3M9JA

Crystal structure of human thioredoxin c69/73s double mutant, reduced form
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human thioredoxin revealing an unraveled helix and exposed S-nitrosation site.
pubmed doi rcsb
molecule keywords Thioredoxin
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 38
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3m9jA00
3I69A 2YZHA 1EEJA 1W89A 3O3TA 2F51A 5E4WA 1ZYQB 3UOMA 2C8UA 2C0EA 1U87A 4ZL8A 2C3TA 4MCUA 3F4TA 1G7EA 1O73A 2G2QA 3UIWA 2H76A 1GSEA 3CMIA 2JZTA 1QGVA 4JR6A 2B5XA 2DJ3A 2CZ2A 3FEUA 3GTUB 3U5RE 3LQ7A 2O87A 3EC3A 5IMFA 3L9VA 3GYKA 4V2LA 4E8EA 2CZ3A 3L9SA 3H1NA 2KLXA 2AYTA 1NSWA 2DJKA 2O8VB 2GSSA 4GLTA 3IPZA 4XCSA 2PUKC 2FWFA 5D8IA 3ME7A 4TN8A 4OFMA 2MBTA 1PA3A 5DBQA 4TW5A 1O85A 4G19A 5AIXA 1PL2A 2ES7A 2LS5A 1A23A 5ECQB 3O6TA 4KNDA 4NAXA 5AGYA 3DKSA 1GTUA 2ZUPA 3IR4A 2H30A 2OE3A 5A4WA 5HQPA 2E7PA 3ZFBA 4XRDA 3BBYA 3ZFLA 4MMMA 13GSA 1IYIA 1N8JA 4V2MA 5AN1A 2I3YA 4ULXA 5DJMA 1SK0A 4LA1A 3HYPA 4WXTA 2LRTA 1MD3A 5EY6A 3TKSA 1FO5A 3NZNA 3HHVA 4KA0A 5ELAA 4Z7XA 2DSAA 3I9V2 3BD2A 3I6AA 4FYUA 1F3BA 2ZNMA 3ISOA 2VLUA 3IK7A 2PGTA 4NWYA 1W4VA 3MAKA 1ABAA 3G7IA 4MABA 2QKEA 3NOFA 1I9DA 4LLRA 3TRXA 2P0GA 2VIMA 5DDLA 11GSA 3FHKA 4K8MA 4GSTA 4MP4A 5H5RA 1AQVA 4I6XA 3ZIJA 4YH2A 1YEPA 3VI7A 4JR4A 1M7TA 1G6WA 2GLRA 2JSZA 3D0ZA 2XBQA 1M0UA 5E59A 3E0UA 4WF5A 5HR3A 4G9HA 2H6XA 4ZILA 2C3NA 4XS4B 1EOHA 2V2GA 2DJJA 3EE2A 5G30A 1HYUA 2VCWA 2Z9SA 2A4VA 3N9JA 4NPBA 1TW9A 2YN1A 3UJ1A 4LMWA 1CQGA 4TR1B 1THXA 3QAVA 2HRNA 3CRUA 2C0GA 5F05A 5DALA 1X5EA 2O7KA 16GSA 1GSUA 1BG5A 1V40A 4LL4B 5F06A 1AAZA 3TDGA 1WWJA 4HI7A 3GA4A 1O7UA 1TXXA 2R2JA 3QAWA 3FK8A 5DQSA 2GQMA 6GSWA 5J5NA 5G5EA 3KP9A 1HNBA 4F0CA 3S9FA 4PGTA 3ERFA 4K7NA 1BJXA 4CHSA 1B8XA 3D4TA 3TKSC 2B3SA 3MWHA 1TU7A 4KE3A 4J56E 3L4NA 1AIUA 4POLA 1I5GA 2CVBA 1X9SB 2YCDA 3TCOA 3R2QA 4HZ2A 2LJKA 2K9FA 2OBKA 3HD5A 4ML1A 3FZ4A 4PQIA 9GSSA 5A5KA 5D96A 3IBHA 1CQHA 4ZB8A 3QDNA 1G0TA 3M1GA 4HOJA 1NHOA 2IL3A 3PR8A 1SL0B 3E3EA 4RI7A 3G7JA 2H74A 3DD3A 4ECBA 2AJQB 1XXUA 1SJ6A 1HD2A 2HXKA 3ERGA 4EO3A 4N30A 2CAIA 1Z6NA 4K7OA 1GUKA 1GLPA 2DLXA 2OA7A 1XOAA 2VO4A 1RW1A 4KSMA 1M2DA 2DIYA 5A4VA 2B5EA 2G0FA 2IMIA 3UBKA 5LCZA 5ECRB 2LNTA 2IFQB 2A2SA 5DAKB 1GLQA 1OC9B 3VI5A 3Q74A 1EEMA 2NVLA 2WZ9A 3IE3A 2JSYA 5G31A 5AISA 5ID2B 1YY7A 1FAAA 4OFTA 1EGOA 2KOKA 1O81A 1NW2A 4NXIA 2TRXA 3KIJA 3M8NA 4PNFA 2R3XA 3ME8A 4MF6A 2CVDA 4GRFA 3LGCA 5J9CA 2K18A 2YWMA 2FGXA 5J3RA 1A0FA 1A0RP 3W6GA 2GZPA 4GQFA 1WPIA 1ZOFA 2CAQA 2E0QA 2VL2A 1YDKA 1NM3A 4KDUA 4KCEA 4KDYA 3TOTA 1T4YA 4KDXA 1V9WA 5HR2A 4ILFA 3IK9A 1PKWA 3ZIVA 4XS6A 2I4AA 2DIZA 2IFQA 2NDOA 3LYPA 4FO5A 1AUCA 2YOIA 4CW9A 4GCIA 5DCHA 2JZRA 3APOA 2JU5A 3Q18A 3J7Yk 1SKRB 1XWCA 5G5FA 1K0MA 5ECIB 1ZYEA 1SKWB 1G7OA 2H0GA 1OC8A 1A2JA 3M9KA 1F6MC 4K0GA 3UMAA 3VPQA 1JLWA 4HQSA 5AIVA 3DRNA 1GULA 4GQCA 1PX7A 2VCQA 1ML6A 5CO3A 1MEKA 2LQQA 2IWTA 4ID0A 4MJBA 4IN0A 1JLVA 2H1BA 1Z7PA 3GMFA 5GSSA 1OVNA 4I5QA 2C3QA 3Q6OA 5IPGA 1B9YC 4MLYA 2XPDA 3KZQA 1RQMA 2OJLA 1RK4A 2WB9A 4K2DA 2IMFA 3QAGA 3C8EA 5G1KA 1TOFA 4ZL7A 3EU3A 3VWXA 4DSSA 3VLNA 4WEYA 4I8BA 4OMVA 1Y25A 2CX3A 1EP8A 3KM6A 3F6FA 3HCZA 5CNWA 1Z3EA 1UN2A 1TRUA 2LKUA 2XBIA 4EKZA 4ECIA 4AJ6A 1XOBA 3VWUA 4EF0A 1FOVA 2OBIA 2FHEA 4XRAA 4PQ1A 2VL2C 2BJXA 4QL7A 2YANA 1FVKA 1JHBA 1O6JA 3WD6A 4O92A 3ZL5A 5HFKA 4N11A 5KN2A 1HQOA 3F8UA 4MPGA 3GN3A 1WE0A 4IP6A 4J57E 2WFCA 3ZLPA 1GH2A 2OADA 1ZMAA 2X99A 2MMZA 4QQ7A 3ZREA 1J9BA 1MDJA 1VRSD 1KBNA 4TRXA 1GSQA 3TJKA 2HSHA 1QFNA 4KAEA 4PQHA 3FZ9A 4TVEA 5CRHA 2QSIA 3DXBA 4GSNA 4BPYA 1ON4A 2YP6A 1DBYA 5IO2A 3GUSA 4FYBA 3ERWA 5IIZA 3TJJA 1R7HA 1WRYA 1GUMA 3ZMLA 2GVPA 3IRAA 2NBSA 4I2UA 2YZUA 2R4VA 5JCWA 3IXRA 4WR5A 3LWAA 3TJFA 2B1LA 5F8BA 3GKKA 3U6VA 4F82A 3KTLA 3DEXA 4RQRA 2H75A 3HDCA 3CXGA 4EE0A 4GSSA 3SWLA 2VAFA 2M46A 1GSSA 2PWJA 1SK2A 1AC1A 6GSSA 1K0BA 1AW9A 3TRPA 1QMVA 3LEFA 4HUAA 2H1GA 1XPVA 1M2AA 3ZTLA 2PERA 4X43A 3H8QA 2WGRA 2H66A 3TUEA 2HZEB 4F03A 2JADA 5B7CA 5D9XA 1N2AA 4BA7A 3HA9A 4HU7A 5J4UA 4F0BA 1H4OA 2YPMA 3V1WA 3TKQA 2VL3A 1PKZA 1SJIA 1ZGNA 4OCEA 1XWKA 4QL9A 4RUVA 2H71A 3BCKA 6GSTA 3CYNA 3F3RA 1EZKA 1ST9A 2RUEA 1OC3A 5JWQB 3LXZA 2GQKA 1YF0A 1GTIA 2JL4A 1PX6A 1B4PA 3KTBA 20GSA 5IMZA 4WBJA 5ECNB 3VWWA 1EV4A 2OE1A 4DSQA 5HR1A 2V6KA 1FB0A 4D73A 3WGXA 5IMVA 3IV4A 5EVOA 1C72A 3F4RA 2KP2A 2EIRA 2H0HA 1A8YA 3ZVJD 2HZEA 2AUVA 3PGTA 2L5LA 2A2RA 5DALB 1X5CA 1SD8A 2FA4A 2R5GA 5CYYA 1U88A 3M3MA 3W8SA 3RDWA 4AJ8A 4IJ3A 4MJCA 3DIEA 2V6OA 2PMTA 3GURA 4TKYA 2B7KA 2IN3A 5IMCA 2L4QA 5D73A 2WJUA 3D4MA 2WS2A 2GSRA 1E2YA 1E6BA 4ZBBA 1LJRA 1JZDA 2WULA 2X64A 5D9VA 3HJOA 2IJYA 5HFGA 3A2VA 2CV4A 5F07A 3AY8A 3GFKA 3FW2A 5ECHB 4OFNA 1PQNA 2IIYA 2J9HA 1JFUA 2P5RA 