3M95A

Crystal structure of autophagy-related protein atg8 from the silkworm bombyx mori
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
b'MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy related protein Atg8
publication title Structure of autophagy-related protein Atg8 from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 34
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m95A00
2O6VD 4HWIB 2BPSA 2MWSB 2YVCA 4FHKA 3VFKA 2BKFA 1V2YA 4X57B 2JY6A 4HXDA 2BYFA 4G11A 3SHQA 3CF6E 3ALBA 1U4AA 2MBQA 4CYEA 2ZVNA 3L54A 5JH5C 2BGFA 4EKUA 4KVGB 2I1KA 4WWPA 1E5WA 1WF9A 1XQQA 3PT2B 2JVCA 3DBHI 4GDKB 4GXBA 3PV1A 3QJZA 3RD2A 1J8CA 1TZ1A 2LJ5A 1L2NA 3RZWC 4BBNC 3PGEA 1UBIA 3AU4A 3H1UA 3IHPC 2LUEA 2KVRA 2REXA 2BYVE 4HPMB 4KV2A 3A4SC 2O6VA 4FULA 1WZ0A 4A3PA 4DDID 4GU2A 3PZDA 2L8JA 2FIFA 2G3QB 1UD7A 2MLBA 1NBFC 2AL3A 2O2VA 3L10B 3NZSA 2MCNB 3X23A 1G6JA 2Z0EB 2NR2A 2KXJA 4NJ7A 3APDA 4DK5A 4NY0A 4F8CB 2LZ6A 4JLCA 2FCQA 2NBUA 4P7IA 3I3TB 2JRHA 3OLMD 1C1YB 3IG3A 5CHWA 2MBEA 1ZGUB 2FNJB 1WGRA 3R66C 1R4NI 3U30A 4BBNF 4JL9A 2CS4A 2N9XA 3UINB 4ZRJA 4DHJB 1WXVA 3QWZB 3PHWB 4DHJD 2NCNA 2DZIA 2RPQA 2CHZA 3PREA 2DYOA 3ZDTA 4RM9A 1YQBA 4XX5A 5KHOA 2KJ6A 1WY8A 1V86A 1EO6A 4TUUA 3QAQA 2CU1A 4DXAB 4G50A 2NVUI 3ZIMA 4F7ZA 2HE7A 1KM7A 1P3QU 2ZNVC 3H6NA 4LDTB 3MJWA 4MDKE 1LM8B 1WGDA 1YIWA 4IWOA 1V80A 2GBRA 4LDTD 3QCAA 2GBKA 4HCPB 5IAAC 4TQ0A 4EZLA 4E74A 3M62B 1WE7A 4DDGD 2ZVOA 1WJ6A 1ZW7A 4CHKA 3VUWA 1IP9A 3K9OB 4ANWA 2IO1B 3KW5B 1UH6A 4FJZA 1WX7A 3ZRFA 3H9DA 1MG8A 3X0WA 2ZPNA 1Q0WB 2PE6B 4RMAA 2G4SA 2LXCA 3PRPB 3UIPB 2CKHB 4CO7A 3UQBA 1WXAA 1GUAB 5E6OA 3QK0A 2Z59B 3K9PB 3WA0A 2KDIA 2K8CA 4IC7B 3DBSA 2LVPA 2KDBA 3ZW3A 3VHTC 2KKCA 3ZVVA 4AUQC 2KTRB 3VUYA 2KC1A 4ICUA 2J0MA 2AEHA 3PLUA 4K7UA 3TIXA 4AWJA 2NBWB 2J0KA 3ZRCA 1P1AA 4HJKA 3DVGX 1WJ4A 4M8MA 1QZEA 4HPLB 2DX5B 3KUDB 3PTFC 1NDDA 4AJYB 2KQ7A 2N1VA 2XBBC 2ZPYA 3NY5A 4II3B 1OTRB 5DPWA 4OVUA 2N9PC 2J7QB 2DAJA 1V9JA 2R2QA 3UGBB 3ZTDA 4F1SA 1WMHB 2Z0DB 4NAWA 3TJPA 1TBEA 4BOZB 1WFYA 3SDLC 2KX3A 5D2MB 2A5UA 4K1RB 4BFRA 3LDZE 2KJRA 3M63B 2BF8B 2C60A 4HDQA 4YL8A 1V5OA 4FADA 1K8RB 1WGYA 2ZEQA 4GDLA 1KJTA 4KIKA 5G2NA 1VCBA 4KSKC 2JWZA 2KJHB 1J0GA 2CR5A 1WXSA 2PPHA 4MM3A 3WANA 3B08A 3DOWA 3RT3B 4MGKE 1L7YA 3PS6A 4AJWA 2AWTA 3TL5A 5EDSA 5E6NA 1WYWB 3A9KA 3L13A 3C0RB 4A20A 2WWZA 3BINA 4WQOB 1WJNA 1ZKHA 1HE8A 1GG3A 2O6VB 5C23A 1E7VA 4IUMB 5AZFA 4PYZA 5D6JB 2YLMA 2O2VB 2FAZA 2L76A 3OJ3A 4MH0E 2JF5A 3L08A 1E8XA 4K81A 4N9F4 5D94A 5E6PA 3QX1A 3IBEA 4EFOA 1KLVA 2MBOA 2K8BA 3UQAA 1WXMA 2LI5A 1YJ1A 5GMVA 4BKTA 3DVNU 4HCNB 1RFAA 2C7NB 3U8ZA 1GC7A 2LVQA 2M1MA 3VUXA 2LRWA 3EHVA 1GC6A 5L83A 2MSED 1WJUA 4WJQA 1T0YA 2KWCA 1OGWA 2FCSA 2WX1A 3ZNZB 2DYMA 4FLHA 3ZKJC 1WI0A 2MP2A 1S3SG 2GBNA 5CHVC 3ZDMC 3A9JA 4JGHB 2KOXA 3JVZX 5C1ZA 5CTRC 1IYFA 1UZXB 5JZEB 3PRMB 2L0TA 2C7HA 2GMIC 3DBLI 4ICVA 3IVFA 4G0NB 4EZJA 1Z2MA 4FJVB 4IG7B 4ZRIA 3R7QA 4LJOB 2HTHA 4EEWA 4E3CA 2LVOA 4W9IA 2BWES 3JSVA 1TTNA 3ZO5B 3Q3FA 1YD8U 2XK5B 3BY4B 2GOWA 1AARA 1UGMA 1LFDA 2KD0A 2HJ8A 2ZCCA 3RZFA 4PS7A 4GOCA 2N1WA 3ZUNA 2KLCA 2KWVB 2D3GA 4NNJB 3V6CB 4DBGA 4JIOU 2BYEA 3B0AA 4NPNA 1OQYA 3VTVA 1WGHA 2KWUB 5DPTA 1BT0A 4MGZE 5LXHA 2LGDA 1RLFA 2KNBA 2M17A 4IM2A 2XK5A 3QHTA 2KQSA 5AZGA 3W1SC 3VAWA 2UYZB 3LJ3A 4PYUA 3TMPB 2ZNVB 2C7MB 4LCDE 3A4RA 2D2QA 4MGYE 4WJPA 4BOSC 2NS5A 4OVVA 2RSUA 3ML9A 2GBJA 2EKEC 1Q1OA 2K6QA 2CHWA 2PJHA 3T8MA 1EF1A 1P0RA 4GMVA 4ANXA 4TQ1A 5TR5A 4NAWB 1OEYA 5JHBA 3ECIA 1TGZB 3ZNGC 1P9DU 3N32A 2LD9A 3ZLZA 5AZHA 4I6LB 1H8CA 4KDLB 4GDLB 4RM8A 4KIKB 4I6PA 2WYQA 5IA7A 1YX6B 2V4LA 2KFJA 2K6DB 2PEAA 4IW0A 3W1YA 2KMCA 5D7GA 2FCNA 5KHQA 2CHXA 3A9KB 2KK8A 3KVFB 3UIOB 2JXXA 4M0WB 4E71A 4FN2A 2WX0A 3W1SA 3Q3JA 4XC2A 2MBBB 1YX5B 2K1FA 5LLIA 4ZDVA 4GGQA 4WWOA 4MJSB 4EZKA 1GNUA 4NQLB 2V3SA 3RYTA 2DAFA 2HD5B 2D11A 3WAOA 1KOTA 3R3MA 4HVBA 3DDCB 4W9LA 2J0JA 4BKSD 1A5RA 4EUTA 2G4DB 4A3OA 4DHZB 5J17A 2FUHB 3NZUA 3VQIA 2JUOA 3CMMB 3QARA 1R4MI 4FA6A 2BWFA 2KANA 4ZRKA 2K39A 3D32A 2L05A 3A33B 2LASA 4JQWC 4ANVA 1V49A 4BKGA 2JPHA 4II2B 4NQKE 4MJSA 2LRUA 2MP2B 1SGHA 2I1JA 2KLGA 3IFWB 2WDTB 4FBJB 4IM3A 3HIZA 1EUVB 1LQBA 3DBRI 2DHZA 2L0FA 3A9JB 4BKSA 2M4NA 3VH3B 4TV3A 3DQVA 1E8WA 5J18A 3TBLD 2D07B 3RCZA 4WWNA 3VDZA 4AP4C 1E7UA 4W9JA 3MTNB 3PHXB 4NJ6A 2B3AA 2L00B 3UF8A 3JSVB 2DYBA 2FCMA 1XD3B 3M95A 3VXWA 3L16A 2D10A 2KDFB 2VRRB 4K7WA 3KYDD 3GZNI 3PRZA 3VTWA 1I35A 2BKRB 2XEWA 3VTUA 5CX3A 2IBIB 1EF5A 2R2OA 4PS8A 5CHFA 1IPGA 2K8HA 2IO2B 2JRIB 2K25A 4K7SA 1D3ZA 3MHSD 3V62A 3QA8A 4XZ4A 3GOEA 3QQ8B 2ZCBA 2Y5BB 3QIJA 3OJ4B 2AYOB 3A1QA 2KFKA 2A4ZA 2OOBB 3H7SA 4MSMB 4TKNA 2ZZPB 4FJYA 5L95C 4ASWC 2MW5A 3EC8A 2C9WB 2MA9B 4KSLC 3VH4B 3JYUA 2KC2A 4IWPA 4AOFA 4HDOA 5FR6A 4W9CA 4B6WA 1X1MA 2C5LC 3KH0A 4GDKA 3EECA 5DPSA 3CSFA 4W9KA 3R7RA 5HKHA 2RD0A 1E8YA 3NOBA 1Z5SB 2LGYA 4KZ0A 4LJPB 3EFUA 1V5TA 2JZZA 1E90A 1WM2A 2KHWB 4W9DA 1Y8RC 2UWQA 2EMSA 3S2AA 1V81A 2DZJA 1VD2A 2IY1B 2KMAA 4IM0A 4ZYNA 1WIAA 3SD5A 2PE9A 3H7PB 2L3ZA 3ML8A 2V1YA 4HLEA 1WZ3A 2L7RA 2NBVB 2AL6A 1J19A 2RGFA 2N4FA 1UBQA 1SIFA 4W9FA 4MELA 3ONSA 1P98A 3ZTCA 3PLVA 3N3KB 4I6NB 3DVNV 1WR6E 1F9JA 3DPDA 1I42A 1LXDA 3PVLA 3HHMA 4J6IA 4WAAA 2JZ3B 3P2BA 3RUIB 1C3TA 4B9KA 2KZRA 3NS8A 4PS3A 2KDEB 3PSEB 2NPTB 3L0WB 1RRBA 1PQSA 2N7EA 2M0XA 3JW0X 4M8NA 1NI2A 3O65B 3H7PA 4IWQA 3OAWA 1WRDB 2LGXA 2FIDA 2QHOA 5LXIB 4MSQB 1FXTB 3T9LA 3HK0A 2ZJDA 1WGGA 3B1LX 2IZVB 4EOYA 1S1QB 5DPRA 4DHZE 1WH3A 4BVUC 4HK2A 2KTFA 3HM3A 4W9EA 4KZCA 3SU8X 2LWPA 2ASQA 4URKA 2IYDB 2NPTA 4KDIC 4WJNA 3KUZA 1GJZA 2KX0A 1XT9B 1V6EA 4GN1A 3RULA 4WJOA 2MX2A 4W9HA 2M8SA 3U7DA 1CMXB 3V60A 1H4RA 4DWFA 3AULA 2N7DA 1WX8A 2KN5A 3V61A 4GIVA 3QC8B 1OEYJ 3KYCD 3KUCB 3WAPA 3ZNHB 4ANUA 3ENEA 1ISNA 3DCGA 3AXCA 2G45B 2DZKA 2W9NA 2MQJA 2JT4B 1WR1A 2LXAA 3N30A 4W9GA 3TCAA 2KTRA 5AEKB 1UELA 2MRPA 3AU5A 2DZMA 3AI5A 2IO3B 3APCA 3CSTA 2IY0B 5J2RA 2DENB 1RAXA 2KO3A 3WIMA 2N9EB 2OJRA 4GSWA 3NHEB 4MEMA 1WE6A 1WX9A 3APFA 5BO4B 1E8ZA 2MBHA 3PPAA 1M94A 1Q5WB 2RR9A 4FHJA 3ZNID 3HM6X 4G3XB 3V6EB 1WM3A 3DVGY 3WALA 2EMTA 4GB9A 2IO0B 2GBMA 5JHAA 5G55A 1SE9A 1WMHA 3WAMA 4MGIE 1JRUA 4B95A 3L17A 3VVWB 3A1QB 2KFKB 5DCNA 3M3JA
chains in the Genus database with same CATH superfamily
