3M95A

Crystal structure of autophagy-related protein atg8 from the silkworm bombyx mori
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of autophagy-related protein Atg8 from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
molecule keywords Autophagy related protein Atg8
total genus 34
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m95A00
3DVGY 4ZRKA 5D94A 2G45B 4ZYNA 3W1YA 4URKA 3H6NA 4GDKB 1L7YA 1VCBA 2JRIB 2KVRA 1T0YA 1V5TA 3ZTDA 2W9NA 3MHSD 1J0GA 5CHFA 4EFOA 1L2NA 1E8WA 2LGYA 1GC6A 2DZKA 2L3ZA 2MBBB 2O6VD 4HJKA 4MSQB 2L05A 2N1VA 4JIOU 1V49A 1NBFC 2MBQA 3QARA 4FHJA 5IA7A 3HM3A 2KWVB 4HK2A 3KH0A 4IUMB 4XX5A 3VQIA 3VHTC 4AOFA 1WZ0A 4DHZE 1M94A 4RMAA 1KM7A 4HDOA 3ZNHB 3OJ3A 3TIXA 4KSLC 4PS8A 1SE9A 3VVWB 3ZTCA 4EZLA 2KDEB 3OJ4B 4GSWA 3TBLD 4PS7A 1NDDA 1Q0WB 3ZNID 4M8MA 1WH3A 4TUUA 2ZCBA 2CHWA 2RD0A 5D6JB 4PYZA 2UYZB 2KD0A 4W9EA 2PE6B 4WWOA 3H1UA 5FR6A 3X23A 4TQ0A 1WGDA 4EZJA 2KKCA 2BKFA 2KTRA 3R7RA 1E90A 4WWNA 1E8YA 1WMHB 2BGFA 1V6EA 1Z2MA 2NCNA 2KTRB 2MA9B 4HXDA 5J18A 3PREA 1GUAB 3K9PB 1UGMA 1EUVB 1ZW7A 2L0TA 4BOSC 5JZEB 2EMSA 4OVVA 2V4LA 3QA8A 4HCNB 5LXHA 1IPGA 1WX9A 2C7MB 2HTHA 2KMCA 3Q3JA 1YD8U 1Z5SB 2BF8B 3NZUA 2NBUA 3DVGX 4BBNC 3H7SA 4B95A 3ECIA 5E6NA 2N4FA 3LDZE 2Z0DB 3A9KA 3A4RA 2LGDA 4BOZB 1H4RA 2C7HA 2WYQA 3VFKA 2WX0A 3QC8B 5D2MB 2LWPA 3DVNV 2CS4A 4DHZB 1LQBA 1UELA 3IFWB 3EECA 3N3KB 1RAXA 2GOWA 3APFA 2Z0EB 2KHWB 3JYUA 3N32A 4WJQA 2JUOA 4DHJB 2JZ3B 3DBRI 1LXDA 3L16A 4GDLB 1XQQA 3BY4B 4BKSA 2IO1B 3PRPB 3VUYA 5KHQA 4ICVA 2GBJA 4MJSA 3V62A 3SDLC 4FJVB 2KOXA 2DZMA 3W1SA 1Y8RC 4K7UA 2ZEQA 4NAWB 2G4SA 4IC7B 4IM0A 2Y5BB 3Q3FA 2KJ6A 4I6PA 1WM3A 4LJPB 3WA0A 3VTWA 4TV3A 3VDZA 2AWTA 1MG8A 3AU5A 2L7RA 3JVZX 3HK0A 3M63B 4EZKA 4AJWA 2ZZPB 1YQBA 4DWFA 3VUXA 3D32A 3NOBA 1WY8A 3IVFA 4GMVA 2KN5A 1WGHA 1WIAA 2EKEC 1I35A 2XK5B 2K6QA 2AEHA 3QIJA 2BYFA 3C0RB 3DCGA 1WX7A 3APDA 4XZ4A 4GIVA 4A3PA 3PHWB 2HJ8A 2JWZA 1KOTA 3MTNB 2MP2A 5EDSA 1YJ1A 2BWFA 2V1YA 5AZFA 2MP2B 4KIKB 3LJ3A 4DBGA 2FCNA 1UBIA 2L8JA 4K7SA 2JF5A 1WYWB 2JPHA 3B1LX 4PYUA 1WGYA 2YVCA 2N9EB 2IBIB 3KYDD 2LI5A 3O65B 1P1AA 4XC2A 4EKUA 1WJ4A 2N1WA 1WXMA 3M3JA 5LXIB 1H8CA 2K6DB 4IWOA 4FBJB 5E6PA 3A9KB 3NY5A 3PLVA 4AP4C 3ML8A 2KX0A 2FIDA 4G0NB 4BKGA 2JT4B 2LGXA 4MGIE 4GXBA 3DBHI 4WJOA 2KQSA 4PS3A 3T8MA 2MW5A 1WJNA 2ZCCA 1R4NI 3WAPA 4NJ7A 3L54A 1Q1OA 2DZIA 1EO6A 2KLCA 2K8CA 2GBNA 2ZNVB 4ANXA 2ZPYA 2MWSB 3PSEB 2KJRA 3JSVA 1WI0A 2L00B 4W9IA 1WGGA 2ZVNA 2UWQA 4LDTB 4GDKA 1E8XA 4MJSB 3ZNZB 5JHAA 1KLVA 4HLEA 1ZGUB 4JL9A 3CSFA 3JSVB 4KSKC 3RD2A 2O2VA 4W9CA 2IO2B 2CR5A 4KV2A 3L0WB 4HCPB 2A5UA 3ZLZA 2C5LC 4HPMB 3QJZA 5AZGA 3UINB 2FNJB 1S3SG 2KMAA 2NPTA 3L17A 2KFKB 3VTVA 1WMHA 5LLIA 2KLGA 2D3GA 4MH0E 3PRMB 3B08A 4N9F4 4W9DA 2R2OA 5JH5C 1QZEA 4MELA 2MLBA 3HM6X 4KIKA 4NAWA 2YLMA 3V6EB 4NPNA 2JRHA 3EFUA 3PHXB 4B9KA 1OTRB 2DX5B 1RFAA 1WRDB 2XEWA 2IY1B 2NBWB 3IHPC 1J8CA 1TGZB 2KTFA 1WF9A 2BYVE 2ZNVC 1KJTA 3HIZA 4NY0A 2K39A 3P2BA 4KZCA 2PPHA 4ZRJA 4E74A 2XK5A 2N9PC 2KC1A 5GMVA 3RUIB 4DDID 4MEMA 4K81A 2JY6A 2CHZA 4W9KA 4FA6A 1V2YA 4ZDVA 3ZUNA 3UQBA 5DCNA 2MRPA 4W9FA 2MCNB 2M0XA 2AYOB 4MGYE 1OGWA 3KVFB 4KVGB 4B6WA 4EEWA 2OOBB 1OEYJ 3PGEA 1J19A 2PJHA 3DOWA 4FJYA 1F9JA 3M62B 4ANVA 2G3QB 2KANA 2L76A 1WFYA 1RLFA 2J0MA 2ZVOA 4X57B 1GG3A 3S2AA 2M8SA 1EF1A 1V80A 3H7PA 2LVOA 3SD5A 2O2VB 4IWQA 2KFJA 3ONSA 3RCZA 3ZKJC 4OVUA 3QQ8B 5DPWA 2IZVB 4NQLB 5CX3A 2DHZA 4AUQC 1YIWA 5BO4B 2KWCA 3ALBA 1S1QB 2M1MA 2KK8A 2KFKA 3ZRFA 2BYEA 2J0JA 2JZZA 4K7WA 1WM2A 4LJOB 1WR1A 4BVUC 3QK0A 2LVPA 1WXSA 2R2QA 1C1YB 2KNBA 1EF5A 3NS8A 2CHXA 4NJ6A 2D11A 3KUZA 4HDQA 3SHQA 3DPDA 4GOCA 3UIOB 1G6JA 1GC7A 2N9XA 1XD3B 2VRRB 2RPQA 2DYOA 3DBSA 4DHJD 2GBRA 1A5RA 4JLCA 2WDTB 1WX8A 3WALA 3PV1A 4WJNA 1TBEA 4ZRIA 2B3AA 2DYMA 3R66C 4JQWC 3HHMA 3GOEA 4HVBA 1YX5B 3TCAA 1BT0A 3APCA 3TMPB 4BBNF 2GMIC 3AU4A 3V61A 1C3TA 3ZW3A 3DDCB 1LFDA 3X0WA 1GJZA 2LZ6A 2N7DA 2MQJA 4AJYB 2JXXA 3K9OB 4GGQA 2KDIA 2LXAA 2BPSA 4LDTD 2C9WB 4CO7A 3UQAA 4II3B 2FCQA 5DPSA 2LJ5A 2RGFA 5AZHA 3PLUA 3PT2B 1P0RA 3KUCB 3R3MA 2CKHB 4EOYA 3NHEB 2Z59B 1FXTB 1WJ6A 4II2B 4TKNA 3U8ZA 4M0WB 4DXAB 2IO3B 4MM3A 1RRBA 3VUWA 3CMMB 3DBLI 3IG3A 1ISNA 1Q5WB 1LM8B 2FCSA 4IW0A 3VH4B 4BKTA 5E6OA 3ZRCA 1D3ZA 4W9LA 2GBKA 3QWZB 3EC8A 5J2RA 3L08A 2IY0B 4HPLB 2KQ7A 3UF8A 3ZNGC 2IYDB 3PZDA 2LASA 4F8CB 1CMXB 5CHWA 1E7UA 4I6LB 3JW0X 3M95A 3H7PB 4KDLB 3AXCA 1WE7A 3WANA 3ML9A 4GN1A 5L95C 3QAQA 1WR6E 1XT9B 4G11A 2NR2A 3VTUA 4DK5A 3DVNU 1IP9A 4E3CA 5DPRA 3GZNI 2GBMA 2KWUB 4M8NA 5D7GA 4FADA 3UIPB 3KW5B 3RZWC 4F7ZA 2C7NB 5JHBA 2I1JA 3L13A 3V6CB 3TJPA 1AARA 4NQKE 1P3QU 2LRUA 4W9GA 2L0FA 1JRUA 1VD2A 2DZJA 3QHTA 4MSMB 2PEAA 5CTRC 5CHVC 5J17A 4AWJA 2NPTB 1WXVA 3PPAA 1K8RB 3A33B 2A4ZA 2DYBA 5AEKB 3VAWA 4HWIB 4WQOB 4A20A 3OLMD 1P9DU 3NZSA 3RT3B 1E8ZA 2MBHA 5C23A 5DPTA 4MDKE 5IAAC 2KO3A 2KDFB 1UH6A 2JVCA 3PTFC 3QX1A 4NNJB 2IO0B 4WAAA 1I42A 3N30A 4WJPA 2HE7A 2FCMA 4WWPA 3PRZA 4FHKA 4ASWC 4EUTA 3U7DA 4BKSD 2RSUA 3RYTA 2D10A 1TZ1A 2QHOA 2KXJA 1U4AA 2FIFA 4IG7B 1WE6A 4DDGD 1WZ3A 1E7VA 2HD5B 4KZ0A 3WIMA 2G4DB 2AL3A 3IBEA 4W9HA 3OAWA 3VXWA 4BFRA 1GNUA 2LRWA 2C60A 3A9JB 1UBQA 2NVUI 5KHOA 3H9DA 2MX2A 3RULA 2WX1A 2NBVB 2KZRA 2MBOA 1V81A 2WWZA 3A9JA 3R7QA 1V5OA 2EMTA 1R4MI 4GDLA 4I6NB 3A1QA 2ASQA 4FN2A 5C1ZA 3KYCD 2J7QB 3DQVA 3I3TB 4JGHB 4GB9A 1V86A 2D07B 4RM8A 4ICUA 4CHKA 5HKHA 3PS6A 4GU2A 3A1QB 4G3XB 4FULA 4K1RB 2ZJDA 2PE9A 1E5WA 2I1KA 3L10B 3PVLA 4TQ1A 1V9JA 3ZIMA 4E71A 4IWPA 4MGKE 3BINA 3QCAA 1WGRA 2K25A 3AULA 1P98A 3AI5A 3ZDTA 2FAZA 4A3OA 2LD9A 4ANUA 2XBBC 2BWES 2ZPNA 4W9JA 2K8HA 3MJWA 3ZVVA 1OEYA 2LXCA 1SIFA 3CSTA 4LCDE 3ZO5B 2LVQA 3V60A 1NI2A 2K1FA 4IM2A 3UGBB 3W1SC 2K8BA 2KC2A 2OJRA 1UD7A 2AL6A 2CU1A 2KX3A 1SGHA 4G50A 5G2NA 1TTNA 2FUHB 4P7IA 1WJUA 1OQYA 2KJHB 3B0AA 4IM3A 3A4SC 3SU8X 2MSED 4FLHA 4KDIC 2KDBA 3CF6E 4ANWA 3T9LA 4F1SA 1IYFA 2NS5A 1ZKHA 4YL8A 3RZFA 5L83A 2DAJA 2D2QA 1PQSA 2RR9A 4FJZA 1WXAA 3WAOA 4CYEA 1HE8A 3VH3B 2DENB 4RM9A 1YX6B 1X1MA 2M4NA 1UZXB 2MBEA 2O6VB 4J6IA 2N7EA 5TR5A 3ZDMC 2LUEA 2J0KA 2BKRB 3TL5A 3U30A 2M17A 2O6VA 2V3SA 2REXA 3ENEA 3EHVA 3KUDB 2DAFA 3WAMA 4MGZE 5G55A
chains in the Genus database with same CATH superfamily