5GAND 5DQYA 3HZ8A 1Z6MA 1BQ7A 3CTFA 5D9WA 4IP1A 2LUSA 1FHEA 4ECJA 1EP7A 2FUG2 3G9BA 1AXDA 2HFDA 3QPMA 1Z7RA 1GSYA 4IELA 1FB6A 3KD0A 5GAPD 10GSA 5FWGA 4TR4A 5KN1A 2LSTA 1XFLA 3IAM2 3N5OA 4G2EA 2F9SA 4TR0A 4AF2A 1YQ1A 3QOUA 4K0NA 2VCZA 2AB6A 4PXOA 5G1LA 3C73A 4PUFC 5B8AA 4TR3A 1BAYA 4J2FA 2PBJA 5LD0A 4BWQA 3FR6A 1GTBA 5B6MA 3GSTA 3GX8A 5JWOB 4MK3A 1PMTA 1S3CA 3KH7A 3NIVA 2P5QA 3GL3A 5DJLA 1Z5YE 3KP8A 3I43A 2WCIA 5FHIA 2H19A 3W8JA 2YV9A 2IPAA 2C4JA 2O85A 5IMDA 1SL1B 4EC0A 4XTSA 3QR6A 4L8EA 3FKFA 5HFIA 4KGIA 2K6VA 5JWRB 2GS3A 4MF7A 4E8HA 5HR0A 1PD21 4BVYA 1DSBA 1GNWA 5COHA 4EVMA 4ZBDA 3BOAA 1TU8A 4EDZA 4ZBAA 1EV9A 4MDCA 2PN8A 1MD4A 1OYJA 3IAS2 1T3BA 2RUFA 1YF1A 5D93A 3ZZXA 3VPTA 3CSJA 2N5BA 4PUAA 2VCTA 4OCFA 3UVTA 1B4QA 2ALBA 4FIWA 4KX4A 3PH9A 1UVZA 4K7IA 3RAZA 3TB2A 1VF3A 2DMMA 4MZCA 4GWRA 5CREA 1ZL9A 5INYA 4WF4A 3P2AA 3HVSA 5CRDA 3A3TA 3OR5A 2B1KA 2QGVA 3QFAC 4GTUA 3P7XA 2PVOC 1UC7A 2GGTA 3F4SA 2C0DA 4POKA 2L6DA 2V41A 2CT6A 4G10A 3VFIA 4ML6A 4YQVA 1F9MA 1B9XC 2GQLA 7GSSA 2EIQA 3GL5A 3L9UA 4IQ1A 4JBBA 3CSHA 1F37A 2CA8A 1Q98A 3RBTA 1GUHA 3UAPA 2HLSA 1K0DA 4MPFA 3EWLA 1PL1A 1K3OA 2VD0A 4MA9A 3F3QA 2H6ZA 2C1YA 4HZ4A 5KN3A 1SJZA 1TJDA 4DSSB 2FWHA 2GZZA 2B6MA 3EU4A 4BL7A 3BCIA 3LORA 3TJGA 2E2MA 5L71A 3EMXA 4N10A 3WT2A 5ELGA 4OD7A 4L5OA 2XC2A 2J23A 1EOGA 1K3LA 3KMOA 3CTGA 2K8VA 1KTEA 2FY6A 1THOA 17GSA 5A4UA 3EVIA 5FT3A 3UVHA 2L6CA 1T7PB 1GL8A 3A5WA 4WBRD 2H1DA 4ZXGA 2VM2A 1WMJA 1XWAA 4NV5A 2VLTA 3EINA 1T4ZA 1XVQA 1QUWA 1OKTA 1TDIA 2F8FA 1FW1A 3DYRA 4MZBA 1PRXA 2RIIA 1F2EA 3HJPA 3GRXA 5H5SA 3GX0A 1ERVA 3F0IA 4XIHA 2I1UA 4LL1B 1XVWA 1M9AA 2FA8A 3ZMKA 1JZOA 3UARA 1SU9A 4N0VA 4HEA2 1LU4A 4KSOA 1DE1A 2KUCA 1USBA 3O76A 3QD9A 3A2XA 18GSA 5ABRA 3GV1A 1V2AA 4WETA 1V58A 3EURA 2DJ1A 2LJRA 2B5YA 3RPPA 3JCML 2GT5A 2HZFA 3GSSA 1TP9A 4EL1A 1G6YA 1T1VA 2VM1A 2LV3A 3BJ5A 1R4WA 2AV4A 4KW6A 3IDVA 1HNCA 4V1Ag 2MMOA 5C00A 1K0OA 1XW5A 4BVXA 2TRCP 3FY7A 1XW9A 2ON5A 1GWCA 2TIRA 4YQMA 3WGEA 1F3AA 4X1UA 1GSFA 3IHQA 1B48A 4IW9A 3MSZA 2H72A 4OO5A 4XHMA 3J7Yb 2M72A 5ECLB 2IMDA 3IC4A 2HSYA 1A2LA 1OKDA 4PURA 1AQXA 1ERWA 4JRRA 4DSRA 5KEJA 1O8WA 3C1RA 3GNJA 3H4KA 5DCGA 4YQUA 3M0FA 1X9MB 4WR4A 1A8LA 1ACVA 1IYHA 4HQZA 4D73B 5CRWA 2M80A 4ECCA 1TI1A 2K8SA 5IO0A 4EDYA 4NV2A 1M2BA 2OKAA 3RPNA 8GSSA 4ISDA 4F2IA 3WGDA 3HVVA 1TI3A 2HYXA 4YAPA 1PGTA 2X8GA 4AJ7A 3HKRA 1R5PA 1S3DA 1YZXA 2H01A 3LYKA 2ON7A 3D5JA 1O8XA 3FR9A 1TK5B 3FYGA 3HY2A 1R5AA 1ZCPA 5ENUA 2MMAA 3LJRA 2FD3A 4P3YB 4IVFA 3F63A 4POBA 3C7MA 2LRNA 3KMNA 2YNXA 1Y6EA 5B6NA 4MJAA 1TK8B 3A2WA 5GZZB 3D21A 1FVJA 3KEBA 2GSQA 3H93A 3D6IA 3GTUA 1T00A 3G7YA 1U6TA 4Q5RA 4L5LA 3TKPA 5JCUA 4YAVA 1TK0B 1XW6A 2VD1A 3GKMA 2BTOT 4MH3A 4KB3A 4NMUA 5IQYA 3TRQA 3UBLA 1XWBA 1YEXA 3GH9A 4AGSA 1XZOA 2JZSA 4ZL9A 3CBUA 2GZYA 1U3IA 4RQXA 4JE1A 3IA1A 22GSA 1MDKA 1XWGA 1BEDA 3QFBC 4DVCA 2YJHA 1PSQA 4IQAA 2XPEA 3UL3A 2HT9A 2R6KA 3EMPA 1SYRA 1MDIA 3TJBA 3ED3A 1ILOA 2N5AA 3LG6A 2XHFA 1WOUA 2FWEA 2YJ7A 2L57A 1A24A 2IMKA 2FNOA 1ZZYA 4DEJA 3APSA 3Q19A 1XCCA 1S3AA 3VK9A 19GSA 1KEBA 2VUPA 4MZWA 1TRSA 1EGRA 4ACSA 4Q5QA 3P8WA 5ECMB 1JZWA 2X8HA 4HDEA 4HS1A 3IOSA 3GIXA 2LQOA 1YJ6A 5KN0A 3KGKA 4N0ZA 2OE0A 4H86A 4O7HA 1J0FA 1XBSA 3F6DA 2EIOA 2LTKA 3MNGA 2HE3A 3DGQA 2MMNA 1WIKA 2KHPA 1ERTA 1URMA 2ZCTA 4KCAA 3FZ5A 4HJ2A 2WRTA 5D9TA 3TKRA 1J08A 3RHBA 4HU9A 4HJMA 3M9JA 2HNLA 2C80A 2PU9C 2DMLA 4TXOB 2RLIA 4XS4A 1BYEA 2HRFA 6GSXA 1R26A 2KP1A 1VF2A 3VWVA 3RHCA 1TRWA 4L0UA 5EPFA 3C71A 1FG4A 5C04A 3KCMA 2QC7A 2L59A 1V98A 2L4CA 1DE2A 4TR1A 1WP0A 6GSYA 2CX4A 2YWNA 5CP1A 4V2NA 1TTZA 5H5QA 12GSA 2JACA 4K9ZA 2DC5A 1SK1A 2GDRA 2OACA 2LRCA 2BMXA 4JEDA 3WYWA 1A2MA 2YV7A 3ZRDA 3C1SA 4LMVA 3WT1A 5GSTA 4O32A 5B8BA 2IMEA 1KNGA 1OE7A 3FRCA 2LJAA 2F3MA 4F9ZA 4GXZA 2C0FA 4TXOA 1TRVA 4JU5A 3TGZA 3HJMA 2REMA 2I9HA 2PPTA 1SENA 1Z9HA 4IBPA 1YKCA 2MBSA 3TOUA 2DBCA 2NPBA 5J9BA 5IM9A 2AAWA 3KXOA 2YWOA 1OE8A 1GTAA 4FYCA 3HZ4A 3FZAA 3QCPA 1ERUA 3VURA 4O5RA 2CVKA 3KJYA 2DJ0A 1VF4A 3KH9A 3GHAA 3UEMA 2X8CA 2NTOA 1HNAA 1X0RA 2MYGA 3P90A 1QK8A 1LBKA 5IMAA 3TKSE 1WJKA 1GRXA 2E2GA 3DMLA 4JZQA 5IOWA 2WDUA 2CQ9A 2VOCA 3L78A 1QQ2A 1U3AA 4MJEA 2HI7A 4IHUA 5CRGA 2LEGA 2RM6A 4X0XA 1EWXA 4ZB9A 1V57A 1NHYA 1QXHA 2GTUA 1X9WB 2F8AA 2H70A 3ZVJA 1AQWA 4K6XA 5G2ZA 2I81A 2FWGA 3LXTA 3D22A 2V1MA 2VLVA 3FR3A 3MDKA 3ZITA 4NHWA 1MTCA 5EL8A 4WKWA 2LNSA 2P31A 2RM5A 4IKHA 4TXVA 1K0CA 5DAKA 2O89A 5J41A 3PINA 1OC9A 4NHZA 2MZCA 2H73A 1M9BA 1GSDA 4OWYA 4POMA 2DJ2A 5CAXA 3HXSA 5ECPB 1SD9A 4KUNA 4IS0A 2GSTA 1BX9A 4MF5A 5ID2A 4CDOA 4Q5FA 1K0NA 2EC4A 2YWIA 1SYXA 4EUYA 4EXJA 3HVXA 3L0HA 1SKSB 3GKNA 1K0AA 1GNEA 1UA5A 5JCGA 1JZRA 4ZB6A 2R37A 2AHEA 2L5OA 4ZIJA 4I2TA 4IJIA 3DWVA 3APQA 1Q4JA 2B7JA 4XS1A 2FCHA 3US3A 1VF1A 2VCXA 1GP1A 3CSIA 1K3YA 2GT6A 4FH8A 4TOPA 4KH7A 2N5FA 2H1AA 4V1Ap 1TKDB 2H8LA 1SL2B 1YKAA 4I97A 3DVWA 5IPHA 2D2ZA 4IGJA 5F0GA 2V32A 3F9UA 1T8EB 4PX1A 2VCVA 5ECSA 3LSZA 5IOXA 14GSA 5DVBA 3GKXA 5ECKB 4GF0A 3EYTA 3E9JB 4Q5NA 1H75A 1DUGA 3LFLA 4L0WA 2H6YA 3ZYWA 6GSVA 4OO4A 3DVXA 3QMXA 3GH6A 5ECOB 1PN9A 4MH2A 5LNKe 3H79A 1OAZA 2FLSA 2PVQA 2VL9A 4K1FA 2H0IA 1M99A 1XIYA 4BWSA 4RI6A 4PNGA 3K8NA 3SBCA 1VGLA 6GSUA 1X5DA 3CRTA
