3M95A

Crystal structure of autophagy-related protein atg8 from the silkworm bombyx mori
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
115
structure length
115
Chain Sequence
MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autophagy related protein Atg8
publication title Structure of autophagy-related protein Atg8 from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
molecule tags Transport protein
total genus 34
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m95A00
3DCGA 2KTRB 5BO4B 1KM7A 3NZUA 2DX5B 4GXBA 1GC7A 2KKCA 1WE7A 1WGHA 1R4NI 4FJZA 4HCPB 5L95C 2C5LC 2BYEA 4HXDA 4TQ1A 4HWIB 2L3ZA 3V60A 4MGYE 4GMVA 3CF6E 1E8WA 3ZO5B 2CHWA 3KUCB 2KFJA 3K9OB 1R4MI 2L05A 2V3SA 5J18A 2JF5A 3VHTC 2REXA 3DOWA 2JRHA 3KUDB 4NAWB 3V62A 2KD0A 2N7DA 2EMTA 2KWVB 1UBIA 4WJPA 3DBLI 3RULA 2JT4B 1P1AA 3A4SC 3KW5B 2IY0B 5AZGA 4MSQB 3NZSA 4GU2A 3RT3B 4FN2A 3K9PB 5CHWA 3U30A 3PPAA 4GOCA 2MP2B 3PTFC 1C3TA 2C7MB 1K8RB 2LWPA 3APDA 5CTRC 3A9KA 1V9JA 4F1SA 4MJSA 2RSUA 1LFDA 2EKEC 2VRRB 3TMPB 4A3OA 3B1LX 2LI5A 2KDFB 3VAWA 1LQBA 1UBQA 3QA8A 2CHZA 2KDIA 3PRZA 1WR6E 4KV2A 3DPDA 1ZKHA 2WX1A 3L0WB 4HJKA 4WJOA 2K8BA 1T0YA 2C60A 4HDOA 4IWOA 3QARA 2EMSA 1WZ3A 1SIFA 3L54A 1WM2A 2KLCA 2L76A 3PV1A 3UINB 3HM6X 4BKSD 3TCAA 2DYOA 3A9JB 2Z59B 3L17A 4JIOU 2V1YA 2DZIA 4A3PA 1G6JA 4DBGA 3PLVA 2RR9A 2O6VB 2N1VA 1F9JA 1E8YA 4PS7A 4IUMB 4EFOA 4HPLB 2YLMA 1A5RA 4BOSC 3L10B 4N9F4 2KTRA 3KH0A 1RLFA 3ZKJC 2FNJB 4W9KA 4ASWC 3H7SA 1P3QU 3KYCD 4II2B 3WAMA 4BVUC 2GOWA 1WGDA 1V80A 4K7SA 3QHTA 4IM3A 2N9EB 2N7EA 1E8XA 3WIMA 2NPTB 3PS6A 2KZRA 2MWSB 3JYUA 1UD7A 1WRDB 2KJ6A 4K81A 4I6LB 5JH5C 3N32A 1E7VA 1OEYA 3PVLA 4W9DA 3P2BA 3UIPB 2KO3A 4ZRKA 3IBEA 2KQ7A 5DPTA 2DYMA 1TBEA 2HE7A 2IO0B 1H4RA 4AP4C 4YL8A 3RD2A 5E6NA 2DZKA 4NAWA 2LVQA 3VTVA 4BFRA 1PQSA 3TIXA 1RFAA 2ZPYA 3X23A 2IO3B 2BGFA 2K1FA 4IC7B 1P9DU 2IO1B 2JVCA 3ZNGC 3APFA 4DWFA 4FJVB 2O2VB 1MG8A 4ZDVA 1I42A 2NBUA 2LRWA 2MA9B 3HIZA 3ZTCA 3ENEA 4G11A 2MP2A 3ZTDA 4RMAA 4W9IA 3VUWA 5D94A 4DHZB 3QWZB 2KC1A 1V86A 2LUEA 3PT2B 4GDKB 3U8ZA 1KLVA 2NBVB 3U7DA 5JHBA 4W9LA 5GMVA 4AJYB 1UZXB 1YX5B 4W9GA 2KJRA 3QIJA 5DPRA 2KC2A 2KX0A 4NPNA 3IG3A 5CHVC 4K7UA 2CS4A 1V6EA 4FULA 4JGHB 4OVVA 4E3CA 2PE9A 2NS5A 4K7WA 3VUXA 2CR5A 4GDLB 2G45B 2JZ3B 3ZRFA 4NQKE 2FIFA 1XD3B 4K1RB 4DK5A 1Z5SB 2DENB 4HDQA 3B08A 3ZRCA 3A9JA 4LDTD 4E74A 1GJZA 2C7HA 2BYVE 3R7QA 3VUYA 2JZZA 3OLMD 4XX5A 4ZYNA 3X0WA 3ALBA 2O6VA 4AOFA 2G4DB 4AJWA 4KIKB 2C7NB 5E6PA 2KK8A 4WWOA 2N9PC 4I6PA 1AARA 2L0TA 4P7IA 4DDID 3NOBA 1Z2MA 4CO7A 1J0GA 3N30A 4PS3A 2KQSA 4DHZE 3ZUNA 4TKNA 2D2QA 4MSMB 1E5WA 3JW0X 4MELA 1SGHA 2ASQA 3QAQA 1EO6A 2HJ8A 2NPTA 1WE6A 4WAAA 2J0KA 5LLIA 3ML9A 3QCAA 2UWQA 1OQYA 5L83A 3V6EB 2HD5B 3DVGY 2BF8B 3H9DA 3KUZA 2CU1A 1WZ0A 1XQQA 3H6NA 2DYBA 4MH0E 3V61A 1WX9A 3PGEA 4B9KA 5JHAA 3MJWA 2L00B 4KSKC 4DHJD 4PS8A 2YVCA 4HPMB 2GBJA 4DDGD 1V5OA 1IYFA 2BKFA 1ZGUB 1OEYJ 1WXVA 3KVFB 3NHEB 3VQIA 3M3JA 5E6OA 2PJHA 3GZNI 4OVUA 3DDCB 4KDLB 2O2VA 3APCA 3DBHI 4BBNF 1Q1OA 3A1QB 4EKUA 4BKTA 2DAJA 2JY6A 3Q3JA 5FR6A 1WJ6A 3UQBA 3BY4B 3OJ3A 3SD5A 1V5TA 2RD0A 1E7UA 4TUUA 5DPWA 2MBOA 3WA0A 4W9JA 4ANVA 4W9EA 4GDKA 3WANA 2LVOA 2KXJA 3GOEA 4W9FA 3TJPA 1WXMA 3R66C 4LJOB 3H7PB 1GC6A 2J0MA 1WI0A 2BYFA 3PLUA 4WQOB 3RZFA 3W1YA 3PZDA 4WJNA 2CKHB 4AUQC 4ANWA 3VVWB 3DVNV 3PRMB 5C23A 2LGDA 2IY1B 2KX3A 2ZNVB 3A4RA 3ZNID 2L7RA 3ZW3A 3EC8A 4GDLA 2LZ6A 4HK2A 2KFKB 3UQAA 2KWCA 3B0AA 1TZ1A 3DQVA 4PYZA 4MEMA 4ZRJA 1V49A 3ZDMC 4IWQA 4CHKA 3AULA 3MTNB 4NJ6A 4FADA 2M8SA 1EF1A 2KMAA 2MBQA 1TGZB 3ZNHB 2ZZPB 3VXWA 3HM3A 1CMXB 2JPHA 4KIKA 1XT9B 3M95A 3V6CB 2C9WB 4ICVA 4IW0A 5IAAC 1X1MA 3IVFA 2W9NA 3JVZX 4NY0A 3LDZE 2MBHA 4TQ0A 3N3KB 2ZCBA 2GBMA 2KLGA 3H1UA 2WWZA 4GSWA 1WF9A 4WWPA 3W1SA 5IA7A 1RAXA 5AZFA 4F8CB 4FHJA 4IM0A 2QHOA 2V4LA 5AEKB 3WALA 2K8CA 2WDTB 1RRBA 3SHQA 1FXTB 2BWFA 2LVPA 3VH4B 3RZWC 2KWUB 2KMCA 4DXAB 2LXCA 2KVRA 1NBFC 4EOYA 3UGBB 2BPSA 2LGXA 2LD9A 1S3SG 5D6JB 3W1SC 4ANXA 4BOZB 4EEWA 2FCMA 5J17A 3UIOB 4B6WA 4W9CA 3CSTA 3A1QA 3DVGX 2AL6A 4JL9A 2FCQA 2M17A 3Q3FA 2LJ5A 2Z0DB 3IFWB 2MBBB 1E8ZA 4WJQA 4MDKE 5JZEB 2MLBA 2MBEA 4EZKA 3H7PA 1WXSA 1WXAA 4KSLC 1P0RA 3I3TB 4JQWC 2CHXA 3LJ3A 3ZDTA 2MQJA 2MW5A 3T9LA 4FA6A 2IYDB 3D32A 4II3B 1HE8A 3L08A 1Y8RC 4MGIE 4AWJA 3T8MA 3ONSA 2JWZA 1WMHB 1WGGA 4I6NB 4KZCA 4JLCA 2ZVNA 4FBJB 2KFKA 2G4SA 1YQBA 4XC2A 2XBBC 4M8NA 1GUAB 1D3ZA 3JSVB 2KOXA 3QX1A 3TL5A 1WX7A 3CMMB 4MGKE 2K39A 3R7RA 2K8HA 2UYZB 3ML8A 2Y5BB 2GBRA 3C0RB 5G2NA 5AZHA 2KHWB 2NR2A 2Z0EB 2ZNVC 2NCNA 3SU8X 1M94A 4URKA 1L2NA 1UGMA 1UELA 1SE9A 3CSFA 1E90A 4BKSA 3DBSA 2KTFA 1QZEA 4LDTB 2K6QA 2AEHA 4E71A 5TR5A 1WM3A 2M4NA 2AL3A 1OGWA 3DBRI 4ANUA 3EFUA 5C1ZA 4TV3A 4RM8A 4J6IA 2J0JA 1YIWA 2D10A 1J8CA 1WH3A 3PSEB 1P98A 1WGYA 2M0XA 1ISNA 3AU4A 1BT0A 2PE6B 3L16A 5G55A 5D7GA 2JXXA 5EDSA 2GBKA 3ZVVA 3MHSD 1LM8B 3OAWA 3AI5A 3OJ4B 1ZW7A 1TTNA 2PEAA 2OOBB 2BWES 2MRPA 4ZRIA 4EZLA 1U4AA 4NQLB 3UF8A 1EF5A 1I35A 2AYOB 3RYTA 1Q0WB 4FHKA 5LXHA 3HK0A 2L8JA 3PHXB 1C1YB 1JRUA 2GBNA 4DHJB 2OJRA 3VTWA 2I1JA 3EECA 2O6VD 4X57B 2DAFA 2RPQA 2B3AA 2N4FA 2D11A 2A4ZA 4ICUA 1WJUA 2DZJA 1WY8A 1L7YA 4KVGB 3ZLZA 5KHQA 2BKRB 4EZJA 4XZ4A 3AXCA 2R2OA 4FJYA 2RGFA 3PRPB 4B95A 4GN1A 5D2MB 1YX6B 1UH6A 1KJTA 3HHMA 4G3XB 2LASA 3A33B 4GB9A 2XK5B 1EUVB 1GNUA 2HTHA 2A5UA 1WIAA 1WYWB 1V81A 1WMHA 3QK0A 4IG7B 3IHPC 1KOTA 1LXDA 3NY5A 1VCBA 4LJPB 2GMIC 3O65B 1NDDA 3NS8A 2FCNA 2FAZA 2ZVOA 3WAOA 3JSVA 5CX3A 4M0WB 2LGYA 2KNBA 3QC8B 3RUIB 2FIDA 2ZPNA 4FLHA 4NJ7A 2NBWB 2L0FA 5J2RA 2XEWA 1VD2A 2KJHB 2LRUA 2NVUI 2DHZA 1WJNA 2KDBA 3S2AA 4GIVA 1WJ4A 2K6DB 5KHOA 3QQ8B 1NI2A 2ZJDA 1S1QB 3ZIMA 2ZCCA 4G0NB 4IWPA 2MX2A 1GG3A 3DVNU 3R3MA 1H8CA 5HKHA 3VTUA 4WWNA 3WAPA 3VH3B 2N1WA 4MM3A 2JUOA 5DPSA 4M8MA 1WR1A 4RM9A 4HLEA 4EUTA 1IPGA 2IO2B 4W9HA 1Q5WB 5CHFA 2K25A 3TBLD 5LXIB 4KDIC 3BINA 3ECIA 3ZNZB 1YJ1A 4PYUA 2KANA 2N9XA 3PHWB 2FCSA 2DZMA 2D07B 3M63B 2KN5A 2LXAA 3QJZA 4F7ZA 1YD8U 3A9KB 2KDEB 3PREA 4MGZE 1WFYA 4MJSB 1WX8A 2M1MA 2AWTA 2D3GA 2MSED 4NNJB 3KYDD 2IZVB 4CYEA 2R2QA 1OTRB 4GGQA 3VFKA 4BBNC 2ZEQA 2PPHA 2WYQA 2I1KA 3EHVA 4LCDE 3RCZA 2FUHB 1WGRA 4KZ0A 4BKGA 3AU5A 3VDZA 4A20A 2J7QB 4IM2A 4HCNB 3L13A 1J19A 2G3QB 5DCNA 2XK5A 3SDLC 2WX0A 3M62B 4G50A 4HVBA 1V2YA 2IBIB 1IP9A 2MCNB 2JRIB
chains in the Genus database with same CATH superfamily
