3M99C

Structure of the ubp8-sgf11-sgf73-sus1 saga dub module
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
91
structure length
91
Chain Sequence
AQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for assembly and activation of the heterotetrameric SAGA histone H2B deubiquitinase module.
pubmed doi rcsb
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
molecule tags Transcription
source organism Saccharomyces cerevisiae
total genus 33
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10163 EnY2 Transcription factor e(y)2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.140 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 3m99C00
3MHSB 4FK5B 4MBEC 3KIKA 3MHHB 4FIPB 4C31B 3FWBC 4WA6B 4ZUXV 3FWCC 4DHXB 4FJCB 4W4UB 3M99C 3KJLA
chains in the Genus database with same CATH superfamily
5ID7A 1H5WA 2BXAA 3MHSB 4S1YA 1E7HA 2Z8KA 3V09A 4EMXA 4ZBQA 3TDLA 4Z9OA 2V36A 5IJEA 4LB2A 2LQIA 1MUHA 3JQZA 1JNBA 5FUOA 3FNMA 5ID9A 4OTUA 5DQFA 3W1SA 2BXCA 4OT2A 3SQJA 1FOUA 4GG2A 4BY9C 4GDKB 2OZBB 4LUFA 2NNWA 1HK4A 3SIUB 2XVWA 3LU7A 2ROHA 2BXPA 2VDBA 3A73A 2EFCA 3WHSA 1HK2A 1BJ5A 2KWFA 2XSIA 3H37A 3ICXA 4Z69A 1E78A 2CKXA 3LU8A 4I9OA 4LB9A 4N3ZA 2DBXA 3JRYA 5IIUA 1AO6A 3ECPA 2BXKA 2DYOA 2QHBA 3NVKA 2XW0A 4ZCGA 2BXLA 4N0UD 1MIYA 4K71A 5IIHA 2DYMA 4DM0A 1J7EA 4MBEC 3MHHB 4F5SA 2AGHB 4WA6B 2QM6A 3NMUA 3GQXA 4F5VA 2DBUA 4L8UA 3GA9L 2XMOA 2JUHA 1MIVA 2E0XA 4HGMB 2Z8IA 4OR0A 3LU6A 5D7GA 1N5UA 4F5UA 2EFEA 4PO0A 3B9MA 2LXSA 3H3AA 2EFHA 2VUEA 4ZBKA 1HK5A 2LQHA 2YDFA 1E7BA 5GINA 4C31B 4J2VA 5HOZA 2I30A 1KDXA 3G9KD 1BM0A 3A75A 4ZBRA 2BXGA 3V08A 3VQIA 5B5TA 4TQ0A 4G03A 5IJFA 2BXIA 4FIPB 4BKEA 4G01A 4JK4A 4OTTA 4DHXB 4GDXA 2BXBA 2NQOA 4G04A 1TXUA 1J78A 2BXQA 5GHKA 3WHRA 2XW1A 1E7GA 4D7XA 1VZSA 4M70B 2GUTA 3B9LA 2BXEA 4L9KA 4W4UB 4HGKA 3SIVB 2I2ZA 5IIXA 2BXMA 4NAWB 4LUHA 1LNSA 3NVIA 3KIKA 1E7CA 3FWBC 2LXTA 1GNJA 1VFIA 2BXDA 2VUFA 3M99C 1MUSA 2OT3A 1HA2A 2QMCA 3BPJA 4TQ1A 4K2CA 1KW2A 2Z8JA 3UIVA 4E99A 5IFOA 2BXOA 2BXNA 5GIOA 1MM8A 2XVQA 1HK3A 5IJ5A 5BPKA 3CX9A 1HK1A 1LOTA 2DBWA 1TF0A 4IW2A 1IJGA 4GDLB 4F5TA 3FWCC 1MIWA 2BX8A 3GQUA 1MA9A 4FJCB 2XVVA 3KJLA 3WHQA 4IW1A 3NVMA 1H9ZA 4FK5B 4ZC6A 1O9XA 1E7AA 4ZUXV 1KXPD 2E0YA 5GIPA 2BXFA 2K0NA 2XVUA 1BKEA 5DBYA 3V03A 3PLAA 4N0FD 2BXHA 2AJEA 2LOQA 4L9QA 2DG5A 2KBZA 4LA0A 1E7EA 1SB0A 2EFDA 1NT2B 1GNIA 1E7FA 1E7IA 1UORA