chains in the Genus database with same CATH superfamily
2DKHA 3I69A 2YZHA 1EEJA 1W89A 3O3TA 4MNNA 2F51A 5E4WA 1ZYQB 3UOMA 2C8UA 2C0EA 1U87A 4ZL8A 2C3TA 4MCUA 3F4TA 2HSMA 1G7EA 1O73A 2G2QA 3UIWA 2H76A 1GSEA 4K5RA 3CMIA 2JZTA 1QGVA 4JR6A 2B5XA 2DJ3A 2CZ2A 3FEUA 3GTUB 3U5RE 3LQ7A 2O87A 3EC3A 5IMFA 3L9VA 3GYKA 4V2LA 4E8EA 2CZ3A 3L9SA 3H1NA 2KLXA 2AYTA 1NSWA 2DJKA 2O8VB 2GSSA 4GLTA 3IPZA 4XCSA 2PUKC 2FWFA 5D8IA 3ME7A 4K2XA 4TN8A 4OFMA 2MBTA 1PA3A 5DBQA 4TW5A 1O85A 4G19A 5AIXA 1PL2A 2ES7A 2LS5A 3HVNA 1A23A 5ECQB 3O6TA 4KNDA 4NAXA 5AGYA 3DKSA 1GTUA 2ZUPA 3IR4A 2H30A 2OE3A 5A4WA 5HQPA 2E7PA 3ZFBA 4XRDA 3BBYA 3ZFLA 4MMMA 13GSA 1IYIA 1N8JA 4V2MA 5AN1A 2I3YA 4ULXA 5DJMA 1SK0A 4LA1A 3HYPA 4PTSA 5BMUA 4WXTA 2LRTA 1MD3A 5EY6A 3TKSA 1FO5A 3NZNA 3HHVA 4KA0A 5ELAA 4Z7XA 2DSAA 3I9V2 3BD2A 3I6AA 4FYUA 1F3BA 2ZNMA 3ISOA 2VLUA 3IK7A 2PGTA 4NWYA 1W4VA 3MAKA 1ABAA 3G7IA 4MABA 2QKEA 3NOFA 1I9DA 4LLRA 3TRXA 2P0GA 2VIMA 5DDLA 11GSA 3FHKA 4K8MA 4GSTA 4MP4A 5H5RA 1AQVA 4I6XA 3ZIJA 4YH2A 1YEPA 3VI7A 4JR4A 1M7TA 1G6WA 2GLRA 2JSZA 3D0ZA 2XBQA 1M0UA 5E59A 3E0UA 4WF5A 5HR3A 4G9HA 2H6XA 4ZILA 2C3NA 4XS4B 1EOHA 2V2GA 2DJJA 3EE2A 5G30A 1HYUA 2VCWA 2Z9SA 2A4VA 3N9JA 4NPBA 1TW9A 2YN1A 3UJ1A 4LMWA 1CQGA 4TR1B 1THXA 3QAVA 2HRNA 3CRUA 2C0GA 5F05A 5DALA 1X5EA 2O7KA 16GSA 1GSUA 1BG5A 1V40A 4LL4B 5F06A 1AAZA 3TDGA 1WWJA 4HI7A 3GA4A 1O7UA 1TXXA 2R2JA 3QAWA 3FK8A 5DQSA 2GQMA 6GSWA 5J5NA 5G5EA 3KP9A 1HNBA 4F0CA 3S9FA 4PGTA 3ERFA 4K7NA 1BJXA 4CHSA 1B8XA 3D4TA 3TKSC 1M3JA 2B3SA 3MWHA 1TU7A 4KE3A 4J56E 3L4NA 1AIUA 4POLA 1I5GA 2CVBA 1X9SB 2YCDA 3TCOA 3R2QA 4HZ2A 2LJKA 2K9FA 2OBKA 3HD5A 4EIQA 4ML1A 3FZ4A 4PQIA 9GSSA 5A5KA 5D96A 3IBHA 1CQHA 4ZB8A 3QDNA 1G0TA 3M1GA 4HOJA 1NHOA 2IL3A 3PR8A 1SL0B 3E3EA 4RI7A 3G7JA 2H74A 3DD3A 4ECBA 2AJQB 1XXUA 1SJ6A 1HD2A 2HXKA 3ERGA 4EO3A 4N30A 2CAIA 1Z6NA 4K7OA 1GUKA 1GLPA 2DLXA 2OA7A 1XOAA 2VO4A 1RW1A 4KSMA 1M2DA 2DIYA 5A4VA 3MIXA 2B5EA 2G0FA 4K5SA 2IMIA 3UBKA 5LCZA 5ECRB 2LNTA 2IFQB 2A2SA 5DAKB 1GLQA 1OC9B 3VI5A 3Q74A 1EEMA 2NVLA 2WZ9A 3IE3A 2JSYA 5G31A 5AISA 4Z2TA 5ID2B 1YY7A 1FAAA 4OFTA 1EGOA 2KOKA 1O81A 1NW2A 4NXIA 2TRXA 3KIJA 3M8NA 4PNFA 2R3XA 3ME8A 4MF6A 2CVDA 4GRFA 3LGCA 5J9CA 2K18A 2YWMA 2FGXA 2HRKA 5J3RA 1A0FA 1A0RP 3W6GA 2GZPA 4GQFA 1WPIA 1ZOFA 2CAQA 2E0QA 2VL2A 1YDKA 1NM3A 4KDUA 4KCEA 4KDYA 3TOTA 2HRAA 1T4YA 4KDXA 1V9WA 5HR2A 4ILFA 3IK9A 1PKWA 3ZIVA 4XS6A 2I4AA 2DIZA 2IFQA 2NDOA 4YKGA 3LYPA 4FO5A 1AUCA 2YOIA 3CQFA 4CW9A 5KOWA 4GCIA 5DCHA 2JZRA 3APOA 2JU5A 3Q18A 3J7Yk 1SKRB 1XWCA 5G5FA 1K0MA 5ECIB 1ZYEA 1SKWB 1G7OA 2H0GA 1OC8A 1A2JA 3M9KA 1F6MC 4K0GA 3UMAA 3VPQA 1JLWA 4HQSA 5AIVA 3DRNA 1GULA 4GQCA 1PX7A 2VCQA 1ML6A 5CO3A 1MEKA 1FOHA 2LQQA 2IWTA 4ID0A 4MJBA 4G0KA 4IN0A 1JLVA 2H1BA 1Z7PA 3GMFA 5KOXA 5GSSA 1OVNA 4I5QA 2C3QA 3Q6OA 5IPGA 1B9YC 3FMWA 4MLYA 1PN0A 2XPDA 3KZQA 1RQMA 3MYDA 2OJLA 1RK4A 2WB9A 4K2DA 2IMFA 3QAGA 3C8EA 5G1KA 1TOFA 4ZL7A 3EU3A 3VWXA 4DSSA 3VLNA 4WEYA 4I8BA 4OMVA 1Y25A 2CX3A 1EP8A 3KM6A 3F6FA 3HCZA 5CNWA 1Z3EA 1UN2A 1TRUA 2LKUA 2XBIA 4EKZA 4ECIA 4AJ6A 1XOBA 3VWUA 4EF0A 1FOVA 2OBIA 2FHEA 4XRAA 4PQ1A 2VL2C 2BJXA 4QL7A 2YANA 1FVKA 1JHBA 1O6JA 3WD6A 4O92A 3ZL5A 5HFKA 4N11A 5KN2A 1HQOA 3F8UA 4MPGA 3GN3A 1WE0A 4IP6A 4J57E 2WFCA 3ZLPA 1GH2A 2OADA 4Z2UA 1ZMAA 2X99A 2MMZA 4QQ7A 3ZREA 1J9BA 1MDJA 1VRSD 1KBNA 4TRXA 1GSQA 3TJKA 2HSHA 1QFNA 4KAEA 4PQHA 3FZ9A 4TVEA 5CRHA 3A5IA 4USSA 2QSIA 3DXBA 4GSNA 4BPYA 1ON4A 2YP6A 1DBYA 5IO2A 3GUSA 4FYBA 3ERWA 5IIZA 3TJJA 1R7HA 1WRYA 1GUMA 3ZMLA 2GVPA 3IRAA 2NBSA 4I2UA 2YZUA 2R4VA 5JCWA 3IXRA 4WR5A 3LWAA 3TJFA 2B1LA 5F8BA 3GKKA 3U6VA 4F82A 3KTLA 3DEXA 4RQRA 2H75A 3HDCA 3CXGA 4EE0A 1ZYPA 4GSSA 3SWLA 2VAFA 2M46A 1GSSA 2PWJA 1SK2A 1AC1A 1XG8A 4CY6A 6GSSA 1K0BA 1AW9A 3TRPA 1QMVA 3LEFA 4HUAA 2H1GA 1XPVA 1M2AA 3ZTLA 2PERA 4X43A 3H8QA 2WGRA 2H66A 5BRTA 3TUEA 2HZEB 4F03A 2JADA 5B7CA 5D9XA 1N2AA 4BA7A 3HA9A 4HU7A 5J4UA 4F0BA 3EPTA 1H4OA 2YPMA 3V1WA 3TKQA 2VL3A 1PKZA 1SJIA 1ZGNA 4OCEA 1XWKA 4QL9A 4RUVA 2H71A 3BCKA 6GSTA 3CYNA 3IHGA 3F3RA 1EZKA 1ST9A 2RUEA 3LW9A 1OC3A 5JWQB 3LXZA 2GQKA 1YF0A 1GTIA 2JL4A 1PX6A 1B4PA 3KTBA 20GSA 5IMZA 4WBJA 5ECNB 3VWWA 1EV4A 2OE1A 4DSQA 5HR1A 2V6KA 1FB0A 4D73A 3WGXA 5IMVA 3IV4A 5EVOA 1C72A 3F4RA 2KP2A 2EIRA 2H0HA 1A8YA 3ZVJD 2HZEA 2AUVA 3PGTA 2L5LA 2A2RA 5DALB 1X5CA 1SD8A 