3U2SC 3ZJTA 2KTRB 5BO4B 2DX5B 3OG5A 3GB1A 5AUKA 1R4NI 4FJZA 3OWEB 4OW0A 2L3ZA 1E9MA 2DWQA 1FFUA 3KUCB 2V3SA 5J18A 2JF5A 2ICIA 2REXA 3DOWA 2KD0A 3U4EG 3C8YA 4BZAA 3I57A 3ZXRA 2JT4B 2W82A 4GU2A 1C77A 4FN2A 3K9PB 5CHWA 1XCQL 5EE1A 3PTFC 2C7MB 1GB4A 1V9JA 4MJSA 2RSUA 3TMPB 2LI5A 1NEKB 1QKZA 2LEKA 5BYRA 4ZRPA 1ZKHA 5BMGA 1ENFA 2K8BA 2C60A 4UDUC 1ZDXA 1E7PB 3TCAA 2X8XX 4DBGA 3PLVA 4XWWA 3RNGC 1I4XA 3AEFB 2KTRA 2FNJB 1Y56A 4RFBA 1P3QU 3BVGA 1WGDA 2BB5A 3QHTA 3Q14C 4IM3A 2N7EA 3WIMA 3Q6BA 2NPTB 3B9JA 1WRDB 4K81A 1E7VA 1BXTA 2KO3A 2RPVA 4P6VF 1Q10A 1TBEA 3RD2A 2DZKA 1FNWA 3DHHC 3TIXA 1RFAA 3V3XA 2BW2A 2IO3B 3KQ4A 2IO1B 2G1EA 2LRWA 2LHDA 2J53A 4C4VB 3ZTCA 3Q3NC 1HTQA 1UWMA 3ENEA 4G11A 1ROEA 1CZPA 1QF6A 4DHZB 2KC1A 3PT2B 2AQ2B 2NBVB 3BYYB 1UZXB 1TJEA 4W9GA 3HVZA 4NPNA 1YMHE 3VUXA 2KQ4X 1IBXB 3EFCA 3N1ZC 4HDQA 4LDTD 3AE4B 4HEA1 2BYVE 3R7QA 2JZZA 3OLMD 1T5XD 4AOFA 1E6EB 1FM0D 1QOBA 2JXTA 3RPFC 3RNAC 4ZHPA 1YNTE 1J0GA 3N30A 3ZUNA 2D2QA 3JW0X 1SGHA 2ASQA 2PMVA 1EO6A 1F1HA 2NPTA 3ML9A 2UWQA 3P4RB 2WS3B 2HD5B 3DVGY 1FEHA 4WWMA 5JHAA 1I4QA 3MJWA 2ZW0A 2YVCA 2INDC 1OEYJ 3NHEB 2AQ3B 3M3JA 3DDCB 3DBHI 5TSSA 2BB6A 4C4VA 3A1QB 4EKUA 4BKTA 5C2TB 4EE2A 1K51A 3BY4B 3SD5A 1KH0A 4W9JA 4HROA 4W9EA 2KXJA 4KKIA 3Q3OC 3R66C 3H7PB 2KN4A 1R7SA 3W5VB 4ANWA 3VVWB 5C23A 1QOAA 3GE8C 1IBXA 2L7RA 4HK2A 3UQAA 2GB1A 3B0AA 4IWQA 1MI0A 3AULA 4FADA 2KMAA 1TGZB 3EA6A 1CMXB 4FXCA 4IW0A 5IAAC 1X1MA 3N3KB 2XNAC 3IT4B 3ZJUA 5IA7A 3NVZA 5AZFA 4IM0A 3WCQA 5AEKB 2WDTB 1FXTB 3RZWC 2WDQB 1QLBB 4EEWA 3KWLA 1BUIC 4B0EA 5J17A 3CSTA 3A1QA 4JL9A 2M17A 3Q3FA 1OQRA 4MDKE 5JZEB 4EZKA 3H7PA 4KSLC 2RDHA 2CHXA 2JU6X 2MQJA 2MW5A 3T9LA 3C19A 2YEPF 2WXGA 3ONSA 2JWZA 1WGGA 2ZVNA 3Q2AC 1JW9D 1D3ZA 4YT0B 3TL5A 3CMMB 2PVOD 2K39A 1C4AA 2VH2A 5AZHA 2Z0EB 1D5MC 4BKSA 1E90A 2KTFA 2NMQA 2LMCA 1JROA 2ZW1A 2GI9A 5H92C 4Q2JA 3Q8FA 3TEZA 2D10A 1J8CA 3PSEB 1WGYA 2M0XA 1XLNA 3L16A 5FR3A 1DYQA 3OAWA 2PEAA 3I9V1 4JX1C 4LTUA 4ZRIA 1U4AA 1SEBD 3E56A 1EF5A 5LXHA 3HK0A 4ACFA 3N20C 3U52E 2I1JA 1C4CA 2SAKA 2DAFA 4MSMB 1TY2A 1WJUA 2QILA 2WXJA 1PYWD 1JWAD 3AXCA 2BS4B 1P7EA 4B95A 1YX6B 1UH6A 2GLSA 1KJTA 1F0ZA 4G3XB 4DHZE 3QK0A 1EUVB 1NI3A 2HTHA 1LXDA 3ZYYX 3NY5A 1ET9A 1VCBA 2KACA 3O65B 3WAOA 4M0WB 2KNBA 2ZPNA 3O13A 1XF5L 5FK9C 1VD2A 4BAXA 2NVUI 1WJNA 2KDBA 1XCTL 4GIVA 2K6DB 4RF1A 2Y3AA 3VRAB 3DWMA 1XLPA 4IWPA 3DVNU 1IGCA 4WWNA 1SXTA 2MHJA 1QOGA 5HHDG 2JSVX 2JUOA 3FKYA 4W9HA 2K25A 3TBLD 2K0PA 3Q8BA 1PDXA 3MC0B 2KN5A 2KDEB 2VZKD 1WFYA 3IT6B 3KYDD 2WU5B 4CYEA 2R2QA 1IUEA 1YJJA 3FC4A 2WYQA 2I1KA 1V97A 2IJ0A 4JPSA 4TMAB 4IDIA 2WP9B 1MPEA 4HCNB 2RDBC 1EU3A 2WX0A 3M62B 3VR9B 2IBIB 1IP9A 2GRIA 2K3UA 1EM7A 3NZUA 4GXBA 1GC7A 4M0WA 4HCPB 4WQMA 2C5LC 4HXDA 4TQ1A 1FCCC 4GMVA 3CF6E 1E8WA 2E6XA 2KFJA 3U7ZA 4XE0A 2HDEA 3KUDB 2JRHA 3V62A 2QCZA 2DNFA 2N7DA 2KWVB 1V1OA 1R4MB 3A4SC 5AZGA 3NZSA 4RNAA 3MP9A 3RT3B 1FRDA 3PPAA 3DBLB 4GOCA 2MP2B 3AECB 1C3TA 4DXFA 3APDA 2BYTA 4ZRQA 1WWTA 5G5GA 1LFDA 1J7AA 2EKEC 1UWXA 3VAWA 1UBQA 3P4QB 3RMKC 1SE4A 2QC8A 3L0WB 2J42A 4ITKA 3QARA 2EMSA 5EE3A 1T0RC 4BKSD 3LYYA 2DYOA 1MG4A 4JIOU 2DZIA 4USAA 1B1ZA 1SIJA 2K5PA 1E8YA 1SF0A 1B9RA 4EFOA 1L6UA 2YLMA 4BOSC 4N9F4 1RLFA 3ZKJC 2IDYA 3KYCD 3AM9A 4BVUC 1V80A 3NVWA 2BS3B 5AUIA 3AE9B 4B0MA 1UD7A 2KJ6A 5JH5C 1TY0A 4W9DA 3UIPB 3IBEA 5DPTA 2KWDA 2INCC 2IO0B 2ONQA 4AP4C 1GPXA 4MACA 4S17A 5E6NA 4BFRA 2BGFA 2K1FA 4IC7B 3AE8B 4FJVB 3HUIA 1I42A 2NBUA 1L0VB 1HTOA 2AX5A 5G5HA 2MP2A 1YN3A 1IGDA 3BVMA 4RMAA 4W9IA 5D94A 3AE3B 4GDKB 3U7DA 2PW9A 4W9LA 4J3OD 1AW7A 5DPRA 5CHVC 4E3CA 4OVVA 4C7ZA 3SFEB 1XLOA 2G45B 4NQKE 2FIFA 2LGIA 4K1RB 4DK5A 1Z5SB 3ZRCA 3VUYA 2WXQA 4LNFA 2L1AA 1N60A 2C7NB 2EKIA 4CO7A 2D5GA 3AEGB 4PS3A 4ARIA 2KQSA 2WGSA 1L4DB 1PGXA 3QAQA 1GOZA 2NTTA 5LLIA 1PUTA 3MFGA 3V6EB 1FXIA 3EGRA 3Q3MC 3H9DA 3B2FA 1WZ0A 1XQQA 3R8BA 2M19A 1WYGA 1WX9A 4PS8A 1I4RA 1IYFA 4DDGD 1V5OA 2BKFA 1WXVA 2WXRA 4YTNB 5EE9A 3SEBA 3NRZA 1MHHE 3GZNI 4KGSA 4KDLB 4AQ7A 4YSYB 1QOFA 5FR6A 1YN5A 3UQBA 2RDGA 4TUUA 2E3TA 4GDKA 2LVOA 3TJPA 1GC6A 3PLUA 3RZFA 2CKHB 4AUQC 2V0GA 5IKCM 2IY1B 3ZW3A 2LZ6A 2KFKB 1T0QC 4MEMA 1V49A 3RFZB 3MTNB 2M8SA 3VXWA 2V9HA 3M95A 4L2YA 1TS3A 3JVZX 4NY0A 1KLUD 3AE6B 2K22A 3H1UA 1WF9A 1ACCA 4NAMA 2QHOA 2V4LA 1C79A 3ZQ4A 3WALA 3PZ7A 2BWFA 2LVPA 4US8A 5C3JB 2KWUB 2KMCA 4DXAB 2LXCA 4EOYA 3UGBB 2BPSA 4HRSA 3W1SC 4BOZB 4B6WA 5D3IB 3DVGX 2AL6A 1ESFA 2Z0DB 1EWYC 2MBBB 1E8ZA 4RGOS 1HEZE 2DLBA 2MBEA 3I3TB 4JQWC 2WLBA 3LJ3A 3ZDTA 2VZKB 4FA6A 2IYDB 3D32A 4II3B 1HE8A 3L08A 4MGIE 1HZ6A 5HI1A 2PLPA 3P4SB 1PFDA 2KFKA 1YQBA 2XBBC 1GUAB 2WDVB 4MGKE 2UYZB 5G2NA 2ZNVC 1HA5A 1UELA 1SE9A 3CSFA 1PGAA 3DBSA 5TR5A 3W5UB 1WXQA 2M4NA 5BMHA 3AEDB 2AL3A 1OGWA 2BBCA 3DBRI 4ANUA 3EFUA 4J6IA 3H8HA 2KMMA 4US9A 3RI7C 5LNK1 1LM8B 3AI5A 3P42A 2W54A 4NQLB 2WNMA 2QMTA 3N1XC 1RFKA 5BMIA 1Q0WB 3R2TA 4FHKA 1C1YB 2V3PA 2HTME 4X57B 5KHQA 4EZJA 2R2OA 4S0RA 5D2MB 4LNIA 2LASA 3A33B 4GB9A 1L5PA 1YJIA 2A5UA 1WIAA 2Z8LA 3PZ8A 3BZDB 2N0SB 1KOTA 3AE2B 3NS8A 2FCNA 2FAZA 1FD6A 3RNEC 1JWSD 4C7YA 4C56C 4NJ7A 4NJCA 2LRUA 1DGJA 1V1PB 2DHZA 2JZPA 2ZJDA 3ZIMA 4G0NB 3R3MA 3ZJVA 3ZGZA 3VH3B 1J7BA 4M8MA 5CHFA 4JE3B 3ZNZB 1YJ1A 2FCSA 2INNE 1UGJA 3M63B 1WGKA 1YD8U 3A9KB 1DOIA 4XDCA 2AWTA 1FMAD 2MSED 2XN9C 1OTRB 4GGQA 2PPHA 3Q8CA 1T0SC 3RCZA 1FPYA 4BKGA 2IGGA 1F2RI 4RGNA 4IM2A 5BYSA 5DCNA 4G50A 4WIPA 4HVBA 2MCNB 2JRIB 1KM7A 2KKCA 1SE2A 2D3CA 5L95C 3LXFA 2BYEA 1MHXA 3V60A 4A6QA 1V1PA 1K52A 1R4NB 3ZO5B 2CHWA 2MEKA 3K9OB 5HFYA 3VHTC 2N7JA 1UNSA 2EMTA 1UBIA 4WJPA 2Y5PA 3RULA 1AWDA 3LB8C 3KW5B 3AV8A 4C80A 1C9FA 4MSQB 3MHZA 3NVYA 1SSNA 1LO5D 1JQ4A 2LWPA 1FFVA 5CTRC 3A9KA 2WU2B 2VRRB 4A3OA 3B1LX 2WXPA 2KVZA 1WR6E 4KV2A 1ZXHA 2WX1A 4WJOA 2JQRB 1T0YA 4IWOA 4HDOA 1NVID 3L54A 2L76A 3UINB 2Z59B 2V1YA 1VZ7A 2O6VB 2N1VA 1CK1A 2J4XA 4PS7A 1AYFA 4IUMB 1A5RA 4ASWC 3B2GA 2LHEA 4K7SA 1E8XA 2KT7A 2WXFA 3PS6A 1F2RC 3JYUA 4JWSC 3PVLA 1OEYA 3P2BA 4ZRKA 2DYMA 4YL8A 2LVQA 1PQSA 1VLBA 2LFIA 1P9DU 2JVCA 1EWCA 4DWFA 1LGRA 1MVKA 2O2VB 1TKEA 4REZA 2MA9B 3HIZA 3BK2A 1KRHA 3VUWA 4HKQA 5JHBA 2WDRB 5GMVA 5E6JA 4AJYB 3P4PB 1YX5B 3GP7A 3IG3A 1VRAB 3KLSX 4K7WA 4DQOC 3ZRFA 1MFWA 4IOIE 2DENB 1GJZA 2C7HA 2B76B 3VRBB 3N1YC 4XX5A 2M0AA 3FAHA 3ALBA 2O6VA 1ET6A 1KF6B 5E6PA 2MJ3A 4YSZB 2N9KA 1ZE3D 4I6PA 1AARA 2L0TA 4DDID 2KYWA 2W3RA 3NS1A 2JX5A 4TKNA 1FIQA 4MELA 2HJ8A 1WE6A 4WAAA 2J0KA 4KX6B 1OQYA 2BF8B 3KUZA 2R61A 2CU1A 2INPE 3H6NA 4MH0E 3V61A 1C76A 3PGEA 2L00B 4HKZE 1KLGD 3BWUD 2GBJA 3KVFB 1ZGUB 3VQIA 1K53A 5E6OA 2O2VA 3APCA 2JY6A 5IP4D 2QEJC 1SJHD 3AE5B 3W2DA 1V5TA 2RD0A 1E7UA 3Q8EA 3DBHB 3GOEA 4W9FA 2J0MA 4WQOB 3P63A 5IO9A 3W1YA 3PZDA 2K9XA 4WJNA 1UF0A 3DVNV 2LGDA 2KX3A 1VDVA 3ZNID 3EC8A 1TZ1A 3CIRB 3DQVA 4PYZA 3W9CB 3ZDMC 1QQRA 4OZCA 1ZPSA 4NJ6A 2TSSA 2BTEA 2MBQA 5T8IA 4YTMB 3IAM1 2JPHA 3TEXA 1XT9B 4ICVA 2FBWB 1KTKA 4HPPA 3N9YC 2ZCBA 2BS2B 1GAQB 2WWZA 4GSWA 4F8CB 4FHJA 2BT6A 4AS1A 1RRBA 4OZBA 2Y5CA 1NBFC 3J9CA 2LGXA 2LD9A 1S3SG 4RCOA 2J52A 4ANXA 2FCMA 1JMLA 3UIOB 4W9CA 4WURA 4K3BA 4WJQA 4XGAB 1WSPA 2MLBA 3AEAB 1L4ZB 1WXSA 1WXAA 1NENB 3BVZA 2CU3A 5BYQA 4OVZA 1TKGA 4PT5A 3TEWA 1Y8RC 4AWJA 3T8MA 1WMHB 1CJEA 4FBJB 2G4SA 4XC2A 1T6BX 1TS2A 1XLQA 2KOXA 1FCLA 1WX7A 2K8HA 3I5JC 3C0RB 4RGTA 3FILB 2KHWB 2W55A 2NCNA 3SU8X 1M94A 4URKA 1YN4A 5JXVA 1QZEA 2K6QA 3AN1A 2RMMA 4E71A 3EUB2 2M56B 3KWVA 4LNOA 4TV3A 4RM8A 2J0JA 1WH3A 3AMZA 3MC8A 3Q69A 1ISNA 1NYQA 3AU4A 5D7GA 2JXXA 5EDSA 1QILA 2GBKA 3AB5A 3ZVVA 3MHSD 4P1BC 2OEDA 1ZW7A 2OOBB 2BWES 4EZLA 2AYOB 1YOVB 4GLSC 2L8JA 3PHXB 1JRUA 4DHJB 2NTSA 3VTWA 2O6VD 1C78A 2B3AA 2N4FA 3ZLZA 1WY8A 1L7YA 2BKRB 4FJYA 3TEYA 4GN1A 2W3SA 1GNUA 1WYWB 1WMHA 4IG7B 1E10A 4JWUC 4LJPB 3AE1B 1RYJA 3E9SA 4MH8A 1CQVA 4FLHA 2NBWB 2L0FA 2XEWA 2KJHB 3FILA 3S2AA 2MJDA 5KHOA 3QQ8B 1S1QB 3NG0A 2MX2A 1H8CA 1XO3A 4R3DA 4TSSA 1N5WA 2WXNA 3WAPA 2N1WA 4DXGA 4RM9A 1WR1A 2WQYB 4EUTA 2IO2B 5LXIB 4KDIC 3ECIA 4ARCA 3PHWB 2DZMA 2D07B 4IKGA 3QJZA 1K50A 3PREA 2WXKA 1WX8A 2M1MA 4L23A 2IGHA 4NNJB 2IZVB 4H2AA 5H8YE 3VFKA 