chains in the Genus database with same CATH topology
5ID7A 1H5WA 2BXAA 3MHSB 4S1YA 1E7HA 2Z8KA 3V09A 4EMXA 4ZBQA 3TDLA 4Z9OA 2V36A 5IJEA 4LB2A 3JQZA 1JNBA 5FUOA 3FNMA 5ID9A 4OTUA 5DQFA 3W1SA 2BXCA 4OT2A 3SQJA 1FOUA 4GG2A 4BY9C 4GDKB 2OZBB 4LUFA 2NNWA 1HK4A 3SIUB 2XVWA 3LU7A 2ROHA 2BXPA 2VDBA 3A73A 2EFCA 3WHSA 1HK2A 1BJ5A 2XSIA 4Z69A 3H37A 3ICXA 1E78A 2CKXA 3LU8A 4LB9A 5IIUA 4N3ZA 2DBXA 3JRYA 1AO6A 2QHBA 2BXKA 2DYOA 3NVKA 2XW0A 4ZCGA 2BXLA 4N0UD 1MIYA 4K71A 5IIHA 2DYMA 1J7EA 4MBEC 3MHHB 4F5SA 4WA6B 2QM6A 3NMUA 3GQXA 4F5VA 2DBUA 4L8UA 3GA9L 2XMOA 2JUHA 1MIVA 2E0XA 4HGMB 2Z8IA 4OR0A 3LU6A 5D7GA 1N5UA 4F5UA 2EFEA 4PO0A 3B9MA 3H3AA 2EFHA 2VUEA 4ZBKA 1HK5A 2YDFA 1E7BA 5GINA 4C31B 4J2VA 5HOZA 2I30A 3G9KD 1BM0A 3A75A 4ZBRA 2BXGA 3V08A 3VQIA 5B5TA 4TQ0A 4G03A 5IJFA 2BXIA 4FIPB 4BKEA 4G01A 4JK4A 4OTTA 4DHXB 4GDXA 2BXBA 2NQOA 4G04A 1TXUA 1J78A 2BXQA 5GHKA 3WHRA 2XW1A 1E7GA 1VZSA 4M70B 3B9LA 2BXEA 4L9KA 4W4UB 4HGKA 3SIVB 2I2ZA 5IIXA 2BXMA 4NAWB 4LUHA 1LNSA 3NVIA 3KIKA 1E7CA 3FWBC 1GNJA 1VFIA 2BXDA 2VUFA 3M99C 2OT3A 1HA2A 2QMCA 4TQ1A 3UIVA 4K2CA 1KW2A 2Z8JA 4E99A 5IFOA 2BXOA 2BXNA 5GIOA 2XVQA 1HK3A 5IJ5A 5BPKA 3CX9A 1HK1A 1LOTA 2DBWA 1TF0A 4IW2A 1IJGA 4GDLB 4F5TA 3FWCC 1MIWA 2BX8A 3GQUA 1MA9A 4FJCB 2XVVA 3KJLA 3WHQA 4IW1A 3NVMA 1H9ZA 4FK5B 4ZC6A 1O9XA 1E7AA 4ZUXV 1KXPD 2E0YA 5GIPA 2BXFA 2XVUA 1BKEA 5DBYA 3V03A 3PLAA 4N0FD 2BXHA 2AJEA 2LOQA 4L9QA 2DG5A 2KBZA 4LA0A 1E7EA 2EFDA 1NT2B 1GNIA 1E7FA 1E7IA 1UORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHS B;  4FK5 B;  4MBE C;  3KIK A;  3MHH B;  4FIP B;  4C31 B;  3FWB C;  4WA6 B;  4ZUX V;  3FWC C;  4DHX B;  4FJC B;  4W4U B;  3M99 C;  3KJL A; 
#chains in the Genus database with same CATH topology