2FA4A 2R5GA 5CYYA 4Z2RA 1U88A 3M3MA 3W8SA 4A5PA 3RDWA 4AJ8A 4IJ3A 4MJCA 3DIEA 2V6OA 2PMTA 3GURA 4TKYA 2B7KA 2IN3A 5IMCA 2L4QA 1ZYNA 5D73A 2WJUA 3D4MA 2WS2A 2GSRA 1E2YA 1E6BA 4ZBBA 1LJRA 1JZDA 2WULA 2A4HA 2X64A 5D9VA 3HJOA 2IJYA 5HFGA 3A2VA 3R3EA 2CV4A 5F07A 3AY8A 3GFKA 3FW2A 5ECHB 4OFNA 1PQNA 2IIYA 2J9HA 1JFUA 2P5RA 3PPUA 5GAND 5DQYA 3HZ8A 1Z6MA 1BQ7A 3CTFA 5D9WA 4IP1A 2LUSA 1FHEA 4ECJA 3IC8A 1EP7A 2FUG2 3G9BA 1AXDA 2HFDA 3QPMA 1Z7RA 1GSYA 4IELA 1FB6A 3KD0A 5GAPD 10GSA 5FWGA 4TR4A 5KN1A 2LSTA 1XFLA 3IAM2 3N5OA 4G2EA 2F9SA 4TR0A 4AF2A 1YQ1A 3QOUA 4K0NA 2VCZA 4BVYB 2AB6A 4PXOA 5G1LA 3C73A 4PUFC 5B8AA 4TR3A 4KF9A 1BAYA 4J2FA 2PBJA 5LD0A 4BWQA 3FR6A 4HSCX 1GTBA 5B6MA 3GSTA 2R0CA 3GX8A 5JWOB 4MK3A 1PMTA 1S3CA 3KH7A 3NIVA 2P5QA 3GL3A 5DJLA 1Z5YE 3KP8A 3I43A 2WCIA 5FHIA 2H19A 3W8JA 2YV9A 2IPAA 2C4JA 2O85A 5IMDA 1SL1B 4EC0A 4XTSA 3QR6A 4L8EA 3FKFA 5HFIA 4KGIA 2K6VA 5JWRB 2GS3A 4MF7A 4E8HA 5HR0A 1PD21 4BVYA 1DSBA 1GNWA 5COHA 4EVMA 4ZBDA 3BOAA 1TU8A 4EDZA 4ZBAA 1EV9A 2A2PA 4MDCA 2PN8A 1MD4A 1OYJA 3IAS2 1T3BA 2RUFA 1YF1A 5D93A 3ZZXA 3VPTA 3CSJA 2N5BA 4PUAA 2VCTA 4OCFA 3UVTA 1B4QA 2ALBA 4FIWA 4KX4A 3PH9A 1UVZA 4K7IA 3RAZA 3TB2A 1VF3A 2DMMA 4MZCA 4GWRA 5CREA 1ZL9A 5INYA 4WF4A 3P2AA 3HVSA 5CRDA 3A3TA 4CY8A 3OR5A 2B1KA 2X49A 2QGVA 3QFAC 4GTUA 3P7XA 2PVOC 1UC7A 2GGTA 3F4SA 2C0DA 4POKA 2L6DA 2V41A 2CT6A 4G10A 3VFIA 4ML6A 4YQVA 1F9MA 1B9XC 2GQLA 7GSSA 2EIQA 3GL5A 3L9UA 4IQ1A 4JBBA 2DKIA 3CSHA 1F37A 2CA8A 1Q98A 3RBTA 1GUHA 3UAPA 2HLSA 1K0DA 4MPFA 3EWLA 1PL1A 1K3OA 2VD0A 4MA9A 3F3QA 2H6ZA 2C1YA 4HZ4A 5KN3A 1SJZA 1TJDA 4DSSB 2FWHA 2GZZA 2B6MA 3EU4A 4BL7A 3BCIA 3LORA 3TJGA 2E2MA 5L71A 3EMXA 4N10A 3WT2A 5ELGA 4OD7A 4L5OA 2XC2A 2J23A 1EOGA 1K3LA 3KMOA 3CTGA 2K8VA 1KTEA 2FY6A 1THOA 17GSA 4EIPA 5A4UA 3EVIA 5FT3A 3UVHA 2L6CA 1T7PB 1GL8A 3A5WA 4WBRD 2H1DA 4ZXGA 2VM2A 1WMJA 1XWAA 4NV5A 2VLTA 3EINA 1T4ZA 1XVQA 1QUWA 1OKTA 1TDIA 2F8FA 1FW1A 3DYRA 4MZBA 1PRXA 2RIIA 1F2EA 3HJPA 3GRXA 5H5SA 3GX0A 1ERVA 3F0IA 4XIHA 2I1UA 4LL1B 1XVWA 1M9AA 2FA8A 4G0LA 3ZMKA 1JZOA 3UARA 1SU9A 4N0VA 4HEA2 1LU4A 4KSOA 1DE1A 2KUCA 1USBA 3O76A 3QD9A 3A2XA 18GSA 5ABRA 3GV1A 1V2AA 4WETA 1V58A 3EURA 2DJ1A 2LJRA 2B5YA 3RPPA 3JCML 2GT5A 4YKFA 2HZFA 3GSSA 1TP9A 4EL1A 1G6YA 1T1VA 1S3RA 2VM1A 2LV3A 3BJ5A 1R4WA 2AV4A 4KW6A 2R0PA 1HNCA 3IDVA 2MMOA 4V1Ag 5C00A 1K0OA 1XW5A 4BVXA 2TRCP 3FY7A 1XW9A 2ON5A 1GWCA 2TIRA 4YQMA 3WGEA 1F3AA 4X1UA 1GSFA 3IHQA 1B48A 4IW9A 3MSZA 2H72A 4OO5A 4XHMA 3J7Yb 2M72A 5ECLB 2IMDA 3IC4A 2HSYA 1A2LA 1OKDA 4PURA 1AQXA 1ERWA 4JRRA 4DSRA 5KEJA 1O8WA 3C1RA 3GNJA 3H4KA 5DCGA 4YQUA 3M0FA 1X9MB 4WR4A 1A8LA 1ACVA 1IYHA 4HQZA 4D73B 5CRWA 2M80A 4ECCA 1TI1A 2K8SA 5IO0A 4EDYA 4NV2A 1M2BA 2OKAA 3RPNA 8GSSA 4ISDA 4F2IA 3WGDA 3HVVA 1TI3A 2HYXA 4YAPA 1PGTA 2X8GA 4AJ7A 3HKRA 1R5PA 1S3DA 1YZXA 2H01A 3LYKA 2ON7A 3D5JA 1O8XA 3FR9A 4O5QA 1TK5B 3FYGA 3HY2A 1R5AA 1ZCPA 5ENUA 2MMAA 3LJRA 2FD3A 4P3YB 4IVFA 3F63A 4POBA 3C7MA 2LRNA 3KMNA 2YNXA 1Y6EA 5B6NA 4MJAA 1TK8B 3A2WA 5GZZB 3D21A 1FVJA 3KEBA 2GSQA 3H93A 3D6IA 3GTUA 1T00A 3G7YA 1U6TA 4Q5RA 4L5LA 3TKPA 5JCUA 4YAVA 1TK0B 1XW6A 2VD1A 3GKMA 2BTOT 4MH3A 4KB3A 4NMUA 5IQYA 3TRQA 3UBLA 1XWBA 1YEXA 3GH9A 4AGSA 1XZOA 2JZSA 4ZL9A 3CBUA 2GZYA 1U3IA 4RQXA 4JE1A 3IA1A 22GSA 1MDKA 1XWGA 1BEDA 3QFBC 4DVCA 2YJHA 1PSQA 4IQAA 2XPEA 3UL3A 2HT9A 2R6KA 3EMPA 1SYRA 1MDIA 3TJBA 3ED3A 1ILOA 2N5AA 3LG6A 2XHFA 1WOUA 2FWEA 2YJ7A 2L57A 1A24A 2IMKA 2FNOA 1ZZYA 1PFOA 4DEJA 3APSA 3Q19A 1XCCA 1S3AA 3VK9A 19GSA 1KEBA 2VUPA 4MZWA 1TRSA 1EGRA 4ACSA 4Q5QA 3P8WA 5ECMB 1JZWA 2X8HA 4HDEA 4HS1A 3IOSA 3GIXA 2LQOA 1YJ6A 5KN0A 3KGKA 4N0ZA 2OE0A 4H86A 4O7HA 1J0FA 1XBSA 3F6DA 2EIOA 2LTKA 3MNGA 2HE3A 3DGQA 2MMNA 1WIKA 2KHPA 1ERTA 1URMA 2ZCTA 2UZ8A 4KCAA 3FZ5A 4HJ2A 2WRTA 5D9TA 2X4AA 3TKRA 1J08A 3RHBA 4HU9A 4HJMA 3M9JA 2HNLA 2C80A 2PU9C 2DMLA 4TXOB 2RLIA 4XS4A 1BYEA 2HRFA 6GSXA 1R26A 2KP1A 1VF2A 3VWVA 3RHCA 1TRWA 4L0UA 5EPFA 3C71A 1FG4A 5C04A 3KCMA 2QC7A 2L59A 1V98A 2L4CA 4O5UA 1DE2A 4TR1A 1WP0A 6GSYA 2CX4A 2YWNA 5CP1A 4V2NA 1TTZA 5H5QA 12GSA 2JACA 4K9ZA 2DC5A 1SK1A 2GDRA 2OACA 2LRCA 2BMXA 4JEDA 3WYWA 1A2MA 2YV7A 3ZRDA 3C1SA 4LMVA 4ICYA 3WT1A 5GSTA 4O32A 5B8BA 2IMEA 1KNGA 1OE7A 3FRCA 2LJAA 2F3MA 4F9ZA 4GXZA 2C0FA 4TXOA 1TRVA 4JU5A 3TGZA 3HJMA 2REMA 2I9HA 2PPTA 1SENA 1Z9HA 4IBPA 1YKCA 2MBSA 3TOUA 2DBCA 2NPBA 5J9BA 5IM9A 2AAWA 4FQUA 3KXOA 2YWOA 1OE8A 1GTAA 4FYCA 3HZ4A 3FZAA 3QCPA 1ERUA 3VURA 4O5RA 2CVKA 3KJYA 2DJ0A 1VF4A 3KH9A 3GHAA 3UEMA 4BL7B 2X8CA 2NTOA 1HNAA 1X0RA 2MYGA 3P90A 1QK8A 4G0IA 1LBKA 5IMAA 3TKSE 1WJKA 1GRXA 2E2GA 3DMLA 4JZQA 5IOWA 2WDUA 2CQ9A 2VOCA 3L78A 1QQ2A 1U3AA 4MJEA 2HI7A 4IHUA 5CRGA 2LEGA 2RM6A 4X0XA 1EWXA 4ZB9A 1V57A 1NHYA 1QXHA 2GTUA 1X9WB 2R0GA 2F8AA 2H70A 3ZVJA 