4ZRKA 4URKA 4GDKB 2KVRA 3N20C 1V5TA 2KVZA 2WXJA 1DGJA 3ZJVA 1E8WA 1XLQA 2O6VD 4HJKA 4R3DA 2L05A 5HG2A 1V49A 3VR8B 3HM3A 3Q8FA 4IUMB 3KLSX 4XX5A 4RMAA 2MJDA 3VVWB 4PS8A 1BMLC 2KDEB 4GSWA 4DXGA 1NDDA 3DHHC 4XYCA 2MHJA 5D6JB 4PYZA 2PE6B 2LEKA 3H1UA 4LNNA 2Y5CA 1L6UA 1TKYA 2JYEA 4EZJA 2PVGC 5IOIA 1E8YA 1V6EA 1Z2MA 2NCNA 4HXDA 3AEEB 2L0TA 1D5MC 1WX9A 4N6EB 3EGRA 1YD8U 1EM7A 3MJ5A 1T0RC 1SXTA 1L0VB 3A4RA 2LGDA 3VFKA 3AEAB 5D2MB 3DVNV 3APFA 2ACZB 3JYUA 4WJQA 3J9CA 4RH6A 4BKSA 3IAM1 4ZRQA 3LXFA 3VUYA 5KHQA 1I7HA 5FKAC 4IM0A 2KJ6A 4LJPB 3AU5A 2PKOA 4EZKA 2I2YA 2ZW0A 1T0SC 4DWFA 3P1MA 4JPSA 3MC0B 2V0GA 2XK5B 2BYFA 3I63C 1WX7A 1PGXA 4XZ4A 2JWZA 1KOTA 3MTNB 2K22A 4YXDB 1JW9D 3LJ3A 3Q3MC 1SJED 1WYWB 1WGYA 2YVCA 4IWOA 4KGTA 5E6PA 1XCTL 2BB5A 2JT4B 2LGXA 4KKJA 1MHHE 1WGKA 4PS3A 2MW5A 1R4NI 1Q1OA 2MJEA 3OG5A 2YEPB 2MWSB 2BQQA 1N5XA 3Q8EA 4XGAB 4C00A 4LDTB 4GDKA 2Y3AA 4A55A 3CSFA 2X8XX 2BYTA 1SEBD 3QJZA 3UINB 1TS3A 1WMHA 4W9DA 3B9JA 1E9MA 2MLBA 3HM6X 4KGSA 3BVZA 4NAWA 4NPNA 3BK2A 4B9KA 1OTRB 1K53A 2KTFA 2D3CA 1YJIA 2ZNVC 1KJTA 1TT5B 1FRRA 2K39A 4KZCA 2PPHA 4E74A 2XK5A 1FEHA 4DDID 4M02A 2KWDA 3R2IA 3P4SB 3Q3NC 1VZ8A 3UQBA 2VH2A 2MCNB 2AYOB 2WDVB 3BVGA 4KVGB 3Q6BA 4EEWA 4N58A 2N9KA 2J0MA 1HEZE 3SEBA 3S2AA 1HTOA 4MT5A 2ZW1A 3ZKJC 5DPWA 2E3TA 4AUQC 1YIWA 2W3RA 2KFKA 1CQVA 3E56A 3FKYA 2J0JA 4K7WA 2QDFA 4D2KA 3NUHB 3DHGC 1EF5A 3GZNB 3N1YC 2V4IB 4GOCA 3UIOB 2IJ0A 1F2RC 2N9XA 2VRRB 2GBRA 1A5RA 2RDHA 3HHMA 4AS1A 1YX5B 3TCAA 1FXAA 3GS2A 4BBNF 1C76A 1C3TA 2CU3A 2LHEA 1DYQA 1LFDA 1GJZA 1XLPA 4WAFA 2MQJA 5G5HA 3VRBB 2KDIA 2IGGA 3RMKC 2C9WB 3AV8A 2AX5A 2FCQA 2RGFA 5AZHA 3PLUA 1P0RA 3R3MA 2CKHB 4EOYA 1MG4A 2Z59B 1FXTB 4II2B 3VUWA 3IG3A 1Q5WB 2FCSA 1LM8B 4BKTA 3HRDD 3VH4B 1D3ZA 5H8YE 3QWZB 3ZNGC 1E7UA 1YNTE 4I6LB 4JX1C 2DNFA 4GN1A 3QAQA 3VTUA 5C3JB 1IP9A 1V1PA 3GZNI 4M8NA 1PDXA 1VDVA 3L13A 3E9SA 1AARA 1VD2A 1SSNA 1K8RB 2K5PA 5AUIA 3A33B 3AE6B 2A4ZA 2KQ4X 4PK1A 5AEKB 2MBHA 1UH6A 2IO0B 1F77A 2INCC 3N30A 4L2YA 4WWPA 3U7DA 3N9YC 1TZ1A 2KXJA 1U4AA 4IOIE 4DDGD 1E7VA 1RYJA 2HD5B 2G4DB 1K52A 1NENB 1L4DB 1TJEA 1UBQA 3AB5A 2MX2A 3ABVB 2N7JA 4I6NB 2ASQA 3IT6B 2JWUA 4GB9A 1N6ZA 3PS6A 4FULA 1Q10A 2ZJDA 2PE9A 2I1KA 4OZAA 1TY2A 1NVID 1V9JA 4E71A 3VR9B 2IGHA 2N9LA 3Q8CA 4IWPA 4MGKE 1VJKA 1JROA 3CIRB 4US9A 3RNFC 1IGDA 1WGRA 3AI5A 2FAZA 2BWES 2K8HA 3MJWA 1SIFA 2INNE 1YQ3B 3KWVA 3U2SC 3AE7B 1UD7A 1SGHA 4G50A 5I4DA 3B0AA 5C2TB 2Y5PA 4FLHA 2OHFA 4LNOA 2KDBA 1YQ4B 3CF6E 2KAJA 3T9LA 5L83A 3H8HA 3RZFA 1HTQA 2LJIA 4FJZA 1WXAA 3WAOA 1KF6B 3VH3B 2FUG1 2M56B 2JX5A 4A6QA 2N7EA 1ZXHA 1MHXA 1QOGA 2DAFA 5G5GA 1CJEA 5JXVA 2VZKD 3DVGY 4OVZA 2G45B 5D94A 4ZYNA 4US8A 3GB1A 2W9NA 1JRPA 3C19A 4YWGG 1WYGA 1L2NA 2L3ZA 3V05A 1NBFC 1FNVA 2MBQA 5IA7A 2KWVB 4HK2A 3NVVA 3VQIA 3DHIC 3P63A 4HDOA 1JWAD 3TIXA 1SE9A 1HZ5A 4WIPA 3TBLD 4PS7A 1OFFA 3ZNID 3BZDB 2CHWA 3MFGA 2KD0A 4W9EA 4WWOA 5FR6A 3X23A 1C4PA 2KTRA 2RDGA 4WWNA 1MJDA 2KTRB 2MA9B 2JZPA 3PREA 5JZEB 2EMSA 4OVVA 5LXHA 2HTHA 3Q3JA 2NMQA 4BBNC 3AEBB 1JCKB 2PTLA 5E6NA 5EE3A 1FXIA 4BOZB 3VRAB 1FPYA 1L5PA 4M00A 2DWQA 2GOWA 3N32A 2KHWB 1GAQB 1SE3A 1LXDA 2KN4A 3L16A 5EE1A 2LGSA 1PGAA 3BYYB 4BAXA 4ICVA 4C4VB 4PT5A 3SDLC 3PZ7A 2KOXA 1D6EC 4NAWB 1Y8RC 4MH8A 2G4SA 3WA0A 3RNBC 3VDZA 1TS2A 3AE5B 3B2GA 1JWUD 3HK0A 3M63B 1BXTA 3D32A 1WY8A 3IVFA 1WGHA 2EKEC 5IO9A 3V3XA 1I35A 2AEHA 3C0RB 2JQRB 1NYRA 3PHWB 3ZYYX 4HPPA 1HQRD 1XLOA 3Q14C 2BWFA 2RDBC 2D3AA 2LFIA 1UBIA 4K3CA 1TY0A 4MM3B 2JPHA 4JE3B 2N9EB 3NRZA 2VZKB 2GRIA 1P1AA 1WXMA 1H8CA 5LXIB 2K6DB 4FBJB 2ON8A 3PLVA 4AP4C 3DWGC 3ML8A 2FIDA 4G0NB 4BKGA 1AN8A 3DBHI 4WJOA 2D5GA 1E10A 3WAPA 4NJ7A 1J7AA 1EO6A 2KLCA 2K8CA 2GBNA 3B2FA 2ZPYA 4AQ7A 4ZHOA 2ZVNA 2UWQA 2QMTA 3U52E 4JL9A 4KSKC 1FM0D 2O2VA 2IO2B 1A70A 2CR5A 4KV2A 4HCPB 5H92C 1AYFA 3TEWA 5AZGA 2GB1A 3L17A 5LLIA 4MH0E 4N9F4 3B08A 5JH5C 1QZEA 4MELA 4KIKA 2YLMA 3AE9B 1ZOYB 3EFUA 4ZHPA 1RFAA 2XEWA 2G9HD 1J8CA 1WF9A 2BYVE 2DBYA 3UI3A 2KC1A 3MP9A 4MEMA 4K81A 2JY6A 2PMVA 4LNFA 4FA6A 3ZUNA 5DCNA 2MRPA 3DBHB 4W9FA 2M0XA 4MGYE 3P4RB 4B6WA 1OEYJ 2JU6X 2PJHA 4ANVA 2FE8A 4XWTA 2PVOD 4USAA 2OJWA 3NS1A 1GG3A 2LVOA 4IWQA 2KFJA 3ONSA 3RCZA 4OVUA 2BS2B 1QQRA 2BYEA 1QT9A 4BVUC 1WXSA 2WGSA 3NS8A 2CHXA 1F1HA 3EA6A 5HI1A 3SHQA 3BK1A 3TEZA 2HTME 2RPQA 2DYOA 3DBSA 1QOAA 1TBEA 4TMAB 2KACA 3RFZB 3AN1A 3R66C 3GOEA 4HVBA 4FXCA 3AU4A 4JWSC 2WXNA 2N7DA 3K9OB 2BPSA 1HZ6A 1KLUD 5DPSA 5TSSA 2CJNA 4K3BA 1WJ6A 3U8ZA 4MM3A 2H88B 4CQNA 1RRBA 3CMMB 1WRIA 1EWYC 5E6OA 3ZRCA 3EC8A 2KQ7A 1CZPA 3HUIA 3PZDA 2LASA 3R8BA 1CMXB 4JWUC 5CHWA 3JW0X 1M4VA 1JMLA 3OWEB 1WR6E 3DVNU 5BYRA 4LNKA 3GP7A 1DOIA 3UIPB 3KW5B 4FADA 3RZWC 1IUEA 1R4NB 2C7NB 1I4QA 5JHBA 3V6CB 4W9GA 1P3QU 5AUKA 2J4XA 2HJ1A 1QILA 3ZJTA 2DYBA 4HWIB 4A20A 4WURA 1FCLA 3BWUD 2QEJC 5C23A 1KTKA 2KDFB 3PTFC 4ZOHC 1EU3A 3CWIA 2FCMA 3T3NA 3PRZA 3TSSA 2XNAC 3RYTA 2D10A 2WS3B 2QHOA 3NZ3A 1UNSA 4H2AA 4KZ0A 2AL3A 2L52A 1SE4A 2LRWA 2WX1A 2NBVB 4RGNA 2MBOA 3R7QA 2EMTA 2IPKD 1ZXIA 4GDLA 3IAS1 2PIAA 3AE1B 5FR3A 3DQVA 4YSXB 4JGHB 2WXPA 1YMHE 1V86A 3KWLA 4P1CC 4ICUA 4CHKA 3A1QB 1XEEA 1TZOA 3ZIMA 2WXOA 3BINA 1VZ6A 2K25A 4TSSA 3DWMA 4ANUA 4LNIA 2RPVA 4S0RA 3TUOA 1WXQA 3ZO5B 1LO5D 1UGJA 2K1FA 1FFUA 3W1SC 2KC2A 2FBWB 2E6XA 3U7ZA 1TTNA 2PW9A 4EE2A 1I4RA 3SU8X 2EELA 3Q3OC 5FK9C 1IYFA 1ZKHA 4YL8A 4HJGE 1PQSA 4IDIA 2DENB 1JQ4A 1T0QC 5TR5A 2J0KA 2BKRB 3TL5A 3KUDB 2M17A 2V3SA 2REXA 3ENEA 3EHVA 1I4XA 4UDUC 4S17A 3W1YA 2WXIA 3NG0A 3ZTDA 1T0YA 4IKGA 1J0GA 2J42A 5CHFA 4EFOA 4C7YA 2WXQA 2DZKA 4MSQB 1XF5L 2MH7A 4JIOU 3QARA 4ACFA 1JALA 4FHJA 1ROEA 1B9RA 1WZ0A 4DHZE 1M94A 1KM7A 3ZJUA 1TS4A 1YN3A 3OJ4B 4P6VF 1Q0WB 1L6VA 3W9CB 2INPE 2JXTA 2L1AA 2WNMA 1FNWA 1WWTA 2KKCA 3R7RA 1ET6A 1WMHB 2BGFA 1MI0A 1FMAD 1GUAB 1UGMA 4BOSC 1XO3A 2V4LA 3QA8A 5BMGA 2KMCA 2BF8B 1Z5SB 3NZUA 2BT6A 3DVGX 4P16A 3ECIA 1RWSA 2IGDA 2N4FA 3A9KA 1H4RA 2WYQA 2WX0A 1KFYB 3QC8B 1PUTA 2LWPA 3TEXA 1E6EB 4DHZB 2KMMA 3N3KB 3ZXVA 2Z0EB 2JUOA 1FFVA 4DHJB 2J53A 5BMHA 1NYQA 4MJSA 1GB1A 1B1ZA 4K7UA 4IC7B 4XDCA 1E0ZA 2Y5BB 1WM3A 4TV3A 2AWTA 2V9HA 3JVZX 4AJWA 2ZZPB 1YQBA 3VUXA 3NOBA 4GMVA 2L83A 1ZUD2 1WIAA 3HVZA 2K6QA 3FAHA 3APDA 2Q5WD 4GIVA 4RGOS 4L23A 2NTSA 5EDSA 1YJ1A 2V1YA 4DBGA 2FCNA 2L8JA 4KKIA 2JF5A 2IBIB 1WJ4A 3M3JA 1K51A 3W5UB 4Q2JA 4MGIE 2H89B 2M0AA 1WJNA 2ZCCA 3L54A 1L0XB 4ANXA 3T3OA 2KJRA 4W9IA 1WI0A 2BVCA 2L00B 2WP9B 4B0EA 2INDC 1KLVA 1E8XA 5JHAA 4HLEA 3JSVB 1V1OA 3ZLZA 1V97A 2C5LC 3LYYA 2FNJB 2NPTA 2KFKB 3VTVA 2OEDA 3SFEB 1TIFA 2R2OA 1EWCA 2SEBD 2VH1A 3V6EB 3PHXB 3W5VB 1FD6A 2NBWB 4C80A 1TGZB 2Z8LA 3P2BA 2N9PC 5GMVA 2BS3B 3RUIB 3N1XC 4A90A 3EFCA 3PO0A 1R4MB 1P7EA 1V2YA 4ZDVA 1JWBD 1OGWA 2WDRB 1TKGA 1J19A 2WHIA 4FJYA 2WXMA 2KANA 1D5XC 2ZVOA 4X57B 1EF1A 1V80A 3H7PA 1KLGD 5MPOA 2O2VB 2IZVB 2KWCA 1S1QB 3HVDA 2KK8A 4RFBA 1C78A 1WR1A 2LGIA 4ARCA 2N0SB 4C4VA 2D11A 3KUZA 4HDQA 3DPDA 1G6JA 1XD3B 4A9AA 1UWMA 2MJ3A 3Q8BA 2YEPF 4RF0A 2HDEA 2WDTB 1D5ZC 1WX8A 3U4EG 3TEYA 2B3AA 2DYMA 3KQ4A 3AECB 3TMPB 2GMIC 3ZW3A 1F2RI 1ENFA 4N59A 4AJYB 4GGQA 1QF6A 4LDTD 1OQRA 4CO7A 5EE0A 4YT0B 2WXGA 4XE0A 3AH7A 2LJ5A 1K50A 3NHEB 4ARIA 1STEA 2IO3B 4LK0M 1HA5A 3DBLI 4NZLB 4IW0A 4W9LA 2CJOA 4HPLB 2IY0B 3UF8A 2IYDB 4F8CB 1WE7A 3ML9A 5L95C 1QOFA 4HKQA 1XT9B 4G11A 4E3CA 1UF0A 4L1BA 1GPXA 2W55A 4HEA1 4RF1A 2I1JA 3AE2B 3NVWA 4NQKE 2LRUA 2ICIA 4MSMB 2PEAA 5CTRC 5J17A 4AWJA 2NPTB 1UWXA 3PZ8A 1WXVA 1QOBA 2G1EA 2JYTA 1Y56A 3VAWA 4WQOB 1F0ZA 1P9DU 1SJHD 3Q2AC 1HXYD 3NZSA 1E8ZA 5DPTA 4MDKE 2KO3A 2JVCA 4NNJB 1DOYA 4WAAA 1I42A 4WJPA 1FRDA 4ASWC 4EUTA 1C4AA 4BKSD 5EE9A 3W2DA 2FIFA 1WE6A 2QJLA 1YJJA 1WZ3A 3DBLB 1RFKA 4KGRA 4XWWA 1QLBB 3VXWA 2BW2A 3GE3C 1GNUA 4HKZE 4WWMA 2KYWA 3AEGB 2C60A 5KHOA 2NVUI 2WU2B 1I4GA 1V81A 4ZYSA 1AWDA 1ZP0B 2WWZA 1SF0A 1V8CA 1VRAB 1V5OA 1FO4A 3A1QA 3KYCD 4LTUA 2KDMA 4A8XC 4RM8A 5E6JA 3ZGZA 3L10B 3MHZA 4B0MA 4GLSC 5BYSA 1J7BA 3QCAA 1NI3A 3AULA 1YN4A 2WXFA 3BIID 3ZDTA 4A3OA 2XBBC 2ZPNA 4W9JA 2W54A 1OEYA 2LXCA 3CSTA 1LGRA 1OQQA 2QSDA 2D3BA 2K8BA 2W3SA 2AL6A 2CU1A 3IXSA 4OHJA 5G2NA 1JWMD 2BB6A 4P7IA 1WJUA 1OQYA 2SAKA 3A4SC 1R7SA 1ZDVA 2MSED 4KDIC 2NS5A 1F52A 2DAJA 2D2QA 