2ZEQA 1RM6C 4LCDE 3ETRA 4HJGE 4KZ0A 2YEPB 4A20A 1XXGA 3L13A 5D3DA 3SDLC 1OQQA 2X38A 4YWGG 3DCGA 2H88B 1HQRD 4ZOHC 5HG2A 1WE7A 4OZAA 1D5ZC 1WGHA 3DHGC 1N62A 3Q8AA 1FXAA 4HWIB 4MGYE 3DHIC 2PKOA 3AH7A 3P1MA 2HJ1A 2UU7A 4KGRA 2QJLA 1R4MI 2L05A 4NAWB 1M4VA 3DBLI 4ZHOA 1N61A 1P1AA 1OFFA 2IY0B 2H89B 4WAFA 2MJEA 3V05A 3U30A 4XYCA 4RGMA 1TT5B 1K8RB 2WXLA 2CJNA 4F1SA 3TUOA 1BMLC 1L0YB 2KDFB 4A90A 1D6EC 1LQBA 3QA8A 2CHZA 2KDIA 3R2IA 3PRZA 1HZ5A 2IPKD 4PK1A 3DPDA 3MC9A 1YQ4B 4HJKA 1WZ3A 1SIFA 3TSSA 1WM2A 2KLCA 3PV1A 2WXMA 3HM6X 3A9JB 4A55A 3L17A 4A3PA 1G6JA 2RR9A 1F9JA 2LGSA 4HPLB 4YXDB 3L10B 3KH0A 3AE7B 4W9KA 3H7SA 4II2B 3WAMA 2GOWA 1NYRA 5EE0A 2N9EB 4O1NA 4P16A 2KZRA 2MWSB 4I6LB 3N32A 2KAJA 1EU4A 2KDMA 3DWGC 2KQ7A 2HE7A 1H4RA 3VTVA 4NAWA 1SJED 2LUMA 2ZPYA 3X23A 1I4HA 3ZNGC 3APFA 1MG8A 1ZUD2 4MT5A 4ZDVA 1J7CA 1ZP0B 2L83A 1UUPA 1VR9A 3ZTDA 2PTLA 3QWZB 1V86A 2LUEA 1PGBA 3U8ZA 1KLVA 1JWUD 3HRDD 1WRIA 2KJRA 3QIJA 2KC2A 2KX0A 4K7UA 4YSXB 2CS4A 1V6EA 4FULA 4JGHB 2PE9A 2NS5A 2CR5A 3HVDA 4GDLB 2JZ3B 3MJ5A 4M00A 1GB1A 1XD3B 3B08A 3A9JA 4E74A 2Q5WD 4ZYNA 3X0WA 1T3QA 4RF0A 2G4DB 4AJWA 4KIKB 3UI3A 2KK8A 4WWOA 2N9PC 4P7IA 3NOBA 1Z2MA 1ZDVA 1N5XA 4KGTA 2WXOA 1DOYA 1N63A 1E5WA 2QIEB 4XWTA 1N6ZA 3QCAA 5L83A 1AN8A 2G9HD 4OHJA 2JWUA 2DYBA 4B9KA 3GE3C 1VZ8A 2EELA 4KSKC 1QT9A 4DHJD 4HPMB 3NJTA 2V3NA 4LNNA 2PJHA 4OVUA 4NZLB 4BBNF 1Q1OA 1A70A 3IAS1 2DAJA 3Q3JA 2OJWA 1WJ6A 3CWIA 3OJ3A 2WXHA 3GZNB 1I4PA 5DPWA 2MBOA 1TZOA 3WA0A 4ANVA 1V8CA 3WANA 1WXMA 4LJOB 2FUG1 1C4PA 1WI0A 2BYFA 2ON8A 3L4PA 1ZOYB 3BK1A 3PRMB 4RH6A 4N6EB 3VR8B 2ZNVB 4KKJA 3A4RA 4LLGM 1YQ3B 4GDLA 2VH1A 3NZ3A 4LNKA 2KWCA 4ZRJA 4CHKA 1L6VA 2N9LA 1EF1A 5GXGB 3ZNHB 2BQQA 2ZZPB 3HM3A 4KIKA 3URYA 3V6CB 2C9WB 3RNCC 3IVFA 3ZXVA 2W9NA 3LDZE 2MBHA 4TQ0A 1P7FA 3BYTB 1D4BA 2IGDA 2GBMA 2KLGA 1FNVA 4A8XC 4WWPA 3W1SA 1RAXA 2MH7A 1JWBD 2K8CA 4ZYSA 3SHQA 1JRPA 4WH4A 1FNUA 3VH4B 2FE8A 2I38A 1ZXIA 2KVRA 2QDFA 5D6JB 1DOXA 1MJDA 3SFDB 3IXSA 4N58A 2FCQA 2LJ5A 3IFWB 1F52A 2PIAA 4CQNA 2JYEA 1P0RA 3RNFC 3NVVA 3T3OA 4I6NB 4KZCA 4JLCA 4QAYA 3RNBC 4M8NA 4L1BA 3JSVB 3QX1A 2SEBD 3R7RA 1VZ6A 4A9AA 3ML8A 2CJOA 2GBRA 2Y5BB 4XDDA 2I2YA 2NR2A 1L2NA 3AEEB 1UGMA 3T3NA 2AQ1B 4LDTB 2AEHA 5IOIA 1WM3A 4M02A 1TIFA 5C1ZA 1YIWA 1RWSA 4MM3B 3DBRB 1P98A 2DBYA 1BT0A 2L32A 2PE6B 2D3AA 5G55A 3OJ4B 2OHFA 1SB3C 1TTNA 4P1CC 1HXYD 2MRPA 3PO0A 2WHIA 3UF8A 2LJIA 3NUHB 3ABVB 1I35A 3BIID 3RYTA 1D5XC 1KFYB 2GBNA 2OJRA 3EECA 5FKAC 4ICUA 2RPQA 2D11A 2A4ZA 4M01A 4KVGB 2DZJA 2PVGC 4XZ4A 2RGFA 3PRPB 4D2KA 4YTPB 3HHMA 3AEBB 1TS5A 2XK5B 2ACZB 5MPOA 1V81A 3IHPC 1STEA 5IN7A 2GMIC 1NDDA 2ZVOA 4C00A 3JSVA 5CX3A 2LGYA 3QC8B 3RUIB 2FIDA 5J2RA 1L0XB 3I63C 1WJ4A 1NI2A 5I4DA 2ZCCA 1GG3A 5HKHA 3VTUA 2JYTA 1E0ZA 1TKYA 1SBBB 4MM3A 4N59A 5DPSA 1VJKA 4HLEA 1IPGA 4K3CA 1Q5WB 3BINA 4LK0M 1SE3A 4PYUA 1F77A 2KANA 2N9XA 2L52A 1JWMD 3GS2A 2BVCA 2LXAA 4F7ZA 2V4IB 4MGZE 4MJSB 1TS4A 2D3GA 2QSDA 2WXIA 4BBNC 1FRRA 3EHVA 2FUHB 1WGRA 1TYGB 1I4GA 3AU5A 3VDZA 3RN9C 1JALA 2D3BA 2J7QB 1FO4A 3SR6A 1JCKB 1J19A 1XEEA 2G3QB 2XK5A 1V2YA 1I7HA
chains in the Genus database with same CATH topology
3DCGA 2KTRB 5BO4B 1KM7A 3NZUA 2DX5B 4GXBA 1GC7A 2KKCA 1WE7A 1WGHA 1R4NI 4FJZA 4HCPB 5L95C 2C5LC 2BYEA 4HXDA 4TQ1A 4HWIB 2L3ZA 3V60A 4MGYE 4GMVA 3CF6E 1E8WA 3ZO5B 2CHWA 3KUCB 2KFJA 3K9OB 1R4MI 2L05A 2V3SA 5J18A 2JF5A 3VHTC 2REXA 3DOWA 2JRHA 3KUDB 4NAWB 3V62A 2KD0A 2N7DA 2EMTA 2KWVB 1UBIA 4WJPA 3DBLI 3RULA 2JT4B 1P1AA 3A4SC 3KW5B 2IY0B 5AZGA 4MSQB 3NZSA 4GU2A 3RT3B 4FN2A 3K9PB 5CHWA 3U30A 3PPAA 4GOCA 2MP2B 3PTFC 1C3TA 2C7MB 1K8RB 2LWPA 3APDA 5CTRC 3A9KA 1V9JA 4F1SA 4MJSA 2RSUA 1LFDA 2EKEC 2VRRB 3TMPB 4A3OA 3B1LX 2LI5A 2KDFB 3VAWA 1LQBA 1UBQA 3QA8A 2CHZA 2KDIA 3PRZA 1WR6E 4KV2A 3DPDA 1ZKHA 2WX1A 3L0WB 4HJKA 4WJOA 2K8BA 1T0YA 2C60A 4HDOA 4IWOA 3QARA 2EMSA 1WZ3A 1SIFA 3L54A 1WM2A 2KLCA 2L76A 3PV1A 3UINB 3HM6X 4BKSD 3TCAA 2DYOA 3A9JB 2Z59B 3L17A 4JIOU 2V1YA 2DZIA 4A3PA 1G6JA 4DBGA 3PLVA 2RR9A 2O6VB 2N1VA 1F9JA 1E8YA 4PS7A 4IUMB 4EFOA 4HPLB 2YLMA 1A5RA 4BOSC 3L10B 4N9F4 2KTRA 3KH0A 1RLFA 3ZKJC 2FNJB 4W9KA 4ASWC 3H7SA 1P3QU 3KYCD 4II2B 3WAMA 4BVUC 2GOWA 1WGDA 1V80A 4K7SA 3QHTA 4IM3A 2N9EB 2N7EA 1E8XA 3WIMA 2NPTB 3PS6A 2KZRA 2MWSB 3JYUA 1UD7A 1WRDB 2KJ6A 4K81A 4I6LB 5JH5C 3N32A 1E7VA 1OEYA 3PVLA 4W9DA 3P2BA 3UIPB 2KO3A 4ZRKA 3IBEA 2KQ7A 5DPTA 2DYMA 1TBEA 2HE7A 2IO0B 1H4RA 4AP4C 4YL8A 3RD2A 5E6NA 2DZKA 4NAWA 2LVQA 3VTVA 4BFRA 1PQSA 3TIXA 1RFAA 2ZPYA 3X23A 2IO3B 2BGFA 2K1FA 4IC7B 1P9DU 2IO1B 2JVCA 3ZNGC 3APFA 4DWFA 4FJVB 2O2VB 1MG8A 4ZDVA 1I42A 2NBUA 2LRWA 2MA9B 3HIZA 3ZTCA 3ENEA 4G11A 2MP2A 3ZTDA 4RMAA 4W9IA 3VUWA 5D94A 4DHZB 3QWZB 2KC1A 1V86A 2LUEA 3PT2B 4GDKB 3U8ZA 1KLVA 2NBVB 3U7DA 5JHBA 4W9LA 5GMVA 4AJYB 1UZXB 1YX5B 4W9GA 2KJRA 3QIJA 5DPRA 2KC2A 2KX0A 4NPNA 3IG3A 5CHVC 4K7UA 2CS4A 1V6EA 4FULA 4JGHB 4OVVA 4E3CA 2PE9A 2NS5A 4K7WA 3VUXA 2CR5A 4GDLB 2G45B 2JZ3B 3ZRFA 4NQKE 2FIFA 1XD3B 4K1RB 4DK5A 1Z5SB 2DENB 4HDQA 3B08A 3ZRCA 3A9JA 4LDTD 4E74A 1GJZA 2C7HA 2BYVE 3R7QA 3VUYA 2JZZA 3OLMD 4XX5A 4ZYNA 3X0WA 3ALBA 2O6VA 4AOFA 2G4DB 4AJWA 4KIKB 2C7NB 5E6PA 2KK8A 4WWOA 2N9PC 4I6PA 1AARA 2L0TA 4P7IA 4DDID 3NOBA 1Z2MA 4CO7A 1J0GA 3N30A 4PS3A 2KQSA 4DHZE 3ZUNA 4TKNA 2D2QA 4MSMB 1E5WA 3JW0X 4MELA 1SGHA 2ASQA 3QAQA 1EO6A 2HJ8A 2NPTA 1WE6A 4WAAA 2J0KA 5LLIA 3ML9A 3QCAA 2UWQA 1OQYA 5L83A 3V6EB 2HD5B 3DVGY 2BF8B 3H9DA 3KUZA 2CU1A 1WZ0A 1XQQA 3H6NA 2DYBA 4MH0E 3V61A 1WX9A 3PGEA 4B9KA 5JHAA 3MJWA 2L00B 4KSKC 4DHJD 4PS8A 2YVCA 4HPMB 2GBJA 4DDGD 1V5OA 1IYFA 2BKFA 1ZGUB 1OEYJ 1WXVA 3KVFB 3NHEB 3VQIA 3M3JA 5E6OA 2PJHA 3GZNI 4OVUA 3DDCB 4KDLB 2O2VA 3APCA 3DBHI 4BBNF 1Q1OA 3A1QB 4EKUA 4BKTA 2DAJA 2JY6A 3Q3JA 5FR6A 1WJ6A 3UQBA 3BY4B 3OJ3A 3SD5A 1V5TA 2RD0A 1E7UA 4TUUA 5DPWA 2MBOA 3WA0A 4W9JA 4ANVA 4W9EA 4GDKA 3WANA 2LVOA 2KXJA 3GOEA 4W9FA 3TJPA 1WXMA 3R66C 4LJOB 3H7PB 1GC6A 2J0MA 1WI0A 2BYFA 3PLUA 4WQOB 3RZFA 3W1YA 3PZDA 4WJNA 2CKHB 4AUQC 4ANWA 3VVWB 3DVNV 3PRMB 5C23A 2LGDA 2IY1B 2KX3A 2ZNVB 3A4RA 3ZNID 2L7RA 3ZW3A 3EC8A 4GDLA 2LZ6A 4HK2A 2KFKB 3UQAA 2KWCA 3B0AA 1TZ1A 3DQVA 4PYZA 4MEMA 4ZRJA 1V49A 3ZDMC 4IWQA 4CHKA 3AULA 3MTNB 4NJ6A 4FADA 2M8SA 1EF1A 2KMAA 2MBQA 1TGZB 3ZNHB 2ZZPB 3VXWA 3HM3A 1CMXB 2JPHA 4KIKA 1XT9B 3M95A 3V6CB 2C9WB 4ICVA 4IW0A 5IAAC 1X1MA 3IVFA 2W9NA 3JVZX 4NY0A 3LDZE 2MBHA 4TQ0A 3N3KB 2ZCBA 2GBMA 2KLGA 3H1UA 2WWZA 4GSWA 1WF9A 4WWPA 3W1SA 5IA7A 1RAXA 5AZFA 4F8CB 4FHJA 4IM0A 2QHOA 2V4LA 5AEKB 3WALA 2K8CA 2WDTB 1RRBA 3SHQA 1FXTB 2BWFA 2LVPA 3VH4B 3RZWC 2KWUB 2KMCA 4DXAB 2LXCA 2KVRA 1NBFC 4EOYA 3UGBB 2BPSA 2LGXA 2LD9A 1S3SG 5D6JB 3W1SC 4ANXA 4BOZB 4EEWA 2FCMA 5J17A 3UIOB 4B6WA 4W9CA 3CSTA 3A1QA 3DVGX 2AL6A 4JL9A 2FCQA 2M17A 3Q3FA 2LJ5A 2Z0DB 3IFWB 2MBBB 1E8ZA 4WJQA 4MDKE 5JZEB 2MLBA 2MBEA 4EZKA 3H7PA 1WXSA 1WXAA 4KSLC 1P0RA 3I3TB 4JQWC 2CHXA 3LJ3A 3ZDTA 2MQJA 2MW5A 3T9LA 4FA6A 2IYDB 3D32A 4II3B 1HE8A 3L08A 1Y8RC 4MGIE 4AWJA 3T8MA 3ONSA 2JWZA 1WMHB 1WGGA 4I6NB 4KZCA 4JLCA 2ZVNA 4FBJB 2KFKA 2G4SA 1YQBA 4XC2A 2XBBC 4M8NA 1GUAB 1D3ZA 3JSVB 2KOXA 3QX1A 3TL5A 1WX7A 3CMMB 4MGKE 2K39A 3R7RA 2K8HA 2UYZB 3ML8A 2Y5BB 2GBRA 3C0RB 5G2NA 5AZHA 2KHWB 2NR2A 2Z0EB 2ZNVC 2NCNA 3SU8X 1M94A 