1AQWA 4K6XA 5G2ZA 2I81A 2FWGA 3LXTA 3D22A 2V1MA 2VLVA 3FR3A 3MDKA 3ZITA 4NHWA 1MTCA 5EL8A 4WKWA 2LNSA 2P31A 2RM5A 4IKHA 4TXVA 1K0CA 5DAKA 2O89A 5J41A 3PINA 1OC9A 4NHZA 2MZCA 2H73A 1M9BA 1GSDA 4OWYA 4POMA 2DJ2A 5CAXA 3HXSA 5ECPB 1SD9A 4KUNA 4IS0A 2GSTA 1BX9A 4MF5A 5ID2A 4CDOA 4Q5FA 1K0NA 2EC4A 2YWIA 1SYXA 4EUYA 4EXJA 3HVXA 3L0HA 1SKSB 3GKNA 1K0AA 1GNEA 1UA5A 5JCGA 1JZRA 4ZB6A 2R37A 2AHEA 2L5OA 4ZIJA 4I2TA 4IJIA 3DWVA 3APQA 1Q4JA 2B7JA 1M3IA 2FCHA 4XS1A 3US3A 1VF1A 2VCXA 1GP1A 3CSIA 1K3YA 2GT6A 4FH8A 4TOPA 4KH7A 2N5FA 2QA2A 2H1AA 4BIKA 4V1Ap 4BVXB 1TKDB 2H8LA 1SL2B 1YKAA 4I97A 3DVWA 5IPHA 2D2ZA 4IGJA 5F0GA 2V32A 3F9UA 1T8EB 4PX1A 2VCVA 5ECSA 3LSZA 5IOXA 14GSA 5DVBA 3GKXA 5ECKB 4GF0A 3EYTA 3E9JB 4Q5NA 1H75A 1DUGA 3LFLA 4L0WA 2H6YA 3ZYWA 6GSVA 4OO4A 3DVXA 3QMXA 3GH6A 5ECOB 1PN9A 4MH2A 4X4JA 5LNKe 3H79A 1OAZA 2FLSA 2PVQA 2QA1A 2VL9A 4K1FA 2H0IA 1M99A 1XIYA 4BWSA 4RI6A 4PNGA 3K8NA 3SBCA 1VGLA 6GSUA 1X5DA 3CRTA
chains in the Genus database with same CATH topology
2DKHA 3I69A 2YZHA 1EEJA 1W89A 3O3TA 4MNNA 2F51A 5E4WA 1ZYQB 3UOMA 2C8UA 2C0EA 1U87A 4ZL8A 2C3TA 4MCUA 3F4TA 2HSMA 1G7EA 1O73A 2G2QA 3UIWA 2H76A 1GSEA 4K5RA 3CMIA 2JZTA 1QGVA 4JR6A 2B5XA 2DJ3A 2CZ2A 3FEUA 3GTUB 3U5RE 3LQ7A 2O87A 3EC3A 5IMFA 3L9VA 3GYKA 4V2LA 4E8EA 2CZ3A 3L9SA 3H1NA 2KLXA 2AYTA 1NSWA 2DJKA 2O8VB 2GSSA 4GLTA 3IPZA 4XCSA 2PUKC 2FWFA 5D8IA 3ME7A 4K2XA 4TN8A 4OFMA 2MBTA 1PA3A 5DBQA 4TW5A 1O85A 4G19A 5AIXA 1PL2A 2ES7A 2LS5A 1A23A 5ECQB 3O6TA 4KNDA 4NAXA 5AGYA 3DKSA 1GTUA 2ZUPA 3IR4A 2H30A 2OE3A 5A4WA 5HQPA 2E7PA 3ZFBA 4XRDA 3BBYA 3ZFLA 4MMMA 13GSA 1IYIA 1N8JA 4V2MA 5AN1A 2I3YA 4ULXA 5DJMA 1SK0A 4LA1A 3HYPA 4PTSA 5BMUA 4WXTA 2LRTA 1MD3A 5EY6A 3TKSA 1FO5A 3NZNA 3HHVA 4KA0A 5ELAA 4Z7XA 2DSAA 3I9V2 3BD2A 3I6AA 4FYUA 1F3BA 2ZNMA 3ISOA 2VLUA 3IK7A 2PGTA 4NWYA 1W4VA 3MAKA 1ABAA 3G7IA 4MABA 2QKEA 3NOFA 1I9DA 4LLRA 3TRXA 2P0GA 2VIMA 5DDLA 11GSA 3FHKA 4K8MA 4GSTA 4MP4A 5H5RA 1AQVA 4I6XA 3ZIJA 4YH2A 1YEPA 3VI7A 4JR4A 1M7TA 1G6WA 2GLRA 2JSZA 3D0ZA 2XBQA 1M0UA 5E59A 3E0UA 4WF5A 5HR3A 4G9HA 2H6XA 4ZILA 2C3NA 4XS4B 1EOHA 2V2GA 2DJJA 3EE2A 5G30A 1HYUA 2VCWA 2Z9SA 2A4VA 3N9JA 4NPBA 1TW9A 2YN1A 3UJ1A 4LMWA 1CQGA 4TR1B 1THXA 3QAVA 2HRNA 3CRUA 2C0GA 5F05A 5DALA 1X5EA 2O7KA 16GSA 1GSUA 1BG5A 1V40A 4LL4B 5F06A 1AAZA 3TDGA 1WWJA 4HI7A 3GA4A 1O7UA 1TXXA 2R2JA 3QAWA 3FK8A 5DQSA 2GQMA 6GSWA 5J5NA 5G5EA 3KP9A 1HNBA 4F0CA 3S9FA 4PGTA 3ERFA 4K7NA 1BJXA 4CHSA 1B8XA 3D4TA 3TKSC 2B3SA 3MWHA 1TU7A 4KE3A 4J56E 3L4NA 1AIUA 4POLA 1I5GA 2CVBA 1X9SB 2YCDA 3TCOA 3R2QA 4HZ2A 2LJKA 2K9FA 2OBKA 3HD5A 4EIQA 4ML1A 3FZ4A 4PQIA 9GSSA 5A5KA 5D96A 3IBHA 1CQHA 4ZB8A 3QDNA 1G0TA 3M1GA 4HOJA 1NHOA 2IL3A 3PR8A 1SL0B 3E3EA 4RI7A 3G7JA 2H74A 3DD3A 4ECBA 2AJQB 1XXUA 1SJ6A 1HD2A 2HXKA 3ERGA 4EO3A 4N30A 2CAIA 1Z6NA 4K7OA 1GUKA 1GLPA 2DLXA 2OA7A 1XOAA 2VO4A 1RW1A 4KSMA 1M2DA 2DIYA 5A4VA 3MIXA 2B5EA 2G0FA 4K5SA 2IMIA 3UBKA 5LCZA 5ECRB 2LNTA 2IFQB 2A2SA 5DAKB 1GLQA 1OC9B 3VI5A 3Q74A 1EEMA 2NVLA 2WZ9A 3IE3A 2JSYA 5G31A 5AISA 4Z2TA 5ID2B 1YY7A 1FAAA 4OFTA 1EGOA 2KOKA 1O81A 1NW2A 4NXIA 2TRXA 3KIJA 3M8NA 4PNFA 2R3XA 3ME8A 4MF6A 2CVDA 4GRFA 3LGCA 5J9CA 2K18A 2YWMA 2FGXA 2HRKA 5J3RA 1A0FA 1A0RP 3W6GA 2GZPA 4GQFA 1WPIA 1ZOFA 2CAQA 2E0QA 2VL2A 1YDKA 1NM3A 4KDUA 4KCEA 4KDYA 3TOTA 2HRAA 1T4YA 4KDXA 1V9WA 5HR2A 4ILFA 3IK9A 1PKWA 3ZIVA 4XS6A 2I4AA 2DIZA 2IFQA 2NDOA 4YKGA 3LYPA 4FO5A 1AUCA 2YOIA 4CW9A 5KOWA 4GCIA 5DCHA 2JZRA 3APOA 2JU5A 3Q18A 3J7Yk 1SKRB 1XWCA 5G5FA 1K0MA 5ECIB 1ZYEA 1SKWB 1G7OA 2H0GA 1OC8A 1A2JA 3M9KA 1F6MC 4K0GA 3UMAA 3VPQA 1JLWA 4HQSA 5AIVA 3DRNA 1GULA 4GQCA 1PX7A 2VCQA 1ML6A 5CO3A 1MEKA 1FOHA 2LQQA 2IWTA 4ID0A 4MJBA 4G0KA 4IN0A 1JLVA 2H1BA 1Z7PA 3GMFA 5KOXA 5GSSA 1OVNA 4I5QA 2C3QA 3Q6OA 5IPGA 1B9YC 3FMWA 4MLYA 1PN0A 2XPDA 3KZQA 1RQMA 3MYDA 2OJLA 1RK4A 2WB9A 4K2DA 2IMFA 3QAGA 3C8EA 5G1KA 1TOFA 4ZL7A 3EU3A 3VWXA 4DSSA 3VLNA 4WEYA 4I8BA 4OMVA 1Y25A 2CX3A 1EP8A 3KM6A 3F6FA 3HCZA 5CNWA 1Z3EA 1UN2A 1TRUA 2LKUA 2XBIA 4EKZA 4ECIA 4AJ6A 1XOBA 3VWUA 4EF0A 1FOVA 2OBIA 2FHEA 4XRAA 4PQ1A 2VL2C 2BJXA 4QL7A 2YANA 1FVKA 1JHBA 1O6JA 3WD6A 4O92A 3ZL5A 5HFKA 4N11A 5KN2A 1HQOA 3F8UA 4MPGA 3GN3A 1WE0A 4IP6A 4J57E 2WFCA 3ZLPA 1GH2A 2OADA 4Z2UA 1ZMAA 2X99A 2MMZA 4QQ7A 3ZREA 1J9BA 1MDJA 1VRSD 1KBNA 4TRXA 1GSQA 3TJKA 2HSHA 1QFNA 4KAEA 4PQHA 3FZ9A 4TVEA 5CRHA 3A5IA 4USSA 2QSIA 3DXBA 4GSNA 4BPYA 1ON4A 2YP6A 1DBYA 5IO2A 3GUSA 4FYBA 3ERWA 5IIZA 3TJJA 1R7HA 1WRYA 1GUMA 3ZMLA 2GVPA 3IRAA 2NBSA 4I2UA 2YZUA 2R4VA 5JCWA 3IXRA 4WR5A 3LWAA 3TJFA 2B1LA 5F8BA 3GKKA 3U6VA 4F82A 3KTLA 3DEXA 4RQRA 2H75A 3HDCA 3CXGA 4EE0A 1ZYPA 4GSSA 3SWLA 2VAFA 2M46A 1GSSA 2PWJA 1SK2A 1AC1A 4CY6A 6GSSA 1K0BA 1AW9A 3TRPA 1QMVA 3LEFA 4HUAA 2H1GA 1XPVA 1M2AA 3ZTLA 2PERA 4X43A 