2RR9A 1PFDA 4CYEA 2WXHA 1HE8A 2J52A 4YTMB 4RM9A 3ZQ4A 2M4NA 2MBEA 4J6IA 2LUEA 5HHDG 1VLBA 2O6VA 2BBCA 4MGZE 5G55A 3H6NA 1L7YA 1VCBA 2JRIB 3ETRA 3MHSD 1VZ7A 3Q8AA 2LGYA 1GC6A 1ET9A 2MBBB 2WQYB 2N1VA 5IKCM 3KH0A 3SFDB 3VHTC 4AOFA 5LNK1 3ZNHB 3OJ3A 4KSLC 3ZTCA 5IP4D 4EZLA 3BYTB 4M8MA 1GOZA 1WH3A 4TUUA 2ZCBA 2RD0A 2V3NA 2UYZB 3AE3B 5T8IA 2K3UA 4TQ0A 1WGDA 2BKFA 1E90A 5IN7A 1D4BA 4XDDA 5J18A 3K9PB 1EUVB 1ZW7A 1GB4A 4HCNB 4YSZB 1IPGA 2C7MB 2NBUA 3H7SA 4B95A 3LDZE 2Z0DB 3L4PA 1L4ZB 2C7HA 2EKIA 1QKZA 5HFYA 3RNCC 2CS4A 1LQBA 1UELA 3IFWB 3EECA 1RAXA 2TSSA 1SBBB 1N62A 2JZ3B 3DBRI 3I9V1 4GDLB 1XQQA 3BY4B 2IO1B 3PRPB 2GBJA 3V62A 4FJVB 2DZMA 1SIJA 3W1SA 2ZEQA 3Q3FA 4QAYA 4I6PA 3VTWA 2L32A 1IBXA 1MG8A 1N5WA 2L7RA 3MC9A 4DXFA 1KRHA 1I4PA 2KN5A 3NJTA 1ZPSA 4HROA 2ONQA 3QIJA 3AEFB 3DCGA 2BS4B 4A3PA 2HJ8A 2MP2A 2UU7A 4ITKA 5AZFA 2MP2B 3MC8A 4KIKB 4K7SA 3B1LX 4PYUA 3KYDD 2LI5A 1FCCC 1MFWA 3O65B 1ZDXA 4XC2A 4YTNB 4EKUA 2N1WA 2WXKA 4P1BC 3A9KB 3FC4A 3DBRB 3NY5A 2LHDA 1JWSD 2KX0A 2WDQB 1V1PB 4GXBA 3RI7C 2KQSA 3T8MA 2R61A 4OW0A 4C56C 2LUMA 2DZIA 2ZNVB 3BVMA 4C7ZA 3RNGC 3PSEB 3JSVA 2DLBA 1WGGA 1WSPA 4MACA 3ZNZB 4MJSB 4REZA 1ZGUB 3RD2A 4W9CA 1ZE3D 3L0WB 1KH0A 2A5UA 4HPMB 1S3SG 2KMAA 2QIEB 2X38A 2KLGA 2D3GA 3PRMB 1L0YB 1EU4A 3C8YA 1C9FA 2JRHA 5BMIA 4NJCA 2DX5B 2QC8A 1WRDB 2IY1B 4DQOC 3IHPC 4KX6B 1MPEA 4NY0A 3HIZA 4ZRJA 1CK1A 1N63A 2LMCA 4WH4A 4HRSA 2I38A 3RN9C 4ZRPA 2CHZA 4W9KA 1AW7A 1ESFA 3AE4B 3KVFB 1YN5A 1FNUA 2BTEA 2OOBB 3I57A 3PGEA 3DOWA 3SR6A 3FILB 2V3PA 1DOXA 1F9JA 3M62B 3RPFC 2G3QB 2L76A 1WFYA 1RLFA 5D3IB 2M8SA 1P7FA 3AM9A 3SD5A 1XXGA 3QQ8B 1BUIC 2JSVX 4NQLB 5CX3A 4BZAA 2DHZA 5BO4B 3ALBA 2M1MA 3ZRFA 3RNAC 2JZZA 1WM2A 4LJOB 4RGMA 3QK0A 2LVPA 2R2QA 4YSYB 1C1YB 2KNBA 2WXLA 3P4QB 4NJ6A 1RM6C 1GC7A 3AMZA 2AQ3B 4DHJD 3R2TA 4WQMA 4JLCA 3AEDB 3WALA 3PV1A 4WJNA 4ZRIA 1C79A 4JQWC 1BT0A 3APCA 3V61A 1T3QA 3O13A 3DDCB 3X0WA 2LZ6A 2JXXA 2LXAA 2IDYA 3NVYA 3UQAA 4II3B 3PT2B 3KUCB 4J3OD 1C77A 1PYWD 4TKNA 4M0WB 4DXAB 1ISNA 4RGTA 3FILA 4M0WA 2GBKA 5J2RA 3L08A 1UUPA 3M95A 3H7PB 4KDLB 3AXCA 2MEKA 2B76B 3WANA 3EUB2 2NR2A 4DK5A 3ZXRA 5DPRA 2GBMA 2KWUB 2KT7A 5D7GA 4F7ZA 3TJPA 2L0FA 1JRUA 2DZJA 3QHTA 1NEKB 1I4HA 2QCZA 5CHVC 1YOVB 2GLSA 3PPAA 4OZCA 3OLMD 1TS5A 3RT3B 1SB3C 5IAAC 3RNEC 1PGBA 3QX1A 1ACCA 1J7CA 2HE7A 4FHKA 1FIQA 2RMMA 2RSUA 2AQ2B 4M01A 4IG7B 3WIMA 2GI9A 1SE2A 2K9XA 3IBEA 4W9HA 3OAWA 4BFRA 5GXGB 2PLPA 3P42A 3A9JB 3H9DA 3RULA 3P4PB 1VR9A 2KZRA 3A9JA 3Q69A 1R4MI 3IT4B 2WU5B 4FN2A 5C1ZA 2J7QB 1XCQL 1TKEA 2QILA 3I3TB 4YTPB 2D07B 1T5XD 2K0PA 5HKHA 5BYQA 4RCOA 4GU2A 4G3XB 4K1RB 4RNAA 1E5WA 5D3DA 3PVLA 4TQ1A 4OZBA 2WLBA 2AQ1B 1TYGB 1N61A 1P98A 2LD9A 3URYA 3ZVVA 3GE8C 4LCDE 1C4CA 4LLGM 2LVQA 2XN9C 3V60A 2WXRA 1NI2A 3NVZA 4IM2A 3UGBB 2OJRA 1MVKA 2KX3A 3I5JC 3LB8C 2W82A 1IGCA 2FUHB 1IBXB 2KJHB 4IM3A 2NTTA 3AE8B 4ANWA 3N1ZC 4F1SA 2M19A 1N60A 1YX6B 1X1MA 3WCQA 2O6VB 1UZXB 1E7PB 1XLNA 4NAMA 3ZDMC 4O1NA 3U30A 3WAMA 1T6BX
chains in the Genus database with same CATH topology
3DVGY 4ZRKA 5D94A 2G45B 4ZYNA 3W1YA 4URKA 3H6NA 4GDKB 1L7YA 1VCBA 2JRIB 2KVRA 1T0YA 1V5TA 3ZTDA 2W9NA 3MHSD 1J0GA 5CHFA 4EFOA 1L2NA 1E8WA 2LGYA 1GC6A 2DZKA 2L3ZA 2MBBB 2O6VD 4HJKA 4MSQB 2L05A 2N1VA 4JIOU 1V49A 1NBFC 2MBQA 3QARA 4FHJA 5IA7A 3HM3A 2KWVB 4HK2A 3KH0A 4IUMB 4XX5A 3VQIA 3VHTC 4AOFA 1WZ0A 4DHZE 1M94A 4RMAA 1KM7A 4HDOA 3ZNHB 3OJ3A 3TIXA 4KSLC 4PS8A 1SE9A 3VVWB 3ZTCA 4EZLA 2KDEB 3OJ4B 4GSWA 3TBLD 4PS7A 1NDDA 1Q0WB 3ZNID 4M8MA 1WH3A 4TUUA 2ZCBA 2CHWA 2RD0A 5D6JB 4PYZA 2UYZB 2KD0A 4W9EA 2PE6B 4WWOA 3H1UA 5FR6A 3X23A 4TQ0A 1WGDA 4EZJA 2KKCA 2BKFA 2KTRA 3R7RA 1E90A 4WWNA 1E8YA 1WMHB 2BGFA 1V6EA 1Z2MA 2NCNA 2KTRB 2MA9B 4HXDA 5J18A 3PREA 1GUAB 3K9PB 1UGMA 1EUVB 1ZW7A 2L0TA 4BOSC 5JZEB 2EMSA 4OVVA 2V4LA 3QA8A 4HCNB 5LXHA 1IPGA 1WX9A 2C7MB 2HTHA 2KMCA 3Q3JA 1YD8U 1Z5SB 2BF8B 3NZUA 2NBUA 3DVGX 4BBNC 3H7SA 4B95A 3ECIA 5E6NA 2N4FA 3LDZE 2Z0DB 3A9KA 3A4RA 2LGDA 4BOZB 1H4RA 2C7HA 2WYQA 3VFKA 2WX0A 3QC8B 5D2MB 2LWPA 3DVNV 2CS4A 4DHZB 1LQBA 1UELA 3IFWB 3EECA 3N3KB 1RAXA 2GOWA 3APFA 2Z0EB 2KHWB 3JYUA 3N32A 4WJQA 2JUOA 4DHJB 2JZ3B 3DBRI 1LXDA 3L16A 4GDLB 1XQQA 3BY4B 4BKSA 2IO1B 3PRPB 3VUYA 5KHQA 4ICVA 2GBJA 4MJSA 3V62A 3SDLC 4FJVB 2KOXA 2DZMA 3W1SA 1Y8RC 4K7UA 2ZEQA 4NAWB 2G4SA 4IC7B 4IM0A 2Y5BB 3Q3FA 2KJ6A 4I6PA 1WM3A 4LJPB 3WA0A 3VTWA 4TV3A 3VDZA 2AWTA 1MG8A 3AU5A 2L7RA 3JVZX 3HK0A 3M63B 4EZKA 4AJWA 2ZZPB 1YQBA 4DWFA 3VUXA 3D32A 3NOBA 1WY8A 3IVFA 4GMVA 2KN5A 1WGHA 1WIAA 2EKEC 1I35A 2XK5B 2K6QA 2AEHA 3QIJA 2BYFA 3C0RB 3DCGA 1WX7A 3APDA 4XZ4A 4GIVA 4A3PA 3PHWB 2HJ8A 2JWZA 1KOTA 3MTNB 2MP2A 5EDSA 1YJ1A 2BWFA 2V1YA 5AZFA 2MP2B 4KIKB 3LJ3A 4DBGA 2FCNA 1UBIA 2L8JA 4K7SA 2JF5A 1WYWB 2JPHA 3B1LX 4PYUA 1WGYA 2YVCA 2N9EB 2IBIB 3KYDD 2LI5A 3O65B 1P1AA 4XC2A 4EKUA 1WJ4A 2N1WA 1WXMA 3M3JA 5LXIB 1H8CA 2K6DB 4IWOA 4FBJB 5E6PA 3A9KB 3NY5A 3PLVA 4AP4C 3ML8A 2KX0A 2FIDA 4G0NB 4BKGA 2JT4B 2LGXA 4MGIE 4GXBA 3DBHI 4WJOA 2KQSA 4PS3A 3T8MA 2MW5A 1WJNA 2ZCCA 1R4NI 3WAPA 4NJ7A 3L54A 1Q1OA 2DZIA 1EO6A 2KLCA 2K8CA 2GBNA 2ZNVB 4ANXA 2ZPYA 2MWSB 3PSEB 2KJRA 3JSVA 1WI0A 2L00B 4W9IA 1WGGA 2ZVNA 2UWQA 4LDTB 4GDKA 1E8XA 4MJSB 3ZNZB 5JHAA 1KLVA 4HLEA 1ZGUB 4JL9A 3CSFA 3JSVB 4KSKC 3RD2A 2O2VA 4W9CA 2IO2B 2CR5A 4KV2A 3L0WB 4HCPB 2A5UA 3ZLZA 2C5LC 4HPMB 3QJZA 5AZGA 3UINB 2FNJB 1S3SG 2KMAA 2NPTA 3L17A 2KFKB 3VTVA 1WMHA 5LLIA 2KLGA 2D3GA 4MH0E 3PRMB 3B08A 4N9F4 4W9DA 2R2OA 5JH5C 1QZEA 4MELA 2MLBA 3HM6X 4KIKA 4NAWA 2YLMA 3V6EB 4NPNA 2JRHA 3EFUA 3PHXB 4B9KA 1OTRB 2DX5B 1RFAA 1WRDB 2XEWA 2IY1B 2NBWB 3IHPC 1J8CA 1TGZB 2KTFA 1WF9A 2BYVE 2ZNVC 1KJTA 3HIZA 4NY0A 2K39A 3P2BA 4KZCA 2PPHA 4ZRJA 4E74A 2XK5A 2N9PC 2KC1A 5GMVA 3RUIB 4DDID 4MEMA 4K81A 2JY6A 2CHZA 4W9KA 4FA6A 1V2YA 4ZDVA 3ZUNA 3UQBA 5DCNA 2MRPA 4W9FA 2MCNB 2M0XA 2AYOB 4MGYE 1OGWA 3KVFB 4KVGB 4B6WA 4EEWA 2OOBB 1OEYJ 3PGEA 1J19A 2PJHA 3DOWA 4FJYA 1F9JA 3M62B 4ANVA 2G3QB 2KANA 2L76A 1WFYA 1RLFA 2J0MA 2ZVOA 4X57B 1GG3A 3S2AA 2M8SA 1EF1A 1V80A 3H7PA 2LVOA 3SD5A 2O2VB 4IWQA 2KFJA 3ONSA 3RCZA 3ZKJC 4OVUA 3QQ8B 5DPWA 2IZVB 4NQLB 5CX3A 2DHZA 4AUQC 1YIWA 5BO4B 2KWCA 3ALBA 1S1QB 2M1MA 2KK8A 2KFKA 3ZRFA 2BYEA 2J0JA 2JZZA 4K7WA 1WM2A 4LJOB 1WR1A 4BVUC 3QK0A 2LVPA 1WXSA 2R2QA 1C1YB 2KNBA 1EF5A 3NS8A 2CHXA 4NJ6A 2D11A 3KUZA 4HDQA 3SHQA 3DPDA 4GOCA 3UIOB 1G6JA 1GC7A 2N9XA 1XD3B 2VRRB 2RPQA 2DYOA 3DBSA 4DHJD 2GBRA 1A5RA 4JLCA 2WDTB 1WX8A 3WALA 3PV1A 4WJNA 1TBEA 4ZRIA 2B3AA 2DYMA 3R66C 4JQWC 3HHMA 3GOEA 4HVBA 1YX5B 3TCAA 1BT0A 3APCA 3TMPB 4BBNF 2GMIC 3AU4A 3V61A 1C3TA 3ZW3A 3DDCB 1LFDA 3X0WA 1GJZA 2LZ6A 2N7DA 2MQJA 4AJYB 2JXXA 3K9OB 4GGQA 2KDIA 2LXAA 2BPSA 4LDTD 2C9WB 4CO7A 3UQAA 4II3B 2FCQA 5DPSA 2LJ5A 2RGFA 5AZHA 3PLUA 3PT2B 1P0RA 3KUCB 3R3MA 2CKHB 4EOYA 3NHEB 2Z59B 1FXTB 1WJ6A 4II2B 4TKNA 3U8ZA 4M0WB 4DXAB 2IO3B 4MM3A 1RRBA 3VUWA 3CMMB 3DBLI 3IG3A 1ISNA 1Q5WB 1LM8B 2FCSA 4IW0A 3VH4B 4BKTA 5E6OA 3ZRCA 1D3ZA 4W9LA 2GBKA 3QWZB 3EC8A 5J2RA 3L08A 2IY0B 4HPLB 2KQ7A 3UF8A 3ZNGC 2IYDB 3PZDA 2LASA 4F8CB 1CMXB 5CHWA 1E7UA 4I6LB 3JW0X 3M95A 3H7PB 4KDLB 3AXCA 1WE7A 3WANA 3ML9A 4GN1A 5L95C 3QAQA 1WR6E 1XT9B 4G11A 2NR2A 3VTUA 4DK5A 3DVNU 1IP9A 4E3CA 5DPRA 