3Q3NC 2BKFA 1V2YA 1GPXA 2JY6A 4HXDA 2MBQA 4CYEA 2FE8A 3CWIA 4WWPA 4GXBA 3DBHI 3PV1A 1TZ1A 2LJ5A 1DGJA 2IDYA 2BYVE 3A4SC 2O6VA 4A3PA 3PZDA 1FXIA 2KAJA 3NZSA 3DWMA 2NR2A 4NJ7A 4DK5A 4RGNA 2NBUA 4P7IA 2G1EA 3O13A 3IG3A 2R61A 4BBNF 1UF0A 2QSDA 4DHJD 2AQ1B 2DYOA 3ZDTA 4RM9A 2KJ6A 2LGSA 1K53A 3DHIC 4G50A 1EM7A 4A8XC 1FEHA 2QC8A 4LDTB 4LK0M 3MJWA 4IWOA 1L0VB 5IAAC 2WDRB 4O1NA 3VUWA 2RDHA 4WWMA 3KW5B 4US8A 3MHZA 1KTKA 2LXCA 3PRPB 2H88B 5HHDG 3MFGA 3WA0A 2KDIA 3DBHB 4IC7B 2KDBA 3ZW3A 1NYRA 4AUQC 2KTRB 1QILA 4K7UA 3RNAC 1P1AA 3DVGX 4C4VB 3PTFC 3EFCA 2KQ7A 5DPWA 1V9JA 3MC8A 3UGBB 2QIEB 4F1SA 4ZRQA 1TBEA 3IT4B 4BOZB 1WFYA 3NVWA 4K1RB 3LB8C 1XEEA 3TSSA 2BF8B 2C60A 3N20C 3P4QB 1J0GA 1WXSA 3WANA 3DOWA 1L7YA 4AJWA 3TL5A 1XLPA 3NS1A 4NAMA 2WQYB 4USAA 2I38A 2WWZA 2WXGA 4WQOB 1ZKHA 1HE8A 1GG3A 2O6VB 1XLOA 4IUMB 5D6JB 1NEKB 3GP7A 2FAZA 4MH0E 1K50A 5D94A 3SEBA 2BS3B 3QX1A 1WXMA 2LI5A 3OWEB 4JE3B 5GMVA 3DVNU 1MVKA 4S17A 3VUXA 5FKAC 1PGAA 5L83A 4WJQA 2AQ3B 2KWDA 2FCSA 2GBNA 2JX5A 2HTME 2KOXA 3JVZX 1D5ZC 3B2GA 4KKIA 4L2YA 5JZEB 4G0NB 4FJVB 1CQVA 1AN8A 3AEDB 4EEWA 3VR9B 2LVOA 1OFFA 2XK5B 1WRIA 4IKGA 1LFDA 1OQRA 2HJ8A 2ZCCA 3AEBB 2N1WA 3ZUNA 3AEEB 3EGRA 2BYEA 3B0AA 1WGHA 2KWUB 1LO5D 3SR6A 2LGDA 2KNBA 5AZGA 1MFWA 2UYZB 3AE4B 3V05A 2D2QA 1QOGA 2LEKA 4OVVA 3ML9A 2RMMA 2PVGC 3AE1B 1Q1OA 1TKEA 2WP9B 4P6VF 1PGXA 5FR3A 2GRIA 4GMVA 1MHXA 5TR5A 5AUKA 2X38A 1TKYA 1NI3A 1TGZB 2OHFA 5AZHA 1ZE3D 3AE6B 2LHDA 4KDLB 5IOIA 1ROEA 1FXAA 3C19A 4I6PA 2WYQA 5IA7A 2G9HD 1FO4A 2KFJA 2K6DB 4RF1A 4YTMB 4EE2A 3PZ7A 2VH1A 1YX5B 2K1FA 5LLIA 4LTUA 3RNEC 1HA5A 4BZAA 2D11A 1KOTA 2Y3AA 2J0JA 4BKSD 1BXTA 1A5RA 4JWUC 4DHZB 5J17A 5H8YE 3NZUA 3VQIA 3CMMB 5EE9A 2K39A 2WXHA 4ANVA 1V49A 4II2B 1KLUD 1E10A 2LRUA 2I1JA 2KLGA 4FBJB 3HIZA 1EUVB 4PK1A 2L0FA 1FNVA 2Y5PA 3DQVA 4YXDB 3VDZA 4NJ6A 2BTEA 4M01A 3M95A 3L16A 2D10A 2N9KA 2VRRB 3PRZA 3AM9A 2SEBD 1I35A 1FFUA 1YQ3B 3VTUA 1SXTA 2IBIB 2R2OA 5CHFA 1IPGA 1EWCA 2IO2B 4WIPA 3N1ZC 3MHSD 3GOEA 2ZCBA 3A1QA 2KFKA 2A4ZA 2ZZPB 4FJYA 5L95C 4ASWC 2BQQA 4KSLC 2DNFA 1YOVB 3FC4A 1VLBA 3I5JC 3VRBB 5DPSA 4PT5A 3NOBA 1WXQA 4KZ0A 2CJNA 2UWQA 3VR8B 4IM0A 1F0ZA 4US9A 2PE9A 2L7RA 1CJEA 2NBVB 1L5PA 2N4FA 1SIFA 4W9FA 3ONSA 1P98A 3PLVA 5BMGA 4I6NB 4MH8A 4GLSC 2KN4A 2DLBA 2Q5WD 3PVLA 4XYCA 4YTPB 1IUEA 2ACZB 4J6IA 3AEFB 1UWXA 2J4XA 2MEKA 1C76A 1B1ZA 3PSEB 5MPOA 1PQSA 1KLGD 2M0XA 3MJ5A 1V97A 4M8NA 1YJJA 3H7PA 3EUB2 4WH4A 3OAWA 3H8HA 2BT6A 1FXTB 3T9LA 2ZJDA 2JU6X 1TIFA 2N7JA 2QJLA 4W9EA 4KZCA 3RNFC 2ASQA 4URKA 1XLNA 4WJNA 2JWUA 3AEAB 1GJZA 2KX0A 1XT9B 2QILA 2X8XX 3AB5A 2M8SA 3PO0A 1CMXB 4W9HA 3U7DA 3V60A 1QT9A 3AULA 2N7DA 1WX8A 3WAPA 1STEA 3U52E 4KX6B 4W9GA 2LXAA 3TCAA 5AEKB 5HI1A 1PUTA 1SSNA 3BWUD 5J2RA 2KO3A 1HQRD 4Q2JA 3AE8B 4GSWA 1WE6A 1WX9A 1T3QA 2YEPB 3PPAA 1B9RA 1WM3A 1BUIC 1L6VA 1TS4A 5G55A 4B95A 3VVWB 3A1QB 2KFKB 1J7AA 2JYEA 3VFKA 4LNKA 2BYFA 4AS1A 2ZVNA 3L54A 5GXGB 2I1KA 1E5WA 1WF9A 3PT2B 3KQ4A 4BBNC 3AU4A 4KV2A 1F1HA 1KF6B 1TY2A 4KGTA 3E9SA 3L10B 2BW2A 3Q2AC 2KXJA 3APDA 4NY0A 2LZ6A 1ENFA 3I3TB 5IKCM 2JRHA 1C1YB 5CHWA 1ZGUB 3Q6BA 2Z8LA 1WGRA 3R66C 2CS4A 3UINB 4ZRJA 3HUIA 4DHJB 2INCC 3NUHB 2NCNA 2DZIA 2RPQA 1PYWD 4IDIA 3PREA 1QOBA 4KKJA 4S0RA 3GB1A 2WNMA 3QAQA 2CU1A 4DXAB 1IGDA 5LNK1 2HE7A 1KM7A 3H6NA 1TS2A 3QCAA 4E74A 1SEBD 3RPFC 1WE7A 4DDGD 2NTSA 1WJ6A 2IPKD 5C2TB 1IP9A 4D2KA 4ANWA 4FJZA 2D5GA 1MG8A 2ZPNA 3ZJTA 1Q0WB 2PE6B 2G4SA 4CO7A 3UQBA 1WXAA 3GS2A 5E6OA 4ARIA 1P7EA 2K8CA 4IOIE 1XXGA 2KKCA 1IBXB 3VUYA 2KC1A 3E56A 2J0KA 2KVZA 1GOZA 4HJKA 1YN5A 1WJ4A 4MM3B 1QZEA 1L4ZB 4HPLB 2M56B 3KUDB 2N1VA 1YJIA 2K3UA 1Y56A 2R2QA 1QOAA 4NAWA 3URYA 3SDLC 2WHIA 1ACCA 3LDZE 4FADA 1JWUD 1KJTA 5G2NA 1P7FA 3AMZA 4MGKE 3PS6A 3Q8EA 4K3BA 5EDSA 1ZDXA 2QDFA 3A9KA 4M0WA 4A20A 2JQRB 5C23A 1E7VA 2J42A 2L83A 2DBYA 3OJ3A 2JF5A 4UDUC 3L08A 1E8XA 4N9F4 4EFOA 1J7BA 3UQAA 2IGHA 3ZYYX 1L4DB 4HCNB 3U8ZA 2LVQA 1V8CA 2M1MA 1T6BX 3KLSX 3EHVA 1JWSD 1YN3A 1D6EC 1AW7A 1QLBB 1WJUA 5IO9A 4RF0A 1T0YA 1WI0A 1S3SG 3Q3OC 1SE3A 1ZXIA 4A6QA 5C1ZA 5CTRC 1FM0D 3PRMB 2C7HA 2GMIC 3MC0B 4EZJA 1M4VA 1Z2MA 2OEDA 1EU4A 4ZRIA 3R7QA 1ZP0B 3FILA 5C3JB 2WXMA 1TTNA 3Q3FA 1UGMA 2KD0A 4RH6A 5BMIA 2KWVB 3V6CB 2HJ1A 4DBGA 1OQYA 3P42A 3IAM1 1RLFA 2M17A 3AE3B 2XK5A 3T3OA 4RGOS 4LCDE 3A4RA 4MGYE 4WJPA 4BOSC 2RSUA 2EKEC 2W54A 2LMCA 1YMHE 1P0RA 4ANXA 4NAWB 2BS4B 3N32A 2LD9A 4I6LB 2E6XA 4RM8A 4TMAB 3I9V1 1YQ4B 1E6EB 2KMCA 5D7GA 3A9KB 2KK8A 4M0WB 4E71A 4FN2A 2WX0A 3WCQA 4XC2A 4ZDVA 4WWOA 4EZKA 4NQLB 2V3SA 2ZW0A 2WU5B 3RYTA 3W9CB 1IGCA 1R7SA 4XDCA 3DDCB 2G4DB 1I7HA 4FA6A 2JUOA 4XWTA 1R4MI 1SB3C 4OZBA 4C00A 4ZRKA 1I4GA 3D32A 1F77A 1PFDA 2L05A 2M0AA 1N5XA 1UUPA 1HXYD 2KT7A 4L1BA 2M4NA 1VRAB 5J18A 3TBLD 2D07B 4OHJA 4W9JA 2BYTA 2KACA 3MTNB 2B76B 3FILB 2IJ0A 1C9FA 2SAKA 4WAFA 3W5UB 2WDQB 3VXWA 3NVVA 2RDBC 3KYDD 2K9XA 5FK9C 2BKRB 2K8HA 1RM6C 4K7SA 3DWGC 3QQ8B 3AH7A 3OJ4B 2OOBB 1N5WA 3H7SA 4MSMB 4DQOC 1PGBA 4LNOA 3EC8A 2C9WB 3VH4B 3JYUA 4AOFA 4HDOA 5FR6A 4W9CA 3KH0A 3CSFA 2RD0A 1Z5SB 2LGYA 4LJPB 3EFUA 2JZZA 1WM2A 2KHWB 5G5GA 1R4MB 1V81A 2KMAA 1WIAA 3SD5A 2V3PA 1KFYB 1N62A 2AL6A 2FUG1 1I4HA 3ZTCA 1JWBD 1WR6E 1F9JA 2WXOA 2WXNA 2Y5CA 3BZDB 4WAAA 1C3TA 4L23A 2DWQA 3J9CA 3NS8A 1T5XD 5BYSA 3BYTB 1FD6A 1NI2A 1WGKA 4DXGA 5LXIB 5I4DA 3HK0A 1L0YB 4BVUC 2MH7A 3HRDD 1V6EA 4GN1A 3RULA 4WJOA 2MX2A 4YSYB 4DWFA 2WXKA 3QC8B 1OEYJ 1FIQA 4ANUA 3ENEA 4WURA 3AXCA 4AQ7A 1XCQL 1HZ6A 3NRZA 2MQJA 2JT4B 1WR1A 3AU5A 2DZMA 2K22A 3AI5A 3V3XA 3APCA 3CSTA 2IY0B 2DENB 1RAXA 4M02A 2ICIA 2OJRA 4MEMA 3APFA 4HRSA 1TY0A 2RR9A 4G3XB 3WALA 4ACFA 4YSXB 2WXQA 2MJDA 1SE9A 1WMHA 1WSPA 3RNCC 1VDVA 2YEPF 3L17A 1SE4A 5DCNA 3M3JA 2O6VD 2MWSB 2YVCA 3W5VB 2VZKD 4X57B 4G11A 3SHQA 1NVID 3CF6E 3ALBA 1U4AA 4HKQA 4P16A 2BGFA 4KVGB 2PMVA 1XQQA 5EE0A 2JVCA 2IGDA 1VJKA 3RD2A 1J8CA 4FXCA 1L2NA 3PGEA 4XDDA 3IHPC 2KYWA 4HPMB 4FULA 3RNBC 4DDID 4GU2A 2L8JA 2FIFA 3B9JA 1UD7A 4KGRA 1NBFC 2AL3A 2MCNB 3X23A 1G6JA 2Z0EB 1F52A 2INNE 2MBEA 2FNJB 1HTOA 2BS2B 2N9XA 3PHWB 5EE3A 2INPE 3RMKC 2L32A 5D3IB 4ZYSA 3AV8A 1VZ8A 1L6UA 3RN9C 3PZ8A 5KHOA 1WY8A 1V86A 2MHJA 4TUUA 3Q8FA 1AWDA 4HPPA 2NVUI 3ZIMA 4F7ZA 4MDKE 1TS5A 1LM8B 1WGDA 1JW9D 1YIWA 2GBRA 4EZLA 4TQ0A 3R2TA 3M62B 2ZVOA 1HZ5A 3K9OB 3NVZA 2RPVA 3ZRFA 4J3OD 3UIPB 2CKHB 1FPYA 2Z59B 4BAXA 3K9PB 3DBSA 2LJIA 3ZVVA 3N1YC 1I4RA 1EWYC 4AWJA 2NBWB 2WXJA 1QKZA 3Q14C 3RI7C 3SFEB 1NDDA 2ZPYA 1OTRB 4REZA 4OVUA 2N9PC 2DAJA 3ZTDA 2FBWB 1WMHB 2Z0DB 4TSSA 1KRHA 3TJPA 2KX3A 5D2MB 1N63A 2A5UA 5H92C 4YL8A 1IBXA 4HDQA 1V5OA 1K8RB 1WGYA 2ZEQA 4GDLA 1VCBA 4KSKC 2KJHB 1DOYA 2PPHA 4MM3A 3B08A 5AUIA 3AECB 3RT3B 2AWTA 1FCCC 1WYWB 2ZW1A 2L52A 1UWMA 3OG5A 3C0RB 3BINA 3T3NA 2HDEA 2JSVX 4PYZA 1K51A 2L76A 4K81A 5E6PA 1UNSA 5BYQA 1KLVA 4N58A 1K52A 2MBOA 2K8BA 2W3RA 1RYJA 2V3NA 2C7NB 2LRWA 5G5HA 2KWCA 2WX1A 2DYMA 4FLHA 3TEZA 2W82A 5CHVC 3ZDMC 4JGHB 3AE9B 1FMAD 5BYRA 4XWWA 1IYFA 3DBLI 3IVFA 4IG7B 4LJOB 2HTHA 1DOXA 4E3CA 3NG0A 4KGSA 2JXTA 4ARCA 3AEGB 4W9IA 2BWES 1JQ4A 4RGMA 2PW9A 3ZO5B 1YD8U 3BY4B 2GOWA 1AARA 1XLQA 3RZFA 4GOCA 3EA6A 3Q3MC 2KLCA 3ZXVA 1AYFA 2D3AA 4JIOU 3VTVA 5DPTA 1BT0A 2GLSA 4MGZE 5LXHA 1L0XB 1F2RI 2EKIA 3N9YC 4RCOA 1OQQA 4PYUA 2ZNVB 3ZQ4A 2C7MB 1ESFA 2JZPA 2ON8A 4C7ZA 1JROA 1OEYA 5JHBA 1FNWA 3U7ZA 3ZLZA 1H8CA 4P1BC 4GDLB 4OZAA 1YN4A 4ITKA 1YX6B 2V4LA 2PEAA 3W1YA 2FCNA 1N60A 1ZUD2 3KVFB 3IAS1 2JXXA 3W1SA 3Q3JA 3DBLB 4GGQA 4CQNA 4MJSB 1GNUA 2DAFA 3GE3C 2LGIA 3R2IA 2WXPA 2WXRA 4N59A 3GE8C 2PVOD 3DHGC 2BBCA 1JCKB 1FRRA 2JPHA 4NQKE 4A90A 3P1MA 1SGHA 4RGTA 2PLPA 2WDTB 1LQBA 2DHZA 4BKSA 4H2AA 4TV3A 1E8WA 3RCZA 2LFIA 1E7UA 5TSSA 5EE1A 3PHXB 2B3AA 2ONQA 4YTNB 2GB1A 3BK1A 4OVZA 1XD3B 4DXFA 2E3TA 2QCZA 2KDFB 4B0EA 5HFYA 3P63A 3GZNI 1MJDA 2LHEA 5CX3A 1EF5A 2JRIB 2K25A 5T8IA 4XZ4A 1I4PA 5E6JA 2AYOB 2MW5A 3U4EG 3B2FA 1LGRA 3KWLA 5IP4D 1WYGA 4B6WA 2W55A 4GDKA 3EECA 4W9KA 5HKHA 3LYYA 1SF0A 1E90A 4MT5A 2QMTA 2EMSA 3S2AA 2DZJA 1HTQA 2IY1B 4R3DA 1C4AA 2MJEA 3ML8A 2V1YA 1WZ3A 2WXIA 1N6ZA 1J19A 1UBQA 1V1PA 2H89B 2W3SA 4RNAA 2PKOA 3DPDA 1LXDA 5IN7A 3HHMA 3RUIB 3MP9A 2V4IB 4LNIA 4PS3A 2NPTB 