3H8QA 2WGRA 2H66A 5BRTA 3TUEA 2HZEB 4F03A 2JADA 5B7CA 5D9XA 1N2AA 4BA7A 3HA9A 4HU7A 5J4UA 4F0BA 3EPTA 1H4OA 2YPMA 3V1WA 3TKQA 2VL3A 1PKZA 1SJIA 1ZGNA 4OCEA 1XWKA 4QL9A 4RUVA 2H71A 3BCKA 6GSTA 3CYNA 3IHGA 3F3RA 1EZKA 1ST9A 2RUEA 3LW9A 1OC3A 5JWQB 3LXZA 2GQKA 1YF0A 1GTIA 2JL4A 1PX6A 1B4PA 3KTBA 20GSA 5IMZA 4WBJA 5ECNB 3VWWA 1EV4A 2OE1A 4DSQA 5HR1A 2V6KA 1FB0A 4D73A 3WGXA 5IMVA 3IV4A 5EVOA 1C72A 3F4RA 2KP2A 2EIRA 2H0HA 1A8YA 3ZVJD 2HZEA 2AUVA 3PGTA 2L5LA 2A2RA 5DALB 1X5CA 1SD8A 2FA4A 2R5GA 5CYYA 4Z2RA 1U88A 3M3MA 3W8SA 4A5PA 3RDWA 4AJ8A 4IJ3A 4MJCA 3DIEA 2V6OA 2PMTA 3GURA 4TKYA 2B7KA 2IN3A 5IMCA 2L4QA 1ZYNA 5D73A 2WJUA 3D4MA 2WS2A 2GSRA 1E2YA 1E6BA 4ZBBA 1LJRA 1JZDA 2WULA 2A4HA 2X64A 5D9VA 3HJOA 2IJYA 5HFGA 3A2VA 3R3EA 2CV4A 5F07A 3AY8A 3GFKA 3FW2A 5ECHB 4OFNA 1PQNA 2IIYA 2J9HA 1JFUA 2P5RA 3PPUA 5GAND 5DQYA 3HZ8A 1Z6MA 1BQ7A 3CTFA 5D9WA 4IP1A 2LUSA 1FHEA 4ECJA 3IC8A 1EP7A 2FUG2 3G9BA 1AXDA 2HFDA 3QPMA 1Z7RA 1GSYA 4IELA 1FB6A 3KD0A 5GAPD 10GSA 5FWGA 4TR4A 5KN1A 2LSTA 1XFLA 3IAM2 3N5OA 4G2EA 2F9SA 4TR0A 4AF2A 1YQ1A 3QOUA 4K0NA 2VCZA 4BVYB 2AB6A 4PXOA 5G1LA 3C73A 4PUFC 5B8AA 4TR3A 4KF9A 1BAYA 4J2FA 2PBJA 5LD0A 4BWQA 3FR6A 1GTBA 5B6MA 3GSTA 2R0CA 3GX8A 5JWOB 4MK3A 1PMTA 1S3CA 3KH7A 3NIVA 2P5QA 3GL3A 5DJLA 1Z5YE 3KP8A 3I43A 2WCIA 5FHIA 2H19A 3W8JA 2YV9A 2IPAA 2C4JA 2O85A 5IMDA 1SL1B 4EC0A 4XTSA 3QR6A 4L8EA 3FKFA 5HFIA 4KGIA 2K6VA 5JWRB 2GS3A 4MF7A 4E8HA 5HR0A 1PD21 4BVYA 1DSBA 1GNWA 5COHA 4EVMA 4ZBDA 3BOAA 1TU8A 4EDZA 4ZBAA 1EV9A 2A2PA 4MDCA 2PN8A 1MD4A 1OYJA 3IAS2 1T3BA 2RUFA 1YF1A 5D93A 3ZZXA 3VPTA 3CSJA 2N5BA 4PUAA 2VCTA 4OCFA 3UVTA 1B4QA 2ALBA 4FIWA 4KX4A 3PH9A 1UVZA 4K7IA 3RAZA 3TB2A 1VF3A 2DMMA 4MZCA 4GWRA 5CREA 1ZL9A 5INYA 4WF4A 3P2AA 3HVSA 5CRDA 3A3TA 4CY8A 3OR5A 2B1KA 2X49A 2QGVA 3QFAC 4GTUA 3P7XA 2PVOC 1UC7A 2GGTA 3F4SA 2C0DA 4POKA 2L6DA 2V41A 2CT6A 4G10A 3VFIA 4ML6A 4YQVA 1F9MA 1B9XC 2GQLA 7GSSA 2EIQA 3GL5A 3L9UA 4IQ1A 4JBBA 2DKIA 3CSHA 1F37A 2CA8A 1Q98A 3RBTA 1GUHA 3UAPA 2HLSA 1K0DA 4MPFA 3EWLA 1PL1A 1K3OA 2VD0A 4MA9A 3F3QA 2H6ZA 2C1YA 4HZ4A 5KN3A 1SJZA 1TJDA 4DSSB 2FWHA 2GZZA 2B6MA 3EU4A 4BL7A 3BCIA 3LORA 3TJGA 2E2MA 5L71A 3EMXA 4N10A 3WT2A 5ELGA 4OD7A 4L5OA 2XC2A 2J23A 1EOGA 1K3LA 3KMOA 3CTGA 2K8VA 1KTEA 2FY6A 1THOA 17GSA 4EIPA 5A4UA 3EVIA 5FT3A 3UVHA 2L6CA 1T7PB 1GL8A 3A5WA 4WBRD 2H1DA 4ZXGA 2VM2A 1WMJA 1XWAA 4NV5A 2VLTA 3EINA 1T4ZA 1XVQA 1QUWA 1OKTA 1TDIA 2F8FA 1FW1A 3DYRA 4MZBA 1PRXA 2RIIA 1F2EA 3HJPA 3GRXA 5H5SA 3GX0A 1ERVA 3F0IA 4XIHA 2I1UA 4LL1B 1XVWA 1M9AA 2FA8A 4G0LA 3ZMKA 1JZOA 3UARA 1SU9A 4N0VA 4HEA2 1LU4A 4KSOA 1DE1A 2KUCA 1USBA 3O76A 3QD9A 3A2XA 18GSA 5ABRA 3GV1A 1V2AA 4WETA 1V58A 3EURA 2DJ1A 2LJRA 2B5YA 3RPPA 3JCML 2GT5A 4YKFA 2HZFA 3GSSA 1TP9A 4EL1A 1G6YA 1T1VA 2VM1A 2LV3A 3BJ5A 1R4WA 2AV4A 4KW6A 2R0PA 1HNCA 3IDVA 2MMOA 4V1Ag 5C00A 1K0OA 1XW5A 4BVXA 2TRCP 3FY7A 1XW9A 2ON5A 1GWCA 2TIRA 4YQMA 3WGEA 1F3AA 4X1UA 1GSFA 3IHQA 1B48A 4IW9A 3MSZA 2H72A 4OO5A 4XHMA 3J7Yb 2M72A 5ECLB 2IMDA 3IC4A 2HSYA 1A2LA 1OKDA 4PURA 1AQXA 1ERWA 4JRRA 4DSRA 5KEJA 1O8WA 3C1RA 3GNJA 3H4KA 5DCGA 4YQUA 3M0FA 1X9MB 4WR4A 1A8LA 1ACVA 1IYHA 4HQZA 4D73B 5CRWA 2M80A 4ECCA 1TI1A 2K8SA 5IO0A 4EDYA 4NV2A 1M2BA 2OKAA 3RPNA 8GSSA 4ISDA 4F2IA 3WGDA 3HVVA 1TI3A 2HYXA 4YAPA 1PGTA 2X8GA 4AJ7A 3HKRA 1R5PA 1S3DA 1YZXA 2H01A 3LYKA 2ON7A 3D5JA 1O8XA 3FR9A 4O5QA 1TK5B 3FYGA 3HY2A 1R5AA 1ZCPA 5ENUA 2MMAA 3LJRA 2FD3A 4P3YB 4IVFA 3F63A 4POBA 3C7MA 2LRNA 3KMNA 2YNXA 1Y6EA 5B6NA 4MJAA 1TK8B 3A2WA 5GZZB 3D21A 1FVJA 3KEBA 2GSQA 3H93A 3D6IA 3GTUA 1T00A 3G7YA 1U6TA 4Q5RA 4L5LA 3TKPA 5JCUA 4YAVA 1TK0B 1XW6A 2VD1A 3GKMA 2BTOT 4MH3A 4KB3A 4NMUA 5IQYA 3TRQA 3UBLA 1XWBA 1YEXA 3GH9A 4AGSA 1XZOA 2JZSA 4ZL9A 3CBUA 2GZYA 1U3IA 4RQXA 4JE1A 3IA1A 22GSA 1MDKA 1XWGA 1BEDA 3QFBC 4DVCA 2YJHA 1PSQA 4IQAA 2XPEA 3UL3A 2HT9A 2R6KA 3EMPA 1SYRA 1MDIA 3TJBA 3ED3A 1ILOA 2N5AA 3LG6A 2XHFA 1WOUA 2FWEA 2YJ7A 2L57A 1A24A 2IMKA 2FNOA 1ZZYA 4DEJA 3APSA 3Q19A 1XCCA 1S3AA 3VK9A 19GSA 1KEBA 2VUPA 4MZWA 1TRSA 1EGRA 4ACSA 4Q5QA 3P8WA 5ECMB 1JZWA 2X8HA 4HDEA 4HS1A 3IOSA 3GIXA 2LQOA 1YJ6A 5KN0A 3KGKA 4N0ZA 2OE0A 4H86A 4O7HA 1J0FA 1XBSA 3F6DA 2EIOA 2LTKA 3MNGA 2HE3A 3DGQA 2MMNA 1WIKA 2KHPA 1ERTA 1URMA 2ZCTA 2UZ8A 4KCAA 3FZ5A 4HJ2A 2WRTA 5D9TA 2X4AA 3TKRA 1J08A 3RHBA 4HU9A 4HJMA 3M9JA 2HNLA 2C80A 2PU9C 2DMLA 4TXOB 2RLIA 4XS4A 1BYEA 2HRFA 6GSXA 1R26A 2KP1A 1VF2A 3VWVA 3RHCA 1TRWA 4L0UA 5EPFA 3C71A 1FG4A 5C04A 3KCMA 2QC7A 2L59A 1V98A 2L4CA 4O5UA 1DE2A 4TR1A 1WP0A 6GSYA 2CX4A 2YWNA 5CP1A 4V2NA 1TTZA 5H5QA 12GSA 2JACA 4K9ZA 2DC5A 1SK1A 2GDRA 2OACA 2LRCA 2BMXA 4JEDA 3WYWA 1A2MA 2YV7A 3ZRDA 3C1SA 4LMVA 4ICYA 3WT1A 5GSTA 4O32A 5B8BA 2IMEA 1KNGA 1OE7A 3FRCA 2LJAA 2F3MA 4F9ZA 4GXZA 2C0FA 4TXOA 1TRVA 4JU5A 3TGZA 