3M99C

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
AQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 33
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3m99C00
4DHXB 4ZUXV 3FWBC 3KIKA 4FIPB 4W4UB 3FWCC 4MBEC 4C31B 3KJLA 4FK5B 3MHSB 3M99C 3MHHB 4FJCB 4WA6B
chains in the Genus database with same CATH superfamily
2Z8KA 4LUHA 4DM0A 1MM8A 2I2ZA 2VDBA 1HA2A 4TQ0A 2KWFA 1E7EA 3A73A 3JRYA 5FUOA 2BXMA 3NVKA 5IFOA 2BXLA 1UORA 4L9QA 4MBEC 4F5VA 3LU6A 4ZC6A 5IJFA 5GHKA 4ZBRA 4Z9OA 2V36A 1E7BA 4EMXA 4ZCGA 2XW0A 2DYOA 4I9OA 4ZBKA 2E0YA 2NQOA 3ICXA 1MUSA 1MA9A 3CX9A 5IIXA 2BXPA 1J78A 5IIUA 1MUHA 3SIVB 2GUTA 5IJEA 3LU8A 2DG5A 4K2CA 2QHBA 4FIPB 5B5TA 2XVQA 1TXUA 1KXPD 3H3AA 4FK5B 4IW2A 1N5UA 5BPKA 3UIVA 2BXCA 3H37A 3V08A 4G01A 2XSIA 5DQFA 2I30A 2BXHA 4GDKB 1KDXA 2DYMA 4L9KA 4TQ1A 2BXBA 1NT2B 2LXSA 1VZSA 1GNIA 2LXTA 2VUEA 3FWCC 4F5TA 4GG2A 2DBWA 1HK4A 4PO0A 3MHHB 3B9LA 1AO6A 1H5WA 3VQIA 3LU7A 4G04A 1IJGA 1LNSA 4LUFA 4OTUA 1E7AA 3SQJA 5ID9A 3WHQA 3JQZA 1BJ5A 3MHSB 4L8UA 4BKEA 3M99C 1E7HA 2E0XA 2EFEA 4OR0A 4F5UA 5ID7A 2OZBB 2XMOA 2LQIA 1HK2A 4JK4A 1MIWA 1SB0A 2BXDA 4M70B 1BKEA 4N0FD 2XVWA 3SIUB 2BXAA 2JUHA 3GA9L 2ROHA 3ECPA 1E7GA 2LOQA 5IIHA 3FWBC 2K0NA 4W4UB 1GNJA 2BXOA 5GIOA 1TF0A 2DBUA 3KJLA 4LB2A 2OT3A 3NVMA 3BPJA 3TDLA 2DBXA 4S1YA 3G9KD 2Z8JA 3V09A 2BXFA 1KW2A 2XVVA 3GQXA 4OTTA 3B9MA 4GDXA 2AJEA 3FNMA 2QM6A 3GQUA 2BXEA 4FJCB 3NMUA 1E7IA 4E99A 1HK1A 2BXIA 1MIVA 2YDFA 4GDLB 5GIPA 1VFIA 1J7EA 4G03A 4NAWB 3W1SA 4LB9A 2BXKA 4ZUXV 4C31B 3WHSA 4N3ZA 1HK3A 2CKXA 2LQHA 4OT2A 5D7GA 4BY9C 2QMCA 5HOZA 3V03A 1LOTA 3WHRA 2Z8IA 2BXNA 2BXQA 1FOUA 1HK5A 1JNBA 2EFHA 4F5SA 2NNWA 4K71A 2BXGA 1O9XA 2XW1A 4Z69A 4WA6B 4IW1A 4DHXB 1E78A 4N0UD 1H9ZA 4LA0A 1E7FA 5IJ5A 1MIYA 4D7XA 2EFCA 1BM0A 2VUFA 4HGMB 2AGHB 5DBYA 3A75A 2XVUA 2KBZA 3KIKA 4HGKA 3NVIA 5GINA 2BX8A 4ZBQA 2EFDA 3PLAA 4J2VA 1E7CA
chains in the Genus database with same CATH topology