1RRBA 1KH0A 2N7EA 1DYQA 3JW0X 3O65B 1CZPA 4IWQA 1WRDB 2LGXA 2FIDA 4MSQB 1WGGA 2IZVB 1A70A 1S1QB 1XF5L 3GZNB 1QF6A 4DHZE 1WH3A 4HK2A 3RNGC 4KDIC 3R8BA 3KUZA 1TS3A 4HKZE 2K5PA 2WGSA 3V61A 1FNUA 3KYCD 3KUCB 3MC9A 3ZNHB 1TJEA 3DCGA 1JWAD 3I63C 2LUMA 3N30A 4JX1C 2MRPA 3I57A 2PTLA 3WIMA 2N9EB 4JWSC 3NHEB 1E8ZA 1M94A 1Q5WB 3ZNID 3HM6X 3U2SC 3V6EB 3DVGY 1ZPSA 5JHAA 3WAMA 1YNTE 1JRUA 4HWIB 1ZDVA 2BPSA 2VZKB 4FHKA 4HROA 5JH5C 4EKUA 4GDKB 3QJZA 3RZWC 1UBIA 2JYTA 3H1UA 1C4CA 2KVRA 2LUEA 4XE0A 2REXA 2BVCA 1WZ0A 2QEJC 2G3QB 2O2VA 2MLBA 3DHHC 1T0QC 4F8CB 2AX5A 4JLCA 1V1PB 2FCQA 1I4XA 3OLMD 2KDMA 1C4PA 1R4NI 1C78A 1UGJA 3U30A 4JL9A 1WXVA 3QWZB 4K3CA 1C77A 3TEXA 3Q8CA 2CHZA 2WU2B 1YQBA 4XX5A 1HEZE 3P4RB 1EO6A 2M19A 2D3BA 4RFBA 1P3QU 2ZNVC 3TEYA 3RFZB 4LDTD 1V80A 2GBKA 4HCPB 4YSZB 1ZW7A 4CHKA 3L4PA 2IO1B 1UH6A 1WX7A 3H9DA 4P1CC 4WQMA 3X0WA 1TT5B 4RMAA 1TYGB 2BB5A 1GUAB 2AQ2B 3QK0A 2INDC 1RFKA 1C79A 2LVPA 2VH2A 3VHTC 2XN9C 3FKYA 1BMLC 4ICUA 2J0MA 2AEHA 3PLUA 3TIXA 2D3CA 3ZRCA 3ZGZA 4M8MA 1FFVA 2DX5B 3BVGA 4AJYB 3NY5A 4II3B 2XBBC 4LLGM 2J7QB 1T0SC 4YT0B 3ETRA 1R4NB 4BFRA 2KJRA 3M63B 4KIKA 2JWZA 3TUOA 2CR5A 2WXFA 1ET9A 1QOFA 2GI9A 5E6NA 3P4SB 3L13A 1F2RC 1WJNA 1D5XC 5AZFA 1FCLA 1V1OA 2YLMA 2O2VB 4LNNA 2KMMA 2NMQA 3IBEA 1PDXA 4C7YA 1YJ1A 3NZ3A 4BKTA 1RFAA 1GC7A 3ZJVA 1GC6A 1NYQA 2MSED 2L1AA 1OGWA 3ZNZB 3ZKJC 1GAQB 2MP2A 3Q8BA 3HVDA 1MI0A 3Q69A 3A9JA 3FAHA 5D3DA 1UZXB 2L0TA 4ICVA 2WXLA 1JWMD 3P4PB 3BVZA 3JSVA 3ABVB 1NENB 3BIID 2K0PA 4PS7A 2OJWA 4C80A 2D3GA 4NNJB 4XGAB 5HG2A 1XCTL 4NPNA 1MG4A 3IXSA 4IM2A 3QHTA 1Q10A 2KQSA 3W1SC 3VAWA 1JALA 2TSSA 4A9AA 3LJ3A 3TMPB 1SE2A 2NS5A 2GBJA 2IGGA 2PIAA 1J7CA 2K6QA 2WDVB 2CHWA 2PJHA 3T8MA 4N6EB 1EF1A 1E0ZA 4TQ1A 3AN1A 3ECIA 3BYYB 3ZNGC 1P9DU 1EU3A 4KIKB 4IW0A 5KHQA 2CHXA 3UIOB 2N9LA 4LNFA 4ZRPA 1ZXHA 2MBBB 5JXVA 1GB1A 2HD5B 3WAOA 5BMHA 3R3MA 4HVBA 1RWSA 4W9LA 1JMLA 1SBBB 4ZOHC 4EUTA 4A3OA 4HJGE 3ZXRA 2FUHB 2J53A 3QARA 2BWFA 2KANA 3AE5B 3A33B 2LASA 4JQWC 1VZ7A 4BKGA 4OW0A 1MHHE 3NJTA 4MJSA 2MP2B 3IFWB 2KQ4X 4IM3A 2BB6A 3DBRI 1D5MC 1SJED 2MJ3A 3A9JB 3VH3B 1SJHD 4WWNA 4AP4C 2CU3A 1GB4A 3TEWA 1E7PB 3BVMA 4QAYA 4YWGG 2L00B 3UF8A 1TKGA 4ZHPA 3JSVB 2DYBA 2FCMA 3LXFA 3N1XC 2UU7A 4NZLB 2V0GA 4K7WA 4M00A 3VTWA 2XEWA 4OZCA 4PS8A 3VRAB 1D3ZA 3V62A 3QA8A 1E9MA 2Y5BB 3QIJA 1D4BA 1WWTA 4HEA1 4TKNA 2I2YA 4B0MA 2MA9B 4IWPA 2KC2A 3KWVA 2WLBA 4MACA 1X1MA 2C5LC 3R7RA 1T0RC 1E8YA 3ZJUA 1V5TA 4W9DA 3NVYA 1Y8RC 4JPSA 3W2DA 1ZOYB 1VD2A 1ET6A 4ZYNA 4C56C 3H7PB 2L3ZA 4HLEA 2N0SB 2RGFA 2J52A 3DBRB 4MELA 3N3KB 3DVNV 1I42A 3C8YA 2XNAC 3P2BA 2JZ3B 1VR9A 3AE7B 4B9KA 4A55A 2KZRA 1XO3A 2KDEB 3L0WB 1TZOA 2EELA 1N61A 3SFDB 3UI3A 2QHOA 1DOIA 1CK1A 3B1LX 4EOYA 5DPRA 3IT6B 4ZHOA 2KTFA 3HM3A 1MPEA 3SU8X 2LWPA 2IYDB 2NPTA 2CJOA 2RDGA 1I4QA 1H4RA 2KN5A 4GIVA 3BK2A 1ISNA 2G45B 2DZKA 2W9NA 2WS3B 2KTRA 1UELA 3Q8AA 3AE2B 2IO3B 1JRPA 3HVZA 1SIJA 4C4VA 3CIRB 5BO4B 2MBHA 1QQRA 4FHJA 4NJCA 4GB9A 2V9HA 2EMTA 2IO0B 2GBMA 4MGIE 1VZ6A 1FRDA 2NTTA
chains in the Genus database with same CATH topology
2O6VD 4HWIB 2BPSA 2MWSB 2YVCA 4FHKA 3VFKA 2BKFA 1V2YA 4X57B 2JY6A 4HXDA 2BYFA 4G11A 3SHQA 3CF6E 3ALBA 1U4AA 2MBQA 4CYEA 2ZVNA 3L54A 5JH5C 2BGFA 4EKUA 4KVGB 2I1KA 4WWPA 1E5WA 1WF9A 1XQQA 3PT2B 2JVCA 3DBHI 4GDKB 4GXBA 3PV1A 3QJZA 3RD2A 1J8CA 1TZ1A 2LJ5A 1L2NA 3RZWC 4BBNC 3PGEA 1UBIA 3AU4A 3H1UA 3IHPC 2LUEA 2KVRA 2REXA 2BYVE 4HPMB 4KV2A 3A4SC 2O6VA 4FULA 1WZ0A 4A3PA 4DDID 4GU2A 3PZDA 2L8JA 2FIFA 2G3QB 1UD7A 2MLBA 1NBFC 2AL3A 2O2VA 3L10B 3NZSA 2MCNB 3X23A 1G6JA 2Z0EB 2NR2A 2KXJA 4NJ7A 3APDA 4DK5A 4NY0A 4F8CB 2LZ6A 4JLCA 2FCQA 2NBUA 4P7IA 3I3TB 2JRHA 3OLMD 1C1YB 3IG3A 5CHWA 2MBEA 1ZGUB 2FNJB 1WGRA 3R66C 1R4NI 3U30A 4BBNF 4JL9A 2CS4A 2N9XA 3UINB 4ZRJA 4DHJB 1WXVA 3QWZB 3PHWB 4DHJD 2NCNA 2DZIA 2RPQA 2CHZA 3PREA 2DYOA 3ZDTA 4RM9A 1YQBA 4XX5A 5KHOA 2KJ6A 1WY8A 1V86A 1EO6A 4TUUA 3QAQA 2CU1A 4DXAB 4G50A 2NVUI 3ZIMA 4F7ZA 2HE7A 1KM7A 1P3QU 2ZNVC 3H6NA 4LDTB 3MJWA 4MDKE 1LM8B 1WGDA 1YIWA 4IWOA 1V80A 2GBRA 4LDTD 3QCAA 2GBKA 4HCPB 5IAAC 4TQ0A 4EZLA 4E74A 3M62B 1WE7A 4DDGD 2ZVOA 1WJ6A 1ZW7A 4CHKA 3VUWA 1IP9A 3K9OB 4ANWA 2IO1B 3KW5B 1UH6A 4FJZA 1WX7A 3ZRFA 3H9DA 1MG8A 3X0WA 2ZPNA 1Q0WB 2PE6B 4RMAA 2G4SA 2LXCA 3PRPB 3UIPB 2CKHB 4CO7A 3UQBA 1WXAA 1GUAB 5E6OA 3QK0A 2Z59B 3K9PB 3WA0A 2KDIA 2K8CA 4IC7B 3DBSA 2LVPA 2KDBA 3ZW3A 3VHTC 2KKCA 3ZVVA 4AUQC 2KTRB 3VUYA 2KC1A 4ICUA 2J0MA 2AEHA 3PLUA 4K7UA 3TIXA 4AWJA 2NBWB 2J0KA 3ZRCA 1P1AA 4HJKA 3DVGX 1WJ4A 4M8MA 1QZEA 4HPLB 2DX5B 3KUDB 3PTFC 1NDDA 4AJYB 2KQ7A 2N1VA 2XBBC 2ZPYA 3NY5A 4II3B 1OTRB 5DPWA 4OVUA 2N9PC 2J7QB 2DAJA 1V9JA 2R2QA 3UGBB 3ZTDA 4F1SA 1WMHB 2Z0DB 4NAWA 3TJPA 1TBEA 4BOZB 1WFYA 3SDLC 2KX3A 5D2MB 2A5UA 4K1RB 4BFRA 3LDZE 2KJRA 3M63B 2BF8B 2C60A 4HDQA 4YL8A 1V5OA 4FADA 1K8RB 1WGYA 2ZEQA 4GDLA 1KJTA 4KIKA 5G2NA 1VCBA 4KSKC 2JWZA 2KJHB 1J0GA 2CR5A 1WXSA 2PPHA 4MM3A 3WANA 3B08A 3DOWA 3RT3B 4MGKE 1L7YA 3PS6A 4AJWA 2AWTA 3TL5A 5EDSA 5E6NA 1WYWB 3A9KA 3L13A 3C0RB 4A20A 2WWZA 3BINA 4WQOB 1WJNA 1ZKHA 1HE8A 1GG3A 2O6VB 5C23A 1E7VA 4IUMB 5AZFA 4PYZA 5D6JB 2YLMA 2O2VB 2FAZA 2L76A 3OJ3A 4MH0E 2JF5A 3L08A 1E8XA 4K81A 4N9F4 5D94A 5E6PA 3QX1A 3IBEA 4EFOA 1KLVA 2MBOA 2K8BA 3UQAA 1WXMA 2LI5A 1YJ1A 5GMVA 4BKTA 3DVNU 4HCNB 1RFAA 2C7NB 3U8ZA 1GC7A 2LVQA 2M1MA 3VUXA 2LRWA 3EHVA 1GC6A 5L83A 2MSED 1WJUA 4WJQA 1T0YA 2KWCA 1OGWA 2FCSA 2WX1A 3ZNZB 2DYMA 4FLHA 3ZKJC 1WI0A 2MP2A 1S3SG 2GBNA 5CHVC 3ZDMC 3A9JA 4JGHB 2KOXA 3JVZX 5C1ZA 5CTRC 1IYFA 1UZXB 5JZEB 3PRMB 2L0TA 2C7HA 2GMIC 3DBLI 4ICVA 3IVFA 4G0NB 4EZJA 1Z2MA 4FJVB 4IG7B 4ZRIA 3R7QA 4LJOB 2HTHA 4EEWA 4E3CA 2LVOA 4W9IA 2BWES 3JSVA 1TTNA 3ZO5B 3Q3FA 1YD8U 2XK5B 3BY4B 2GOWA 1AARA 1UGMA 1LFDA 2KD0A 2HJ8A 2ZCCA 3RZFA 4PS7A 4GOCA 2N1WA 3ZUNA 2KLCA 2KWVB 2D3GA 4NNJB 3V6CB 4DBGA 4JIOU 2BYEA 3B0AA 4NPNA 1OQYA 3VTVA 1WGHA 2KWUB 5DPTA 1BT0A 4MGZE 5LXHA 2LGDA 1RLFA 2KNBA 2M17A 4IM2A 2XK5A 3QHTA 2KQSA 5AZGA 3W1SC 3VAWA 2UYZB 3LJ3A 4PYUA 3TMPB 2ZNVB 2C7MB 4LCDE 3A4RA 2D2QA 4MGYE 4WJPA 4BOSC 2NS5A 4OVVA 2RSUA 3ML9A 2GBJA 2EKEC 1Q1OA 2K6QA 2CHWA 2PJHA 3T8MA 1EF1A 1P0RA 4GMVA 4ANXA 4TQ1A 5TR5A 4NAWB 1OEYA 5JHBA 3ECIA 1TGZB 3ZNGC 1P9DU 3N32A 2LD9A 3ZLZA 5AZHA 4I6LB 1H8CA 4KDLB 4GDLB 4RM8A 4KIKB 4I6PA 2WYQA 5IA7A 1YX6B 2V4LA 2KFJA 2K6DB 2PEAA 4IW0A 3W1YA 2KMCA 5D7GA 2FCNA 5KHQA 2CHXA 3A9KB 2KK8A 3KVFB 3UIOB 2JXXA 4M0WB 4E71A 4FN2A 2WX0A 3W1SA 3Q3JA 4XC2A 2MBBB 1YX5B 2K1FA 5LLIA 4ZDVA 4GGQA 4WWOA 4MJSB 4EZKA 1GNUA 4NQLB 2V3SA 3RYTA 2DAFA 2HD5B 2D11A 3WAOA 1KOTA 3R3MA 4HVBA 3DDCB 4W9LA 2J0JA 4BKSD 1A5RA 4EUTA 2G4DB 4A3OA 4DHZB 5J17A 2FUHB 3NZUA 3VQIA 2JUOA 3CMMB 3QARA 1R4MI 4FA6A 2BWFA 2KANA 4ZRKA 2K39A 3D32A 2L05A 3A33B 2LASA 4JQWC 4ANVA 1V49A 4BKGA 2JPHA 4II2B 4NQKE 4MJSA 2LRUA 2MP2B 1SGHA 2I1JA 2KLGA 3IFWB 2WDTB 4FBJB 4IM3A 3HIZA 1EUVB 1LQBA 3DBRI 2DHZA 2L0FA 3A9JB 4BKSA 2M4NA 3VH3B 4TV3A 3DQVA 1E8WA 5J18A 3TBLD 2D07B 3RCZA 4WWNA 3VDZA 4AP4C 1E7UA 4W9JA 3MTNB 3PHXB 4NJ6A 2B3AA 2L00B 3UF8A 3JSVB 2DYBA 2FCMA 1XD3B 3M95A 3VXWA 3L16A 2D10A 2KDFB 2VRRB 4K7WA 3KYDD 3GZNI 3PRZA 3VTWA 1I35A 2BKRB 2XEWA 3VTUA 5CX3A 2IBIB 1EF5A 2R2OA 4PS8A 5CHFA 1IPGA 2K8HA 2IO2B 2JRIB 