4URKA 1L2NA 1UGMA 1UELA 1SE9A 3CSFA 1E90A 4BKSA 3DBSA 2KTFA 1QZEA 4LDTB 2K6QA 2AEHA 4E71A 5TR5A 1WM3A 2M4NA 2AL3A 1OGWA 3DBRI 4ANUA 3EFUA 5C1ZA 4TV3A 4RM8A 4J6IA 2J0JA 1YIWA 2D10A 1J8CA 1WH3A 3PSEB 1P98A 1WGYA 2M0XA 1ISNA 3AU4A 1BT0A 2PE6B 3L16A 5G55A 5D7GA 2JXXA 5EDSA 2GBKA 3ZVVA 3MHSD 1LM8B 3OAWA 3AI5A 3OJ4B 1ZW7A 1TTNA 2PEAA 2OOBB 2BWES 2MRPA 4ZRIA 4EZLA 1U4AA 4NQLB 3UF8A 1EF5A 1I35A 2AYOB 3RYTA 1Q0WB 4FHKA 5LXHA 3HK0A 2L8JA 3PHXB 1C1YB 1JRUA 2GBNA 4DHJB 2OJRA 3VTWA 2I1JA 3EECA 2O6VD 4X57B 2DAFA 2RPQA 2B3AA 2N4FA 2D11A 2A4ZA 4ICUA 1WJUA 2DZJA 1WY8A 1L7YA 4KVGB 3ZLZA 5KHQA 2BKRB 4EZJA 4XZ4A 3AXCA 2R2OA 4FJYA 2RGFA 3PRPB 4B95A 4GN1A 5D2MB 1YX6B 1UH6A 1KJTA 3HHMA 4G3XB 2LASA 3A33B 4GB9A 2XK5B 1EUVB 1GNUA 2HTHA 2A5UA 1WIAA 1WYWB 1V81A 1WMHA 3QK0A 4IG7B 3IHPC 1KOTA 1LXDA 3NY5A 1VCBA 4LJPB 2GMIC 3O65B 1NDDA 3NS8A 2FCNA 2FAZA 2ZVOA 3WAOA 3JSVA 5CX3A 4M0WB 2LGYA 2KNBA 3QC8B 3RUIB 2FIDA 2ZPNA 4FLHA 4NJ7A 2NBWB 2L0FA 5J2RA 2XEWA 1VD2A 2KJHB 2LRUA 2NVUI 2DHZA 1WJNA 2KDBA 3S2AA 4GIVA 1WJ4A 2K6DB 5KHOA 3QQ8B 1NI2A 2ZJDA 1S1QB 3ZIMA 2ZCCA 4G0NB 4IWPA 2MX2A 1GG3A 3DVNU 3R3MA 1H8CA 5HKHA 3VTUA 4WWNA 3WAPA 3VH3B 2N1WA 4MM3A 2JUOA 5DPSA 4M8MA 1WR1A 4RM9A 4HLEA 4EUTA 1IPGA 2IO2B 4W9HA 1Q5WB 5CHFA 2K25A 3TBLD 5LXIB 4KDIC 3BINA 3ECIA 3ZNZB 1YJ1A 4PYUA 2KANA 2N9XA 3PHWB 2FCSA 2DZMA 2D07B 3M63B 2KN5A 2LXAA 3QJZA 4F7ZA 1YD8U 3A9KB 2KDEB 3PREA 4MGZE 1WFYA 4MJSB 1WX8A 2M1MA 2AWTA 2D3GA 2MSED 4NNJB 3KYDD 2IZVB 4CYEA 2R2QA 1OTRB 4GGQA 3VFKA 4BBNC 2ZEQA 2PPHA 2WYQA 2I1KA 3EHVA 4LCDE 3RCZA 2FUHB 1WGRA 4KZ0A 4BKGA 3AU5A 3VDZA 4A20A 2J7QB 4IM2A 4HCNB 3L13A 1J19A 2G3QB 5DCNA 2XK5A 3SDLC 2WX0A 3M62B 4G50A 4HVBA 1V2YA 2IBIB 1IP9A 2MCNB 2JRIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCG A;  2KTR B;  5BO4 B;  1KM7 A;  3NZU A;  2DX5 B;  4GXB A;  1GC7 A;  2KKC A;  1WE7 A;  1WGH A;  1R4N I;  4FJZ A;  4HCP B;  5L95 C;  2C5L C;  2BYE A;  4HXD A;  4TQ1 A;  4HWI B;  2L3Z A;  3V60 A;  4MGY E;  4GMV A;  3CF6 E;  1E8W A;  3ZO5 B;  2CHW A;  3KUC B;  2KFJ A;  3K9O B;  1R4M I;  2L05 A;  2V3S A;  5J18 A;  2JF5 A;  3VHT C;  2REX A;  3DOW A;  2JRH A;  3KUD B;  4NAW B;  3V62 A;  2KD0 A;  2N7D A;  2EMT A;  2KWV B;  1UBI A;  4WJP A;  3DBL I;  3RUL A;  2JT4 B;  1P1A A;  3A4S C;  3KW5 B;  2IY0 B;  5AZG A;  4MSQ B;  3NZS A;  4GU2 A;  3RT3 B;  4FN2 A;  3K9P B;  5CHW A;  3U30 A;  3PPA A;  4GOC A;  2MP2 B;  3PTF C;  1C3T A;  2C7M B;  1K8R B;  2LWP A;  3APD A;  5CTR C;  3A9K A;  1V9J A;  4F1S A;  4MJS A;  2RSU A;  1LFD A;  2EKE C;  2VRR B;  3TMP B;  4A3O A;  3B1L X;  2LI5 A;  2KDF B;  3VAW A;  1LQB A;  1UBQ A;  3QA8 A;  2CHZ A;  2KDI A;  3PRZ A;  1WR6 E;  4KV2 A;  3DPD A;  1ZKH A;  2WX1 A;  3L0W B;  4HJK A;  4WJO A;  2K8B A;  1T0Y A;  2C60 A;  4HDO A;  4IWO A;  3QAR A;  2EMS A;  1WZ3 A;  1SIF A;  3L54 A;  1WM2 A;  2KLC A;  2L76 A;  3PV1 A;  3UIN B;  3HM6 X;  4BKS D;  3TCA A;  2DYO A;  3A9J B;  2Z59 B;  3L17 A;  4JIO U;  2V1Y A;  2DZI A;  4A3P A;  1G6J A;  4DBG A;  3PLV A;  2RR9 A;  2O6V B;  2N1V A;  1F9J A;  1E8Y A;  4PS7 A;  4IUM B;  4EFO A;  4HPL B;  2YLM A;  1A5R A;  4BOS C;  3L10 B;  4N9F 4;  2KTR A;  3KH0 A;  1RLF A;  3ZKJ C;  2FNJ B;  4W9K A;  4ASW C;  3H7S A;  1P3Q U;  3KYC D;  4II2 B;  3WAM A;  4BVU C;  2GOW A;  1WGD A;  1V80 A;  4K7S A;  3QHT A;  4IM3 A;  2N9E B;  2N7E A;  1E8X A;  3WIM A;  2NPT B;  3PS6 A;  2KZR A;  2MWS B;  3JYU A;  1UD7 A;  1WRD B;  2KJ6 A;  4K81 A;  4I6L B;  5JH5 C;  3N32 A;  1E7V A;  1OEY A;  3PVL A;  4W9D A;  3P2B A;  3UIP B;  2KO3 A;  4ZRK A;  3IBE A;  2KQ7 A;  5DPT A;  2DYM A;  1TBE A;  2HE7 A;  2IO0 B;  1H4R A;  4AP4 C;  4YL8 A;  3RD2 A;  5E6N A;  2DZK A;  4NAW A;  2LVQ A;  3VTV A;  4BFR A;  1PQS A;  3TIX A;  1RFA A;  2ZPY A;  3X23 A;  2IO3 B;  2BGF A;  2K1F A;  4IC7 B;  1P9D U;  2IO1 B;  2JVC A;  3ZNG C;  3APF A;  4DWF A;  4FJV B;  2O2V B;  1MG8 A;  4ZDV A;  1I42 A;  2NBU A;  2LRW A;  2MA9 B;  3HIZ A;  3ZTC A;  3ENE A;  4G11 A;  2MP2 A;  3ZTD A;  4RMA A;  4W9I A;  3VUW A;  5D94 A;  4DHZ B;  3QWZ B;  2KC1 A;  1V86 A;  2LUE A;  3PT2 B;  4GDK B;  3U8Z A;  1KLV A;  2NBV B;  3U7D A;  5JHB A;  4W9L A;  5GMV A;  4AJY B;  1UZX B;  1YX5 B;  4W9G A;  2KJR A;  3QIJ A;  5DPR A;  2KC2 A;  2KX0 A;  4NPN A;  3IG3 A;  5CHV C;  4K7U A;  2CS4 A;  1V6E A;  4FUL A;  4JGH B;  4OVV A;  4E3C A;  2PE9 A;  2NS5 A;  4K7W A;  3VUX A;  2CR5 A;  4GDL B;  2G45 B;  2JZ3 B;  3ZRF A;  4NQK E;  2FIF A;  1XD3 B;  4K1R B;  4DK5 A;  1Z5S B;  2DEN B;  4HDQ A;  3B08 A;  3ZRC A;  3A9J A;  4LDT D;  4E74 A;  1GJZ A;  2C7H A;  2BYV E;  3R7Q A;  3VUY A;  2JZZ A;  3OLM D;  4XX5 A;  4ZYN A;  3X0W A;  3ALB A;  2O6V A;  4AOF A;  2G4D B;  4AJW A;  4KIK B;  2C7N B;  5E6P A;  2KK8 A;  4WWO A;  2N9P C;  4I6P A;  1AAR A;  2L0T A;  4P7I A;  4DDI D;  3NOB A;  1Z2M A;  4CO7 A;  1J0G A;  3N30 A;  4PS3 A;  2KQS A;  4DHZ E;  3ZUN A;  4TKN A;  2D2Q A;  4MSM B;  1E5W A;  3JW0 X;  4MEL A;  1SGH A;  2ASQ A;  3QAQ A;  1EO6 A;  2HJ8 A;  2NPT A;  1WE6 A;  4WAA A;  2J0K A;  5LLI A;  3ML9 A;  3QCA A;  2UWQ A;  1OQY A;  5L83 A;  3V6E B;  2HD5 B;  3DVG Y;  2BF8 B;  3H9D A;  3KUZ A;  2CU1 A;  1WZ0 A;  1XQQ A;  3H6N A;  2DYB A;  4MH0 E;  3V61 A;  1WX9 A;  3PGE A;  4B9K A;  5JHA A;  3MJW A;  2L00 B;  4KSK C;  4DHJ D;  4PS8 A;  2YVC A;  4HPM B;  2GBJ A;  4DDG D;  1V5O A;  1IYF A;  2BKF A;  1ZGU B;  1OEY J;  1WXV A;  3KVF B;  3NHE B;  3VQI A;  3M3J A;  5E6O A;  2PJH A;  3GZN I;  4OVU A;  3DDC B;  4KDL B;  2O2V A;  3APC A;  3DBH I;  4BBN F;  1Q1O A;  3A1Q B;  4EKU A;  4BKT A;  2DAJ A;  2JY6 A;  3Q3J A;  5FR6 A;  1WJ6 A;  3UQB A;  3BY4 B;  3OJ3 A;  3SD5 A;  1V5T A;  2RD0 A;  1E7U A;  4TUU A;  5DPW A;  2MBO A;  3WA0 A;  4W9J A;  4ANV A;  4W9E A;  4GDK A;  3WAN A;  2LVO A;  2KXJ A;  3GOE A;  4W9F A;  3TJP A;  1WXM A;  3R66 C;  4LJO B;  3H7P B;  1GC6 A;  2J0M A;  1WI0 A;  2BYF A;  3PLU A;  4WQO B;  3RZF A;  3W1Y A;  3PZD A;  4WJN A;  2CKH B;  4AUQ C;  4ANW A;  3VVW B;  3DVN V;  3PRM B;  5C23 A;  2LGD A;  2IY1 B;  2KX3 A;  2ZNV B;  3A4R A;  3ZNI D;  2L7R A;  3ZW3 A;  3EC8 A;  4GDL A;  2LZ6 A;  4HK2 A;  2KFK B;  3UQA A;  2KWC A;  3B0A A;  1TZ1 A;  3DQV A;  4PYZ A;  4MEM A;  4ZRJ A;  1V49 A;  3ZDM C;  4IWQ A;  4CHK A;  3AUL A;  3MTN B;  4NJ6 A;  4FAD A;  2M8S A;  1EF1 A;  2KMA A;  2MBQ A;  1TGZ B;  3ZNH B;  2ZZP B;  3VXW A;  3HM3 A;  1CMX B;  2JPH A;  4KIK A;  1XT9 B;  3M95 A;  3V6C B;  2C9W B;  4ICV A;  4IW0 A;  5IAA C;  1X1M A;  3IVF A;  2W9N A;  3JVZ X;  4NY0 A;  3LDZ E;  2MBH A;  4TQ0 A;  3N3K B;  2ZCB A;  2GBM A;  2KLG A;  3H1U A;  2WWZ A;  4GSW A;  1WF9 A;  4WWP A;  3W1S A;  5IA7 A;  1RAX A;  5AZF A;  4F8C B;  4FHJ A;  4IM0 A;  2QHO A;  2V4L A;  5AEK B;  3WAL A;  2K8C A;  2WDT B;  1RRB A;  3SHQ A;  1FXT B;  2BWF A;  2LVP A;  3VH4 B;  3RZW C;  2KWU B;  2KMC A;  4DXA B;  2LXC A;  2KVR A;  1NBF C;  4EOY A;  3UGB B;  2BPS A;  2LGX A;  2LD9 A;  1S3S G;  5D6J B;  3W1S C;  4ANX A;  4BOZ B;  4EEW A;  2FCM A;  5J17 A;  3UIO B;  4B6W A;  4W9C A;  3CST A;  3A1Q A;  3DVG X;  2AL6 A;  4JL9 A;  2FCQ A;  2M17 A;  3Q3F A;  2LJ5 A;  2Z0D B;  3IFW B;  2MBB B;  1E8Z A;  4WJQ A;  4MDK