3GZNI 2GBMA 2KWUB 4M8NA 5D7GA 4FADA 3UIPB 3KW5B 3RZWC 4F7ZA 2C7NB 5JHBA 2I1JA 3L13A 3V6CB 3TJPA 1AARA 4NQKE 1P3QU 2LRUA 4W9GA 2L0FA 1JRUA 1VD2A 2DZJA 3QHTA 4MSMB 2PEAA 5CTRC 5CHVC 5J17A 4AWJA 2NPTB 1WXVA 3PPAA 1K8RB 3A33B 2A4ZA 2DYBA 5AEKB 3VAWA 4HWIB 4WQOB 4A20A 3OLMD 1P9DU 3NZSA 3RT3B 1E8ZA 2MBHA 5C23A 5DPTA 4MDKE 5IAAC 2KO3A 2KDFB 1UH6A 2JVCA 3PTFC 3QX1A 4NNJB 2IO0B 4WAAA 1I42A 3N30A 4WJPA 2HE7A 2FCMA 4WWPA 3PRZA 4FHKA 4ASWC 4EUTA 3U7DA 4BKSD 2RSUA 3RYTA 2D10A 1TZ1A 2QHOA 2KXJA 1U4AA 2FIFA 4IG7B 1WE6A 4DDGD 1WZ3A 1E7VA 2HD5B 4KZ0A 3WIMA 2G4DB 2AL3A 3IBEA 4W9HA 3OAWA 3VXWA 4BFRA 1GNUA 2LRWA 2C60A 3A9JB 1UBQA 2NVUI 5KHOA 3H9DA 2MX2A 3RULA 2WX1A 2NBVB 2KZRA 2MBOA 1V81A 2WWZA 3A9JA 3R7QA 1V5OA 2EMTA 1R4MI 4GDLA 4I6NB 3A1QA 2ASQA 4FN2A 5C1ZA 3KYCD 2J7QB 3DQVA 3I3TB 4JGHB 4GB9A 1V86A 2D07B 4RM8A 4ICUA 4CHKA 5HKHA 3PS6A 4GU2A 3A1QB 4G3XB 4FULA 4K1RB 2ZJDA 2PE9A 1E5WA 2I1KA 3L10B 3PVLA 4TQ1A 1V9JA 3ZIMA 4E71A 4IWPA 4MGKE 3BINA 3QCAA 1WGRA 2K25A 3AULA 1P98A 3AI5A 3ZDTA 2FAZA 4A3OA 2LD9A 4ANUA 2XBBC 2BWES 2ZPNA 4W9JA 2K8HA 3MJWA 3ZVVA 1OEYA 2LXCA 1SIFA 3CSTA 4LCDE 3ZO5B 2LVQA 3V60A 1NI2A 2K1FA 4IM2A 3UGBB 3W1SC 2K8BA 2KC2A 2OJRA 1UD7A 2AL6A 2CU1A 2KX3A 1SGHA 4G50A 5G2NA 1TTNA 2FUHB 4P7IA 1WJUA 1OQYA 2KJHB 3B0AA 4IM3A 3A4SC 3SU8X 2MSED 4FLHA 4KDIC 2KDBA 3CF6E 4ANWA 3T9LA 4F1SA 1IYFA 2NS5A 1ZKHA 4YL8A 3RZFA 5L83A 2DAJA 2D2QA 1PQSA 2RR9A 4FJZA 1WXAA 3WAOA 4CYEA 1HE8A 3VH3B 2DENB 4RM9A 1YX6B 1X1MA 2M4NA 1UZXB 2MBEA 2O6VB 4J6IA 2N7EA 5TR5A 3ZDMC 2LUEA 2J0KA 2BKRB 3TL5A 3U30A 2M17A 2O6VA 2V3SA 2REXA 3ENEA 3EHVA 3KUDB 2DAFA 3WAMA 4MGZE 5G55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DVG Y;  4ZRK A;  5D94 A;  2G45 B;  4ZYN A;  3W1Y A;  4URK A;  3H6N A;  4GDK B;  1L7Y A;  1VCB A;  2JRI B;  2KVR A;  1T0Y A;  1V5T A;  3ZTD A;  2W9N A;  3MHS D;  1J0G A;  5CHF A;  4EFO A;  1L2N A;  1E8W A;  2LGY A;  1GC6 A;  2DZK A;  2L3Z A;  2MBB B;  2O6V D;  4HJK A;  4MSQ B;  2L05 A;  2N1V A;  4JIO U;  1V49 A;  1NBF C;  2MBQ A;  3QAR A;  4FHJ A;  5IA7 A;  3HM3 A;  2KWV B;  4HK2 A;  3KH0 A;  4IUM B;  4XX5 A;  3VQI A;  3VHT C;  4AOF A;  1WZ0 A;  4DHZ E;  1M94 A;  4RMA A;  1KM7 A;  4HDO A;  3ZNH B;  3OJ3 A;  3TIX A;  4KSL C;  4PS8 A;  1SE9 A;  3VVW B;  3ZTC A;  4EZL A;  2KDE B;  3OJ4 B;  4GSW A;  3TBL D;  4PS7 A;  1NDD A;  1Q0W B;  3ZNI D;  4M8M A;  1WH3 A;  4TUU A;  2ZCB A;  2CHW A;  2RD0 A;  5D6J B;  4PYZ A;  2UYZ B;  2KD0 A;  4W9E A;  2PE6 B;  4WWO A;  3H1U A;  5FR6 A;  3X23 A;  4TQ0 A;  1WGD A;  4EZJ A;  2KKC A;  2BKF A;  2KTR A;  3R7R A;  1E90 A;  4WWN A;  1E8Y A;  1WMH B;  2BGF A;  1V6E A;  1Z2M A;  2NCN A;  2KTR B;  2MA9 B;  4HXD A;  5J18 A;  3PRE A;  1GUA B;  3K9P B;  1UGM A;  1EUV B;  1ZW7 A;  2L0T A;  4BOS C;  5JZE B;  2EMS A;  4OVV A;  2V4L A;  3QA8 A;  4HCN B;  5LXH A;  1IPG A;  1WX9 A;  2C7M B;  2HTH A;  2KMC A;  3Q3J A;  1YD8 U;  1Z5S B;  2BF8 B;  3NZU A;  2NBU A;  3DVG X;  4BBN C;  3H7S A;  4B95 A;  3ECI A;  5E6N A;  2N4F A;  3LDZ E;  2Z0D B;  3A9K A;  3A4R A;  2LGD A;  4BOZ B;  1H4R A;  2C7H A;  2WYQ A;  3VFK A;  2WX0 A;  3QC8 B;  5D2M B;  2LWP A;  3DVN V;  2CS4 A;  4DHZ B;  1LQB A;  1UEL A;  3IFW B;  3EEC A;  3N3K B;  1RAX A;  2GOW A;  3APF A;  2Z0E B;  2KHW B;  3JYU A;  3N32 A;  4WJQ A;  2JUO A;  4DHJ B;  2JZ3 B;  3DBR I;  1LXD A;  3L16 A;  4GDL B;  1XQQ A;  3BY4 B;  4BKS A;  2IO1 B;  3PRP B;  3VUY A;  5KHQ A;  4ICV A;  2GBJ A;  4MJS A;  3V62 A;  3SDL C;  4FJV B;  2KOX A;  2DZM A;  3W1S A;  1Y8R C;  4K7U A;  2ZEQ A;  4NAW B;  2G4S A;  4IC7 B;  4IM0 A;  2Y5B B;  3Q3F A;  2KJ6 A;  4I6P A;  1WM3 A;  4LJP B;  3WA0 A;  3VTW A;  4TV3 A;  3VDZ A;  2AWT A;  1MG8 A;  3AU5 A;  2L7R A;  3JVZ X;  3HK0 A;  3M63 B;  4EZK A;  4AJW A;  2ZZP B;  1YQB A;  4DWF A;  3VUX A;  3D32 A;  3NOB A;  1WY8 A;  3IVF A;  4GMV A;  2KN5 A;  1WGH A;  1WIA A;  2EKE C;  1I35 A;  2XK5 B;  2K6Q A;  2AEH A;  3QIJ A;  2BYF A;  3C0R B;  3DCG A;  1WX7 A;  3APD A;  4XZ4 A;  4GIV A;  4A3P A;  3PHW B;  2HJ8 A;  2JWZ A;  1KOT A;  3MTN B;  2MP2 A;  5EDS A;  1YJ1 A;  2BWF A;  2V1Y A;  5AZF A;  2MP2 B;  4KIK B;  3LJ3 A;  4DBG A;  2FCN A;  1UBI A;  2L8J A;  4K7S A;  2JF5 A;  1WYW B;  2JPH A;  3B1L X;  4PYU A;  1WGY A;  2YVC A;  2N9E B;  2IBI B;  3KYD D;  2LI5 A;  3O65 B;  1P1A A;  4XC2 A;  4EKU A;  1WJ4 A;  2N1W A;  1WXM A;  3M3J A;  5LXI B;  1H8C A;  2K6D B;  4IWO A;  4FBJ B;  5E6P A;  3A9K B;  3NY5 A;  3PLV A;  4AP4 C;  3ML8 A;  2KX0 A;  2FID A;  4G0N B;  4BKG A;  2JT4 B;  2LGX A;  4MGI E;  4GXB A;  3DBH I;  4WJO A;  2KQS A;  4PS3 A;  3T8M A;  2MW5 A;  1WJN A;  2ZCC A;  1R4N I;  3WAP A;  4NJ7 A;  3L54 A;  1Q1O A;  2DZI A;  1EO6 A;  2KLC A;  2K8C A;  2GBN A;  2ZNV B;  4ANX A;  2ZPY A;  2MWS B;  3PSE B;  2KJR A;  3JSV A;  1WI0 A;  2L00 B;  4W9I A;  1WGG A;  2ZVN A;  2UWQ A;  4LDT B;  4GDK A;  1E8X A;  4MJS B;  3ZNZ B;  5JHA A;  1KLV A;  4HLE A;  1ZGU B;  4JL9 A;  3CSF A;  3JSV B;  4KSK C;  3RD2 A;  2O2V A;  4W9C A;  2IO2 B;  2CR5 A;  4KV2 A;  3L0W B;  4HCP B;  2A5U A;  3ZLZ A;  2C5L C;  4HPM B;  3QJZ A;  5AZG A;  3UIN B;  2FNJ B;  1S3S G;  2KMA A;  2NPT A;  3L17 A;  2KFK B;  3VTV A;  1WMH A;  5LLI A;  2KLG A;  2D3G A;  4MH0 E;  3PRM B;  3B08 A;  4N9F 4;  4W9D A;  2R2O A;  5JH5 C;  1QZE A;  4MEL A;  2MLB A;  3HM6 X;  4KIK A;  4NAW A;  2YLM A;  3V6E B;  4NPN A;  2JRH A;  3EFU A;  3PHX B;  4B9K A;  1OTR B;  2DX5 B;  1RFA A;  1WRD B;  2XEW A;  2IY1 B;  2NBW B;  3IHP C;  1J8C A;  1TGZ B;  2KTF A;  1WF9 A;  2BYV E;  2ZNV C;  1KJT A;  3HIZ A;  4NY0 A;  2K39 A;  3P2B A;  4KZC A;  2PPH A;  4ZRJ A;  4E74 A;  2XK5 A;  2N9P C;  2KC1 A;  5GMV A;  3RUI B;  4DDI D;  4MEM A;  4K81 A;  2JY6 A;  2CHZ A;  4W9K A;  4FA6 A;  1V2Y A;  4ZDV A;  3ZUN A;  3UQB A;  5DCN A;  2MRP A;  4W9F A;  2MCN B;  2M0X A;  2AYO B;  4MGY E;  1OGW A;  3KVF B;  4KVG B;  4B6W A;  4EEW A;  2OOB B;  1OEY J;  3PGE A;  1J19 A;  2PJH A;  3DOW A;  4FJY A;  1F9J A;  3M62 B;  4ANV A;  2G3Q B;  2KAN A;  2L76 A;  1WFY A;  1RLF A;  2J0M A;  2ZVO A;  4X57 B;  1GG3 A;  3S2A A;  2M8S A;  1EF1 A;  1V80 A;  3H7P A;  2LVO A;  3SD5 A;  2O2V B;  4IWQ A;  2KFJ A;  3ONS A;  3RCZ A;  3ZKJ C;  4OVU A;  3QQ8 B;  5DPW A;  2IZV B;  4NQL B;  5CX3 A;  2DHZ A;  4AUQ C;  1YIW A;  5BO4 B;  2KWC A;  3ALB A;  1S1Q B;  2M1M A;  2KK8 A;  2KFK A;  3ZRF A;  2BYE A;  2J0J A;  2JZZ A;  4K7W A;  1WM2 A;  4LJO B;  1WR1 A;  4BVU C;  3QK0 A;  2LVP A;  1WXS A;  2R2Q A;  1C1Y B;  2KNB A;  1EF5 A;  3NS8 A;  2CHX A;  4NJ6 A;  2D11 A;  3KUZ A;  4HDQ A;  3SHQ A;  3DPD A;  4GOC A;  3UIO B;  1G6J A;  1GC7 A;  2N9X A;  1XD3 B;  2VRR B;  2RPQ A;  2DYO A;  3DBS A;  4DHJ D;  2GBR A;  1A5R A;  4JLC A;  2WDT B;  1WX8 A;  3WAL A;  3PV1 A;  4WJN A;  1TBE A;  4ZRI A;  2B3A A;  2DYM A;  3R66 C;  4JQW C;  3HHM A;  3GOE A;  4HVB A;  1YX5 B;  3TCA A;  1BT0 A;  3APC A;  3TMP B;  4BBN F;  2GMI C;  3AU4 A;  3V61 A;  1C3T A;  3ZW3 A;  3DDC B;  1LFD A;  3X0W A;  1GJZ A;  2LZ6 A;  2N7D A;  2MQJ A;  4AJY B;  2JXX A;  3K9O B;  4GGQ A;  2KDI A;  2LXA A;  2BPS A;  4LDT D;  2C9W B;  4CO7 A;  3UQA A;  4II3 B;  2FCQ A;  5DPS A;  2LJ5 A;  