2K25A 4K7SA 1D3ZA 3MHSD 3V62A 3QA8A 4XZ4A 3GOEA 3QQ8B 2ZCBA 2Y5BB 3QIJA 3OJ4B 2AYOB 3A1QA 2KFKA 2A4ZA 2OOBB 3H7SA 4MSMB 4TKNA 2ZZPB 4FJYA 5L95C 4ASWC 2MW5A 3EC8A 2C9WB 2MA9B 4KSLC 3VH4B 3JYUA 2KC2A 4IWPA 4AOFA 4HDOA 5FR6A 4W9CA 4B6WA 1X1MA 2C5LC 3KH0A 4GDKA 3EECA 5DPSA 3CSFA 4W9KA 3R7RA 5HKHA 2RD0A 1E8YA 3NOBA 1Z5SB 2LGYA 4KZ0A 4LJPB 3EFUA 1V5TA 2JZZA 1E90A 1WM2A 2KHWB 4W9DA 1Y8RC 2UWQA 2EMSA 3S2AA 1V81A 2DZJA 1VD2A 2IY1B 2KMAA 4IM0A 4ZYNA 1WIAA 3SD5A 2PE9A 3H7PB 2L3ZA 3ML8A 2V1YA 4HLEA 1WZ3A 2L7RA 2NBVB 2AL6A 1J19A 2RGFA 2N4FA 1UBQA 1SIFA 4W9FA 4MELA 3ONSA 1P98A 3ZTCA 3PLVA 3N3KB 4I6NB 3DVNV 1WR6E 1F9JA 3DPDA 1I42A 1LXDA 3PVLA 3HHMA 4J6IA 4WAAA 2JZ3B 3P2BA 3RUIB 1C3TA 4B9KA 2KZRA 3NS8A 4PS3A 2KDEB 3PSEB 2NPTB 3L0WB 1RRBA 1PQSA 2N7EA 2M0XA 3JW0X 4M8NA 1NI2A 3O65B 3H7PA 4IWQA 3OAWA 1WRDB 2LGXA 2FIDA 2QHOA 5LXIB 4MSQB 1FXTB 3T9LA 3HK0A 2ZJDA 1WGGA 3B1LX 2IZVB 4EOYA 1S1QB 5DPRA 4DHZE 1WH3A 4BVUC 4HK2A 2KTFA 3HM3A 4W9EA 4KZCA 3SU8X 2LWPA 2ASQA 4URKA 2IYDB 2NPTA 4KDIC 4WJNA 3KUZA 1GJZA 2KX0A 1XT9B 1V6EA 4GN1A 3RULA 4WJOA 2MX2A 4W9HA 2M8SA 3U7DA 1CMXB 3V60A 1H4RA 4DWFA 3AULA 2N7DA 1WX8A 2KN5A 3V61A 4GIVA 3QC8B 1OEYJ 3KYCD 3KUCB 3WAPA 3ZNHB 4ANUA 3ENEA 1ISNA 3DCGA 3AXCA 2G45B 2DZKA 2W9NA 2MQJA 2JT4B 1WR1A 2LXAA 3N30A 4W9GA 3TCAA 2KTRA 5AEKB 1UELA 2MRPA 3AU5A 2DZMA 3AI5A 2IO3B 3APCA 3CSTA 2IY0B 5J2RA 2DENB 1RAXA 2KO3A 3WIMA 2N9EB 2OJRA 4GSWA 3NHEB 4MEMA 1WE6A 1WX9A 3APFA 5BO4B 1E8ZA 2MBHA 3PPAA 1M94A 1Q5WB 2RR9A 4FHJA 3ZNID 3HM6X 4G3XB 3V6EB 1WM3A 3DVGY 3WALA 2EMTA 4GB9A 2IO0B 2GBMA 5JHAA 5G55A 1SE9A 1WMHA 3WAMA 4MGIE 1JRUA 4B95A 3L17A 3VVWB 3A1QB 2KFKB 5DCNA 3M3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V D;  4HWI B;  2BPS A;  2MWS B;  2YVC A;  4FHK A;  3VFK A;  2BKF A;  1V2Y A;  4X57 B;  2JY6 A;  4HXD A;  2BYF A;  4G11 A;  3SHQ A;  3CF6 E;  3ALB A;  1U4A A;  2MBQ A;  4CYE A;  2ZVN A;  3L54 A;  5JH5 C;  2BGF A;  4EKU A;  4KVG B;  2I1K A;  4WWP A;  1E5W A;  1WF9 A;  1XQQ A;  3PT2 B;  2JVC A;  3DBH I;  4GDK B;  4GXB A;  3PV1 A;  3QJZ A;  3RD2 A;  1J8C A;  1TZ1 A;  2LJ5 A;  1L2N A;  3RZW C;  4BBN C;  3PGE A;  1UBI A;  3AU4 A;  3H1U A;  3IHP C;  2LUE A;  2KVR A;  2REX A;  2BYV E;  4HPM B;  4KV2 A;  3A4S C;  2O6V A;  4FUL A;  1WZ0 A;  4A3P A;  4DDI D;  4GU2 A;  3PZD A;  2L8J A;  2FIF A;  2G3Q B;  1UD7 A;  2MLB A;  1NBF C;  2AL3 A;  2O2V A;  3L10 B;  3NZS A;  2MCN B;  3X23 A;  1G6J A;  2Z0E B;  2NR2 A;  2KXJ A;  4NJ7 A;  3APD A;  4DK5 A;  4NY0 A;  4F8C B;  2LZ6 A;  4JLC A;  2FCQ A;  2NBU A;  4P7I A;  3I3T B;  2JRH A;  3OLM D;  1C1Y B;  3IG3 A;  5CHW A;  2MBE A;  1ZGU B;  2FNJ B;  1WGR A;  3R66 C;  1R4N I;  3U30 A;  4BBN F;  4JL9 A;  2CS4 A;  2N9X A;  3UIN B;  4ZRJ A;  4DHJ B;  1WXV A;  3QWZ B;  3PHW B;  4DHJ D;  2NCN A;  2DZI A;  2RPQ A;  2CHZ A;  3PRE A;  2DYO A;  3ZDT A;  4RM9 A;  1YQB A;  4XX5 A;  5KHO A;  2KJ6 A;  1WY8 A;  1V86 A;  1EO6 A;  4TUU A;  3QAQ A;  2CU1 A;  4DXA B;  4G50 A;  2NVU I;  3ZIM A;  4F7Z A;  2HE7 A;  1KM7 A;  1P3Q U;  2ZNV C;  3H6N A;  4LDT B;  3MJW A;  4MDK E;  1LM8 B;  1WGD A;  1YIW A;  4IWO A;  1V80 A;  2GBR A;  4LDT D;  3QCA A;  2GBK A;  4HCP B;  5IAA C;  4TQ0 A;  4EZL A;  4E74 A;  3M62 B;  1WE7 A;  4DDG D;  2ZVO A;  1WJ6 A;  1ZW7 A;  4CHK A;  3VUW A;  1IP9 A;  3K9O B;  4ANW A;  2IO1 B;  3KW5 B;  1UH6 A;  4FJZ A;  1WX7 A;  3ZRF A;  3H9D A;  1MG8 A;  3X0W A;  2ZPN A;  1Q0W B;  2PE6 B;  4RMA A;  2G4S A;  2LXC A;  3PRP B;  3UIP B;  2CKH B;  4CO7 A;  3UQB A;  1WXA A;  1GUA B;  5E6O A;  3QK0 A;  2Z59 B;  3K9P B;  3WA0 A;  2KDI A;  2K8C A;  4IC7 B;  3DBS A;  2LVP A;  2KDB A;  3ZW3 A;  3VHT C;  2KKC A;  3ZVV A;  4AUQ C;  2KTR B;  3VUY A;  2KC1 A;  4ICU A;  2J0M A;  2AEH A;  3PLU A;  4K7U A;  3TIX A;  4AWJ A;  2NBW B;  2J0K A;  3ZRC A;  1P1A A;  4HJK A;  3DVG X;  1WJ4 A;  4M8M A;  1QZE A;  4HPL B;  2DX5 B;  3KUD B;  3PTF C;  1NDD A;  4AJY B;  2KQ7 A;  2N1V A;  2XBB C;  2ZPY A;  3NY5 A;  4II3 B;  1OTR B;  5DPW A;  4OVU A;  2N9P C;  2J7Q B;  2DAJ A;  1V9J A;  2R2Q A;  3UGB B;  3ZTD A;  4F1S A;  1WMH B;  2Z0D B;  4NAW A;  3TJP A;  1TBE A;  4BOZ B;  1WFY A;  3SDL C;  2KX3 A;  5D2M B;  2A5U A;  4K1R B;  4BFR A;  3LDZ E;  2KJR A;  3M63 B;  2BF8 B;  2C60 A;  4HDQ A;  4YL8 A;  1V5O A;  4FAD A;  1K8R B;  1WGY A;  2ZEQ A;  4GDL A;  1KJT A;  4KIK A;  5G2N A;  1VCB A;  4KSK C;  2JWZ A;  2KJH B;  1J0G A;  2CR5 A;  1WXS A;  2PPH A;  4MM3 A;  3WAN A;  3B08 A;  3DOW A;  3RT3 B;  4MGK E;  1L7Y A;  3PS6 A;  4AJW A;  2AWT A;  3TL5 A;  5EDS A;  5E6N A;  1WYW B;  3A9K A;  3L13 A;  3C0R B;  4A20 A;  2WWZ A;  3BIN A;  4WQO B;  1WJN A;  1ZKH A;  1HE8 A;  1GG3 A;  2O6V B;  5C23 A;  1E7V A;  4IUM B;  5AZF A;  4PYZ A;  5D6J B;  2YLM A;  2O2V B;  2FAZ A;  2L76 A;  3OJ3 A;  4MH0 E;  2JF5 A;  3L08 A;  1E8X A;  4K81 A;  4N9F 4;  5D94 A;  5E6P A;  3QX1 A;  3IBE A;  4EFO A;  1KLV A;  2MBO A;  2K8B A;  3UQA A;  1WXM A;  2LI5 A;  1YJ1 A;  5GMV A;  4BKT A;  3DVN U;  4HCN B;  1RFA A;  2C7N B;  3U8Z A;  1GC7 A;  2LVQ A;  2M1M A;  3VUX A;  2LRW A;  3EHV A;  1GC6 A;  5L83 A;  2MSE D;  1WJU A;  4WJQ A;  1T0Y A;  2KWC A;  1OGW A;  2FCS A;  2WX1 A;  3ZNZ B;  2DYM A;  4FLH A;  3ZKJ C;  1WI0 A;  2MP2 A;  1S3S G;  2GBN A;  5CHV C;  3ZDM C;  3A9J A;  4JGH B;  2KOX A;  3JVZ X;  5C1Z A;  5CTR C;  1IYF A;  1UZX B;  5JZE B;  3PRM B;  2L0T A;  2C7H A;  2GMI C;  3DBL I;  4ICV A;  3IVF A;  4G0N B;  4EZJ A;  1Z2M A;  4FJV B;  4IG7 B;  4ZRI A;  3R7Q A;  4LJO B;  2HTH A;  4EEW A;  4E3C A;  2LVO A;  4W9I A;  2BWE S;  3JSV A;  1TTN A;  3ZO5 B;  3Q3F A;  1YD8 U;  2XK5 B;  3BY4 B;  2GOW A;  1AAR A;  1UGM A;  1LFD A;  2KD0 A;  2HJ8 A;  2ZCC A;  3RZF A;  4PS7 A;  4GOC A;  2N1W A;  3ZUN A;  2KLC A;  2KWV B;  2D3G A;  4NNJ B;  3V6C B;  4DBG A;  4JIO U;  2BYE A;  3B0A A;  4NPN A;  1OQY A;  3VTV A;  1WGH A;  2KWU B;  5DPT A;  1BT0 A;  4MGZ E;  5LXH A;  2LGD A;  1RLF A;  2KNB A;  2M17 A;  4IM2 A;  2XK5 A;  3QHT A;  2KQS A;  5AZG A;  3W1S C;  3VAW A;  2UYZ B;  3LJ3 A;  4PYU A;  3TMP B;  2ZNV B;  2C7M B;  4LCD E;  3A4R A;  2D2Q A;  4MGY E;  4WJP A;  4BOS C;  2NS5 A;  4OVV A;  2RSU A;  3ML9 A;  2GBJ A;  2EKE C;  1Q1O A;  2K6Q A;  2CHW A;  2PJH A;  3T8M A;  1EF1 A;  1P0R A;  4GMV A;  4ANX A;  4TQ1 A;  5TR5 A;  4NAW B;  1OEY A;  5JHB A;  3ECI A;  1TGZ B;  3ZNG C;  1P9D U;  3N32 A;  2LD9 A;  3ZLZ A;  5AZH A;  4I6L B;  1H8C A;  4KDL B;  4GDL B;  4RM8 A;  4KIK B;  4I6P A;  2WYQ A;  5IA7 A;  1YX6 B;  2V4L A;  2KFJ A;  2K6D B;  2PEA A;  4IW0 A;  3W1Y A;  2KMC A;  5D7G A;  2FCN A;  5KHQ A;  2CHX A;  3A9K B;  2KK8 A;  3KVF B;  3UIO B;  2JXX A;  4M0W B;  4E71 A;  4FN2 A;  2WX0 A;  3W1S A;  3Q3J A;  4XC2 A;  2MBB B;  1YX5 B;  2K1F A;  5LLI A;  4ZDV A;  4GGQ A;  4WWO A;  4MJS B;  4EZK A;  1GNU A;  4NQL B;  2V3S A;  3RYT A;  2DAF A;  2HD5 B;  2D11 A;  3WAO A;  1KOT A;  3R3M A;  4HVB A;  3DDC B;  4W9L A;  2J0J A;  4BKS D;  1A5R A;  4EUT A;  2G4D B;  4A3O A;  4DHZ B;  5J17 A;  2FUH B;  3NZU A;  3VQI A;  2JUO A;  3CMM B;  3QAR A;  1R4M I;  4FA6 A;  2BWF A;  2KAN A;  4ZRK A;  2K39 A;  3D32 A;  2L05 A;  3A33 B;  2LAS A;  4JQW C;  4ANV