E;  5JZE B;  2MLB A;  2MBE A;  4EZK A;  3H7P A;  1WXS A;  1WXA A;  4KSL C;  1P0R A;  3I3T B;  4JQW C;  2CHX A;  3LJ3 A;  3ZDT A;  2MQJ A;  2MW5 A;  3T9L A;  4FA6 A;  2IYD B;  3D32 A;  4II3 B;  1HE8 A;  3L08 A;  1Y8R C;  4MGI E;  4AWJ A;  3T8M A;  3ONS A;  2JWZ A;  1WMH B;  1WGG A;  4I6N B;  4KZC A;  4JLC A;  2ZVN A;  4FBJ B;  2KFK A;  2G4S A;  1YQB A;  4XC2 A;  2XBB C;  4M8N A;  1GUA B;  1D3Z A;  3JSV B;  2KOX A;  3QX1 A;  3TL5 A;  1WX7 A;  3CMM B;  4MGK E;  2K39 A;  3R7R A;  2K8H A;  2UYZ B;  3ML8 A;  2Y5B B;  2GBR A;  3C0R B;  5G2N A;  5AZH A;  2KHW B;  2NR2 A;  2Z0E B;  2ZNV C;  2NCN A;  3SU8 X;  1M94 A;  4URK A;  1L2N A;  1UGM A;  1UEL A;  1SE9 A;  3CSF A;  1E90 A;  4BKS A;  3DBS A;  2KTF A;  1QZE A;  4LDT B;  2K6Q A;  2AEH A;  4E71 A;  5TR5 A;  1WM3 A;  2M4N A;  2AL3 A;  1OGW A;  3DBR I;  4ANU A;  3EFU A;  5C1Z A;  4TV3 A;  4RM8 A;  4J6I A;  2J0J A;  1YIW A;  2D10 A;  1J8C A;  1WH3 A;  3PSE B;  1P98 A;  1WGY A;  2M0X A;  1ISN A;  3AU4 A;  1BT0 A;  2PE6 B;  3L16 A;  5G55 A;  5D7G A;  2JXX A;  5EDS A;  2GBK A;  3ZVV A;  3MHS D;  1LM8 B;  3OAW A;  3AI5 A;  3OJ4 B;  1ZW7 A;  1TTN A;  2PEA A;  2OOB B;  2BWE S;  2MRP A;  4ZRI A;  4EZL A;  1U4A A;  4NQL B;  3UF8 A;  1EF5 A;  1I35 A;  2AYO B;  3RYT A;  1Q0W B;  4FHK A;  5LXH A;  3HK0 A;  2L8J A;  3PHX B;  1C1Y B;  1JRU A;  2GBN A;  4DHJ B;  2OJR A;  3VTW A;  2I1J A;  3EEC A;  2O6V D;  4X57 B;  2DAF A;  2RPQ A;  2B3A A;  2N4F A;  2D11 A;  2A4Z A;  4ICU A;  1WJU A;  2DZJ A;  1WY8 A;  1L7Y A;  4KVG B;  3ZLZ A;  5KHQ A;  2BKR B;  4EZJ A;  4XZ4 A;  3AXC A;  2R2O A;  4FJY A;  2RGF A;  3PRP B;  4B95 A;  4GN1 A;  5D2M B;  1YX6 B;  1UH6 A;  1KJT A;  3HHM A;  4G3X B;  2LAS A;  3A33 B;  4GB9 A;  2XK5 B;  1EUV B;  1GNU A;  2HTH A;  2A5U A;  1WIA A;  1WYW B;  1V81 A;  1WMH A;  3QK0 A;  4IG7 B;  3IHP C;  1KOT A;  1LXD A;  3NY5 A;  1VCB A;  4LJP B;  2GMI C;  3O65 B;  1NDD A;  3NS8 A;  2FCN A;  2FAZ A;  2ZVO A;  3WAO A;  3JSV A;  5CX3 A;  4M0W B;  2LGY A;  2KNB A;  3QC8 B;  3RUI B;  2FID A;  2ZPN A;  4FLH A;  4NJ7 A;  2NBW B;  2L0F A;  5J2R A;  2XEW A;  1VD2 A;  2KJH B;  2LRU A;  2NVU I;  2DHZ A;  1WJN A;  2KDB A;  3S2A A;  4GIV A;  1WJ4 A;  2K6D B;  5KHO A;  3QQ8 B;  1NI2 A;  2ZJD A;  1S1Q B;  3ZIM A;  2ZCC A;  4G0N B;  4IWP A;  2MX2 A;  1GG3 A;  3DVN U;  3R3M A;  1H8C A;  5HKH A;  3VTU A;  4WWN A;  3WAP A;  3VH3 B;  2N1W A;  4MM3 A;  2JUO A;  5DPS A;  4M8M A;  1WR1 A;  4RM9 A;  4HLE A;  4EUT A;  1IPG A;  2IO2 B;  4W9H A;  1Q5W B;  5CHF A;  2K25 A;  3TBL D;  5LXI B;  4KDI C;  3BIN A;  3ECI A;  3ZNZ B;  1YJ1 A;  4PYU A;  2KAN A;  2N9X A;  3PHW B;  2FCS A;  2DZM A;  2D07 B;  3M63 B;  2KN5 A;  2LXA A;  3QJZ A;  4F7Z A;  1YD8 U;  3A9K B;  2KDE B;  3PRE A;  4MGZ E;  1WFY A;  4MJS B;  1WX8 A;  2M1M A;  2AWT A;  2D3G A;  2MSE D;  4NNJ B;  3KYD D;  2IZV B;  4CYE A;  2R2Q A;  1OTR B;  4GGQ A;  3VFK A;  4BBN C;  2ZEQ A;  2PPH A;  2WYQ A;  2I1K A;  3EHV A;  4LCD E;  3RCZ A;  2FUH B;  1WGR A;  4KZ0 A;  4BKG A;  3AU5 A;  3VDZ A;  4A20 A;  2J7Q B;  4IM2 A;  4HCN B;  3L13 A;  1J19 A;  2G3Q B;  5DCN A;  2XK5 A;  3SDL C;  2WX0 A;  3M62 B;  4G50 A;  4HVB A;  1V2Y A;  2IBI B;  1IP9 A;  2MCN B;  2JRI B; 
#chains in the Genus database with same CATH topology
 3U2S C;  3ZJT A;  2KTR B;  5BO4 B;  2DX5 B;  3OG5 A;  3GB1 A;  5AUK A;  1R4N I;  4FJZ A;  3OWE B;  4OW0 A;  2L3Z A;  1E9M A;  2DWQ A;  1FFU A;  3KUC B;  2V3S A;  5J18 A;  2JF5 A;  2ICI A;  2REX A;  3DOW A;  2KD0 A;  3U4E G;  3C8Y A;  4BZA A;  3I57 A;  3ZXR A;  2JT4 B;  2W82 A;  4GU2 A;  1C77 A;  4FN2 A;  3K9P B;  5CHW A;  1XCQ L;  5EE1 A;  3PTF C;  2C7M B;  1GB4 A;  1V9J A;  4MJS A;  2RSU A;  3TMP B;  2LI5 A;  1NEK B;  1QKZ A;  2LEK A;  5BYR A;  4ZRP A;  1ZKH A;  5BMG A;  1ENF A;  2K8B A;  2C60 A;  4UDU C;  1ZDX A;  1E7P B;  3TCA A;  2X8X X;  4DBG A;  3PLV A;  4XWW A;  3RNG C;  1I4X A;  3AEF B;  2KTR A;  2FNJ B;  1Y56 A;  4RFB A;  1P3Q U;  3BVG A;  1WGD A;  2BB5 A;  3QHT A;  3Q14 C;  4IM3 A;  2N7E A;  3WIM A;  3Q6B A;  2NPT B;  3B9J A;  1WRD B;  4K81 A;  1E7V A;  1BXT A;  2KO3 A;  2RPV A;  4P6V F;  1Q10 A;  1TBE A;  3RD2 A;  2DZK A;  1FNW A;  3DHH C;  3TIX A;  1RFA A;  3V3X A;  2BW2 A;  2IO3 B;  3KQ4 A;  2IO1 B;  2G1E A;  2LRW A;  2LHD A;  2J53 A;  4C4V B;  3ZTC A;  3Q3N C;  1HTQ A;  1UWM A;  3ENE A;  4G11 A;  1ROE A;  1CZP A;  1QF6 A;  4DHZ B;  2KC1 A;  3PT2 B;  2AQ2 B;  2NBV B;  3BYY B;  1UZX B;  1TJE A;  4W9G A;  3HVZ A;  4NPN A;  1YMH E;  3VUX A;  2KQ4 X;  1IBX B;  3EFC A;  3N1Z C;  4HDQ A;  4LDT D;  3AE4 B;  4HEA 1;  2BYV E;  3R7Q A;  2JZZ A;  3OLM D;  1T5X D;  4AOF A;  1E6E B;  1FM0 D;  1QOB A;  2JXT A;  3RPF C;  3RNA C;  4ZHP A;  1YNT E;  1J0G A;  3N30 A;  3ZUN A;  2D2Q A;  3JW0 X;  1SGH A;  2ASQ A;  2PMV A;  1EO6 A;  1F1H A;  2NPT A;  3ML9 A;  2UWQ A;  3P4R B;  2WS3 B;  2HD5 B;  3DVG Y;  1FEH A;  4WWM A;  5JHA A;  1I4Q A;  3MJW A;  2ZW0 A;  2YVC A;  2IND C;  1OEY J;  3NHE B;  2AQ3 B;  3M3J A;  3DDC B;  3DBH I;  5TSS A;  2BB6 A;  4C4V A;  3A1Q B;  4EKU A;  4BKT A;  5C2T B;  4EE2 A;  1K51 A;  3BY4 B;  3SD5 A;  1KH0 A;  4W9J A;  4HRO A;  4W9E A;  2KXJ A;  4KKI A;  3Q3O C;  3R66 C;  3H7P B;  2KN4 A;  1R7S A;  3W5V B;  4ANW A;  3VVW B;  5C23 A;  1QOA A;  3GE8 C;  1IBX A;  2L7R A;  4HK2 A;  3UQA A;  2GB1 A;  3B0A A;  4IWQ A;  1MI0 A;  3AUL A;  4FAD A;  2KMA A;  1TGZ B;  3EA6 A;  1CMX B;  4FXC A;  4IW0 A;  5IAA C;  1X1M A;  3N3K B;  2XNA C;  3IT4 B;  3ZJU A;  5IA7 A;  3NVZ A;  5AZF A;  4IM0 A;  3WCQ A;  5AEK B;  2WDT B;  1FXT B;  3RZW C;  2WDQ B;  1QLB B;  4EEW A;  3KWL A;  1BUI C;  4B0E A;  5J17 A;  3CST A;  3A1Q A;  4JL9 A;  2M17 A;  3Q3F A;  1OQR A;  4MDK E;  5JZE B;  4EZK A;  3H7P A;  4KSL C;  2RDH A;  2CHX A;  2JU6 X;  2MQJ A;  2MW5 A;  3T9L A;  3C19 A;  2YEP F;  2WXG A;  3ONS A;  2JWZ A;  1WGG A;  2ZVN A;  3Q2A C;  1JW9 D;  1D3Z A;  4YT0 B;  3TL5 A;  3CMM B;  2PVO D;  2K39 A;  1C4A A;  2VH2 A;  5AZH A;  2Z0E B;  1D5M C;  4BKS A;  1E90 A;  2KTF A;  2NMQ A;  2LMC A;  1JRO A;  2ZW1 A;  2GI9 A;  5H92 C;  4Q2J A;  3Q8F A;  3TEZ A;  2D10 A;  1J8C A;  3PSE B;  1WGY A;  2M0X A;  1XLN A;  3L16 A;  5FR3 A;  1DYQ A;  3OAW A;  2PEA A;  3I9V 1;  4JX1 C;  4LTU A;  4ZRI A;  1U4A A;  1SEB D;  3E56 A;  1EF5 A;  5LXH A;  3HK0 A;  4ACF A;  3N20 C;  3U52 E;  2I1J A;  1C4C A;  2SAK A;  2DAF A;  4MSM B;  1TY2 A;  1WJU A;  2QIL A;  2WXJ A;  1PYW D;  1JWA D;  3AXC A;  2BS4 B;  1P7E A;  4B95 A;  1YX6 B;  1UH6 A;  2GLS A;  1KJT A;  1F0Z A;  4G3X B;  4DHZ E;  3QK0 A;  1EUV B;  1NI3 A;  2HTH A;  1LXD A;  3ZYY X;  3NY5 A;  1ET9 A;  1VCB A;  2KAC A;  3O65 B;  3WAO A;  4M0W B;  2KNB A;  2ZPN A;  3O13 A;  1XF5 L;  5FK9 C;  1VD2 A;  4BAX A;  2NVU I;  1WJN A;  2KDB A;  1XCT L;  4GIV A;  2K6D B;  4RF1 A;  2Y3A A;  3VRA B;  3DWM A;  1XLP A;  4IWP A;  3DVN U;  1IGC A;  4WWN A;  1SXT A;  2MHJ A;  1QOG A;  5HHD G;  2JSV X;  2JUO A;  3FKY A;  4W9H A;  2K25 A;  3TBL D;  2K0P A;  3Q8B A;  1PDX A;  3MC0 B;  2KN5 A;  2KDE B;  2VZK D;  1WFY A;  3IT6 B;  3KYD D;  2WU5 B;  4CYE A;  2R2Q A;  1IUE A;  1YJJ A;  3FC4 A;  2WYQ A;  2I1K A;  1V97 A;  