2RGF A;  5AZH A;  3PLU A;  3PT2 B;  1P0R A;  3KUC B;  3R3M A;  2CKH B;  4EOY A;  3NHE B;  2Z59 B;  1FXT B;  1WJ6 A;  4II2 B;  4TKN A;  3U8Z A;  4M0W B;  4DXA B;  2IO3 B;  4MM3 A;  1RRB A;  3VUW A;  3CMM B;  3DBL I;  3IG3 A;  1ISN A;  1Q5W B;  1LM8 B;  2FCS A;  4IW0 A;  3VH4 B;  4BKT A;  5E6O A;  3ZRC A;  1D3Z A;  4W9L A;  2GBK A;  3QWZ B;  3EC8 A;  5J2R A;  3L08 A;  2IY0 B;  4HPL B;  2KQ7 A;  3UF8 A;  3ZNG C;  2IYD B;  3PZD A;  2LAS A;  4F8C B;  1CMX B;  5CHW A;  1E7U A;  4I6L B;  3JW0 X;  3M95 A;  3H7P B;  4KDL B;  3AXC A;  1WE7 A;  3WAN A;  3ML9 A;  4GN1 A;  5L95 C;  3QAQ A;  1WR6 E;  1XT9 B;  4G11 A;  2NR2 A;  3VTU A;  4DK5 A;  3DVN U;  1IP9 A;  4E3C A;  5DPR A;  3GZN I;  2GBM A;  2KWU B;  4M8N A;  5D7G A;  4FAD A;  3UIP B;  3KW5 B;  3RZW C;  4F7Z A;  2C7N B;  5JHB A;  2I1J A;  3L13 A;  3V6C B;  3TJP A;  1AAR A;  4NQK E;  1P3Q U;  2LRU A;  4W9G A;  2L0F A;  1JRU A;  1VD2 A;  2DZJ A;  3QHT A;  4MSM B;  2PEA A;  5CTR C;  5CHV C;  5J17 A;  4AWJ A;  2NPT B;  1WXV A;  3PPA A;  1K8R B;  3A33 B;  2A4Z A;  2DYB A;  5AEK B;  3VAW A;  4HWI B;  4WQO B;  4A20 A;  3OLM D;  1P9D U;  3NZS A;  3RT3 B;  1E8Z A;  2MBH A;  5C23 A;  5DPT A;  4MDK E;  5IAA C;  2KO3 A;  2KDF B;  1UH6 A;  2JVC A;  3PTF C;  3QX1 A;  4NNJ B;  2IO0 B;  4WAA A;  1I42 A;  3N30 A;  4WJP A;  2HE7 A;  2FCM A;  4WWP A;  3PRZ A;  4FHK A;  4ASW C;  4EUT A;  3U7D A;  4BKS D;  2RSU A;  3RYT A;  2D10 A;  1TZ1 A;  2QHO A;  2KXJ A;  1U4A A;  2FIF A;  4IG7 B;  1WE6 A;  4DDG D;  1WZ3 A;  1E7V A;  2HD5 B;  4KZ0 A;  3WIM A;  2G4D B;  2AL3 A;  3IBE A;  4W9H A;  3OAW A;  3VXW A;  4BFR A;  1GNU A;  2LRW A;  2C60 A;  3A9J B;  1UBQ A;  2NVU I;  5KHO A;  3H9D A;  2MX2 A;  3RUL A;  2WX1 A;  2NBV B;  2KZR A;  2MBO A;  1V81 A;  2WWZ A;  3A9J A;  3R7Q A;  1V5O A;  2EMT A;  1R4M I;  4GDL A;  4I6N B;  3A1Q A;  2ASQ A;  4FN2 A;  5C1Z A;  3KYC D;  2J7Q B;  3DQV A;  3I3T B;  4JGH B;  4GB9 A;  1V86 A;  2D07 B;  4RM8 A;  4ICU A;  4CHK A;  5HKH A;  3PS6 A;  4GU2 A;  3A1Q B;  4G3X B;  4FUL A;  4K1R B;  2ZJD A;  2PE9 A;  1E5W A;  2I1K A;  3L10 B;  3PVL A;  4TQ1 A;  1V9J A;  3ZIM A;  4E71 A;  4IWP A;  4MGK E;  3BIN A;  3QCA A;  1WGR A;  2K25 A;  3AUL A;  1P98 A;  3AI5 A;  3ZDT A;  2FAZ A;  4A3O A;  2LD9 A;  4ANU A;  2XBB C;  2BWE S;  2ZPN A;  4W9J A;  2K8H A;  3MJW A;  3ZVV A;  1OEY A;  2LXC A;  1SIF A;  3CST A;  4LCD E;  3ZO5 B;  2LVQ A;  3V60 A;  1NI2 A;  2K1F A;  4IM2 A;  3UGB B;  3W1S C;  2K8B A;  2KC2 A;  2OJR A;  1UD7 A;  2AL6 A;  2CU1 A;  2KX3 A;  1SGH A;  4G50 A;  5G2N A;  1TTN A;  2FUH B;  4P7I A;  1WJU A;  1OQY A;  2KJH B;  3B0A A;  4IM3 A;  3A4S C;  3SU8 X;  2MSE D;  4FLH A;  4KDI C;  2KDB A;  3CF6 E;  4ANW A;  3T9L A;  4F1S A;  1IYF A;  2NS5 A;  1ZKH A;  4YL8 A;  3RZF A;  5L83 A;  2DAJ A;  2D2Q A;  1PQS A;  2RR9 A;  4FJZ A;  1WXA A;  3WAO A;  4CYE A;  1HE8 A;  3VH3 B;  2DEN B;  4RM9 A;  1YX6 B;  1X1M A;  2M4N A;  1UZX B;  2MBE A;  2O6V B;  4J6I A;  2N7E A;  5TR5 A;  3ZDM C;  2LUE A;  2J0K A;  2BKR B;  3TL5 A;  3U30 A;  2M17 A;  2O6V A;  2V3S A;  2REX A;  3ENE A;  3EHV A;  3KUD B;  2DAF A;  3WAM A;  4MGZ E;  5G55 A; 
#chains in the Genus database with same CATH topology
 4ZRK A;  4URK A;  4GDK B;  2KVR A;  3N20 C;  1V5T A;  2KVZ A;  2WXJ A;  1DGJ A;  3ZJV A;  1E8W A;  1XLQ A;  2O6V D;  4HJK A;  4R3D A;  2L05 A;  5HG2 A;  1V49 A;  3VR8 B;  3HM3 A;  3Q8F A;  4IUM B;  3KLS X;  4XX5 A;  4RMA A;  2MJD A;  3VVW B;  4PS8 A;  1BML C;  2KDE B;  4GSW A;  4DXG A;  1NDD A;  3DHH C;  4XYC A;  2MHJ A;  5D6J B;  4PYZ A;  2PE6 B;  2LEK A;  3H1U A;  4LNN A;  2Y5C A;  1L6U A;  1TKY A;  2JYE A;  4EZJ A;  2PVG C;  5IOI A;  1E8Y A;  1V6E A;  1Z2M A;  2NCN A;  4HXD A;  3AEE B;  2L0T A;  1D5M C;  1WX9 A;  4N6E B;  3EGR A;  1YD8 U;  1EM7 A;  3MJ5 A;  1T0R C;  1SXT A;  1L0V B;  3A4R A;  2LGD A;  3VFK A;  3AEA B;  5D2M B;  3DVN V;  3APF A;  2ACZ B;  3JYU A;  4WJQ A;  3J9C A;  4RH6 A;  4BKS A;  3IAM 1;  4ZRQ A;  3LXF A;  3VUY A;  5KHQ A;  1I7H A;  5FKA C;  4IM0 A;  2KJ6 A;  4LJP B;  3AU5 A;  2PKO A;  4EZK A;  2I2Y A;  2ZW0 A;  1T0S C;  4DWF A;  3P1M A;  4JPS A;  3MC0 B;  2V0G A;  2XK5 B;  2BYF A;  3I63 C;  1WX7 A;  1PGX A;  4XZ4 A;  2JWZ A;  1KOT A;  3MTN B;  2K22 A;  4YXD B;  1JW9 D;  3LJ3 A;  3Q3M C;  1SJE D;  1WYW B;  1WGY A;  2YVC A;  4IWO A;  4KGT A;  5E6P A;  1XCT L;  2BB5 A;  2JT4 B;  2LGX A;  4KKJ A;  1MHH E;  1WGK A;  4PS3 A;  2MW5 A;  1R4N I;  1Q1O A;  2MJE A;  3OG5 A;  2YEP B;  2MWS B;  2BQQ A;  1N5X A;  3Q8E A;  4XGA B;  4C00 A;  4LDT B;  4GDK A;  2Y3A A;  4A55 A;  3CSF A;  2X8X X;  2BYT A;  1SEB D;  3QJZ A;  3UIN B;  1TS3 A;  1WMH A;  4W9D A;  3B9J A;  1E9M A;  2MLB A;  3HM6 X;  4KGS A;  3BVZ A;  4NAW A;  4NPN A;  3BK2 A;  4B9K A;  1OTR B;  1K53 A;  2KTF A;  2D3C A;  1YJI A;  2ZNV C;  1KJT A;  1TT5 B;  1FRR A;  2K39 A;  4KZC A;  2PPH A;  4E74 A;  2XK5 A;  1FEH A;  4DDI D;  4M02 A;  2KWD A;  3R2I A;  3P4S B;  3Q3N C;  1VZ8 A;  3UQB A;  2VH2 A;  2MCN B;  2AYO B;  2WDV B;  3BVG A;  4KVG B;  3Q6B A;  4EEW A;  4N58 A;  2N9K A;  2J0M A;  1HEZ E;  3SEB A;  3S2A A;  1HTO A;  4MT5 A;  2ZW1 A;  3ZKJ C;  5DPW A;  2E3T A;  4AUQ C;  1YIW A;  2W3R A;  2KFK A;  1CQV A;  3E56 A;  3FKY A;  2J0J A;  4K7W A;  2QDF A;  4D2K A;  3NUH B;  3DHG C;  1EF5 A;  3GZN B;  3N1Y C;  2V4I B;  4GOC A;  3UIO B;  2IJ0 A;  1F2R C;  2N9X A;  2VRR B;  2GBR A;  1A5R A;  2RDH A;  3HHM A;  4AS1 A;  1YX5 B;  3TCA A;  1FXA A;  3GS2 A;  4BBN F;  1C76 A;  1C3T A;  2CU3 A;  2LHE A;  1DYQ A;  1LFD A;  1GJZ A;  1XLP A;  4WAF A;  2MQJ A;  5G5H A;  3VRB B;  2KDI A;  2IGG A;  3RMK C;  2C9W B;  3AV8 A;  2AX5 A;  2FCQ A;  2RGF A;  5AZH A;  3PLU A;  1P0R A;  3R3M A;  2CKH B;  4EOY A;  1MG4 A;  2Z59 B;  1FXT B;  4II2 B;  3VUW A;  3IG3 A;  1Q5W B;  2FCS A;  1LM8 B;  4BKT A;  3HRD D;  3VH4 B;  1D3Z A;  5H8Y E;  3QWZ B;  3ZNG C;  1E7U A;  1YNT E;  4I6L B;  4JX1 C;  2DNF A;  4GN1 A;  3QAQ A;  3VTU A;  5C3J B;  1IP9 A;  1V1P A;  3GZN I;  4M8N A;  1PDX A;  1VDV A;  3L13 A;  3E9S A;  1AAR A;  1VD2 A;  1SSN A;  1K8R B;  2K5P A;  5AUI A;  3A33 B;  3AE6 B;  2A4Z A;  2KQ4 X;  4PK1 A;  5AEK B;  2MBH A;  1UH6 A;  2IO0 B;  1F77 A;  2INC C;  3N30 A;  4L2Y A;  4WWP A;  3U7D A;  3N9Y C;  1TZ1 A;  2KXJ A;  1U4A A;  4IOI E;  4DDG D;  1E7V A;  1RYJ A;  2HD5 B;  2G4D B;  1K52 A;  1NEN B;  1L4D B;  1TJE A;  1UBQ A;  3AB5 A;  2MX2 A;  3ABV B;  2N7J A;  4I6N B;  2ASQ A;  3IT6 B;  2JWU A;  4GB9 A;  1N6Z A;  3PS6 A;  4FUL A;  1Q10 A;  2ZJD A;  2PE9 A;  2I1K A;  4OZA A;  1TY2 A;  1NVI D;  1V9J A;  4E71 A;  3VR9 B;  2IGH A;  2N9L A;  3Q8C A;  4IWP A;  4MGK E;  1VJK A;  1JRO A;  3CIR B;  4US9 A;  3RNF C;  1IGD A;  1WGR A;  3AI5 A;  2FAZ A;  2BWE S;  2K8H A;  3MJW A;  1SIF A;  2INN E;  1YQ3 B;  3KWV A;  3U2S C;  3AE7 B;  1UD7 A;  1SGH A;  4G50 A;  5I4D A;  3B0A A;  5C2T B;  2Y5P A;  4FLH A;  2OHF A;  4LNO A;  2KDB A;  1YQ4 B;  3CF6 E;  2KAJ A;  3T9L A;  5L83 A;  3H8H A;  3RZF A;  1HTQ A;  2LJI A;  4FJZ A;  1WXA A;  3WAO A;  1KF6 B;  3VH3 B;  2FUG 1;  2M56 B;  2JX5 A;  4A6Q A;  2N7E A;  1ZXH A;  1MHX A;  1QOG A;  2DAF A;  5G5G A;  1CJE A;  5JXV A;  2VZK D;  3DVG Y;  4OVZ A;  2G45 B;  5D94 A;  4ZYN A;  4US8 A;  3GB1 A;  2W9N A;  1JRP A;  3C19 A;  4YWG G;  1WYG A;  1L2N A;  2L3Z A;  3V05 A;  1NBF C;  1FNV A;  2MBQ A;  5IA7 A;  2KWV B;  4HK2 A;  3NVV A;  3VQI A;  3DHI C;  3P63 A;  4HDO A;  1JWA D;  3TIX A;  1SE9 A;  1HZ5 A;  4WIP A;  3TBL D;  4PS7 A;  1OFF A;  3ZNI D;  3BZD B;  2CHW A;  3MFG A;  2KD0 A;  4W9E A;  4WWO A;  5FR6 A;  3X23 A;  1C4P A;  2KTR A;  2RDG A;  4WWN A;  1MJD A;  2KTR B;  2MA9 B;  2JZP A;  3PRE A;  5JZE B;  2EMS A;  4OVV A;  5LXH A;  2HTH A;  3Q3J A;  2NMQ A;  4BBN C;  3AEB B;  1JCK B;  2PTL A;  5E6N A;  5EE3 A;  1FXI A;  4BOZ B;  3VRA B;  1FPY A;  1L5P A;  4M00 A;  2DWQ A;  2GOW A;  3N32 A;  2KHW B;  1GAQ B;  1SE3 A;  1LXD A;  2KN4 A;  3L16 A;  5EE1 A;  2LGS A;  1PGA A;  3BYY B;  4BAX A;  4ICV A;  4C4V B;  4PT5 A;  3SDL C;  3PZ7 A;  2KOX A;  1D6E C;  4NAW B;  1Y8R C;  4MH8 A;  2G4S A;  3WA0 A;  3RNB C;  3VDZ A;  1TS2 A;  3AE5 B;  3B2G A;  1JWU D;  3HK0 A;  3M63 B;  1BXT A;  3D32 A;  1WY8 A;  3IVF A;  1WGH A;  2EKE C;  5IO9 A;  3V3X A;  1I35 A;  2AEH A;  3C0R B;  2JQR B;  1NYR A;  3PHW B;  3ZYY X;  4HPP A;  1HQR D;  1XLO A;  3Q14 C;  2BWF A;  2RDB C;  2D3A A;  2LFI A;  1UBI A;  4K3C A;  1TY0 A;  4MM3 B;  2JPH A;  4JE3 B;  2N9E B;  3NRZ A;  2VZK B;  2GRI A;  1P1A A;  1WXM A;  1H8C A;  5LXI B;  2K6D B;  4FBJ B;  2ON8 A;  3PLV A;  4AP4 C;  3DWG C;  3ML8 A;  2FID A;  4G0N B;  4BKG A;  1AN8 A;  3DBH I;  4WJO A;  2D5G A;  1E10 A;  3WAP A;  4NJ7 A;  1J7A A;  1EO6 A;  2KLC A;  2K8C A;  2GBN A;  3B2F A;  2ZPY A;  4AQ7 A;  4ZHO A;  2ZVN A;  2UWQ A;  2QMT A;  3U52 E;  4JL9 A;  4KSK C;  1FM0 D;  2O2V A;  2IO2 B;  1A70 A;  2CR5 A;  4KV2 A;  4HCP B;  5H92 C;  1AYF A;  3TEW A;  5AZG A;  2GB1 A;  3L17 A;  5LLI A;  4MH0 E;  4N9F 4;  3B08 A;  5JH5 C;  1QZE A;  4MEL A;  4KIK A;  2YLM A;  3AE9 B;  1ZOY B;  3EFU A;  4ZHP A;  1RFA A;  2XEW A;  2G9H D;  1J8C A;  1WF9 A;  2BYV E;  2DBY A;  3UI3 A;  2KC1 A;  3MP9 A;  4MEM A;  4K81 A;  2JY6 A;  2PMV A;  4LNF A;  4FA6 A;  3ZUN A;  5DCN A;  2MRP A;  3DBH B;  4W9F A;  2M0X A;  4MGY E;  3P4R B;  4B6W A;  1OEY J;  2JU6 X;  2PJH A;  4ANV A;  2FE8 A;  4XWT A;  2PVO D;  4USA A;  2OJW A;  3NS1 A;  1GG3 A;  2LVO A;  4IWQ A;  2KFJ A;  3ONS A;  3RCZ A;  4OVU A;  2BS2 B;  1QQR A;  2BYE A;  1QT9 A;  4BVU C;  1WXS A;  2WGS A;  3NS8 A;  2CHX A;  1F1H A;  3EA6 A;  5HI1 A;  3SHQ A;  3BK1 A;  3TEZ A;  2HTM E;  2RPQ A;  2DYO A;  3DBS A;  1QOA A;  1TBE A;  4TMA B;  2KAC A;  3RFZ B;  3AN1 A;  3R66 C;  3GOE A;  4HVB A;  4FXC A;  3AU4 A;  4JWS C;  2WXN A;  2N7D A;  3K9O B;  2BPS A;  1HZ6 A;  1KLU D;  5DPS A;  5TSS A;  2CJN A;  4K3B A;  1WJ6 A;  3U8Z A;  4MM3 A;  2H88 B;  4CQN A;  1RRB A;  3CMM B;  1WRI A;  1EWY C;  5E6O A;  3ZRC A;  3EC8 A;  2KQ7 A;  1CZP A;  3HUI A;  3PZD A;  2LAS A;  3R8B A;  1CMX B;  4JWU C;  5CHW A;  3JW0 X;  1M4V A;  1JML A;  3OWE B;  1WR6 E;  3DVN U;  5BYR A;  4LNK A;  3GP7 A;  1DOI A;  3UIP B;  3KW5 B;  4FAD A;  3RZW C;  1IUE A;  1R4N B;  2C7N B;  1I4Q A;  5JHB A;  3V6C B;  4W9G A;  1P3Q U;  5AUK A;  2J4X A;  2HJ1 A;  1QIL A;  3ZJT A;  2DYB A;  4HWI B;  4A20 A;  4WUR A;  1FCL A;  3BWU D;  2QEJ C;  5C23 A;  1KTK A;  2KDF B;  3PTF C;  4ZOH C;  1EU3 A;  3CWI A;  2FCM A;  3T3N A;  3PRZ A;  3TSS A;  2XNA C;  3RYT A;  2D10 A;  2WS3 B;  2QHO A;  3NZ3 A;  1UNS A;  4H2A A;  4KZ0 A;  2AL3 A;  2L52 A;  1SE4 A;  2LRW A;  2WX1 A;  2NBV B;  4RGN A;  2MBO A;  3R7Q A;  2EMT A;  2IPK D;  1ZXI A;  4GDL A;  3IAS 1;  2PIA A;  3AE1 B;  5FR3 A;  3DQV A;  4YSX B;  4JGH B;  2WXP A;  1YMH E;  1V86 A;  3KWL A;  4P1C C;  4ICU A;  4CHK A;  3A1Q B;  1XEE A;  1TZO A;  3ZIM A;  2WXO A;  3BIN A;  1VZ6 A;  2K25 A;  4TSS A;  3DWM A;  4ANU A;  4LNI A;  2RPV A;  4S0R A;  3TUO A;  1WXQ A;  3ZO5 B;  1LO5 D;  1UGJ A;  2K1F A;  1FFU A;  3W1S C;  2KC2 A;  2FBW B;  2E6X A;  3U7Z A;  1TTN A;  2PW9 A;  4EE2 A;  1I4R A;  3SU8 X;  2EEL A;  3Q3O C;  5FK9 C;  1IYF A;  1ZKH A;  4YL8 A;  4HJG E;  1PQS A;  4IDI A;  2DEN B;  1JQ4 A;  1T0Q C;  5TR5 A;  2J0K A;  2BKR B;  3TL5 A;  3KUD B;  2M17 A;  2V3S A;  2REX A;  3ENE A;  3EHV A;  1I4X A;  4UDU C;  4S17 A;  3W1Y A;  2WXI A;  3NG0 A;  3ZTD A;  1T0Y A;  4IKG A;  1J0G A;  2J42 A;  5CHF A;  4EFO A;  4C7Y A;  2WXQ A;  2DZK A;  4MSQ B;  1XF5 L;  2MH7 A;  4JIO U;  3QAR A;  4ACF A;  1JAL A;  4FHJ A;  1ROE A;  1B9R A;  1WZ0 A;  4DHZ E;  1M94 A;  1KM7 A;  3ZJU A;  1TS4 A;  1YN3 A;  3OJ4 B;  4P6V F;  1Q0W B;  1L6V A;  3W9C B;  2INP E;  2JXT A;  2L1A A;  2WNM A;  1FNW A;  1WWT A;  2KKC A;  3R7R A;  1ET6 A;  1WMH B;  2BGF A;  1MI0 A;  1FMA D;  1GUA B;  1UGM A;  4BOS C;  1XO3 A;  2V4L A;  3QA8 A;  5BMG A;  2KMC A;  2BF8 B;  1Z5S B;  3NZU A;  2BT6 A;  3DVG X;  4P16 A;  3ECI A;  1RWS A;  2IGD A;  2N4F A;  3A9K A;  1H4R A;  2WYQ A;  2WX0 A;  1KFY B;  3QC8 B;  1PUT A;  2LWP A;  3TEX A;  1E6E B;  4DHZ B;  2KMM A;  3N3K B;  3ZXV A;  2Z0E B;  2JUO A;  1FFV A;  4DHJ B;  2J53 A;  5BMH A;  1NYQ A;  4MJS A;  1GB1 A;  1B1Z A;  4K7U A;  4IC7 B;  4XDC A;  1E0Z A;  2Y5B B;  1WM3 A;  4TV3 A;  2AWT A;  2V9H A;  3JVZ X;  4AJW A;  2ZZP B;  1YQB A;  3VUX A;  3NOB A;  4GMV A;  2L83 A;  1ZUD 2;  1WIA A;  3HVZ A;  2K6Q A;  3FAH A;  3APD A;  2Q5W D;  4GIV A;  4RGO S;  4L23 A;  2NTS A;  5EDS A;  1YJ1 A;  2V1Y A;  4DBG A;  2FCN A;  2L8J A;  4KKI A;  2JF5 A;  2IBI B;  1WJ4 A;  3M3J A;  1K51 A;  3W5U B;  4Q2J A;  4MGI E;  2H89 B;  2M0A A;  1WJN A;  2ZCC A;  3L54 A;  1L0X B;  4ANX A;  3T3O A;  2KJR A;  4W9I A;  1WI0 A;  2BVC A;  2L00 B;  2WP9 B;  4B0E A;  2IND C;  1KLV A;  1E8X A;  5JHA A;  4HLE A;  3JSV B;  1V1O A;  3ZLZ A;  1V97 A;  2C5L C;  3LYY A;  2FNJ B;  2NPT A;  2KFK B;  3VTV A;  2OED A;  3SFE B;  1TIF A;  2R2O A;  1EWC A;  2SEB D;  2VH1 A;  3V6E B;  3PHX B;  3W5V B;  1FD6 A;  2NBW B;  4C80 A;  1TGZ B;  2Z8L A;  3P2B A;  2N9P C;  5GMV A;  2BS3 B;  3RUI B;  3N1X C;  4A90 A;  3EFC A;  3PO0 A;  1R4M B;  1P7E A;  1V2Y A;  4ZDV A;  1JWB D;  1OGW A;  2WDR B;  1TKG A;  1J19 A;  2WHI A;  4FJY A;  2WXM A;  2KAN A;  1D5X C;  2ZVO A;  4X57 B;  1EF1 A;  1V80 A;  3H7P A;  1KLG D;  5MPO A;  2O2V B;  2IZV B;  2KWC A;  1S1Q B;  3HVD A;  2KK8 A;  4RFB A;  1C78 A;  1WR1 A;  2LGI A;  4ARC A;  2N0S B;  4C4V A;  2D11 A;  3KUZ A;  4HDQ A;  3DPD A;  1G6J A;  1XD3 B;  4A9A A;  1UWM A;  2MJ3 A;  3Q8B A;  2YEP F;  4RF0 A;  2HDE A;  2WDT B;  1D5Z C;  1WX8 A;  3U4E G;  3TEY A;  2B3A A;  2DYM A;  3KQ4 A;  3AEC B;  3TMP B;  2GMI C;  3ZW3 A;  1F2R I;  1ENF A;  4N59 A;  4AJY B;  4GGQ A;  1QF6 A;  4LDT D;  1OQR A;  4CO7 A;  5EE0 A;  4YT0 B;  2WXG A;  4XE0 A;  3AH7 A;  2LJ5 A;  1K50 A;  3NHE B;  4ARI A;  1STE A;  2IO3 B;  4LK0 M;  1HA5 A;  3DBL I;  4NZL B;  4IW0 A;  4W9L A;  2CJO A;  4HPL B;  2IY0 B;  3UF8 A;  2IYD B;  4F8C B;  1WE7 A;  3ML9 A;  5L95 C;  1QOF A;  4HKQ A;  1XT9 B;  4G11 A;  4E3C A;  1UF0 A;  4L1B A;  1GPX A;  2W55 A;  4HEA 1;  4RF1 A;  2I1J A;  3AE2 B;  3NVW A;  4NQK E;  2LRU A;  2ICI A;  4MSM B;  2PEA A;  5CTR C;  5J17 A;  4AWJ A;  2NPT B;  1UWX A;  3PZ8 A;  1WXV A;  1QOB A;  2G1E