 5ID7 A;  1H5W A;  2BXA A;  3MHS B;  4S1Y A;  1E7H A;  2Z8K A;  3V09 A;  4EMX A;  4ZBQ A;  3TDL A;  4Z9O A;  2V36 A;  5IJE A;  4LB2 A;  2LQI A;  1MUH A;  3JQZ A;  1JNB A;  5FUO A;  3FNM A;  5ID9 A;  4OTU A;  5DQF A;  3W1S A;  2BXC A;  4OT2 A;  3SQJ A;  1FOU A;  4GG2 A;  4BY9 C;  4GDK B;  2OZB B;  4LUF A;  2NNW A;  1HK4 A;  3SIU B;  2XVW A;  3LU7 A;  2ROH A;  2BXP A;  2VDB A;  3A73 A;  2EFC A;  3WHS A;  1HK2 A;  1BJ5 A;  2KWF A;  2XSI A;  3H37 A;  3ICX A;  4Z69 A;  1E78 A;  2CKX A;  3LU8 A;  4I9O A;  4LB9 A;  4N3Z A;  2DBX A;  3JRY A;  5IIU A;  1AO6 A;  3ECP A;  2BXK A;  2DYO A;  2QHB A;  3NVK A;  2XW0 A;  4ZCG A;  2BXL A;  4N0U D;  1MIY A;  4K71 A;  5IIH A;  2DYM A;  4DM0 A;  1J7E A;  4MBE C;  3MHH B;  4F5S A;  2AGH B;  4WA6 B;  2QM6 A;  3NMU A;  3GQX A;  4F5V A;  2DBU A;  4L8U A;  3GA9 L;  2XMO A;  2JUH A;  1MIV A;  2E0X A;  4HGM B;  2Z8I A;  4OR0 A;  3LU6 A;  5D7G A;  1N5U A;  4F5U A;  2EFE A;  4PO0 A;  3B9M A;  2LXS A;  3H3A A;  2EFH A;  2VUE A;  4ZBK A;  1HK5 A;  2LQH A;  2YDF A;  1E7B A;  5GIN A;  4C31 B;  4J2V A;  5HOZ A;  2I30 A;  1KDX A;  3G9K D;  1BM0 A;  3A75 A;  4ZBR A;  2BXG A;  3V08 A;  3VQI A;  5B5T A;  4TQ0 A;  4G03 A;  5IJF A;  2BXI A;  4FIP B;  4BKE A;  4G01 A;  4JK4 A;  4OTT A;  4DHX B;  4GDX A;  2BXB A;  2NQO A;  4G04 A;  1TXU A;  1J78 A;  2BXQ A;  5GHK A;  3WHR A;  2XW1 A;  1E7G A;  4D7X A;  1VZS A;  4M70 B;  2GUT A;  3B9L A;  2BXE A;  4L9K A;  4W4U B;  4HGK A;  3SIV B;  2I2Z A;  5IIX A;  2BXM A;  4NAW B;  4LUH A;  1LNS A;  3NVI A;  3KIK A;  1E7C A;  3FWB C;  2LXT A;  1GNJ A;  1VFI A;  2BXD A;  2VUF A;  3M99 C;  1MUS A;  2OT3 A;  1HA2 A;  2QMC A;  3BPJ A;  4TQ1 A;  4K2C A;  1KW2 A;  2Z8J A;  3UIV A;  4E99 A;  5IFO A;  2BXO A;  2BXN A;  5GIO A;  1MM8 A;  2XVQ A;  1HK3 A;  5IJ5 A;  5BPK A;  3CX9 A;  1HK1 A;  1LOT A;  2DBW A;  1TF0 A;  4IW2 A;  1IJG A;  4GDL B;  4F5T A;  3FWC C;  1MIW A;  2BX8 A;  3GQU A;  1MA9 A;  4FJC B;  2XVV A;  3KJL A;  3WHQ A;  4IW1 A;  3NVM A;  1H9Z A;  4FK5 B;  4ZC6 A;  1O9X A;  1E7A A;  4ZUX V;  1KXP D;  2E0Y A;  5GIP A;  2BXF A;  2K0N A;  2XVU A;  1BKE A;  5DBY A;  3V03 A;  3PLA A;  4N0F D;  2BXH A;  2AJE A;  2LOQ A;  4L9Q A;  2DG5 A;  2KBZ A;  4LA0 A;  1E7E A;  1SB0 A;  2EFD A;  1NT2 B;  1GNI A;  1E7F A;  1E7I A;  1UOR A; 
#chains in the Genus database with same CATH homology