2Z8KA 4LUHA 2I2ZA 2VDBA 1HA2A 4TQ0A 3JRYA 1E7EA 3A73A 5FUOA 2BXMA 3NVKA 5IFOA 2BXLA 1UORA 4L9QA 4MBEC 4F5VA 3LU6A 4ZC6A 5IJFA 5GHKA 4ZBRA 4Z9OA 2V36A 1E7BA 4EMXA 4ZCGA 2XW0A 2DYOA 4ZBKA 2E0YA 2NQOA 3ICXA 1MA9A 3CX9A 5IIXA 2BXPA 1J78A 5IIUA 3SIVB 5IJEA 3LU8A 2DG5A 4K2CA 2QHBA 4FIPB 5B5TA 2XVQA 1TXUA 1KXPD 3H3AA 4FK5B 4IW2A 1N5UA 5BPKA 3UIVA 2BXCA 3H37A 3V08A 4G01A 2XSIA 5DQFA 2I30A 2BXHA 4GDKB 2DYMA 4L9KA 4TQ1A 2BXBA 1NT2B 3FWCC 1VZSA 1GNIA 2VUEA 4F5TA 4GG2A 2DBWA 1HK4A 4PO0A 3MHHB 3B9LA 1AO6A 1H5WA 3VQIA 3LU7A 4G04A 1IJGA 1LNSA 4LUFA 4OTUA 1E7AA 3SQJA 5ID9A 3WHQA 3JQZA 1BJ5A 3MHSB 4L8UA 4BKEA 3M99C 1E7HA 2E0XA 2EFEA 4OR0A 4F5UA 5ID7A 2OZBB 2XMOA 1HK2A 4JK4A 1MIWA 4N0FD 2BXDA 4M70B 1BKEA 3SIUB 2XVWA 2BXAA 2JUHA 3GA9L 2ROHA 1E7GA 2LOQA 5IIHA 3FWBC 4W4UB 1GNJA 2BXOA 5GIOA 1TF0A 2DBUA 3KJLA 4LB2A 2OT3A 3NVMA 3TDLA 2DBXA 4S1YA 3G9KD 2Z8JA 3V09A 2BXFA 1KW2A 2XVVA 3GQXA 4OTTA 3B9MA 4GDXA 2AJEA 3FNMA 2QM6A 3GQUA 2BXEA 4FJCB 3NMUA 1E7IA 4E99A 1HK1A 2BXIA 1MIVA 2YDFA 4GDLB 5GIPA 1VFIA 1J7EA 4G03A 4NAWB 3W1SA 4LB9A 2BXKA 4ZUXV 4C31B 3WHSA 4N3ZA 1HK3A 2CKXA 5D7GA 4OT2A 4BY9C 2QMCA 5HOZA 3V03A 1LOTA 3WHRA 2Z8IA 2BXNA 2BXQA 1FOUA 1HK5A 1JNBA 2EFHA 4F5SA 2NNWA 4K71A 2BXGA 1O9XA 2XW1A 4Z69A 4WA6B 4IW1A 4DHXB 1E78A 4N0UD 1H9ZA 4LA0A 1E7FA 5IJ5A 1MIYA 2EFCA 1BM0A 2VUFA 4HGMB 5DBYA 3A75A 2XVUA 2KBZA 3KIKA 4HGKA 3NVIA 5GINA 2BX8A 4ZBQA 2EFDA 3PLAA 4J2VA 1E7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHX B;  4ZUX V;  3FWB C;  3KIK A;  4FIP B;  4W4U B;  3FWC C;  4MBE C;  4C31 B;  3KJL A;  4FK5 B;  3MHS B;  3M99 C;  3MHH B;  4FJC B;  4WA6 B; 
#chains in the Genus database with same CATH topology
 2Z8K A;  4LUH A;  4DM0 A;  1MM8 A;  2I2Z A;  2VDB A;  1HA2 A;  4TQ0 A;  2KWF A;  1E7E A;  3A73 A;  3JRY A;  5FUO A;  2BXM A;  3NVK A;  5IFO A;  2BXL A;  1UOR A;  4L9Q A;  4MBE C;  4F5V A;  3LU6 A;  4ZC6 A;  5IJF A;  5GHK A;  4ZBR A;  4Z9O A;  2V36 A;  1E7B A;  4EMX A;  4ZCG A;  2XW0 A;  2DYO A;  4I9O A;  4ZBK A;  2E0Y A;  2NQO A;  3ICX A;  1MUS A;  1MA9 A;  3CX9 A;  5IIX A;  2BXP A;  1J78 A;  5IIU A;  1MUH A;  3SIV B;  2GUT A;  5IJE A;  3LU8 