A;  1V49 A;  4BKG A;  2JPH A;  4II2 B;  4NQK E;  4MJS A;  2LRU A;  2MP2 B;  1SGH A;  2I1J A;  2KLG A;  3IFW B;  2WDT B;  4FBJ B;  4IM3 A;  3HIZ A;  1EUV B;  1LQB A;  3DBR I;  2DHZ A;  2L0F A;  3A9J B;  4BKS A;  2M4N A;  3VH3 B;  4TV3 A;  3DQV A;  1E8W A;  5J18 A;  3TBL D;  2D07 B;  3RCZ A;  4WWN A;  3VDZ A;  4AP4 C;  1E7U A;  4W9J A;  3MTN B;  3PHX B;  4NJ6 A;  2B3A A;  2L00 B;  3UF8 A;  3JSV B;  2DYB A;  2FCM A;  1XD3 B;  3M95 A;  3VXW A;  3L16 A;  2D10 A;  2KDF B;  2VRR B;  4K7W A;  3KYD D;  3GZN I;  3PRZ A;  3VTW A;  1I35 A;  2BKR B;  2XEW A;  3VTU A;  5CX3 A;  2IBI B;  1EF5 A;  2R2O A;  4PS8 A;  5CHF A;  1IPG A;  2K8H A;  2IO2 B;  2JRI B;  2K25 A;  4K7S A;  1D3Z A;  3MHS D;  3V62 A;  3QA8 A;  4XZ4 A;  3GOE A;  3QQ8 B;  2ZCB A;  2Y5B B;  3QIJ A;  3OJ4 B;  2AYO B;  3A1Q A;  2KFK A;  2A4Z A;  2OOB B;  3H7S A;  4MSM B;  4TKN A;  2ZZP B;  4FJY A;  5L95 C;  4ASW C;  2MW5 A;  3EC8 A;  2C9W B;  2MA9 B;  4KSL C;  3VH4 B;  3JYU A;  2KC2 A;  4IWP A;  4AOF A;  4HDO A;  5FR6 A;  4W9C A;  4B6W A;  1X1M A;  2C5L C;  3KH0 A;  4GDK A;  3EEC A;  5DPS A;  3CSF A;  4W9K A;  3R7R A;  5HKH A;  2RD0 A;  1E8Y A;  3NOB A;  1Z5S B;  2LGY A;  4KZ0 A;  4LJP B;  3EFU A;  1V5T A;  2JZZ A;  1E90 A;  1WM2 A;  2KHW B;  4W9D A;  1Y8R C;  2UWQ A;  2EMS A;  3S2A A;  1V81 A;  2DZJ A;  1VD2 A;  2IY1 B;  2KMA A;  4IM0 A;  4ZYN A;  1WIA A;  3SD5 A;  2PE9 A;  3H7P B;  2L3Z A;  3ML8 A;  2V1Y A;  4HLE A;  1WZ3 A;  2L7R A;  2NBV B;  2AL6 A;  1J19 A;  2RGF A;  2N4F A;  1UBQ A;  1SIF A;  4W9F A;  4MEL A;  3ONS A;  1P98 A;  3ZTC A;  3PLV A;  3N3K B;  4I6N B;  3DVN V;  1WR6 E;  1F9J A;  3DPD A;  1I42 A;  1LXD A;  3PVL A;  3HHM A;  4J6I A;  4WAA A;  2JZ3 B;  3P2B A;  3RUI B;  1C3T A;  4B9K A;  2KZR A;  3NS8 A;  4PS3 A;  2KDE B;  3PSE B;  2NPT B;  3L0W B;  1RRB A;  1PQS A;  2N7E A;  2M0X A;  3JW0 X;  4M8N A;  1NI2 A;  3O65 B;  3H7P A;  4IWQ A;  3OAW A;  1WRD B;  2LGX A;  2FID A;  2QHO A;  5LXI B;  4MSQ B;  1FXT B;  3T9L A;  3HK0 A;  2ZJD A;  1WGG A;  3B1L X;  2IZV B;  4EOY A;  1S1Q B;  5DPR A;  4DHZ E;  1WH3 A;  4BVU C;  4HK2 A;  2KTF A;  3HM3 A;  4W9E A;  4KZC A;  3SU8 X;  2LWP A;  2ASQ A;  4URK A;  2IYD B;  2NPT A;  4KDI C;  4WJN A;  3KUZ A;  1GJZ A;  2KX0 A;  1XT9 B;  1V6E A;  4GN1 A;  3RUL A;  4WJO A;  2MX2 A;  4W9H A;  2M8S A;  3U7D A;  1CMX B;  3V60 A;  1H4R A;  4DWF A;  3AUL A;  2N7D A;  1WX8 A;  2KN5 A;  3V61 A;  4GIV A;  3QC8 B;  1OEY J;  3KYC D;  3KUC B;  3WAP A;  3ZNH B;  4ANU A;  3ENE A;  1ISN A;  3DCG A;  3AXC A;  2G45 B;  2DZK A;  2W9N A;  2MQJ A;  2JT4 B;  1WR1 A;  2LXA A;  3N30 A;  4W9G A;  3TCA A;  2KTR A;  5AEK B;  1UEL A;  2MRP A;  3AU5 A;  2DZM A;  3AI5 A;  2IO3 B;  3APC A;  3CST A;  2IY0 B;  5J2R A;  2DEN B;  1RAX A;  2KO3 A;  3WIM A;  2N9E B;  2OJR A;  4GSW A;  3NHE B;  4MEM A;  1WE6 A;  1WX9 A;  3APF A;  5BO4 B;  1E8Z A;  2MBH A;  3PPA A;  1M94 A;  1Q5W B;  2RR9 A;  4FHJ A;  3ZNI D;  3HM6 X;  4G3X B;  3V6E B;  1WM3 A;  3DVG Y;  3WAL A;  2EMT A;  4GB9 A;  2IO0 B;  2GBM A;  5JHA A;  5G55 A;  1SE9 A;  1WMH A;  3WAM A;  4MGI E;  1JRU A;  4B95 A;  3L17 A;  3VVW B;  3A1Q B;  2KFK B;  5DCN A;  3M3J A; 
#chains in the Genus database with same CATH topology
 3Q3N C;  2BKF A;  1V2Y A;  1GPX A;  2JY6 A;  4HXD A;  2MBQ A;  4CYE A;  2FE8 A;  3CWI A;  4WWP A;  4GXB A;  3DBH I;  3PV1 A;  1TZ1 A;  2LJ5 A;  1DGJ A;  2IDY A;  2BYV E;  3A4S C;  2O6V A;  4A3P A;  3PZD A;  1FXI A;  2KAJ A;  3NZS A;  3DWM A;  2NR2 A;  4NJ7 A;  4DK5 A;  4RGN A;  2NBU A;  4P7I A;  2G1E A;  3O13 A;  3IG3 A;  2R61 A;  4BBN F;  1UF0 A;  2QSD A;  4DHJ D;  2AQ1 B;  2DYO A;  3ZDT A;  4RM9 A;  2KJ6 A;  2LGS A;  1K53 A;  3DHI C;  4G50 A;  1EM7 A;  4A8X C;  1FEH A;  2QC8 A;  4LDT B;  4LK0 M;  3MJW A;  4IWO A;  1L0V B;  5IAA C;  2WDR B;  4O1N A;  3VUW A;  2RDH A;  4WWM A;  3KW5 B;  4US8 A;  3MHZ A;  1KTK A;  2LXC A;  3PRP B;  2H88 B;  5HHD G;  3MFG A;  3WA0 A;  2KDI A;  3DBH B;  4IC7 B;  2KDB A;  3ZW3 A;  1NYR A;  4AUQ C;  2KTR B;  1QIL A;  4K7U A;  3RNA C;  1P1A A;  3DVG X;  4C4V B;  3PTF C;  3EFC A;  2KQ7 A;  5DPW A;  1V9J A;  3MC8 A;  3UGB B;  2QIE B;  4F1S A;  4ZRQ A;  1TBE A;  3IT4 B;  4BOZ B;  1WFY A;  3NVW A;  4K1R B;  3LB8 C;  1XEE A;  3TSS A;  2BF8 B;  2C60 A;  3N20 C;  3P4Q B;  1J0G A;  1WXS A;  3WAN A;  3DOW A;  1L7Y A;  4AJW A;  3TL5 A;  1XLP A;  3NS1 A;  4NAM A;  2WQY B;  4USA A;  2I38 A;  2WWZ A;  2WXG A;  4WQO B;  1ZKH A;  1HE8 A;  1GG3 A;  2O6V B;  1XLO A;  4IUM B;  5D6J B;  1NEK B;  3GP7 A;  2FAZ A;  4MH0 E;  1K50 A;  5D94 A;  3SEB A;  2BS3 B;  3QX1 A;  1WXM A;  2LI5 A;  3OWE B;  4JE3 B;  5GMV A;  3DVN U;  1MVK A;  4S17 A;  3VUX A;  5FKA C;  1PGA A;  5L83 A;  4WJQ A;  2AQ3 B;  2KWD A;  2FCS A;  2GBN A;  2JX5 A;  2HTM E;  2KOX A;  3JVZ X;  1D5Z C;  3B2G A;  4KKI A;  4L2Y A;  5JZE B;  4G0N B;  4FJV B;  1CQV A;  1AN8 A;  3AED B;  4EEW A;  3VR9 B;  2LVO A;  1OFF A;  2XK5 B;  1WRI A;  4IKG A;  1LFD A;  1OQR A;  2HJ8 A;  2ZCC A;  3AEB B;  2N1W A;  3ZUN A;  3AEE B;  3EGR A;  2BYE A;  3B0A A;  1WGH A;  2KWU B;  1LO5 D;  3SR6 A;  2LGD A;  2KNB A;  5AZG A;  1MFW A;  2UYZ B;  3AE4 B;  3V05 A;  2D2Q A;  1QOG A;  2LEK A;  4OVV A;  3ML9 A;  2RMM A;  2PVG C;  3AE1 B;  1Q1O A;  1TKE A;  2WP9 B;  4P6V F;  1PGX A;  5FR3 A;  2GRI A;  4GMV A;  1MHX A;  5TR5 A;  5AUK A;  2X38 A;  1TKY A;  1NI3 A;  1TGZ B;  2OHF A;  5AZH A;  1ZE3 D;  3AE6 B;  2LHD A;  4KDL B;  5IOI A;  1ROE A;  1FXA A;  3C19 A;  4I6P A;  2WYQ A;  5IA7 A;  2G9H D;  1FO4 A;  2KFJ A;  2K6D B;  4RF1 A;  4YTM B;  4EE2 A;  3PZ7 A;  2VH1 A;  1YX5 B;  2K1F A;  5LLI A;  4LTU A;  3RNE C;  1HA5 A;  4BZA A;  2D11 A;  1KOT A;  2Y3A A;  2J0J A;  4BKS D;  1BXT A;  1A5R A;  4JWU C;  4DHZ B;  5J17 A;  5H8Y E;  3NZU A;  3VQI A;  3CMM B;  5EE9 A;  2K39 A;  2WXH A;  4ANV A;  1V49 A;  4II2 B;  1KLU D;  1E10 A;  2LRU A;  2I1J A;  2KLG A;  4FBJ B;  3HIZ A;  1EUV B;  4PK1 A;  2L0F A;  1FNV A;  2Y5P A;  3DQV A;  4YXD B;  3VDZ A;  4NJ6 A;  2BTE A;  4M01 A;  3M95 A;  3L16 A;  2D10 A;  2N9K A;  2VRR B;  3PRZ A;  3AM9 A;  2SEB D;  1I35 A;  1FFU A;  1YQ3 B;  3VTU A;  1SXT A;  2IBI B;  2R2O A;  5CHF A;  1IPG A;  1EWC A;  2IO2 B;  4WIP A;  3N1Z C;  3MHS D;  3GOE A;  2ZCB A;  3A1Q A;  2KFK A;  2A4Z A;  2ZZP B;  4FJY A;  5L95 C;  4ASW C;  2BQQ A;  4KSL C;  2DNF A;  1YOV B;  3FC4 A;  1VLB A;  3I5J C;  3VRB B;  5DPS A;  4PT5 A;  3NOB A;  1WXQ A;  4KZ0 A;  2CJN A;  2UWQ A;  3VR8 B;  4IM0 A;  1F0Z A;  4US9 A;  2PE9 A;  2L7R A;  1CJE A;  2NBV B;  1L5P A;  2N4F A;  1SIF A;  4W9F A;  3ONS A;  1P98 A;  3PLV A;  5BMG A;  4I6N B;  4MH8 A;  4GLS C;  2KN4 A;  2DLB A;  2Q5W D;  3PVL A;  4XYC A;  4YTP B;  1IUE A;  2ACZ B;  4J6I A;  3AEF B;  1UWX A;  2J4X A;  2MEK A;  1C76 A;  1B1Z A;  3PSE B;  5MPO A;  1PQS A;  1KLG D;  2M0X A;  3MJ5 A;  1V97 A;  4M8N A;  1YJJ A;  3H7P A;  3EUB 2;  4WH4 A;  3OAW A;  3H8H A;  2BT6 A;  1FXT B;  3T9L A;  2ZJD A;  2JU6 X;  1TIF A;  2N7J A;  2QJL A;  4W9E A;  4KZC A;  3RNF C;  2ASQ A;  4URK A;  1XLN A;  4WJN A;  2JWU A;  3AEA B;  1GJZ A;  2KX0 A;  1XT9 B;  2QIL A;  2X8X X;  3AB5 A;  2M8S A;  