2IJ0 A;  4JPS A;  4TMA B;  4IDI A;  2WP9 B;  1MPE A;  4HCN B;  2RDB C;  1EU3 A;  2WX0 A;  3M62 B;  3VR9 B;  2IBI B;  1IP9 A;  2GRI A;  2K3U A;  1EM7 A;  3NZU A;  4GXB A;  1GC7 A;  4M0W A;  4HCP B;  4WQM A;  2C5L C;  4HXD A;  4TQ1 A;  1FCC C;  4GMV A;  3CF6 E;  1E8W A;  2E6X A;  2KFJ A;  3U7Z A;  4XE0 A;  2HDE A;  3KUD B;  2JRH A;  3V62 A;  2QCZ A;  2DNF A;  2N7D A;  2KWV B;  1V1O A;  1R4M B;  3A4S C;  5AZG A;  3NZS A;  4RNA A;  3MP9 A;  3RT3 B;  1FRD A;  3PPA A;  3DBL B;  4GOC A;  2MP2 B;  3AEC B;  1C3T A;  4DXF A;  3APD A;  2BYT A;  4ZRQ A;  1WWT A;  5G5G A;  1LFD A;  1J7A A;  2EKE C;  1UWX A;  3VAW A;  1UBQ A;  3P4Q B;  3RMK C;  1SE4 A;  2QC8 A;  3L0W B;  2J42 A;  4ITK A;  3QAR A;  2EMS A;  5EE3 A;  1T0R C;  4BKS D;  3LYY A;  2DYO A;  1MG4 A;  4JIO U;  2DZI A;  4USA A;  1B1Z A;  1SIJ A;  2K5P A;  1E8Y A;  1SF0 A;  1B9R A;  4EFO A;  1L6U A;  2YLM A;  4BOS C;  4N9F 4;  1RLF A;  3ZKJ C;  2IDY A;  3KYC D;  3AM9 A;  4BVU C;  1V80 A;  3NVW A;  2BS3 B;  5AUI A;  3AE9 B;  4B0M A;  1UD7 A;  2KJ6 A;  5JH5 C;  1TY0 A;  4W9D A;  3UIP B;  3IBE A;  5DPT A;  2KWD A;  2INC C;  2IO0 B;  2ONQ A;  4AP4 C;  1GPX A;  4MAC A;  4S17 A;  5E6N A;  4BFR A;  2BGF A;  2K1F A;  4IC7 B;  3AE8 B;  4FJV B;  3HUI A;  1I42 A;  2NBU A;  1L0V B;  1HTO A;  2AX5 A;  5G5H A;  2MP2 A;  1YN3 A;  1IGD A;  3BVM A;  4RMA A;  4W9I A;  5D94 A;  3AE3 B;  4GDK B;  3U7D A;  2PW9 A;  4W9L A;  4J3O D;  1AW7 A;  5DPR A;  5CHV C;  4E3C A;  4OVV A;  4C7Z A;  3SFE B;  1XLO A;  2G45 B;  4NQK E;  2FIF A;  2LGI A;  4K1R B;  4DK5 A;  1Z5S B;  3ZRC A;  3VUY A;  2WXQ A;  4LNF A;  2L1A A;  1N60 A;  2C7N B;  2EKI A;  4CO7 A;  2D5G A;  3AEG B;  4PS3 A;  4ARI A;  2KQS A;  2WGS A;  1L4D B;  1PGX A;  3QAQ A;  1GOZ A;  2NTT A;  5LLI A;  1PUT A;  3MFG A;  3V6E B;  1FXI A;  3EGR A;  3Q3M C;  3H9D A;  3B2F A;  1WZ0 A;  1XQQ A;  3R8B A;  2M19 A;  1WYG A;  1WX9 A;  4PS8 A;  1I4R A;  1IYF A;  4DDG D;  1V5O A;  2BKF A;  1WXV A;  2WXR A;  4YTN B;  5EE9 A;  3SEB A;  3NRZ A;  1MHH E;  3GZN I;  4KGS A;  4KDL B;  4AQ7 A;  4YSY B;  1QOF A;  5FR6 A;  1YN5 A;  3UQB A;  2RDG A;  4TUU A;  2E3T A;  4GDK A;  2LVO A;  3TJP A;  1GC6 A;  3PLU A;  3RZF A;  2CKH B;  4AUQ C;  2V0G A;  5IKC M;  2IY1 B;  3ZW3 A;  2LZ6 A;  2KFK B;  1T0Q C;  4MEM A;  1V49 A;  3RFZ B;  3MTN B;  2M8S A;  3VXW A;  2V9H A;  3M95 A;  4L2Y A;  1TS3 A;  3JVZ X;  4NY0 A;  1KLU D;  3AE6 B;  2K22 A;  3H1U A;  1WF9 A;  1ACC A;  4NAM A;  2QHO A;  2V4L A;  1C79 A;  3ZQ4 A;  3WAL A;  3PZ7 A;  2BWF A;  2LVP A;  4US8 A;  5C3J B;  2KWU B;  2KMC A;  4DXA B;  2LXC A;  4EOY A;  3UGB B;  2BPS A;  4HRS A;  3W1S C;  4BOZ B;  4B6W A;  5D3I B;  3DVG X;  2AL6 A;  1ESF A;  2Z0D B;  1EWY C;  2MBB B;  1E8Z A;  4RGO S;  1HEZ E;  2DLB A;  2MBE A;  3I3T B;  4JQW C;  2WLB A;  3LJ3 A;  3ZDT A;  2VZK B;  4FA6 A;  2IYD B;  3D32 A;  4II3 B;  1HE8 A;  3L08 A;  4MGI E;  1HZ6 A;  5HI1 A;  2PLP A;  3P4S B;  1PFD A;  2KFK A;  1YQB A;  2XBB C;  1GUA B;  2WDV B;  4MGK E;  2UYZ B;  5G2N A;  2ZNV C;  1HA5 A;  1UEL A;  1SE9 A;  3CSF A;  1PGA A;  3DBS A;  5TR5 A;  3W5U B;  1WXQ A;  2M4N A;  5BMH A;  3AED B;  2AL3 A;  1OGW A;  2BBC A;  3DBR I;  4ANU A;  3EFU A;  4J6I A;  3H8H A;  2KMM A;  4US9 A;  3RI7 C;  5LNK 1;  1LM8 B;  3AI5 A;  3P42 A;  2W54 A;  4NQL B;  2WNM A;  2QMT A;  3N1X C;  1RFK A;  5BMI A;  1Q0W B;  3R2T A;  4FHK A;  1C1Y B;  2V3P A;  2HTM E;  4X57 B;  5KHQ A;  4EZJ A;  2R2O A;  4S0R A;  5D2M B;  4LNI A;  2LAS A;  3A33 B;  4GB9 A;  1L5P A;  1YJI A;  2A5U A;  1WIA A;  2Z8L A;  3PZ8 A;  3BZD B;  2N0S B;  1KOT A;  3AE2 B;  3NS8 A;  2FCN A;  2FAZ A;  1FD6 A;  3RNE C;  1JWS D;  4C7Y A;  4C56 C;  4NJ7 A;  4NJC A;  2LRU A;  1DGJ A;  1V1P B;  2DHZ A;  2JZP A;  2ZJD A;  3ZIM A;  4G0N B;  3R3M A;  3ZJV A;  3ZGZ A;  3VH3 B;  1J7B A;  4M8M A;  5CHF A;  4JE3 B;  3ZNZ B;  1YJ1 A;  2FCS A;  2INN E;  1UGJ A;  3M63 B;  1WGK A;  1YD8 U;  3A9K B;  1DOI A;  4XDC A;  2AWT A;  1FMA D;  2MSE D;  2XN9 C;  1OTR B;  4GGQ A;  2PPH A;  3Q8C A;  1T0S C;  3RCZ A;  1FPY A;  4BKG A;  2IGG A;  1F2R I;  4RGN A;  4IM2 A;  5BYS A;  5DCN A;  4G50 A;  4WIP A;  4HVB A;  2MCN B;  2JRI B;  1KM7 A;  2KKC A;  1SE2 A;  2D3C A;  5L95 C;  3LXF A;  2BYE A;  1MHX A;  3V60 A;  4A6Q A;  1V1P A;  1K52 A;  1R4N B;  3ZO5 B;  2CHW A;  2MEK A;  3K9O B;  5HFY A;  3VHT C;  2N7J A;  1UNS A;  2EMT A;  1UBI A;  4WJP A;  2Y5P A;  3RUL A;  1AWD A;  3LB8 C;  3KW5 B;  3AV8 A;  4C80 A;  1C9F A;  4MSQ B;  3MHZ A;  3NVY A;  1SSN A;  1LO5 D;  1JQ4 A;  2LWP A;  1FFV A;  5CTR C;  3A9K A;  2WU2 B;  2VRR B;  4A3O A;  3B1L X;  2WXP A;  2KVZ A;  1WR6 E;  4KV2 A;  1ZXH A;  2WX1 A;  4WJO A;  2JQR B;  1T0Y A;  4IWO A;  4HDO A;  1NVI D;  3L54 A;  2L76 A;  3UIN B;  2Z59 B;  2V1Y A;  1VZ7 A;  2O6V B;  2N1V A;  1CK1 A;  2J4X A;  4PS7 A;  1AYF A;  4IUM B;  1A5R A;  4ASW C;  3B2G A;  2LHE A;  4K7S A;  1E8X A;  2KT7 A;  2WXF A;  3PS6 A;  1F2R C;  3JYU A;  4JWS C;  3PVL A;  1OEY A;  3P2B A;  4ZRK A;  2DYM A;  4YL8 A;  2LVQ A;  1PQS A;  1VLB A;  2LFI A;  1P9D U;  2JVC A;  1EWC A;  4DWF A;  1LGR A;  1MVK A;  2O2V B;  1TKE A;  4REZ A;  2MA9 B;  3HIZ A;  3BK2 A;  1KRH A;  3VUW A;  4HKQ A;  5JHB A;  2WDR B;  5GMV A;  5E6J A;  4AJY B;  3P4P B;  1YX5 B;  3GP7 A;  3IG3 A;  1VRA B;  3KLS X;  4K7W A;  4DQO C;  3ZRF A;  1MFW A;  4IOI E;  2DEN B;  1GJZ A;  2C7H A;  2B76 B;  3VRB B;  3N1Y C;  4XX5 A;  2M0A A;  3FAH A;  3ALB A;  2O6V A;  1ET6 A;  1KF6 B;  5E6P A;  2MJ3 A;  4YSZ B;  2N9K A;  1ZE3 D;  4I6P A;  1AAR A;  2L0T A;  4DDI D;  2KYW A;  2W3R A;  3NS1 A;  2JX5 A;  4TKN A;  1FIQ A;  4MEL A;  2HJ8 A;  1WE6 A;  4WAA A;  2J0K A;  4KX6 B;  1OQY A;  2BF8 B;  3KUZ A;  2R61 A;  2CU1 A;  2INP E;  3H6N A;  4MH0 E;  3V61 A;  1C76 A;  3PGE A;  2L00 B;  4HKZ E;  1KLG D;  3BWU D;  2GBJ A;  3KVF B;  1ZGU B;  3VQI A;  1K53 A;  5E6O A;  2O2V A;  3APC A;  2JY6 A;  5IP4 D;  2QEJ C;  1SJH D;  3AE5 B;  3W2D A;  1V5T A;  2RD0 A;  1E7U A;  3Q8E A;  3DBH B;  3GOE A;  4W9F A;  2J0M A;  4WQO B;  3P63 A;  5IO9 A;  3W1Y A;  3PZD A;  2K9X A;  4WJN A;  1UF0 A;  3DVN V;  2LGD A;  2KX3 A;  1VDV A;  3ZNI D;  3EC8 A;  1TZ1 A;  3CIR B;  3DQV A;  4PYZ A;  3W9C B;  3ZDM C;  1QQR A;  4OZC A;  1ZPS A;  4NJ6 A;  2TSS A;  2BTE A;  2MBQ A;  5T8I A;  4YTM B;  3IAM 1;  2JPH A;  3TEX A;  1XT9 B;  4ICV A;  2FBW B;  1KTK A;  4HPP A;  3N9Y C;  2ZCB A;  2BS2 B;  1GAQ B;  2WWZ A;  4GSW A;  4F8C B;  4FHJ A;  2BT6 A;  4AS1 A;  1RRB A;  4OZB A;  2Y5C A;  1NBF C;  3J9C A;  2LGX A;  2LD9 A;  1S3S G;  4RCO A;  2J52 A;  4ANX A;  2FCM A;  1JML A;  3UIO B;  4W9C A;  4WUR A;  4K3B A;  4WJQ A;  4XGA B;  1WSP A;  2MLB A;  3AEA B;  1L4Z B;  1WXS A;  1WXA A;  1NEN B;  3BVZ A;  2CU3 A;  5BYQ A;  4OVZ A;  1TKG A;  4PT5 A;  3TEW A;  1Y8R C;  4AWJ A;  3T8M A;  1WMH B;  1CJE A;  4FBJ B;  2G4S A;  4XC2 A;  1T6B X;  1TS2 A;  1XLQ A;  2KOX A;  1FCL A;  1WX7 A;  2K8H A;  3I5J C;  3C0R B;  4RGT A;  3FIL B;  2KHW B;  2W55 A;  2NCN A;  3SU8 X;  1M94 A;  4URK A;  1YN4 A;  5JXV A;  1QZE A;  2K6Q A;  3AN1 A;  2RMM A;  4E71 A;  3EUB 2;  2M56 B;  3KWV A;  4LNO A;  4TV3 A;  4RM8 A;  2J0J A;  