A;  2DG5 A;  4K2C A;  2QHB A;  4FIP B;  5B5T A;  2XVQ A;  1TXU A;  1KXP D;  3H3A A;  4FK5 B;  4IW2 A;  1N5U A;  5BPK A;  3UIV A;  2BXC A;  3H37 A;  3V08 A;  4G01 A;  2XSI A;  5DQF A;  2I30 A;  2BXH A;  4GDK B;  1KDX A;  2DYM A;  4L9K A;  4TQ1 A;  2BXB A;  1NT2 B;  2LXS A;  1VZS A;  1GNI A;  2LXT A;  2VUE A;  3FWC C;  4F5T A;  4GG2 A;  2DBW A;  1HK4 A;  4PO0 A;  3MHH B;  3B9L A;  1AO6 A;  1H5W A;  3VQI A;  3LU7 A;  4G04 A;  1IJG A;  1LNS A;  4LUF A;  4OTU A;  1E7A A;  3SQJ A;  5ID9 A;  3WHQ A;  3JQZ A;  1BJ5 A;  3MHS B;  4L8U A;  4BKE A;  3M99 C;  1E7H A;  2E0X A;  2EFE A;  4OR0 A;  4F5U A;  5ID7 A;  2OZB B;  2XMO A;  2LQI A;  1HK2 A;  4JK4 A;  1MIW A;  1SB0 A;  2BXD A;  4M70 B;  1BKE A;  4N0F D;  2XVW A;  3SIU B;  2BXA A;  2JUH A;  3GA9 L;  2ROH A;  3ECP A;  1E7G A;  2LOQ A;  5IIH A;  3FWB C;  2K0N A;  4W4U B;  1GNJ A;  2BXO A;  5GIO A;  1TF0 A;  2DBU A;  3KJL A;  4LB2 A;  2OT3 A;  3NVM A;  3BPJ A;  3TDL A;  2DBX A;  4S1Y A;  3G9K D;  2Z8J A;  3V09 A;  2BXF A;  1KW2 A;  2XVV A;  3GQX A;  4OTT A;  3B9M A;  4GDX A;  2AJE A;  3FNM A;  2QM6 A;  3GQU A;  2BXE A;  4FJC B;  3NMU A;  1E7I A;  4E99 A;  1HK1 A;  2BXI A;  1MIV A;  2YDF A;  4GDL B;  5GIP A;  1VFI A;  1J7E A;  4G03 A;  4NAW B;  3W1S A;  4LB9 A;  2BXK A;  4ZUX V;  4C31 B;  3WHS A;  4N3Z A;  1HK3 A;  2CKX A;  2LQH A;  4OT2 A;  5D7G A;  4BY9 C;  2QMC A;  5HOZ A;  3V03 A;  1LOT A;  3WHR A;  2Z8I A;  2BXN A;  2BXQ A;  1FOU A;  1HK5 A;  1JNB A;  2EFH A;  4F5S A;  2NNW A;  4K71 A;  2BXG A;  1O9X A;  2XW1 A;  4Z69 A;  4WA6 B;  4IW1 A;  4DHX B;  1E78 A;  4N0U D;  1H9Z A;  4LA0 A;  1E7F A;  5IJ5 A;  1MIY A;  4D7X A;  2EFC A;  1BM0 A;  2VUF A;  4HGM B;  2AGH B;  5DBY A;  3A75 A;  2XVU A;  2KBZ A;  3KIK A;  4HGK A;  3NVI A;  5GIN A;  2BX8 A;  4ZBQ A;  2EFD A;  3PLA A;  4J2V A;  1E7C A; 
#chains in the Genus database with same CATH homology