3PO0 A;  1CMX B;  4W9H A;  3U7D A;  3V60 A;  1QT9 A;  3AUL A;  2N7D A;  1WX8 A;  3WAP A;  1STE A;  3U52 E;  4KX6 B;  4W9G A;  2LXA A;  3TCA A;  5AEK B;  5HI1 A;  1PUT A;  1SSN A;  3BWU D;  5J2R A;  2KO3 A;  1HQR D;  4Q2J A;  3AE8 B;  4GSW A;  1WE6 A;  1WX9 A;  1T3Q A;  2YEP B;  3PPA A;  1B9R A;  1WM3 A;  1BUI C;  1L6V A;  1TS4 A;  5G55 A;  4B95 A;  3VVW B;  3A1Q B;  2KFK B;  1J7A A;  2JYE A;  3VFK A;  4LNK A;  2BYF A;  4AS1 A;  2ZVN A;  3L54 A;  5GXG B;  2I1K A;  1E5W A;  1WF9 A;  3PT2 B;  3KQ4 A;  4BBN C;  3AU4 A;  4KV2 A;  1F1H A;  1KF6 B;  1TY2 A;  4KGT A;  3E9S A;  3L10 B;  2BW2 A;  3Q2A C;  2KXJ A;  3APD A;  4NY0 A;  2LZ6 A;  1ENF A;  3I3T B;  5IKC M;  2JRH A;  1C1Y B;  5CHW A;  1ZGU B;  3Q6B A;  2Z8L A;  1WGR A;  3R66 C;  2CS4 A;  3UIN B;  4ZRJ A;  3HUI A;  4DHJ B;  2INC C;  3NUH B;  2NCN A;  2DZI A;  2RPQ A;  1PYW D;  4IDI A;  3PRE A;  1QOB A;  4KKJ A;  4S0R A;  3GB1 A;  2WNM A;  3QAQ A;  2CU1 A;  4DXA B;  1IGD A;  5LNK 1;  2HE7 A;  1KM7 A;  3H6N A;  1TS2 A;  3QCA A;  4E74 A;  1SEB D;  3RPF C;  1WE7 A;  4DDG D;  2NTS A;  1WJ6 A;  2IPK D;  5C2T B;  1IP9 A;  4D2K A;  4ANW A;  4FJZ A;  2D5G A;  1MG8 A;  2ZPN A;  3ZJT A;  1Q0W B;  2PE6 B;  2G4S A;  4CO7 A;  3UQB A;  1WXA A;  3GS2 A;  5E6O A;  4ARI A;  1P7E A;  2K8C A;  4IOI E;  1XXG A;  2KKC A;  1IBX B;  3VUY A;  2KC1 A;  3E56 A;  2J0K A;  2KVZ A;  1GOZ A;  4HJK A;  1YN5 A;  1WJ4 A;  4MM3 B;  1QZE A;  1L4Z B;  4HPL B;  2M56 B;  3KUD B;  2N1V A;  1YJI A;  2K3U A;  1Y56 A;  2R2Q A;  1QOA A;  4NAW A;  3URY A;  3SDL C;  2WHI A;  1ACC A;  3LDZ E;  4FAD A;  1JWU D;  1KJT A;  5G2N A;  1P7F A;  3AMZ A;  4MGK E;  3PS6 A;  3Q8E A;  4K3B A;  5EDS A;  1ZDX A;  2QDF A;  3A9K A;  4M0W A;  4A20 A;  2JQR B;  5C23 A;  1E7V A;  2J42 A;  2L83 A;  2DBY A;  3OJ3 A;  2JF5 A;  4UDU C;  3L08 A;  1E8X A;  4N9F 4;  4EFO A;  1J7B A;  3UQA A;  2IGH A;  3ZYY X;  1L4D B;  4HCN B;  3U8Z A;  2LVQ A;  1V8C A;  2M1M A;  1T6B X;  3KLS X;  3EHV A;  1JWS D;  1YN3 A;  1D6E C;  1AW7 A;  1QLB B;  1WJU A;  5IO9 A;  4RF0 A;  1T0Y A;  1WI0 A;  1S3S G;  3Q3O C;  1SE3 A;  1ZXI A;  4A6Q A;  5C1Z A;  5CTR C;  1FM0 D;  3PRM B;  2C7H A;  2GMI C;  3MC0 B;  4EZJ A;  1M4V A;  1Z2M A;  2OED A;  1EU4 A;  4ZRI A;  3R7Q A;  1ZP0 B;  3FIL A;  5C3J B;  2WXM A;  1TTN A;  3Q3F A;  1UGM A;  2KD0 A;  4RH6 A;  5BMI A;  2KWV B;  3V6C B;  2HJ1 A;  4DBG A;  1OQY A;  3P42 A;  3IAM 1;  1RLF A;  2M17 A;  3AE3 B;  2XK5 A;  3T3O A;  4RGO S;  4LCD E;  3A4R A;  4MGY E;  4WJP A;  4BOS C;  2RSU A;  2EKE C;  2W54 A;  2LMC A;  1YMH E;  1P0R A;  4ANX A;  4NAW B;  2BS4 B;  3N32 A;  2LD9 A;  4I6L B;  2E6X A;  4RM8 A;  4TMA B;  3I9V 1;  1YQ4 B;  1E6E B;  2KMC A;  5D7G A;  3A9K B;  2KK8 A;  4M0W B;  4E71 A;  4FN2 A;  2WX0 A;  3WCQ A;  4XC2 A;  4ZDV A;  4WWO A;  4EZK A;  4NQL B;  2V3S A;  2ZW0 A;  2WU5 B;  3RYT A;  3W9C B;  1IGC A;  1R7S A;  4XDC A;  3DDC B;  2G4D B;  1I7H A;  4FA6 A;  2JUO A;  4XWT A;  1R4M I;  1SB3 C;  4OZB A;  4C00 A;  4ZRK A;  1I4G A;  3D32 A;  1F77 A;  1PFD A;  2L05 A;  2M0A A;  1N5X A;  1UUP A;  1HXY D;  2KT7 A;  4L1B A;  2M4N A;  1VRA B;  5J18 A;  3TBL D;  2D07 B;  4OHJ A;  4W9J A;  2BYT A;  2KAC A;  3MTN B;  2B76 B;  3FIL B;  2IJ0 A;  1C9F A;  2SAK A;  4WAF A;  3W5U B;  2WDQ B;  3VXW A;  3NVV A;  2RDB C;  3KYD D;  2K9X A;  5FK9 C;  2BKR B;  2K8H A;  1RM6 C;  4K7S A;  3DWG C;  3QQ8 B;  3AH7 A;  3OJ4 B;  2OOB B;  1N5W A;  3H7S A;  4MSM B;  4DQO C;  1PGB A;  4LNO A;  3EC8 A;  2C9W B;  3VH4 B;  3JYU A;  4AOF A;  4HDO A;  5FR6 A;  4W9C A;  3KH0 A;  3CSF A;  2RD0 A;  1Z5S B;  2LGY A;  4LJP B;  3EFU A;  2JZZ A;  1WM2 A;  2KHW B;  5G5G A;  1R4M B;  1V81 A;  2KMA A;  1WIA A;  3SD5 A;  2V3P A;  1KFY B;  1N62 A;  2AL6 A;  2FUG 1;  1I4H A;  3ZTC A;  1JWB D;  1WR6 E;  1F9J A;  2WXO A;  2WXN A;  2Y5C A;  3BZD B;  4WAA A;  1C3T A;  4L23 A;  2DWQ A;  3J9C A;  3NS8 A;  1T5X D;  5BYS A;  3BYT B;  1FD6 A;  1NI2 A;  1WGK A;  4DXG A;  5LXI B;  5I4D A;  3HK0 A;  1L0Y B;  4BVU C;  2MH7 A;  3HRD D;  1V6E A;  4GN1 A;  3RUL A;  4WJO A;  2MX2 A;  4YSY B;  4DWF A;  2WXK A;  3QC8 B;  1OEY J;  1FIQ A;  4ANU A;  3ENE A;  4WUR A;  3AXC A;  4AQ7 A;  1XCQ L;  1HZ6 A;  3NRZ A;  2MQJ A;  2JT4 B;  1WR1 A;  3AU5 A;  2DZM A;  2K22 A;  3AI5 A;  3V3X A;  3APC A;  3CST A;  2IY0 B;  2DEN B;  1RAX A;  4M02 A;  2ICI A;  2OJR A;  4MEM A;  3APF A;  4HRS A;  1TY0 A;  2RR9 A;  4G3X B;  3WAL A;  4ACF A;  4YSX B;  2WXQ A;  2MJD A;  1SE9 A;  1WMH A;  1WSP A;  3RNC C;  1VDV A;  2YEP F;  3L17 A;  1SE4 A;  5DCN A;  3M3J A;  2O6V D;  2MWS B;  2YVC A;  3W5V B;  2VZK D;  4X57 B;  4G11 A;  3SHQ A;  1NVI D;  3CF6 E;  3ALB A;  1U4A A;  4HKQ A;  4P16 A;  2BGF A;  4KVG B;  2PMV A;  1XQQ A;  5EE0 A;  2JVC A;  2IGD A;  1VJK A;  3RD2 A;  1J8C A;  4FXC A;  1L2N A;  3PGE A;  4XDD A;  3IHP C;  2KYW A;  4HPM B;  4FUL A;  3RNB C;  4DDI D;  4GU2 A;  2L8J A;  2FIF A;  3B9J A;  1UD7 A;  4KGR A;  1NBF C;  2AL3 A;  2MCN B;  3X23 A;  1G6J A;  2Z0E B;  1F52 A;  2INN E;  2MBE A;  2FNJ B;  1HTO A;  2BS2 B;  2N9X A;  3PHW B;  5EE3 A;  2INP E;  3RMK C;  2L32 A;  5D3I B;  4ZYS A;  3AV8 A;  1VZ8 A;  1L6U A;  3RN9 C;  3PZ8 A;  5KHO A;  1WY8 A;  1V86 A;  2MHJ A;  4TUU A;  3Q8F A;  1AWD A;  4HPP A;  2NVU I;  3ZIM A;  4F7Z A;  4MDK E;  1TS5 A;  1LM8 B;  1WGD A;  1JW9 D;  1YIW A;  2GBR A;  4EZL A;  4TQ0 A;  3R2T A;  3M62 B;  2ZVO A;  1HZ5 A;  3K9O B;  3NVZ A;  2RPV A;  3ZRF A;  4J3O D;  3UIP B;  2CKH B;  1FPY A;  2Z59 B;  4BAX A;  3K9P B;  3DBS A;  2LJI A;  3ZVV A;  3N1Y C;  1I4R A;  1EWY C;  4AWJ A;  2NBW B;  2WXJ A;  1QKZ A;  3Q14 C;  3RI7 C;  3SFE B;  1NDD A;  2ZPY A;  1OTR B;  4REZ A;  4OVU A;  2N9P C;  2DAJ A;  3ZTD A;  2FBW B;  1WMH B;  2Z0D B;  4TSS A;  1KRH A;  3TJP A;  2KX3 A;  5D2M B;  1N63 A;  2A5U A;  5H92 C;  4YL8 A;  1IBX A;  4HDQ A;  1V5O A;  1K8R B;  1WGY A;  2ZEQ A;  4GDL A;  1VCB A;  4KSK C;  2KJH B;  1DOY A;  2PPH A;  4MM3 A;  3B08 A;  5AUI A;  3AEC B;  3RT3 B;  2AWT A;  1FCC C;  1WYW B;  2ZW1 A;  2L52 A;  1UWM A;  3OG5 A;  3C0R B;  3BIN A;  3T3N A;  2HDE A;  2JSV X;  4PYZ A;  1K51 A;  2L76 A;  4K81 A;  5E6P A;  1UNS A;  5BYQ A;  1KLV A;  4N58 A;  1K52 A;  2MBO A;  2K8B A;  2W3R A;  1RYJ A;  2V3N A;  2C7N B;  2LRW A;  5G5H A;  2KWC A;  2WX1 A;  2DYM A;  4FLH A;  3TEZ A;  2W82 A;  5CHV C;  3ZDM C;  4JGH B;  3AE9 B;  1FMA D;  5BYR A;  4XWW A;  1IYF A;  3DBL I;  3IVF A;  4IG7 B;  4LJO B;  2HTH A;  1DOX A;  4E3C A;  3NG0 A;  4KGS A;  2JXT A;  4ARC A;  3AEG B;  4W9I A;  2BWE S;  1JQ4 A;  4RGM A;  2PW9 A;  3ZO5 B;  1YD8 U;  3BY4 B;  2GOW A;  1AAR A;  1XLQ A;  3RZF A;  4GOC A;  3EA6 A;  3Q3M C;  2KLC A;  3ZXV A;  1AYF A;  2D3A A;  4JIO U;  3VTV A;  5DPT A;  1BT0 A;  2GLS A;  4MGZ E;  5LXH A;  1L0X B;  1F2R I;  2EKI A;  3N9Y C;  4RCO A;  1OQQ A;  4PYU A;  2ZNV B;  3ZQ4 A;  2C7M B;  1ESF A;  2JZP A;  2ON8 A;  4C7Z A;  1JRO A;  1OEY A;  5JHB A;  1FNW A;  3U7Z A;  3ZLZ A;  1H8C A;  4P1B C;  4GDL B;  4OZA A;  1YN4 A;  4ITK A;  1YX6 B;  2V4L A;  2PEA A;  3W1Y A;  2FCN A;  1N60 A;  1ZUD 2;  3KVF B;  3IAS 1;  2JXX A;  3W1S A;  3Q3J A;  3DBL B;  4GGQ A;  4CQN A;  4MJS B;  1GNU A;  2DAF A;  3GE3 C;  2LGI A;  3R2I A;  2WXP A;  2WXR A;  4N59 A;  3GE8 C;  2PVO D;  3DHG C;  2BBC A;  1JCK B;  1FRR A;  2JPH A;  4NQK E;  4A90 A;  3P1M A;  1SGH A;  4RGT A;  2PLP A;  2WDT B;  1LQB A;  2DHZ A;  4BKS A;  4H2A A;  4TV3 A;  1E8W A;  3RCZ A;  2LFI A;  1E7U A;  5TSS A;  5EE1 A;  3PHX B;  2B3A A;  2ONQ A;  4YTN B;  2GB1 A;  3BK1 A;  4OVZ A;  1XD3 B;  4DXF A;  2E3T A;  2QCZ A;  2KDF B;  4B0E A;  5HFY A;  3P63 A;  3GZN I;  1MJD A;  2LHE A;  5CX3 A;  1EF5 A;  2JRI B;  2K25 A;  5T8I A;  4XZ4 A;  1I4P A;  5E6J A;  2AYO B;  2MW5 A;  3U4E G;  3B2F A;  1LGR A;  3KWL A;  5IP4 D;  1WYG A;  4B6W A;  2W55 A;  4GDK A;  3EEC A;  4W9K A;  5HKH A;  3LYY A;  1SF0 A;  1E90 A;  4MT5 A;  2QMT A;  2EMS A;  3S2A A;  2DZJ A;  1HTQ A;  2IY1 B;  4R3D A;  1C4A A;  2MJE A;  3ML8 A;  2V1Y A;  1WZ3 A;  2WXI A;  1N6Z A;  1J19 A;  1UBQ A;  1V1P A;  2H89 B;  2W3S A;  4RNA A;  2PKO A;  3DPD A;  1LXD A;  5IN7 A;  3HHM A;  3RUI B;  3MP9 A;  2V4I B;  4LNI A;  4PS3 A;  2NPT B;  1RRB A;  1KH0 A;  2N7E A;  1DYQ A;  3JW0 X;  3O65 B;  1CZP A;  4IWQ A;  1WRD B;  2LGX A;  2FID A;  4MSQ B;  1WGG A;  2IZV B;  1A70 A;  1S1Q B;  1XF5 L;  3GZN B;  1QF6 A;  4DHZ E;  1WH3 A;  4HK2 A;  3RNG C;  4KDI C;  3R8B A;  3KUZ A;  1TS3 A;  4HKZ E;  2K5P A;  2WGS A;  3V61 A;  1FNU A;  3KYC D;  3KUC B;  3MC9 A;  3ZNH B;  1TJE A;  3DCG A;  1JWA D;  3I63 C;  2LUM A;  3N30 A;  4JX1 C;  2MRP A;  3I57 A;  2PTL A;  3WIM A;  2N9E B;  4JWS C;  3NHE B;  1E8Z A;  1M94 A;  1Q5W B;  3ZNI D;  3HM6 X;  3U2S C;  3V6E B;  3DVG Y;  1ZPS A;  5JHA A;  3WAM A;  1YNT E;  1JRU A;  4HWI B;  1ZDV A;  2BPS A;  2VZK B;  4FHK A;  4HRO A;  5JH5 C;  4EKU A;  4GDK B;  3QJZ A;  3RZW C;  1UBI A;  2JYT A;  3H1U A;  1C4C A;  2KVR A;  2LUE A;  4XE0 A;  2REX A;  2BVC A;  1WZ0 A;  2QEJ C;  2G3Q B;  2O2V A;  2MLB A;  3DHH C;  1T0Q C;  4F8C B;  2AX5 A;  4JLC A;  1V1P B;  2FCQ A;  1I4X A;  3OLM D;  2KDM A;  1C4P A;  1R4N I;  1C78 A;  1UGJ A;  3U30 A;  4JL9 A;  1WXV A;  3QWZ B;  4K3C A;  1C77 A;  3TEX A;  3Q8C A;  2CHZ A;  2WU2 B;  1YQB A;  4XX5 A;  1HEZ E;  3P4R B;  1EO6 A;  2M19 A;  2D3B A;  4RFB A;  1P3Q U;  2ZNV C;  3TEY A;  3RFZ B;  4LDT D;  1V80 A;  2GBK A;  4HCP B;  4YSZ B;  1ZW7 A;  4CHK A;  3L4P A;  2IO1 B;  1UH6 A;  1WX7 A;  3H9D A;  4P1C C;  4WQM A;  3X0W A;  1TT5 B;  4RMA A;  1TYG B;  2BB5 A;  1GUA B;  2AQ2 B;  3QK0 A;  2IND C;  1RFK A;  1C79 A;  2LVP A;  2VH2 A;  3VHT C;  2XN9 C;  3FKY A;  1BML C;  4ICU A;  2J0M A;  2AEH A;  3PLU A;  3TIX A;  2D3C A;  3ZRC A;  3ZGZ A;  4M8M A;  1FFV A;  2DX5 B;  3BVG A;  4AJY B;  3NY5 A;  4II3 B;  2XBB C;  4LLG M;  2J7Q B;  1T0S C;  4YT0 B;  3ETR A;  1R4N B;  4BFR A;  2KJR A;  3M63 B;  4KIK A;  2JWZ A;  3TUO A;  2CR5 A;  2WXF A;  1ET9 A;  1QOF A;  2GI9 A;  5E6N A;  3P4S B;  3L13 A;  1F2R C;  1WJN A;  1D5X C;  5AZF A;  1FCL A;  1V1O A;  2YLM A;  2O2V B;  4LNN A;  2KMM A;  2NMQ A;  3IBE A;  1PDX A;  4C7Y A;  1YJ1 A;  3NZ3 A;  4BKT A;  1RFA A;  1GC7 A;  3ZJV A;  1GC6 A;  1NYQ A;  2MSE D;  2L1A A;  1OGW A;  3ZNZ B;  3ZKJ C;  1GAQ B;  2MP2 A;  3Q8B A;  3HVD A;  1MI0 A;  3Q69 A;  3A9J A;  3FAH A;  5D3D A;  1UZX B;  2L0T A;  4ICV A;  2WXL A;  1JWM D;  3P4P B;  3BVZ A;  3JSV A;  3ABV B;  1NEN B;  3BII D;  2K0P A;  4PS7 A;  2OJW A;  4C80 A;  2D3G A;  4NNJ B;  4XGA B;  5HG2 A;  1XCT L;  4NPN A;  1MG4 A;  3IXS A;  4IM2 A;  3QHT A;  1Q10 A;  2KQS A;  3W1S C;  3VAW A;  1JAL A;  2TSS A;  4A9A A;  3LJ3 A;  3TMP B;  1SE2 A;  2NS5 A;  2GBJ A;  2IGG A;  2PIA A;  1J7C A;  2K6Q A;  2WDV B;  2CHW A;  2PJH A;  3T8M A;  4N6E B;  1EF1 A;  1E0Z A;  4TQ1 A;  3AN1 A;  3ECI A;  3BYY B;  3ZNG C;  1P9D U;  1EU3 A;  4KIK B;  4IW0 A;  5KHQ A;  2CHX A;  3UIO B;  2N9L A;  4LNF A;  4ZRP A;  1ZXH A;  2MBB B;  5JXV A;  1GB1 A;  2HD5 B;  3WAO A;  5BMH A;  3R3M A;  4HVB A;  1RWS A;  4W9L A;  1JML A;  1SBB B;  4ZOH C;  4EUT A;  4A3O A;  4HJG E;  3ZXR A;  2FUH B;  2J53 A;  3QAR A;  2BWF A;  2KAN A;  3AE5 B;  3A33 B;  2LAS A;  4JQW C;  1VZ7 A;  4BKG A;  4OW0 A;  1MHH E;  3NJT A;  4MJS A;  2MP2 B;  3IFW B;  2KQ4 X;  4IM3 A;  2BB6 A;  3DBR I;  1D5M C;  1SJE D;  2MJ3 A;  3A9J B;  3VH3 B;  1SJH D;  4WWN A;  4AP4 C;  2CU3 A;  1GB4 A;  3TEW A;  1E7P B;  3BVM A;  4QAY A;  4YWG G;  2L00 B;  3UF8 A;  1TKG A;  4ZHP A;  3JSV B;  2DYB A;  2FCM A;  3LXF A;  3N1X C;  2UU7 A;  4NZL B;  2V0G A;  4K7W A;  4M00 A;  3VTW A;  2XEW A;  4OZC A;  4PS8 A;  3VRA B;  1D3Z A;  3V62 A;  3QA8 A;  1E9M A;  2Y5B B;  3QIJ A;  1D4B A;  1WWT A;  4HEA 1;  4TKN A;  2I2Y A;  4B0M A;  2MA9 B;  4IWP A;  2KC2 A;  3KWV A;  2WLB A;  4MAC A;  1X1M A;  2C5L C;  3R7R A;  1T0R C;  1E8Y A;  3ZJU A;  1V5T A;  4W9D A;  3NVY A;  1Y8R C;  4JPS A;  3W2D A;  1ZOY B;  1VD2 A;  1ET6 A;  4ZYN A;  4C56 C;  3H7P B;  2L3Z A;  4HLE A;  2N0S B;  2RGF A;  2J52 A;  3DBR B;  4MEL A;  3N3K B;  3DVN V;  1I42 A;  3C8Y A;  2XNA C;  3P2B A;  2JZ3 B;  1VR9 A;  3AE7 B;  4B9K A;  4A55 A;  2KZR A;  1XO3 A;  2KDE B;  3L0W B;  1TZO A;  2EEL A;  1N61 A;  3SFD B;  3UI3 A;  2QHO A;  1DOI A;  1CK1 A;  3B1L X;  4EOY A;  5DPR A;  3IT6 B;  4ZHO A;  2KTF A;  3HM3 A;  1MPE A;  3SU8 X;  2LWP A;  2IYD B;  2NPT A;  2CJO A;  2RDG A;  1I4Q A;  1H4R A;  2KN5 A;  4GIV A;  3BK2 A;  1ISN A;  2G45 B;  2DZK A;  2W9N A;  2WS3 B;  2KTR A;  1UEL A;  3Q8A A;  3AE2 B;  2IO3 B;  1JRP A;  3HVZ A;  1SIJ A;  4C4V A;  3CIR B;  5BO4 B;  2MBH A;  1QQR A;  4FHJ A;  4NJC A;  4GB9 A;  2V9H A;  2EMT A;  2IO0 B;  2GBM A;  4MGI E;  1VZ6 A;  1FRD A;  2NTT A; 
#chains in the Genus database with same CATH homology
 2O6V D;  4HWI B;  2BPS A;  2MWS B;  2YVC A;  4FHK A;  3VFK A;  2BKF A;  1V2Y A;  4X57 B;  2JY6 A;  4HXD A;  2BYF A;  4G11 A;  3SHQ A;  3CF6 E;  3ALB A;  1U4A A;  2MBQ A;  4CYE A;  2ZVN A;  3L54 A;  5JH5 C;  2BGF A;  4EKU A;  4KVG B;  2I1K A;  4WWP A;  1E5W A;  1WF9 A;  1XQQ A;  3PT2 B;  2JVC A;  3DBH I;  4GDK B;  4GXB A;  3PV1 A;  3QJZ A;  3RD2 A;  1J8C A;  1TZ1 A;  2LJ5 A;  1L2N A;  3RZW C;  4BBN C;  3PGE A;  1UBI A;  3AU4 A;  3H1U A;  3IHP C;  2LUE A;  2KVR A;  2REX A;  2BYV E;  4HPM B;  4KV2 A;  3A4S C;  2O6V A;  4FUL A;  1WZ0 A;  4A3P A;  4DDI D;  4GU2 A;  3PZD A;  2L8J A;  2FIF A;  2G3Q B;  1UD7 A;  2MLB A;  1NBF C;  2AL3 A;  2O2V A;  3L10 B;  3NZS A;  2MCN B;  3X23 A;  1G6J A;  2Z0E B;  2NR2 A;  2KXJ A;  4NJ7 A;  3APD A;  4DK5 A;  4NY0 A;  4F8C B;  2LZ6 A;  4JLC A;  2FCQ A;  2NBU A;  4P7I A;  3I3T B;  2JRH A;  3OLM D;  1C1Y B;  3IG3 A;  5CHW A;  2MBE A;  1ZGU B;  2FNJ B;  1WGR A;  3R66 C;  1R4N I;  3U30 A;  4BBN F;  4JL9 A;  2CS4 A;  2N9X A;  3UIN B;  4ZRJ A;  4DHJ B;  1WXV A;  3QWZ B;  3PHW B;  4DHJ D;  2NCN A;  2DZI A;  2RPQ A;  2CHZ A;  3PRE A;  2DYO A;  3ZDT A;  4RM9 A;  1YQB A;  4XX5 A;  5KHO A;  2KJ6 A;  1WY8 A;  1V86 A;  1EO6 A;  4TUU A;  3QAQ A;  2CU1 A;  4DXA B;  4G50 A;  2NVU I;  3ZIM A;  4F7Z A;  2HE7 A;  1KM7 A;  1P3Q U;  2ZNV C;  3H6N A;  4LDT B;  3MJW A;  4MDK E;  1LM8 B;  1WGD A;  1YIW A;  4IWO A;  1V80 A;  2GBR A;  4LDT D;  3QCA A;  2GBK A;  4HCP B;  5IAA C;  4TQ0 A;  4EZL A;  4E74 A;  3M62 B;  1WE7 A;  