A;  2JYT A;  1Y56 A;  3VAW A;  4WQO B;  1F0Z A;  1P9D U;  1SJH D;  3Q2A C;  1HXY D;  3NZS A;  1E8Z A;  5DPT A;  4MDK E;  2KO3 A;  2JVC A;  4NNJ B;  1DOY A;  4WAA A;  1I42 A;  4WJP A;  1FRD A;  4ASW C;  4EUT A;  1C4A A;  4BKS D;  5EE9 A;  3W2D A;  2FIF A;  1WE6 A;  2QJL A;  1YJJ A;  1WZ3 A;  3DBL B;  1RFK A;  4KGR A;  4XWW A;  1QLB B;  3VXW A;  2BW2 A;  3GE3 C;  1GNU A;  4HKZ E;  4WWM A;  2KYW A;  3AEG B;  2C60 A;  5KHO A;  2NVU I;  2WU2 B;  1I4G A;  1V81 A;  4ZYS A;  1AWD A;  1ZP0 B;  2WWZ A;  1SF0 A;  1V8C A;  1VRA B;  1V5O A;  1FO4 A;  3A1Q A;  3KYC D;  4LTU A;  2KDM A;  4A8X C;  4RM8 A;  5E6J A;  3ZGZ A;  3L10 B;  3MHZ A;  4B0M A;  4GLS C;  5BYS A;  1J7B A;  3QCA A;  1NI3 A;  3AUL A;  1YN4 A;  2WXF A;  3BII D;  3ZDT A;  4A3O A;  2XBB C;  2ZPN A;  4W9J A;  2W54 A;  1OEY A;  2LXC A;  3CST A;  1LGR A;  1OQQ A;  2QSD A;  2D3B A;  2K8B A;  2W3S A;  2AL6 A;  2CU1 A;  3IXS A;  4OHJ A;  5G2N A;  1JWM D;  2BB6 A;  4P7I A;  1WJU A;  1OQY A;  2SAK A;  3A4S C;  1R7S A;  1ZDV A;  2MSE D;  4KDI C;  2NS5 A;  1F52 A;  2DAJ A;  2D2Q A;  2RR9 A;  1PFD A;  4CYE A;  2WXH A;  1HE8 A;  2J52 A;  4YTM B;  4RM9 A;  3ZQ4 A;  2M4N A;  2MBE A;  4J6I A;  2LUE A;  5HHD G;  1VLB A;  2O6V A;  2BBC A;  4MGZ E;  5G55 A;  3H6N A;  1L7Y A;  1VCB A;  2JRI B;  3ETR A;  3MHS D;  1VZ7 A;  3Q8A A;  2LGY A;  1GC6 A;  1ET9 A;  2MBB B;  2WQY B;  2N1V A;  5IKC M;  3KH0 A;  3SFD B;  3VHT C;  4AOF A;  5LNK 1;  3ZNH B;  3OJ3 A;  4KSL C;  3ZTC A;  5IP4 D;  4EZL A;  3BYT B;  4M8M A;  1GOZ A;  1WH3 A;  4TUU A;  2ZCB A;  2RD0 A;  2V3N A;  2UYZ B;  3AE3 B;  5T8I A;  2K3U A;  4TQ0 A;  1WGD A;  2BKF A;  1E90 A;  5IN7 A;  1D4B A;  4XDD A;  5J18 A;  3K9P B;  1EUV B;  1ZW7 A;  1GB4 A;  4HCN B;  4YSZ B;  1IPG A;  2C7M B;  2NBU A;  3H7S A;  4B95 A;  3LDZ E;  2Z0D B;  3L4P A;  1L4Z B;  2C7H A;  2EKI A;  1QKZ A;  5HFY A;  3RNC C;  2CS4 A;  1LQB A;  1UEL A;  3IFW B;  3EEC A;  1RAX A;  2TSS A;  1SBB B;  1N62 A;  2JZ3 B;  3DBR I;  3I9V 1;  4GDL B;  1XQQ A;  3BY4 B;  2IO1 B;  3PRP B;  2GBJ A;  3V62 A;  4FJV B;  2DZM A;  1SIJ A;  3W1S A;  2ZEQ A;  3Q3F A;  4QAY A;  4I6P A;  3VTW A;  2L32 A;  1IBX A;  1MG8 A;  1N5W A;  2L7R A;  3MC9 A;  4DXF A;  1KRH A;  1I4P A;  2KN5 A;  3NJT A;  1ZPS A;  4HRO A;  2ONQ A;  3QIJ A;  3AEF B;  3DCG A;  2BS4 B;  4A3P A;  2HJ8 A;  2MP2 A;  2UU7 A;  4ITK A;  5AZF A;  2MP2 B;  3MC8 A;  4KIK B;  4K7S A;  3B1L X;  4PYU A;  3KYD D;  2LI5 A;  1FCC C;  1MFW A;  3O65 B;  1ZDX A;  4XC2 A;  4YTN B;  4EKU A;  2N1W A;  2WXK A;  4P1B C;  3A9K B;  3FC4 A;  3DBR B;  3NY5 A;  2LHD A;  1JWS D;  2KX0 A;  2WDQ B;  1V1P B;  4GXB A;  3RI7 C;  2KQS A;  3T8M A;  2R61 A;  4OW0 A;  4C56 C;  2LUM A;  2DZI A;  2ZNV B;  3BVM A;  4C7Z A;  3RNG C;  3PSE B;  3JSV A;  2DLB A;  1WGG A;  1WSP A;  4MAC A;  3ZNZ B;  4MJS B;  4REZ A;  1ZGU B;  3RD2 A;  4W9C A;  1ZE3 D;  3L0W B;  1KH0 A;  2A5U A;  4HPM B;  1S3S G;  2KMA A;  2QIE B;  2X38 A;  2KLG A;  2D3G A;  3PRM B;  1L0Y B;  1EU4 A;  3C8Y A;  1C9F A;  2JRH A;  5BMI A;  4NJC A;  2DX5 B;  2QC8 A;  1WRD B;  2IY1 B;  4DQO C;  3IHP C;  4KX6 B;  1MPE A;  4NY0 A;  3HIZ A;  4ZRJ A;  1CK1 A;  1N63 A;  2LMC A;  4WH4 A;  4HRS A;  2I38 A;  3RN9 C;  4ZRP A;  2CHZ A;  4W9K A;  1AW7 A;  1ESF A;  3AE4 B;  3KVF B;  1YN5 A;  1FNU A;  2BTE A;  2OOB B;  3I57 A;  3PGE A;  3DOW A;  3SR6 A;  3FIL B;  2V3P A;  1DOX A;  1F9J A;  3M62 B;  3RPF C;  2G3Q B;  2L76 A;  1WFY A;  1RLF A;  5D3I B;  2M8S A;  1P7F A;  3AM9 A;  3SD5 A;  1XXG A;  3QQ8 B;  1BUI C;  2JSV X;  4NQL B;  5CX3 A;  4BZA A;  2DHZ A;  5BO4 B;  3ALB A;  2M1M A;  3ZRF A;  3RNA C;  2JZZ A;  1WM2 A;  4LJO B;  4RGM A;  3QK0 A;  2LVP A;  2R2Q A;  4YSY B;  1C1Y B;  2KNB A;  2WXL A;  3P4Q B;  4NJ6 A;  1RM6 C;  1GC7 A;  3AMZ A;  2AQ3 B;  4DHJ D;  3R2T A;  4WQM A;  4JLC A;  3AED B;  3WAL A;  3PV1 A;  4WJN A;  4ZRI A;  1C79 A;  4JQW C;  1BT0 A;  3APC A;  3V61 A;  1T3Q A;  3O13 A;  3DDC B;  3X0W A;  2LZ6 A;  2JXX A;  2LXA A;  2IDY A;  3NVY A;  3UQA A;  4II3 B;  3PT2 B;  3KUC B;  4J3O D;  1C77 A;  1PYW D;  4TKN A;  4M0W B;  4DXA B;  1ISN A;  4RGT A;  3FIL A;  4M0W A;  2GBK A;  5J2R A;  3L08 A;  1UUP A;  3M95 A;  3H7P B;  4KDL B;  3AXC A;  2MEK A;  2B76 B;  3WAN A;  3EUB 2;  2NR2 A;  4DK5 A;  3ZXR A;  5DPR A;  2GBM A;  2KWU B;  2KT7 A;  5D7G A;  4F7Z A;  3TJP A;  2L0F A;  1JRU A;  2DZJ A;  3QHT A;  1NEK B;  1I4H A;  2QCZ A;  5CHV C;  1YOV B;  2GLS A;  3PPA A;  4OZC A;  3OLM D;  1TS5 A;  3RT3 B;  1SB3 C;  5IAA C;  3RNE C;  1PGB A;  3QX1 A;  1ACC A;  1J7C A;  2HE7 A;  4FHK A;  1FIQ A;  2RMM A;  2RSU A;  2AQ2 B;  4M01 A;  4IG7 B;  3WIM A;  2GI9 A;  1SE2 A;  2K9X A;  3IBE A;  4W9H A;  3OAW A;  4BFR A;  5GXG B;  2PLP A;  3P42 A;  3A9J B;  3H9D A;  3RUL A;  3P4P B;  1VR9 A;  2KZR A;  3A9J A;  3Q69 A;  1R4M I;  3IT4 B;  2WU5 B;  4FN2 A;  5C1Z A;  2J7Q B;  1XCQ L;  1TKE A;  2QIL A;  3I3T B;  4YTP B;  2D07 B;  1T5X D;  2K0P A;  5HKH A;  5BYQ A;  4RCO A;  4GU2 A;  4G3X B;  4K1R B;  4RNA A;  1E5W A;  5D3D A;  3PVL A;  4TQ1 A;  4OZB A;  2WLB A;  2AQ1 B;  1TYG B;  1N61 A;  1P98 A;  2LD9 A;  3URY A;  3ZVV A;  3GE8 C;  4LCD E;  1C4C A;  4LLG M;  2LVQ A;  2XN9 C;  3V60 A;  2WXR A;  1NI2 A;  3NVZ A;  4IM2 A;  3UGB B;  2OJR A;  1MVK A;  2KX3 A;  3I5J C;  3LB8 C;  2W82 A;  1IGC A;  2FUH B;  1IBX B;  2KJH B;  4IM3 A;  2NTT A;  3AE8 B;  4ANW A;  3N1Z C;  4F1S A;  2M19 A;  1N60 A;  1YX6 B;  1X1M A;  3WCQ A;  2O6V B;  1UZX B;  1E7P B;  1XLN A;  4NAM A;  3ZDM C;  4O1N A;  3U30 A;  3WAM A;  1T6B X; 
#chains in the Genus database with same CATH homology
 3DVG Y;  4ZRK A;  5D94 A;  2G45 B;  4ZYN A;  3W1Y A;  4URK A;  3H6N A;  4GDK B;  1L7Y A;  1VCB A;  2JRI B;  2KVR A;  1T0Y A;  1V5T A;  3ZTD A;  2W9N A;  3MHS D;  1J0G A;  5CHF A;  4EFO A;  1L2N A;  1E8W A;  2LGY A;  1GC6 A;  2DZK A;  2L3Z A;  2MBB B;  2O6V D;  4HJK A;  4MSQ B;  2L05 A;  2N1V A;  4JIO U;  1V49 A;  1NBF C;  2MBQ A;  3QAR A;  4FHJ A;  5IA7 A;  3HM3 A;  2KWV B;  4HK2 A;  3KH0 A;  4IUM B;  4XX5 A;  3VQI A;  3VHT C;  4AOF A;  1WZ0 A;  4DHZ E;  1M94 A;  4RMA A;  1KM7 A;  4HDO A;  3ZNH B;  3OJ3 A;  3TIX A;  4KSL C;  4PS8 A;  1SE9 A;  3VVW B;  3ZTC A;  4EZL A;  2KDE B;  3OJ4 B;  4GSW A;  3TBL D;  4PS7 A;  1NDD A;  1Q0W B;  3ZNI D;  4M8M A;  1WH3 A;  4TUU A;  2ZCB A;  2CHW A;  2RD0 A;  5D6J B;  4PYZ A;  2UYZ B;  2KD0 A;  4W9E A;  2PE6 B;  4WWO A;  3H1U A;  5FR6 A;  3X23 A;  4TQ0 A;  1WGD A;  4EZJ A;  2KKC A;  2BKF A;  2KTR A;  3R7R A;  1E90 A;  4WWN A;  1E8Y A;  1WMH B;  2BGF A;  1V6E A;  1Z2M A;  2NCN A;  2KTR B;  2MA9 B;  4HXD A;  5J18 A;  3PRE A;  1GUA B;  3K9P B;  1UGM A;  1EUV B;  1ZW7 A;  2L0T A;  4BOS C;  5JZE B;  2EMS A;  4OVV A;  2V4L A;  3QA8 A;  4HCN B;  5LXH A;  1IPG A;  1WX9 A;  2C7M B;  2HTH A;  2KMC A;  3Q3J A;  1YD8 U;  1Z5S B;  2BF8 B;  3NZU A;  2NBU A;  3DVG X;  4BBN C;  3H7S A;  4B95 A;  3ECI A;  5E6N A;  2N4F A;  3LDZ E;  2Z0D B;  3A9K A;  3A4R A;  2LGD A;  4BOZ B;  1H4R A;  2C7H A;  2WYQ A;  3VFK A;  2WX0 A;  3QC8 B;  5D2M B;  2LWP A;  3DVN V;  2CS4 A;  4DHZ B;  1LQB A;  1UEL A;  3IFW B;  3EEC A;  3N3K