3HJMA 2REMA 2I9HA 2PPTA 1SENA 1Z9HA 4IBPA 1YKCA 2MBSA 3TOUA 2DBCA 2NPBA 5J9BA 5IM9A 2AAWA 4FQUA 3KXOA 2YWOA 1OE8A 1GTAA 4FYCA 3HZ4A 3FZAA 3QCPA 1ERUA 3VURA 4O5RA 2CVKA 3KJYA 2DJ0A 1VF4A 3KH9A 3GHAA 3UEMA 4BL7B 2X8CA 2NTOA 1HNAA 1X0RA 2MYGA 3P90A 1QK8A 4G0IA 1LBKA 5IMAA 3TKSE 1WJKA 1GRXA 2E2GA 3DMLA 4JZQA 5IOWA 2WDUA 2CQ9A 2VOCA 3L78A 1QQ2A 1U3AA 4MJEA 2HI7A 4IHUA 5CRGA 2LEGA 2RM6A 4X0XA 1EWXA 4ZB9A 1V57A 1NHYA 1QXHA 2GTUA 1X9WB 2R0GA 2F8AA 2H70A 3ZVJA 1AQWA 4K6XA 5G2ZA 2I81A 2FWGA 3LXTA 3D22A 2V1MA 2VLVA 3FR3A 3MDKA 3ZITA 4NHWA 1MTCA 5EL8A 4WKWA 2LNSA 2P31A 2RM5A 4IKHA 4TXVA 1K0CA 5DAKA 2O89A 5J41A 3PINA 1OC9A 4NHZA 2MZCA 2H73A 1M9BA 1GSDA 4OWYA 4POMA 2DJ2A 5CAXA 3HXSA 5ECPB 1SD9A 4KUNA 4IS0A 2GSTA 1BX9A 4MF5A 5ID2A 4CDOA 4Q5FA 1K0NA 2EC4A 2YWIA 1SYXA 4EUYA 4EXJA 3HVXA 3L0HA 1SKSB 3GKNA 1K0AA 1GNEA 1UA5A 5JCGA 1JZRA 4ZB6A 2R37A 2AHEA 2L5OA 4ZIJA 4I2TA 4IJIA 3DWVA 3APQA 1Q4JA 2B7JA 4XS1A 2FCHA 3US3A 1VF1A 2VCXA 1GP1A 3CSIA 1K3YA 2GT6A 4FH8A 4TOPA 4KH7A 2N5FA 2QA2A 2H1AA 4V1Ap 4BVXB 1TKDB 2H8LA 1SL2B 1YKAA 4I97A 3DVWA 5IPHA 2D2ZA 4IGJA 5F0GA 2V32A 3F9UA 1T8EB 4PX1A 2VCVA 5ECSA 3LSZA 5IOXA 14GSA 5DVBA 3GKXA 5ECKB 4GF0A 3EYTA 3E9JB 4Q5NA 1H75A 1DUGA 3LFLA 4L0WA 2H6YA 3ZYWA 6GSVA 4OO4A 3DVXA 3QMXA 3GH6A 5ECOB 1PN9A 4MH2A 4X4JA 5LNKe 3H79A 1OAZA 2FLSA 2PVQA 2QA1A 2VL9A 4K1FA 2H0IA 1M99A 1XIYA 4BWSA 4RI6A 4PNGA 3K8NA 3SBCA 1VGLA 6GSUA 1X5DA 3CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I69 A;  2YZH A;  1EEJ A;  1W89 A;  3O3T A;  2F51 A;  5E4W A;  1ZYQ B;  3UOM A;  2C8U A;  2C0E A;  1U87 A;  4ZL8 A;  2C3T A;  4MCU A;  3F4T A;  1G7E A;  1O73 A;  2G2Q A;  3UIW A;  2H76 A;  1GSE A;  3CMI A;  2JZT A;  1QGV A;  4JR6 A;  2B5X A;  2DJ3 A;  2CZ2 A;  3FEU A;  3GTU B;  3U5R E;  3LQ7 A;  2O87 A;  3EC3 A;  5IMF A;  3L9V A;  3GYK A;  4V2L A;  4E8E A;  2CZ3 A;  3L9S A;  3H1N A;  2KLX A;  2AYT A;  1NSW A;  2DJK A;  2O8V B;  2GSS A;  4GLT A;  3IPZ A;  4XCS A;  2PUK C;  2FWF A;  5D8I A;  3ME7 A;  4TN8 A;  4OFM A;  2MBT A;  1PA3 A;  5DBQ A;  4TW5 A;  1O85 A;  4G19 A;  5AIX A;  1PL2 A;  2ES7 A;  2LS5 A;  1A23 A;  5ECQ B;  3O6T A;  4KND A;  4NAX A;  5AGY A;  3DKS A;  1GTU A;  2ZUP A;  3IR4 A;  2H30 A;  2OE3 A;  5A4W A;  5HQP A;  2E7P A;  3ZFB A;  4XRD A;  3BBY A;  3ZFL A;  4MMM A;  13GS A;  1IYI A;  1N8J A;  4V2M A;  5AN1 A;  2I3Y A;  4ULX A;  5DJM A;  1SK0 A;  4LA1 A;  3HYP A;  4WXT A;  2LRT A;  1MD3 A;  5EY6 A;  3TKS A;  1FO5 A;  3NZN A;  3HHV A;  4KA0 A;  5ELA A;  4Z7X A;  2DSA A;  3I9V 2;  3BD2 A;  3I6A A;  4FYU A;  1F3B A;  2ZNM A;  3ISO A;  2VLU A;  3IK7 A;  2PGT A;  4NWY A;  1W4V A;  3MAK A;  1ABA A;  3G7I A;  4MAB A;  2QKE A;  3NOF A;  1I9D A;  4LLR A;  3TRX A;  2P0G A;  2VIM A;  5DDL A;  11GS A;  3FHK A;  4K8M A;  4GST A;  4MP4 A;  5H5R A;  1AQV A;  4I6X A;  3ZIJ A;  4YH2 A;  1YEP A;  3VI7 A;  4JR4 A;  1M7T A;  1G6W A;  2GLR A;  2JSZ A;  3D0Z A;  2XBQ A;  1M0U A;  5E59 A;  3E0U A;  4WF5 A;  5HR3 A;  4G9H A;  2H6X A;  4ZIL A;  2C3N A;  4XS4 B;  1EOH A;  2V2G A;  2DJJ A;  3EE2 A;  5G30 A;  1HYU A;  2VCW A;  2Z9S A;  2A4V A;  3N9J A;  4NPB A;  1TW9 A;  2YN1 A;  3UJ1 A;  4LMW A;  1CQG A;  4TR1 B;  1THX A;  3QAV A;  2HRN A;  3CRU A;  2C0G A;  5F05 A;  5DAL A;  1X5E A;  2O7K A;  16GS A;  1GSU A;  1BG5 A;  1V40 A;  4LL4 B;  5F06 A;  1AAZ A;  3TDG A;  1WWJ A;  4HI7 A;  3GA4 A;  1O7U A;  1TXX A;  2R2J A;  3QAW A;  3FK8 A;  5DQS A;  2GQM A;  6GSW A;  5J5N A;  5G5E A;  3KP9 A;  1HNB A;  4F0C A;  3S9F A;  4PGT A;  3ERF A;  4K7N A;  1BJX A;  4CHS A;  1B8X A;  3D4T A;  3TKS C;  2B3S A;  3MWH A;  1TU7 A;  4KE3 A;  4J56 E;  3L4N A;  1AIU A;  4POL A;  1I5G A;  2CVB A;  1X9S B;  2YCD A;  3TCO A;  3R2Q A;  4HZ2 A;  2LJK A;  2K9F A;  2OBK A;  3HD5 A;  4ML1 A;  3FZ4 A;  4PQI A;  9GSS A;  5A5K A;  5D96 A;  3IBH A;  1CQH A;  4ZB8 A;  3QDN A;  1G0T A;  3M1G A;  4HOJ A;  1NHO A;  2IL3 A;  3PR8 A;  1SL0 B;  3E3E A;  4RI7 A;  3G7J A;  2H74 A;  3DD3 A;  4ECB A;  2AJQ B;  1XXU A;  1SJ6 A;  1HD2 A;  2HXK A;  3ERG A;  4EO3 A;  4N30 A;  2CAI A;  1Z6N A;  4K7O A;  1GUK A;  1GLP A;  2DLX A;  2OA7 A;  1XOA A;  2VO4 A;  1RW1 A;  4KSM A;  1M2D A;  2DIY A;  5A4V A;  2B5E A;  2G0F A;  2IMI A;  3UBK A;  5LCZ A;  5ECR B;  2LNT A;  2IFQ B;  2A2S A;  5DAK B;  1GLQ A;  1OC9 B;  3VI5 A;  3Q74 A;  1EEM A;  2NVL A;  2WZ9 A;  3IE3 A;  2JSY A;  5G31 A;  5AIS A;  5ID2 B;  1YY7 A;  1FAA A;  4OFT A;  1EGO A;  2KOK A;  1O81 A;  1NW2 A;  4NXI A;  2TRX A;  3KIJ A;  3M8N A;  4PNF A;  2R3X A;  3ME8 A;  4MF6 A;  2CVD A;  4GRF A;  3LGC A;  5J9C A;  2K18 A;  2YWM A;  2FGX A;  5J3R A;  1A0F A;  1A0R P;  3W6G A;  2GZP A;  4GQF A;  1WPI A;  1ZOF A;  2CAQ A;  2E0Q A;  2VL2 A;  1YDK A;  1NM3 A;  