4DDG D;  2ZVO A;  1WJ6 A;  1ZW7 A;  4CHK A;  3VUW A;  1IP9 A;  3K9O B;  4ANW A;  2IO1 B;  3KW5 B;  1UH6 A;  4FJZ A;  1WX7 A;  3ZRF A;  3H9D A;  1MG8 A;  3X0W A;  2ZPN A;  1Q0W B;  2PE6 B;  4RMA A;  2G4S A;  2LXC A;  3PRP B;  3UIP B;  2CKH B;  4CO7 A;  3UQB A;  1WXA A;  1GUA B;  5E6O A;  3QK0 A;  2Z59 B;  3K9P B;  3WA0 A;  2KDI A;  2K8C A;  4IC7 B;  3DBS A;  2LVP A;  2KDB A;  3ZW3 A;  3VHT C;  2KKC A;  3ZVV A;  4AUQ C;  2KTR B;  3VUY A;  2KC1 A;  4ICU A;  2J0M A;  2AEH A;  3PLU A;  4K7U A;  3TIX A;  4AWJ A;  2NBW B;  2J0K A;  3ZRC A;  1P1A A;  4HJK A;  3DVG X;  1WJ4 A;  4M8M A;  1QZE A;  4HPL B;  2DX5 B;  3KUD B;  3PTF C;  1NDD A;  4AJY B;  2KQ7 A;  2N1V A;  2XBB C;  2ZPY A;  3NY5 A;  4II3 B;  1OTR B;  5DPW A;  4OVU A;  2N9P C;  2J7Q B;  2DAJ A;  1V9J A;  2R2Q A;  3UGB B;  3ZTD A;  4F1S A;  1WMH B;  2Z0D B;  4NAW A;  3TJP A;  1TBE A;  4BOZ B;  1WFY A;  3SDL C;  2KX3 A;  5D2M B;  2A5U A;  4K1R B;  4BFR A;  3LDZ E;  2KJR A;  3M63 B;  2BF8 B;  2C60 A;  4HDQ A;  4YL8 A;  1V5O A;  4FAD A;  1K8R B;  1WGY A;  2ZEQ A;  4GDL A;  1KJT A;  4KIK A;  5G2N A;  1VCB A;  4KSK C;  2JWZ A;  2KJH B;  1J0G A;  2CR5 A;  1WXS A;  2PPH A;  4MM3 A;  3WAN A;  3B08 A;  3DOW A;  3RT3 B;  4MGK E;  1L7Y A;  3PS6 A;  4AJW A;  2AWT A;  3TL5 A;  5EDS A;  5E6N A;  1WYW B;  3A9K A;  3L13 A;  3C0R B;  4A20 A;  2WWZ A;  3BIN A;  4WQO B;  1WJN A;  1ZKH A;  1HE8 A;  1GG3 A;  2O6V B;  5C23 A;  1E7V A;  4IUM B;  5AZF A;  4PYZ A;  5D6J B;  2YLM A;  2O2V B;  2FAZ A;  2L76 A;  3OJ3 A;  4MH0 E;  2JF5 A;  3L08 A;  1E8X A;  4K81 A;  4N9F 4;  5D94 A;  5E6P A;  3QX1 A;  3IBE A;  4EFO A;  1KLV A;  2MBO A;  2K8B A;  3UQA A;  1WXM A;  2LI5 A;  1YJ1 A;  5GMV A;  4BKT A;  3DVN U;  4HCN B;  1RFA A;  2C7N B;  3U8Z A;  1GC7 A;  2LVQ A;  2M1M A;  3VUX A;  2LRW A;  3EHV A;  1GC6 A;  5L83 A;  2MSE D;  1WJU A;  4WJQ A;  1T0Y A;  2KWC A;  1OGW A;  2FCS A;  2WX1 A;  3ZNZ B;  2DYM A;  4FLH A;  3ZKJ C;  1WI0 A;  2MP2 A;  1S3S G;  2GBN A;  5CHV C;  3ZDM C;  3A9J A;  4JGH B;  2KOX A;  3JVZ X;  5C1Z A;  5CTR C;  1IYF A;  1UZX B;  5JZE B;  3PRM B;  2L0T A;  2C7H A;  2GMI C;  3DBL I;  4ICV A;  3IVF A;  4G0N B;  4EZJ A;  1Z2M A;  4FJV B;  4IG7 B;  4ZRI A;  3R7Q A;  4LJO B;  2HTH A;  4EEW A;  4E3C A;  2LVO A;  4W9I A;  2BWE S;  3JSV A;  1TTN A;  3ZO5 B;  3Q3F A;  1YD8 U;  2XK5 B;  3BY4 B;  2GOW A;  1AAR A;  1UGM A;  1LFD A;  2KD0 A;  2HJ8 A;  2ZCC A;  3RZF A;  4PS7 A;  4GOC A;  2N1W A;  3ZUN A;  2KLC A;  2KWV B;  2D3G A;  4NNJ B;  3V6C B;  4DBG A;  4JIO U;  2BYE A;  3B0A A;  4NPN A;  1OQY A;  3VTV A;  1WGH A;  2KWU B;  5DPT A;  1BT0 A;  4MGZ E;  5LXH A;  2LGD A;  1RLF A;  2KNB A;  2M17 A;  4IM2 A;  2XK5 A;  3QHT A;  2KQS A;  5AZG A;  3W1S C;  3VAW A;  2UYZ B;  3LJ3 A;  4PYU A;  3TMP B;  2ZNV B;  2C7M B;  4LCD E;  3A4R A;  2D2Q A;  4MGY E;  4WJP A;  4BOS C;  2NS5 A;  4OVV A;  2RSU A;  3ML9 A;  2GBJ A;  2EKE C;  1Q1O A;  2K6Q A;  2CHW A;  2PJH A;  3T8M A;  1EF1 A;  1P0R A;  4GMV A;  4ANX A;  4TQ1 A;  5TR5 A;  4NAW B;  1OEY A;  5JHB A;  3ECI A;  1TGZ B;  3ZNG C;  1P9D U;  3N32 A;  2LD9 A;  3ZLZ A;  5AZH A;  4I6L B;  1H8C A;  4KDL B;  4GDL B;  4RM8 A;  4KIK B;  4I6P A;  2WYQ A;  5IA7 A;  1YX6 B;  2V4L A;  2KFJ A;  2K6D B;  2PEA A;  4IW0 A;  3W1Y A;  2KMC A;  5D7G A;  2FCN A;  5KHQ A;  2CHX A;  3A9K B;  2KK8 A;  3KVF B;  3UIO B;  2JXX A;  4M0W B;  4E71 A;  4FN2 A;  2WX0 A;  3W1S A;  3Q3J A;  4XC2 A;  2MBB B;  1YX5 B;  2K1F A;  5LLI A;  4ZDV A;  4GGQ A;  4WWO A;  4MJS B;  4EZK A;  1GNU A;  4NQL B;  2V3S A;  3RYT A;  2DAF A;  2HD5 B;  2D11 A;  3WAO A;  1KOT A;  3R3M A;  4HVB A;  3DDC B;  4W9L A;  2J0J A;  4BKS D;  1A5R A;  4EUT A;  2G4D B;  4A3O A;  4DHZ B;  5J17 A;  2FUH B;  3NZU A;  3VQI A;  2JUO A;  3CMM B;  3QAR A;  1R4M I;  4FA6 A;  2BWF A;  2KAN A;  4ZRK A;  2K39 A;  3D32 A;  2L05 A;  3A33 B;  2LAS A;  4JQW C;  4ANV A;  1V49 A;  4BKG A;  2JPH A;  4II2 B;  4NQK E;  4MJS A;  2LRU A;  2MP2 B;  1SGH A;  2I1J A;  2KLG A;  3IFW B;  2WDT B;  4FBJ B;  4IM3 A;  3HIZ A;  1EUV B;  1LQB A;  3DBR I;  2DHZ A;  2L0F A;  3A9J B;  4BKS A;  2M4N A;  3VH3 B;  4TV3 A;  3DQV A;  1E8W A;  5J18 A;  3TBL D;  2D07 B;  3RCZ A;  4WWN A;  3VDZ A;  4AP4 C;  1E7U A;  4W9J A;  3MTN B;  3PHX B;  4NJ6 A;  2B3A A;  2L00 B;  3UF8 A;  3JSV B;  2DYB A;  2FCM A;  1XD3 B;  3M95 A;  3VXW A;  3L16 A;  2D10 A;  2KDF B;  2VRR B;  4K7W A;  3KYD D;  3GZN I;  3PRZ A;  3VTW A;  1I35 A;  2BKR B;  2XEW A;  3VTU A;  5CX3 A;  2IBI B;  1EF5 A;  2R2O A;  4PS8 A;  5CHF A;  1IPG A;  2K8H A;  2IO2 B;  2JRI B;  2K25 A;  4K7S A;  1D3Z A;  3MHS D;  3V62 A;  3QA8 A;  4XZ4 A;  3GOE A;  3QQ8 B;  2ZCB A;  2Y5B B;  3QIJ A;  3OJ4 B;  2AYO B;  3A1Q A;  2KFK A;  2A4Z A;  2OOB B;  3H7S A;  4MSM B;  4TKN A;  2ZZP B;  4FJY A;  5L95 C;  4ASW C;  2MW5 A;  3EC8 A;  2C9W B;  2MA9 B;  4KSL C;  3VH4 B;  3JYU A;  2KC2 A;  4IWP A;  4AOF A;  4HDO A;  5FR6 A;  4W9C A;  4B6W A;  1X1M A;  2C5L C;  3KH0 A;  4GDK A;  3EEC A;  5DPS A;  3CSF A;  4W9K A;  3R7R A;  5HKH A;  2RD0 A;  1E8Y A;  3NOB A;  1Z5S B;  2LGY A;  4KZ0 A;  4LJP B;  3EFU A;  1V5T A;  2JZZ A;  1E90 A;  1WM2 A;  2KHW B;  4W9D A;  1Y8R C;  2UWQ A;  2EMS A;  3S2A A;  1V81 A;  2DZJ A;  1VD2 A;  2IY1 B;  2KMA A;  4IM0 A;  4ZYN A;  1WIA A;  3SD5 A;  2PE9 A;  3H7P B;  2L3Z A;  3ML8 A;  2V1Y A;  4HLE A;  1WZ3 A;  2L7R A;  2NBV B;  2AL6 A;  1J19 A;  2RGF A;  2N4F A;  1UBQ A;  1SIF A;  4W9F A;  4MEL A;  3ONS A;  1P98 A;  3ZTC A;  3PLV A;  3N3K B;  4I6N B;  3DVN V;  1WR6 E;  1F9J A;  3DPD A;  1I42 A;  1LXD A;  3PVL A;  3HHM A;  4J6I A;  4WAA A;  2JZ3 B;  3P2B A;  3RUI B;  1C3T A;  4B9K A;  2KZR A;  3NS8 A;  4PS3 A;  2KDE B;  3PSE B;  2NPT B;  3L0W B;  1RRB A;  1PQS A;  2N7E A;  2M0X A;  3JW0 X;  4M8N A;  1NI2 A;  3O65 B;  3H7P A;  4IWQ A;  3OAW A;  1WRD B;  2LGX A;  2FID A;  2QHO A;  5LXI B;  4MSQ B;  1FXT B;  3T9L A;  3HK0 A;  2ZJD A;  1WGG A;  3B1L X;  2IZV B;  4EOY A;  1S1Q B;  5DPR A;  4DHZ E;  1WH3 A;  4BVU C;  4HK2 A;  2KTF A;  3HM3 A;  4W9E A;  4KZC A;  3SU8 X;  2LWP A;  2ASQ A;  4URK A;  2IYD B;  2NPT A;  4KDI C;  4WJN A;  3KUZ A;  1GJZ A;  2KX0 A;  1XT9 B;  1V6E A;  4GN1 A;  3RUL A;  4WJO A;  2MX2 A;  4W9H A;  2M8S A;  3U7D A;  1CMX B;  3V60 A;  1H4R A;  4DWF A;  3AUL A;  2N7D A;  1WX8 A;  2KN5 A;  3V61 A;  4GIV A;  3QC8 B;  1OEY J;  3KYC D;  3KUC B;  3WAP A;  3ZNH B;  4ANU A;  3ENE A;  1ISN A;  3DCG A;  3AXC A;  2G45 B;  2DZK A;  2W9N A;  2MQJ A;  2JT4 B;  1WR1 A;  2LXA A;  3N30 A;  4W9G A;  3TCA A;  2KTR A;  5AEK B;  1UEL A;  2MRP A;  3AU5 A;  2DZM A;  3AI5 A;  2IO3 B;  3APC A;  3CST A;  2IY0 B;  5J2R A;  2DEN B;  1RAX A;  2KO3 A;  3WIM A;  2N9E B;  2OJR A;  4GSW A;  3NHE B;  4MEM A;  1WE6 A;  1WX9 A;  3APF A;  5BO4 B;  1E8Z A;  2MBH A;  3PPA A;  1M94 A;  1Q5W B;  2RR9 A;  4FHJ A;  3ZNI D;  3HM6 X;  4G3X B;  3V6E B;  1WM3 A;  3DVG Y;  3WAL A;  2EMT A;  4GB9 A;  2IO0 B;  2GBM A;  5JHA A;  5G55 A;  1SE9 A;  1WMH A;  3WAM A;  4MGI E;  1JRU A;  4B95 A;  3L17 A;  3VVW B;  3A1Q B;  2KFK B;  5DCN A;  3M3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...