B;  1RAX A;  2GOW A;  3APF A;  2Z0E B;  2KHW B;  3JYU A;  3N32 A;  4WJQ A;  2JUO A;  4DHJ B;  2JZ3 B;  3DBR I;  1LXD A;  3L16 A;  4GDL B;  1XQQ A;  3BY4 B;  4BKS A;  2IO1 B;  3PRP B;  3VUY A;  5KHQ A;  4ICV A;  2GBJ A;  4MJS A;  3V62 A;  3SDL C;  4FJV B;  2KOX A;  2DZM A;  3W1S A;  1Y8R C;  4K7U A;  2ZEQ A;  4NAW B;  2G4S A;  4IC7 B;  4IM0 A;  2Y5B B;  3Q3F A;  2KJ6 A;  4I6P A;  1WM3 A;  4LJP B;  3WA0 A;  3VTW A;  4TV3 A;  3VDZ A;  2AWT A;  1MG8 A;  3AU5 A;  2L7R A;  3JVZ X;  3HK0 A;  3M63 B;  4EZK A;  4AJW A;  2ZZP B;  1YQB A;  4DWF A;  3VUX A;  3D32 A;  3NOB A;  1WY8 A;  3IVF A;  4GMV A;  2KN5 A;  1WGH A;  1WIA A;  2EKE C;  1I35 A;  2XK5 B;  2K6Q A;  2AEH A;  3QIJ A;  2BYF A;  3C0R B;  3DCG A;  1WX7 A;  3APD A;  4XZ4 A;  4GIV A;  4A3P A;  3PHW B;  2HJ8 A;  2JWZ A;  1KOT A;  3MTN B;  2MP2 A;  5EDS A;  1YJ1 A;  2BWF A;  2V1Y A;  5AZF A;  2MP2 B;  4KIK B;  3LJ3 A;  4DBG A;  2FCN A;  1UBI A;  2L8J A;  4K7S A;  2JF5 A;  1WYW B;  2JPH A;  3B1L X;  4PYU A;  1WGY A;  2YVC A;  2N9E B;  2IBI B;  3KYD D;  2LI5 A;  3O65 B;  1P1A A;  4XC2 A;  4EKU A;  1WJ4 A;  2N1W A;  1WXM A;  3M3J A;  5LXI B;  1H8C A;  2K6D B;  4IWO A;  4FBJ B;  5E6P A;  3A9K B;  3NY5 A;  3PLV A;  4AP4 C;  3ML8 A;  2KX0 A;  2FID A;  4G0N B;  4BKG A;  2JT4 B;  2LGX A;  4MGI E;  4GXB A;  3DBH I;  4WJO A;  2KQS A;  4PS3 A;  3T8M A;  2MW5 A;  1WJN A;  2ZCC A;  1R4N I;  3WAP A;  4NJ7 A;  3L54 A;  1Q1O A;  2DZI A;  1EO6 A;  2KLC A;  2K8C A;  2GBN A;  2ZNV B;  4ANX A;  2ZPY A;  2MWS B;  3PSE B;  2KJR A;  3JSV A;  1WI0 A;  2L00 B;  4W9I A;  1WGG A;  2ZVN A;  2UWQ A;  4LDT B;  4GDK A;  1E8X A;  4MJS B;  3ZNZ B;  5JHA A;  1KLV A;  4HLE A;  1ZGU B;  4JL9 A;  3CSF A;  3JSV B;  4KSK C;  3RD2 A;  2O2V A;  4W9C A;  2IO2 B;  2CR5 A;  4KV2 A;  3L0W B;  4HCP B;  2A5U A;  3ZLZ A;  2C5L C;  4HPM B;  3QJZ A;  5AZG A;  3UIN B;  2FNJ B;  1S3S G;  2KMA A;  2NPT A;  3L17 A;  2KFK B;  3VTV A;  1WMH A;  5LLI A;  2KLG A;  2D3G A;  4MH0 E;  3PRM B;  3B08 A;  4N9F 4;  4W9D A;  2R2O A;  5JH5 C;  1QZE A;  4MEL A;  2MLB A;  3HM6 X;  4KIK A;  4NAW A;  2YLM A;  3V6E B;  4NPN A;  2JRH A;  3EFU A;  3PHX B;  4B9K A;  1OTR B;  2DX5 B;  1RFA A;  1WRD B;  2XEW A;  2IY1 B;  2NBW B;  3IHP C;  1J8C A;  1TGZ B;  2KTF A;  1WF9 A;  2BYV E;  2ZNV C;  1KJT A;  3HIZ A;  4NY0 A;  2K39 A;  3P2B A;  4KZC A;  2PPH A;  4ZRJ A;  4E74 A;  2XK5 A;  2N9P C;  2KC1 A;  5GMV A;  3RUI B;  4DDI D;  4MEM A;  4K81 A;  2JY6 A;  2CHZ A;  4W9K A;  4FA6 A;  1V2Y A;  4ZDV A;  3ZUN A;  3UQB A;  5DCN A;  2MRP A;  4W9F A;  2MCN B;  2M0X A;  2AYO B;  4MGY E;  1OGW A;  3KVF B;  4KVG B;  4B6W A;  4EEW A;  2OOB B;  1OEY J;  3PGE A;  1J19 A;  2PJH A;  3DOW A;  4FJY A;  1F9J A;  3M62 B;  4ANV A;  2G3Q B;  2KAN A;  2L76 A;  1WFY A;  1RLF A;  2J0M A;  2ZVO A;  4X57 B;  1GG3 A;  3S2A A;  2M8S A;  1EF1 A;  1V80 A;  3H7P A;  2LVO A;  3SD5 A;  2O2V B;  4IWQ A;  2KFJ A;  3ONS A;  3RCZ A;  3ZKJ C;  4OVU A;  3QQ8 B;  5DPW A;  2IZV B;  4NQL B;  5CX3 A;  2DHZ A;  4AUQ C;  1YIW A;  5BO4 B;  2KWC A;  3ALB A;  1S1Q B;  2M1M A;  2KK8 A;  2KFK A;  3ZRF A;  2BYE A;  2J0J A;  2JZZ A;  4K7W A;  1WM2 A;  4LJO B;  1WR1 A;  4BVU C;  3QK0 A;  2LVP A;  1WXS A;  2R2Q A;  1C1Y B;  2KNB A;  1EF5 A;  3NS8 A;  2CHX A;  4NJ6 A;  2D11 A;  3KUZ A;  4HDQ A;  3SHQ A;  3DPD A;  4GOC A;  3UIO B;  1G6J A;  1GC7 A;  2N9X A;  1XD3 B;  2VRR B;  2RPQ A;  2DYO A;  3DBS A;  4DHJ D;  2GBR A;  1A5R A;  4JLC A;  2WDT B;  1WX8 A;  3WAL A;  3PV1 A;  4WJN A;  1TBE A;  4ZRI A;  2B3A A;  2DYM A;  3R66 C;  4JQW C;  3HHM A;  3GOE A;  4HVB A;  1YX5 B;  3TCA A;  1BT0 A;  3APC A;  3TMP B;  4BBN F;  2GMI C;  3AU4 A;  3V61 A;  1C3T A;  3ZW3 A;  3DDC B;  1LFD A;  3X0W A;  1GJZ A;  2LZ6 A;  2N7D A;  2MQJ A;  4AJY B;  2JXX A;  3K9O B;  4GGQ A;  2KDI A;  2LXA A;  2BPS A;  4LDT D;  2C9W B;  4CO7 A;  3UQA A;  4II3 B;  2FCQ A;  5DPS A;  2LJ5 A;  2RGF A;  5AZH A;  3PLU A;  3PT2 B;  1P0R A;  3KUC B;  3R3M A;  2CKH B;  4EOY A;  3NHE B;  2Z59 B;  1FXT B;  1WJ6 A;  4II2 B;  4TKN A;  3U8Z A;  4M0W B;  4DXA B;  2IO3 B;  4MM3 A;  1RRB A;  3VUW A;  3CMM B;  3DBL I;  3IG3 A;  1ISN A;  1Q5W B;  1LM8 B;  2FCS A;  4IW0 A;  3VH4 B;  4BKT A;  5E6O A;  3ZRC A;  1D3Z A;  4W9L A;  2GBK A;  3QWZ B;  3EC8 A;  5J2R A;  3L08 A;  2IY0 B;  4HPL B;  2KQ7 A;  3UF8 A;  3ZNG C;  2IYD B;  3PZD A;  2LAS A;  4F8C B;  1CMX B;  5CHW A;  1E7U A;  4I6L B;  3JW0 X;  3M95 A;  3H7P B;  4KDL B;  3AXC A;  1WE7 A;  3WAN A;  3ML9 A;  4GN1 A;  5L95 C;  3QAQ A;  1WR6 E;  1XT9 B;  4G11 A;  2NR2 A;  3VTU A;  4DK5 A;  3DVN U;  1IP9 A;  4E3C A;  5DPR A;  3GZN I;  2GBM A;  2KWU B;  4M8N A;  5D7G A;  4FAD A;  3UIP B;  3KW5 B;  3RZW C;  4F7Z A;  2C7N B;  5JHB A;  2I1J A;  3L13 A;  3V6C B;  3TJP A;  1AAR A;  4NQK E;  1P3Q U;  2LRU A;  4W9G A;  2L0F A;  1JRU A;  1VD2 A;  2DZJ A;  3QHT A;  4MSM B;  2PEA A;  5CTR C;  5CHV C;  5J17 A;  4AWJ A;  2NPT B;  1WXV A;  3PPA A;  1K8R B;  3A33 B;  2A4Z A;  2DYB A;  5AEK B;  3VAW A;  4HWI B;  4WQO B;  4A20 A;  3OLM D;  1P9D U;  3NZS A;  3RT3 B;  1E8Z A;  2MBH A;  5C23 A;  5DPT A;  4MDK E;  5IAA C;  2KO3 A;  2KDF B;  1UH6 A;  2JVC A;  3PTF C;  3QX1 A;  4NNJ B;  2IO0 B;  4WAA A;  1I42 A;  3N30 A;  4WJP A;  2HE7 A;  2FCM A;  4WWP A;  3PRZ A;  4FHK A;  4ASW C;  4EUT A;  3U7D A;  4BKS D;  2RSU A;  3RYT A;  2D10 A;  1TZ1 A;  2QHO A;  2KXJ A;  1U4A A;  2FIF A;  4IG7 B;  1WE6 A;  4DDG D;  1WZ3 A;  1E7V A;  2HD5 B;  4KZ0 A;  3WIM A;  2G4D B;  2AL3 A;  3IBE A;  4W9H A;  3OAW A;  3VXW A;  4BFR A;  1GNU A;  2LRW A;  2C60 A;  3A9J B;  1UBQ A;  2NVU I;  5KHO A;  3H9D A;  2MX2 A;  3RUL A;  2WX1 A;  2NBV B;  2KZR A;  2MBO A;  1V81 A;  2WWZ A;  3A9J A;  3R7Q A;  1V5O A;  2EMT A;  1R4M I;  4GDL A;  4I6N B;  3A1Q A;  2ASQ A;  4FN2 A;  5C1Z A;  3KYC D;  2J7Q B;  3DQV A;  3I3T B;  4JGH B;  4GB9 A;  1V86 A;  2D07 B;  4RM8 A;  4ICU A;  4CHK A;  5HKH A;  3PS6 A;  4GU2 A;  3A1Q B;  4G3X B;  4FUL A;  4K1R B;  2ZJD A;  2PE9 A;  1E5W A;  2I1K A;  3L10 B;  3PVL A;  4TQ1 A;  1V9J A;  3ZIM A;  4E71 A;  4IWP A;  4MGK E;  3BIN A;  3QCA A;  1WGR A;  2K25 A;  3AUL A;  1P98 A;  3AI5 A;  3ZDT A;  2FAZ A;  4A3O A;  2LD9 A;  4ANU A;  2XBB C;  2BWE S;  2ZPN A;  4W9J A;  2K8H A;  3MJW A;  3ZVV A;  1OEY A;  2LXC A;  1SIF A;  3CST A;  4LCD E;  3ZO5 B;  2LVQ A;  3V60 A;  1NI2 A;  2K1F A;  4IM2 A;  3UGB B;  3W1S C;  2K8B A;  2KC2 A;  2OJR A;  1UD7 A;  2AL6 A;  2CU1 A;  2KX3 A;  1SGH A;  4G50 A;  5G2N A;  1TTN A;  2FUH B;  4P7I A;  1WJU A;  1OQY A;  2KJH B;  3B0A A;  4IM3 A;  3A4S C;  3SU8 X;  2MSE D;  4FLH A;  4KDI C;  2KDB A;  3CF6 E;  4ANW A;  3T9L A;  4F1S A;  1IYF A;  2NS5 A;  1ZKH A;  4YL8 A;  3RZF A;  5L83 A;  2DAJ A;  2D2Q A;  1PQS A;  2RR9 A;  4FJZ A;  1WXA A;  3WAO A;  4CYE A;  1HE8 A;  3VH3 B;  2DEN B;  4RM9 A;  1YX6 B;  1X1M A;  2M4N A;  1UZX B;  2MBE A;  2O6V B;  4J6I A;  2N7E A;  5TR5 A;  3ZDM C;  2LUE A;  2J0K A;  2BKR B;  3TL5 A;  3U30 A;  2M17 A;  2O6V A;  2V3S A;  2REX A;  3ENE A;  3EHV A;  3KUD B;  2DAF A;  3WAM A;  4MGZ E;  5G55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...