 5ID7 A;  1H5W A;  2BXA A;  3MHS B;  4S1Y A;  1E7H A;  2Z8K A;  3V09 A;  4EMX A;  4ZBQ A;  3TDL A;  4Z9O A;  2V36 A;  5IJE A;  4LB2 A;  3JQZ A;  1JNB A;  5FUO A;  3FNM A;  5ID9 A;  4OTU A;  5DQF A;  3W1S A;  2BXC A;  4OT2 A;  3SQJ A;  1FOU A;  4GG2 A;  4BY9 C;  4GDK B;  2OZB B;  4LUF A;  2NNW A;  1HK4 A;  3SIU B;  2XVW A;  3LU7 A;  2ROH A;  2BXP A;  2VDB A;  3A73 A;  2EFC A;  3WHS A;  1HK2 A;  1BJ5 A;  2XSI A;  4Z69 A;  3H37 A;  3ICX A;  1E78 A;  2CKX A;  3LU8 A;  4LB9 A;  5IIU A;  4N3Z A;  2DBX A;  3JRY A;  1AO6 A;  2QHB A;  2BXK A;  2DYO A;  3NVK A;  2XW0 A;  4ZCG A;  2BXL A;  4N0U D;  1MIY A;  4K71 A;  5IIH A;  2DYM A;  1J7E A;  4MBE C;  3MHH B;  4F5S A;  4WA6 B;  2QM6 A;  3NMU A;  3GQX A;  4F5V A;  2DBU A;  4L8U A;  3GA9 L;  2XMO A;  2JUH A;  1MIV A;  2E0X A;  4HGM B;  2Z8I A;  4OR0 A;  3LU6 A;  5D7G A;  1N5U A;  4F5U A;  2EFE A;  4PO0 A;  3B9M A;  3H3A A;  2EFH A;  2VUE A;  4ZBK A;  1HK5 A;  2YDF A;  1E7B A;  5GIN A;  4C31 B;  4J2V A;  5HOZ A;  2I30 A;  3G9K D;  1BM0 A;  3A75 A;  4ZBR A;  2BXG A;  3V08 A;  3VQI A;  5B5T A;  4TQ0 A;  4G03 A;  5IJF A;  2BXI A;  4FIP B;  4BKE A;  4G01 A;  4JK4 A;  4OTT A;  4DHX B;  4GDX A;  2BXB A;  2NQO A;  4G04 A;  1TXU A;  1J78 A;  2BXQ A;  5GHK A;  3WHR A;  2XW1 A;  1E7G A;  1VZS A;  4M70 B;  3B9L A;  2BXE A;  4L9K A;  4W4U B;  4HGK A;  3SIV B;  2I2Z A;  5IIX A;  2BXM A;  4NAW B;  4LUH A;  1LNS A;  3NVI A;  3KIK A;  1E7C A;  3FWB C;  1GNJ A;  1VFI A;  2BXD A;  2VUF A;  3M99 C;  2OT3 A;  1HA2 A;  2QMC A;  4TQ1 A;  3UIV A;  4K2C A;  1KW2 A;  2Z8J A;  4E99 A;  5IFO A;  2BXO A;  2BXN A;  5GIO A;  2XVQ A;  1HK3 A;  5IJ5 A;  5BPK A;  3CX9 A;  1HK1 A;  1LOT A;  2DBW A;  1TF0 A;  4IW2 A;  1IJG A;  4GDL B;  4F5T A;  3FWC C;  1MIW A;  2BX8 A;  3GQU A;  1MA9 A;  4FJC B;  2XVV A;  3KJL A;  3WHQ A;  4IW1 A;  3NVM A;  1H9Z A;  4FK5 B;  4ZC6 A;  1O9X A;  1E7A A;  4ZUX V;  1KXP D;  2E0Y A;  5GIP A;  2BXF A;  2XVU A;  1BKE A;  5DBY A;  3V03 A;  3PLA A;  4N0F D;  2BXH A;  2AJE A;  2LOQ A;  4L9Q A;  2DG5 A;  2KBZ A;  4LA0 A;  1E7E A;  2EFD A;  1NT2 B;  1GNI A;  1E7F A;  1E7I A;  1UOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...