1WH3 A;  3AMZ A;  3MC8 A;  3Q69 A;  1ISN A;  1NYQ A;  3AU4 A;  5D7G A;  2JXX A;  5EDS A;  1QIL A;  2GBK A;  3AB5 A;  3ZVV A;  3MHS D;  4P1B C;  2OED A;  1ZW7 A;  2OOB B;  2BWE S;  4EZL A;  2AYO B;  1YOV B;  4GLS C;  2L8J A;  3PHX B;  1JRU A;  4DHJ B;  2NTS A;  3VTW A;  2O6V D;  1C78 A;  2B3A A;  2N4F A;  3ZLZ A;  1WY8 A;  1L7Y A;  2BKR B;  4FJY A;  3TEY A;  4GN1 A;  2W3S A;  1GNU A;  1WYW B;  1WMH A;  4IG7 B;  1E10 A;  4JWU C;  4LJP B;  3AE1 B;  1RYJ A;  3E9S A;  4MH8 A;  1CQV A;  4FLH A;  2NBW B;  2L0F A;  2XEW A;  2KJH B;  3FIL A;  3S2A A;  2MJD A;  5KHO A;  3QQ8 B;  1S1Q B;  3NG0 A;  2MX2 A;  1H8C A;  1XO3 A;  4R3D A;  4TSS A;  1N5W A;  2WXN A;  3WAP A;  2N1W A;  4DXG A;  4RM9 A;  1WR1 A;  2WQY B;  4EUT A;  2IO2 B;  5LXI B;  4KDI C;  3ECI A;  4ARC A;  3PHW B;  2DZM A;  2D07 B;  4IKG A;  3QJZ A;  1K50 A;  3PRE A;  2WXK A;  1WX8 A;  2M1M A;  4L23 A;  2IGH A;  4NNJ B;  2IZV B;  4H2A A;  5H8Y E;  3VFK A;  2ZEQ A;  1RM6 C;  4LCD E;  3ETR A;  4HJG E;  4KZ0 A;  2YEP B;  4A20 A;  1XXG A;  3L13 A;  5D3D A;  3SDL C;  1OQQ A;  2X38 A;  4YWG G;  3DCG A;  2H88 B;  1HQR D;  4ZOH C;  5HG2 A;  1WE7 A;  4OZA A;  1D5Z C;  1WGH A;  3DHG C;  1N62 A;  3Q8A A;  1FXA A;  4HWI B;  4MGY E;  3DHI C;  2PKO A;  3AH7 A;  3P1M A;  2HJ1 A;  2UU7 A;  4KGR A;  2QJL A;  1R4M I;  2L05 A;  4NAW B;  1M4V A;  3DBL I;  4ZHO A;  1N61 A;  1P1A A;  1OFF A;  2IY0 B;  2H89 B;  4WAF A;  2MJE A;  3V05 A;  3U30 A;  4XYC A;  4RGM A;  1TT5 B;  1K8R B;  2WXL A;  2CJN A;  4F1S A;  3TUO A;  1BML C;  1L0Y B;  2KDF B;  4A90 A;  1D6E C;  1LQB A;  3QA8 A;  2CHZ A;  2KDI A;  3R2I A;  3PRZ A;  1HZ5 A;  2IPK D;  4PK1 A;  3DPD A;  3MC9 A;  1YQ4 B;  4HJK A;  1WZ3 A;  1SIF A;  3TSS A;  1WM2 A;  2KLC A;  3PV1 A;  2WXM A;  3HM6 X;  3A9J B;  4A55 A;  3L17 A;  4A3P A;  1G6J A;  2RR9 A;  1F9J A;  2LGS A;  4HPL B;  4YXD B;  3L10 B;  3KH0 A;  3AE7 B;  4W9K A;  3H7S A;  4II2 B;  3WAM A;  2GOW A;  1NYR A;  5EE0 A;  2N9E B;  4O1N A;  4P16 A;  2KZR A;  2MWS B;  4I6L B;  3N32 A;  2KAJ A;  1EU4 A;  2KDM A;  3DWG C;  2KQ7 A;  2HE7 A;  1H4R A;  3VTV A;  4NAW A;  1SJE D;  2LUM A;  2ZPY A;  3X23 A;  1I4H A;  3ZNG C;  3APF A;  1MG8 A;  1ZUD 2;  4MT5 A;  4ZDV A;  1J7C A;  1ZP0 B;  2L83 A;  1UUP A;  1VR9 A;  3ZTD A;  2PTL A;  3QWZ B;  1V86 A;  2LUE A;  1PGB A;  3U8Z A;  1KLV A;  1JWU D;  3HRD D;  1WRI A;  2KJR A;  3QIJ A;  2KC2 A;  2KX0 A;  4K7U A;  4YSX B;  2CS4 A;  1V6E A;  4FUL A;  4JGH B;  2PE9 A;  2NS5 A;  2CR5 A;  3HVD A;  4GDL B;  2JZ3 B;  3MJ5 A;  4M00 A;  1GB1 A;  1XD3 B;  3B08 A;  3A9J A;  4E74 A;  2Q5W D;  4ZYN A;  3X0W A;  1T3Q A;  4RF0 A;  2G4D B;  4AJW A;  4KIK B;  3UI3 A;  2KK8 A;  4WWO A;  2N9P C;  4P7I A;  3NOB A;  1Z2M A;  1ZDV A;  1N5X A;  4KGT A;  2WXO A;  1DOY A;  1N63 A;  1E5W A;  2QIE B;  4XWT A;  1N6Z A;  3QCA A;  5L83 A;  1AN8 A;  2G9H D;  4OHJ A;  2JWU A;  2DYB A;  4B9K A;  3GE3 C;  1VZ8 A;  2EEL A;  4KSK C;  1QT9 A;  4DHJ D;  4HPM B;  3NJT A;  2V3N A;  4LNN A;  2PJH A;  4OVU A;  4NZL B;  4BBN F;  1Q1O A;  1A70 A;  3IAS 1;  2DAJ A;  3Q3J A;  2OJW A;  1WJ6 A;  3CWI A;  3OJ3 A;  2WXH A;  3GZN B;  1I4P A;  5DPW A;  2MBO A;  1TZO A;  3WA0 A;  4ANV A;  1V8C A;  3WAN A;  1WXM A;  4LJO B;  2FUG 1;  1C4P A;  1WI0 A;  2BYF A;  2ON8 A;  3L4P A;  1ZOY B;  3BK1 A;  3PRM B;  4RH6 A;  4N6E B;  3VR8 B;  2ZNV B;  4KKJ A;  3A4R A;  4LLG M;  1YQ3 B;  4GDL A;  2VH1 A;  3NZ3 A;  4LNK A;  2KWC A;  4ZRJ A;  4CHK A;  1L6V A;  2N9L A;  1EF1 A;  5GXG B;  3ZNH B;  2BQQ A;  2ZZP B;  3HM3 A;  4KIK A;  3URY A;  3V6C B;  2C9W B;  3RNC C;  3IVF A;  3ZXV A;  2W9N A;  3LDZ E;  2MBH A;  4TQ0 A;  1P7F A;  3BYT B;  1D4B A;  2IGD A;  2GBM A;  2KLG A;  1FNV A;  4A8X C;  4WWP A;  3W1S A;  1RAX A;  2MH7 A;  1JWB D;  2K8C A;  4ZYS A;  3SHQ A;  1JRP A;  4WH4 A;  1FNU A;  3VH4 B;  2FE8 A;  2I38 A;  1ZXI A;  2KVR A;  2QDF A;  5D6J B;  1DOX A;  1MJD A;  3SFD B;  3IXS A;  4N58 A;  2FCQ A;  2LJ5 A;  3IFW B;  1F52 A;  2PIA A;  4CQN A;  2JYE A;  1P0R A;  3RNF C;  3NVV A;  3T3O A;  4I6N B;  4KZC A;  4JLC A;  4QAY A;  3RNB C;  4M8N A;  4L1B A;  3JSV B;  3QX1 A;  2SEB D;  3R7R A;  1VZ6 A;  4A9A A;  3ML8 A;  2CJO A;  2GBR A;  2Y5B B;  4XDD A;  2I2Y A;  2NR2 A;  1L2N A;  3AEE B;  1UGM A;  3T3N A;  2AQ1 B;  4LDT B;  2AEH A;  5IOI A;  1WM3 A;  4M02 A;  1TIF A;  5C1Z A;  1YIW A;  1RWS A;  4MM3 B;  3DBR B;  1P98 A;  2DBY A;  1BT0 A;  2L32 A;  2PE6 B;  2D3A A;  5G55 A;  3OJ4 B;  2OHF A;  1SB3 C;  1TTN A;  4P1C C;  1HXY D;  2MRP A;  3PO0 A;  2WHI A;  3UF8 A;  2LJI A;  3NUH B;  3ABV B;  1I35 A;  3BII D;  3RYT A;  1D5X C;  1KFY B;  2GBN A;  2OJR A;  3EEC A;  5FKA C;  4ICU A;  2RPQ A;  2D11 A;  2A4Z A;  4M01 A;  4KVG B;  2DZJ A;  2PVG C;  4XZ4 A;  2RGF A;  3PRP B;  4D2K A;  4YTP B;  3HHM A;  3AEB B;  1TS5 A;  2XK5 B;  2ACZ B;  5MPO A;  1V81 A;  3IHP C;  1STE A;  5IN7 A;  2GMI C;  1NDD A;  2ZVO A;  4C00 A;  3JSV A;  5CX3 A;  2LGY A;  3QC8 B;  3RUI B;  2FID A;  5J2R A;  1L0X B;  3I63 C;  1WJ4 A;  1NI2 A;  5I4D A;  2ZCC A;  1GG3 A;  5HKH A;  3VTU A;  2JYT A;  1E0Z A;  1TKY A;  1SBB B;  4MM3 A;  4N59 A;  5DPS A;  1VJK A;  4HLE A;  1IPG A;  4K3C A;  1Q5W B;  3BIN A;  4LK0 M;  1SE3 A;  4PYU A;  1F77 A;  2KAN A;  2N9X A;  2L52 A;  1JWM D;  3GS2 A;  2BVC A;  2LXA A;  4F7Z A;  2V4I B;  4MGZ E;  4MJS B;  1TS4 A;  2D3G A;  2QSD A;  2WXI A;  4BBN C;  1FRR A;  3EHV A;  2FUH B;  1WGR A;  1TYG B;  1I4G A;  3AU5 A;  3VDZ A;  3RN9 C;  1JAL A;  2D3B A;  2J7Q B;  1FO4 A;  3SR6 A;  1JCK B;  1J19 A;  1XEE A;  2G3Q B;  2XK5 A;  1V2Y A;  1I7H A; 
#chains in the Genus database with same CATH homology
 3DCG A;  2KTR B;  5BO4 B;  1KM7 A;  3NZU A;  2DX5 B;  4GXB A;  1GC7 A;  2KKC A;  1WE7 A;  1WGH A;  1R4N I;  4FJZ A;  4HCP B;  5L95 C;  2C5L C;  2BYE A;  4HXD A;  4TQ1 A;  4HWI B;  2L3Z A;  3V60 A;  4MGY E;  4GMV A;  3CF6 E;  1E8W A;  3ZO5 B;  2CHW A;  3KUC B;  2KFJ A;  3K9O B;  1R4M I;  2L05 A;  2V3S A;  5J18 A;  2JF5 A;  3VHT C;  2REX A;  3DOW A;  2JRH A;  3KUD B;  4NAW B;  3V62 A;  2KD0 A;  2N7D A;  2EMT A;  2KWV B;  1UBI A;  4WJP A;  3DBL I;  3RUL A;  2JT4 B;  1P1A A;  3A4S C;  3KW5 B;  2IY0 B;  5AZG A;  4MSQ B;  3NZS A;  4GU2 A;  3RT3 B;  4FN2 A;  3K9P B;  5CHW A;  3U30 A;  3PPA A;  4GOC A;  2MP2 B;  3PTF C;  1C3T A;  2C7M B;  1K8R B;  2LWP A;  3APD A;  5CTR C;  3A9K A;  1V9J A;  4F1S A;  4MJS A;  2RSU A;  1LFD A;  2EKE C;  2VRR B;  3TMP B;  4A3O A;  3B1L X;  2LI5 A;  2KDF B;  3VAW A;  1LQB A;  1UBQ A;  3QA8 A;  2CHZ A;  2KDI A;  3PRZ A;  1WR6 E;  4KV2 A;  3DPD A;  1ZKH A;  2WX1 A;  3L0W B;  4HJK A;  4WJO A;  2K8B A;  1T0Y A;  2C60 A;  4HDO A;  4IWO A;  3QAR A;  2EMS A;  1WZ3 A;  1SIF A;  3L54 A;  1WM2 A;  2KLC A;  2L76 A;  3PV1 A;  3UIN B;  3HM6 X;  4BKS D;  3TCA A;  2DYO A;  3A9J B;  2Z59 B;  3L17 A;  4JIO U;  2V1Y A;  2DZI A;  4A3P A;  1G6J A;  4DBG A;  3PLV A;  2RR9 A;  2O6V B;  2N1V A;  1F9J A;  1E8Y A;  4PS7 A;  4IUM B;  4EFO A;  4HPL B;  2YLM A;  1A5R A;  4BOS C;  3L10 B;  4N9F 4;  2KTR A;  3KH0 A;  1RLF A;  3ZKJ C;  2FNJ B;  4W9K A;  4ASW C;  3H7S A;  1P3Q U;  3KYC D;  4II2 B;  3WAM A;  4BVU C;  2GOW