 2Z8K A;  4LUH A;  2I2Z A;  2VDB A;  1HA2 A;  4TQ0 A;  3JRY A;  1E7E A;  3A73 A;  5FUO A;  2BXM A;  3NVK A;  5IFO A;  2BXL A;  1UOR A;  4L9Q A;  4MBE C;  4F5V A;  3LU6 A;  4ZC6 A;  5IJF A;  5GHK A;  4ZBR A;  4Z9O A;  2V36 A;  1E7B A;  4EMX A;  4ZCG A;  2XW0 A;  2DYO A;  4ZBK A;  2E0Y A;  2NQO A;  3ICX A;  1MA9 A;  3CX9 A;  5IIX A;  2BXP A;  1J78 A;  5IIU A;  3SIV B;  5IJE A;  3LU8 A;  2DG5 A;  4K2C A;  2QHB A;  4FIP B;  5B5T A;  2XVQ A;  1TXU A;  1KXP D;  3H3A A;  4FK5 B;  4IW2 A;  1N5U A;  5BPK A;  3UIV A;  2BXC A;  3H37 A;  3V08 A;  4G01 A;  2XSI A;  5DQF A;  2I30 A;  2BXH A;  4GDK B;  2DYM A;  4L9K A;  4TQ1 A;  2BXB A;  1NT2 B;  3FWC C;  1VZS A;  1GNI A;  2VUE A;  4F5T A;  4GG2 A;  2DBW A;  1HK4 A;  4PO0 A;  3MHH B;  3B9L A;  1AO6 A;  1H5W A;  3VQI A;  3LU7 A;  4G04 A;  1IJG A;  1LNS A;  4LUF A;  4OTU A;  1E7A A;  3SQJ A;  5ID9 A;  3WHQ A;  3JQZ A;  1BJ5 A;  3MHS B;  4L8U A;  4BKE A;  3M99 C;  1E7H A;  2E0X A;  2EFE A;  4OR0 A;  4F5U A;  5ID7 A;  2OZB B;  2XMO A;  1HK2 A;  4JK4 A;  1MIW A;  4N0F D;  2BXD A;  4M70 B;  1BKE A;  3SIU B;  2XVW A;  2BXA A;  2JUH A;  3GA9 L;  2ROH A;  1E7G A;  2LOQ A;  5IIH A;  3FWB C;  4W4U B;  1GNJ A;  2BXO A;  5GIO A;  1TF0 A;  2DBU A;  3KJL A;  4LB2 A;  2OT3 A;  3NVM A;  3TDL A;  2DBX A;  4S1Y A;  3G9K D;  2Z8J A;  3V09 A;  2BXF A;  1KW2 A;  2XVV A;  3GQX A;  4OTT A;  3B9M A;  4GDX A;  2AJE A;  3FNM A;  2QM6 A;  3GQU A;  2BXE A;  4FJC B;  3NMU A;  1E7I A;  4E99 A;  1HK1 A;  2BXI A;  1MIV A;  2YDF A;  4GDL B;  5GIP A;  1VFI A;  1J7E A;  4G03 A;  4NAW B;  3W1S A;  4LB9 A;  2BXK A;  4ZUX V;  4C31 B;  3WHS A;  4N3Z A;  1HK3 A;  2CKX A;  5D7G A;  4OT2 A;  4BY9 C;  2QMC A;  5HOZ A;  3V03 A;  1LOT A;  3WHR A;  2Z8I A;  2BXN A;  2BXQ A;  1FOU A;  1HK5 A;  1JNB A;  2EFH A;  4F5S A;  2NNW A;  4K71 A;  2BXG A;  1O9X A;  2XW1 A;  4Z69 A;  4WA6 B;  4IW1 A;  4DHX B;  1E78 A;  4N0U D;  1H9Z A;  4LA0 A;  1E7F A;  5IJ5 A;  1MIY A;  2EFC A;  1BM0 A;  2VUF A;  4HGM B;  5DBY A;  3A75 A;  2XVU A;  2KBZ A;  3KIK A;  4HGK A;  3NVI A;  5GIN A;  2BX8 A;  4ZBQ A;  2EFD A;  3PLA A;  4J2V A;  1E7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...