A;  1WGD A;  1V80 A;  4K7S A;  3QHT A;  4IM3 A;  2N9E B;  2N7E A;  1E8X A;  3WIM A;  2NPT B;  3PS6 A;  2KZR A;  2MWS B;  3JYU A;  1UD7 A;  1WRD B;  2KJ6 A;  4K81 A;  4I6L B;  5JH5 C;  3N32 A;  1E7V A;  1OEY A;  3PVL A;  4W9D A;  3P2B A;  3UIP B;  2KO3 A;  4ZRK A;  3IBE A;  2KQ7 A;  5DPT A;  2DYM A;  1TBE A;  2HE7 A;  2IO0 B;  1H4R A;  4AP4 C;  4YL8 A;  3RD2 A;  5E6N A;  2DZK A;  4NAW A;  2LVQ A;  3VTV A;  4BFR A;  1PQS A;  3TIX A;  1RFA A;  2ZPY A;  3X23 A;  2IO3 B;  2BGF A;  2K1F A;  4IC7 B;  1P9D U;  2IO1 B;  2JVC A;  3ZNG C;  3APF A;  4DWF A;  4FJV B;  2O2V B;  1MG8 A;  4ZDV A;  1I42 A;  2NBU A;  2LRW A;  2MA9 B;  3HIZ A;  3ZTC A;  3ENE A;  4G11 A;  2MP2 A;  3ZTD A;  4RMA A;  4W9I A;  3VUW A;  5D94 A;  4DHZ B;  3QWZ B;  2KC1 A;  1V86 A;  2LUE A;  3PT2 B;  4GDK B;  3U8Z A;  1KLV A;  2NBV B;  3U7D A;  5JHB A;  4W9L A;  5GMV A;  4AJY B;  1UZX B;  1YX5 B;  4W9G A;  2KJR A;  3QIJ A;  5DPR A;  2KC2 A;  2KX0 A;  4NPN A;  3IG3 A;  5CHV C;  4K7U A;  2CS4 A;  1V6E A;  4FUL A;  4JGH B;  4OVV A;  4E3C A;  2PE9 A;  2NS5 A;  4K7W A;  3VUX A;  2CR5 A;  4GDL B;  2G45 B;  2JZ3 B;  3ZRF A;  4NQK E;  2FIF A;  1XD3 B;  4K1R B;  4DK5 A;  1Z5S B;  2DEN B;  4HDQ A;  3B08 A;  3ZRC A;  3A9J A;  4LDT D;  4E74 A;  1GJZ A;  2C7H A;  2BYV E;  3R7Q A;  3VUY A;  2JZZ A;  3OLM D;  4XX5 A;  4ZYN A;  3X0W A;  3ALB A;  2O6V A;  4AOF A;  2G4D B;  4AJW A;  4KIK B;  2C7N B;  5E6P A;  2KK8 A;  4WWO A;  2N9P C;  4I6P A;  1AAR A;  2L0T A;  4P7I A;  4DDI D;  3NOB A;  1Z2M A;  4CO7 A;  1J0G A;  3N30 A;  4PS3 A;  2KQS A;  4DHZ E;  3ZUN A;  4TKN A;  2D2Q A;  4MSM B;  1E5W A;  3JW0 X;  4MEL A;  1SGH A;  2ASQ A;  3QAQ A;  1EO6 A;  2HJ8 A;  2NPT A;  1WE6 A;  4WAA A;  2J0K A;  5LLI A;  3ML9 A;  3QCA A;  2UWQ A;  1OQY A;  5L83 A;  3V6E B;  2HD5 B;  3DVG Y;  2BF8 B;  3H9D A;  3KUZ A;  2CU1 A;  1WZ0 A;  1XQQ A;  3H6N A;  2DYB A;  4MH0 E;  3V61 A;  1WX9 A;  3PGE A;  4B9K A;  5JHA A;  3MJW A;  2L00 B;  4KSK C;  4DHJ D;  4PS8 A;  2YVC A;  4HPM B;  2GBJ A;  4DDG D;  1V5O A;  1IYF A;  2BKF A;  1ZGU B;  1OEY J;  1WXV A;  3KVF B;  3NHE B;  3VQI A;  3M3J A;  5E6O A;  2PJH A;  3GZN I;  4OVU A;  3DDC B;  4KDL B;  2O2V A;  3APC A;  3DBH I;  4BBN F;  1Q1O A;  3A1Q B;  4EKU A;  4BKT A;  2DAJ A;  2JY6 A;  3Q3J A;  5FR6 A;  1WJ6 A;  3UQB A;  3BY4 B;  3OJ3 A;  3SD5 A;  1V5T A;  2RD0 A;  1E7U A;  4TUU A;  5DPW A;  2MBO A;  3WA0 A;  4W9J A;  4ANV A;  4W9E A;  4GDK A;  3WAN A;  2LVO A;  2KXJ A;  3GOE A;  4W9F A;  3TJP A;  1WXM A;  3R66 C;  4LJO B;  3H7P B;  1GC6 A;  2J0M A;  1WI0 A;  2BYF A;  3PLU A;  4WQO B;  3RZF A;  3W1Y A;  3PZD A;  4WJN A;  2CKH B;  4AUQ C;  4ANW A;  3VVW B;  3DVN V;  3PRM B;  5C23 A;  2LGD A;  2IY1 B;  2KX3 A;  2ZNV B;  3A4R A;  3ZNI D;  2L7R A;  3ZW3 A;  3EC8 A;  4GDL A;  2LZ6 A;  4HK2 A;  2KFK B;  3UQA A;  2KWC A;  3B0A A;  1TZ1 A;  3DQV A;  4PYZ A;  4MEM A;  4ZRJ A;  1V49 A;  3ZDM C;  4IWQ A;  4CHK A;  3AUL A;  3MTN B;  4NJ6 A;  4FAD A;  2M8S A;  1EF1 A;  2KMA A;  2MBQ A;  1TGZ B;  3ZNH B;  2ZZP B;  3VXW A;  3HM3 A;  1CMX B;  2JPH A;  4KIK A;  1XT9 B;  3M95 A;  3V6C B;  2C9W B;  4ICV A;  4IW0 A;  5IAA C;  1X1M A;  3IVF A;  2W9N A;  3JVZ X;  4NY0 A;  3LDZ E;  2MBH A;  4TQ0 A;  3N3K B;  2ZCB A;  2GBM A;  2KLG A;  3H1U A;  2WWZ A;  4GSW A;  1WF9 A;  4WWP A;  3W1S A;  5IA7 A;  1RAX A;  5AZF A;  4F8C B;  4FHJ A;  4IM0 A;  2QHO A;  2V4L A;  5AEK B;  3WAL A;  2K8C A;  2WDT B;  1RRB A;  3SHQ A;  1FXT B;  2BWF A;  2LVP A;  3VH4 B;  3RZW C;  2KWU B;  2KMC A;  4DXA B;  2LXC A;  2KVR A;  1NBF C;  4EOY A;  3UGB B;  2BPS A;  2LGX A;  2LD9 A;  1S3S G;  5D6J B;  3W1S C;  4ANX A;  4BOZ B;  4EEW A;  2FCM A;  5J17 A;  3UIO B;  4B6W A;  4W9C A;  3CST A;  3A1Q A;  3DVG X;  2AL6 A;  4JL9 A;  2FCQ A;  2M17 A;  3Q3F A;  2LJ5 A;  2Z0D B;  3IFW B;  2MBB B;  1E8Z A;  4WJQ A;  4MDK E;  5JZE B;  2MLB A;  2MBE A;  4EZK A;  3H7P A;  1WXS A;  1WXA A;  4KSL C;  1P0R A;  3I3T B;  4JQW C;  2CHX A;  3LJ3 A;  3ZDT A;  2MQJ A;  2MW5 A;  3T9L A;  4FA6 A;  2IYD B;  3D32 A;  4II3 B;  1HE8 A;  3L08 A;  1Y8R C;  4MGI E;  4AWJ A;  3T8M A;  3ONS A;  2JWZ A;  1WMH B;  1WGG A;  4I6N B;  4KZC A;  4JLC A;  2ZVN A;  4FBJ B;  2KFK A;  2G4S A;  1YQB A;  4XC2 A;  2XBB C;  4M8N A;  1GUA B;  1D3Z A;  3JSV B;  2KOX A;  3QX1 A;  3TL5 A;  1WX7 A;  3CMM B;  4MGK E;  2K39 A;  3R7R A;  2K8H A;  2UYZ B;  3ML8 A;  2Y5B B;  2GBR A;  3C0R B;  5G2N A;  5AZH A;  2KHW B;  2NR2 A;  2Z0E B;  2ZNV C;  2NCN A;  3SU8 X;  1M94 A;  4URK A;  1L2N A;  1UGM A;  1UEL A;  1SE9 A;  3CSF A;  1E90 A;  4BKS A;  3DBS A;  2KTF A;  1QZE A;  4LDT B;  2K6Q A;  2AEH A;  4E71 A;  5TR5 A;  1WM3 A;  2M4N A;  2AL3 A;  1OGW A;  3DBR I;  4ANU A;  3EFU A;  5C1Z A;  4TV3 A;  4RM8 A;  4J6I A;  2J0J A;  1YIW A;  2D10 A;  1J8C A;  1WH3 A;  3PSE B;  1P98 A;  1WGY A;  2M0X A;  1ISN A;  3AU4 A;  1BT0 A;  2PE6 B;  3L16 A;  5G55 A;  5D7G A;  2JXX A;  5EDS A;  2GBK A;  3ZVV A;  3MHS D;  1LM8 B;  3OAW A;  3AI5 A;  3OJ4 B;  1ZW7 A;  1TTN A;  2PEA A;  2OOB B;  2BWE S;  2MRP A;  4ZRI A;  4EZL A;  1U4A A;  4NQL B;  3UF8 A;  1EF5 A;  1I35 A;  2AYO B;  3RYT A;  1Q0W B;  4FHK A;  5LXH A;  3HK0 A;  2L8J A;  3PHX B;  1C1Y B;  1JRU A;  2GBN A;  4DHJ B;  2OJR A;  3VTW A;  2I1J A;  3EEC A;  2O6V D;  4X57 B;  2DAF A;  2RPQ A;  2B3A A;  2N4F A;  2D11 A;  2A4Z A;  4ICU A;  1WJU A;  2DZJ A;  1WY8 A;  1L7Y A;  4KVG B;  3ZLZ A;  5KHQ A;  2BKR B;  4EZJ A;  4XZ4 A;  3AXC A;  2R2O A;  4FJY A;  2RGF A;  3PRP B;  4B95 A;  4GN1 A;  5D2M B;  1YX6 B;  1UH6 A;  1KJT A;  3HHM A;  4G3X B;  2LAS A;  3A33 B;  4GB9 A;  2XK5 B;  1EUV B;  1GNU A;  2HTH A;  2A5U A;  1WIA A;  1WYW B;  1V81 A;  1WMH A;  3QK0 A;  4IG7 B;  3IHP C;  1KOT A;  1LXD A;  3NY5 A;  1VCB A;  4LJP B;  2GMI C;  3O65 B;  1NDD A;  3NS8 A;  2FCN A;  2FAZ A;  2ZVO A;  3WAO A;  3JSV A;  5CX3 A;  4M0W B;  2LGY A;  2KNB A;  3QC8 B;  3RUI B;  2FID A;  2ZPN A;  4FLH A;  4NJ7 A;  2NBW B;  2L0F A;  5J2R A;  2XEW A;  1VD2 A;  2KJH B;  2LRU A;  2NVU I;  2DHZ A;  1WJN A;  2KDB A;  3S2A A;  4GIV A;  1WJ4 A;  2K6D B;  5KHO A;  3QQ8 B;  1NI2 A;  2ZJD A;  1S1Q B;  3ZIM A;  2ZCC A;  4G0N B;  4IWP A;  2MX2 A;  1GG3 A;  3DVN U;  3R3M A;  1H8C A;  5HKH A;  3VTU A;  4WWN A;  3WAP A;  3VH3 B;  2N1W A;  4MM3 A;  2JUO A;  5DPS A;  4M8M A;  1WR1 A;  4RM9 A;  4HLE A;  4EUT A;  1IPG A;  2IO2 B;  4W9H A;  1Q5W B;  5CHF A;  2K25 A;  3TBL D;  5LXI B;  4KDI C;  3BIN A;  3ECI A;  3ZNZ B;  1YJ1 A;  4PYU A;  2KAN A;  2N9X A;  3PHW B;  2FCS A;  2DZM A;  2D07 B;  3M63 B;  2KN5 A;  2LXA A;  3QJZ A;  4F7Z A;  1YD8 U;  3A9K B;  2KDE B;  3PRE A;  4MGZ E;  1WFY A;  4MJS B;  1WX8 A;  2M1M A;  2AWT A;  2D3G A;  2MSE D;  4NNJ B;  3KYD D;  2IZV B;  4CYE A;  2R2Q A;  1OTR B;  4GGQ A;  3VFK A;  4BBN C;  2ZEQ A;  2PPH A;  2WYQ A;  2I1K A;  3EHV A;  4LCD E;  3RCZ A;  2FUH B;  1WGR A;  4KZ0 A;  4BKG A;  3AU5 A;  3VDZ A;  4A20 A;  2J7Q B;  4IM2 A;  4HCN B;  3L13 A;  1J19 A;  2G3Q B;  5DCN A;  2XK5 A;  3SDL C;  2WX0 A;  3M62 B;  4G50 A;  4HVB A;  1V2Y A;  2IBI B;  1IP9 A;  2MCN B;  2JRI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...