4KDU A;  4KCE A;  4KDY A;  3TOT A;  1T4Y A;  4KDX A;  1V9W A;  5HR2 A;  4ILF A;  3IK9 A;  1PKW A;  3ZIV A;  4XS6 A;  2I4A A;  2DIZ A;  2IFQ A;  2NDO A;  3LYP A;  4FO5 A;  1AUC A;  2YOI A;  4CW9 A;  4GCI A;  5DCH A;  2JZR A;  3APO A;  2JU5 A;  3Q18 A;  3J7Y k;  1SKR B;  1XWC A;  5G5F A;  1K0M A;  5ECI B;  1ZYE A;  1SKW B;  1G7O A;  2H0G A;  1OC8 A;  1A2J A;  3M9K A;  1F6M C;  4K0G A;  3UMA A;  3VPQ A;  1JLW A;  4HQS A;  5AIV A;  3DRN A;  1GUL A;  4GQC A;  1PX7 A;  2VCQ A;  1ML6 A;  5CO3 A;  1MEK A;  2LQQ A;  2IWT A;  4ID0 A;  4MJB A;  4IN0 A;  1JLV A;  2H1B A;  1Z7P A;  3GMF A;  5GSS A;  1OVN A;  4I5Q A;  2C3Q A;  3Q6O A;  5IPG A;  1B9Y C;  4MLY A;  2XPD A;  3KZQ A;  1RQM A;  2OJL A;  1RK4 A;  2WB9 A;  4K2D A;  2IMF A;  3QAG A;  3C8E A;  5G1K A;  1TOF A;  4ZL7 A;  3EU3 A;  3VWX A;  4DSS A;  3VLN A;  4WEY A;  4I8B A;  4OMV A;  1Y25 A;  2CX3 A;  1EP8 A;  3KM6 A;  3F6F A;  3HCZ A;  5CNW A;  1Z3E A;  1UN2 A;  1TRU A;  2LKU A;  2XBI A;  4EKZ A;  4ECI A;  4AJ6 A;  1XOB A;  3VWU A;  4EF0 A;  1FOV A;  2OBI A;  2FHE A;  4XRA A;  4PQ1 A;  2VL2 C;  2BJX A;  4QL7 A;  2YAN A;  1FVK A;  1JHB A;  1O6J A;  3WD6 A;  4O92 A;  3ZL5 A;  5HFK A;  4N11 A;  5KN2 A;  1HQO A;  3F8U A;  4MPG A;  3GN3 A;  1WE0 A;  4IP6 A;  4J57 E;  2WFC A;  3ZLP A;  1GH2 A;  2OAD A;  1ZMA A;  2X99 A;  2MMZ A;  4QQ7 A;  3ZRE A;  1J9B A;  1MDJ A;  1VRS D;  1KBN A;  4TRX A;  1GSQ A;  3TJK A;  2HSH A;  1QFN A;  4KAE A;  4PQH A;  3FZ9 A;  4TVE A;  5CRH A;  2QSI A;  3DXB A;  4GSN A;  4BPY A;  1ON4 A;  2YP6 A;  1DBY A;  5IO2 A;  3GUS A;  4FYB A;  3ERW A;  5IIZ A;  3TJJ A;  1R7H A;  1WRY A;  1GUM A;  3ZML A;  2GVP A;  3IRA A;  2NBS A;  4I2U A;  2YZU A;  2R4V A;  5JCW A;  3IXR A;  4WR5 A;  3LWA A;  3TJF A;  2B1L A;  5F8B A;  3GKK A;  3U6V A;  4F82 A;  3KTL A;  3DEX A;  4RQR A;  2H75 A;  3HDC A;  3CXG A;  4EE0 A;  4GSS A;  3SWL A;  2VAF A;  2M46 A;  1GSS A;  2PWJ A;  1SK2 A;  1AC1 A;  6GSS A;  1K0B A;  1AW9 A;  3TRP A;  1QMV A;  3LEF A;  4HUA A;  2H1G A;  1XPV A;  1M2A A;  3ZTL A;  2PER A;  4X43 A;  3H8Q A;  2WGR A;  2H66 A;  3TUE A;  2HZE B;  4F03 A;  2JAD A;  5B7C A;  5D9X A;  1N2A A;  4BA7 A;  3HA9 A;  4HU7 A;  5J4U A;  4F0B A;  1H4O A;  2YPM A;  3V1W A;  3TKQ A;  2VL3 A;  1PKZ A;  1SJI A;  1ZGN A;  4OCE A;  1XWK A;  4QL9 A;  4RUV A;  2H71 A;  3BCK A;  6GST A;  3CYN A;  3F3R A;  1EZK A;  1ST9 A;  2RUE A;  1OC3 A;  5JWQ B;  3LXZ A;  2GQK A;  1YF0 A;  1GTI A;  2JL4 A;  1PX6 A;  1B4P A;  3KTB A;  20GS A;  5IMZ A;  4WBJ A;  5ECN B;  3VWW A;  1EV4 A;  2OE1 A;  4DSQ A;  5HR1 A;  2V6K A;  1FB0 A;  4D73 A;  3WGX A;  5IMV A;  3IV4 A;  5EVO A;  1C72 A;  3F4R A;  2KP2 A;  2EIR A;  2H0H A;  1A8Y A;  3ZVJ D;  2HZE A;  2AUV A;  3PGT A;  2L5L A;  2A2R A;  5DAL B;  1X5C A;  1SD8 A;  2FA4 A;  2R5G A;  5CYY A;  1U88 A;  3M3M A;  3W8S A;  3RDW A;  4AJ8 A;  4IJ3 A;  4MJC A;  3DIE A;  2V6O A;  2PMT A;  3GUR A;  4TKY A;  2B7K A;  2IN3 A;  5IMC A;  2L4Q A;  5D73 A;  2WJU A;  3D4M A;  2WS2 A;  2GSR A;  1E2Y A;  1E6B A;  4ZBB A;  1LJR A;  1JZD A;  2WUL A;  2X64 A;  5D9V A;  3HJO A;  2IJY A;  5HFG A;  3A2V A;  2CV4 A;  5F07 A;  3AY8 A;  3GFK A;  3FW2 A;  5ECH B;  4OFN A;  1PQN A;  2IIY A;  2J9H A;  1JFU A;  2P5R A;  5GAN D;  5DQY A;  3HZ8 A;  1Z6M A;  1BQ7 A;  3CTF A;  5D9W A;  4IP1 A;  2LUS A;  1FHE A;  4ECJ A;  1EP7 A;  2FUG 2;  3G9B A;  1AXD A;  2HFD A;  3QPM A;  1Z7R A;  1GSY A;  4IEL A;  1FB6 A;  3KD0 A;  5GAP D;  10GS A;  5FWG A;  4TR4 A;  5KN1 A;  2LST A;  1XFL A;  3IAM 2;  3N5O A;  4G2E A;  2F9S A;  4TR0 A;  4AF2 A;  1YQ1 A;  3QOU A;  4K0N A;  2VCZ A;  2AB6 A;  4PXO A;  5G1L A;  3C73 A;  4PUF C;  5B8A A;  4TR3 A;  1BAY A;  4J2F A;  2PBJ A;  5LD0 A;  4BWQ A;  3FR6 A;  1GTB A;  5B6M A;  3GST A;  3GX8 A;  5JWO B;  4MK3 A;  1PMT A;  1S3C A;  3KH7 A;  3NIV A;  2P5Q A;  3GL3 A;  5DJL A;  1Z5Y E;  3KP8 A;  3I43 A;  2WCI A;  5FHI A;  2H19 A;  3W8J A;  2YV9 A;  2IPA A;  2C4J A;  2O85 A;  5IMD A;  1SL1 B;  4EC0 A;  4XTS A;  3QR6 A;  4L8E A;  3FKF A;  5HFI A;  4KGI A;  2K6V A;  5JWR B;  2GS3 A;  4MF7 A;  4E8H A;  5HR0 A;  1PD2 1;  4BVY A;  1DSB A;  1GNW A;  5COH A;  4EVM A;  4ZBD A;  3BOA A;  1TU8 A;  4EDZ A;  4ZBA A;  1EV9 A;  4MDC A;  2PN8 A;  1MD4 A;  1OYJ A;  3IAS 2;  1T3B A;  2RUF A;  1YF1 A;  5D93 A;  3ZZX A;  3VPT A;  3CSJ A;  2N5B A;  4PUA A;  2VCT A;  4OCF A;  3UVT A;  1B4Q A;  2ALB A;  4FIW A;  4KX4 A;  3PH9 A;  1UVZ A;  4K7I A;  3RAZ A;  3TB2 A;  1VF3 A;  2DMM A;  4MZC A;  4GWR A;  5CRE A;  1ZL9 A;  5INY A;  4WF4 A;  3P2A A;  3HVS A;  5CRD A;  3A3T A;  3OR5 A;  2B1K A;  2QGV A;  3QFA C;  4GTU A;  3P7X A;  2PVO C;  1UC7 A;  2GGT A;  3F4S A;  2C0D A;  4POK A;  2L6D A;  2V41 A;  2CT6 A;  4G10 A;  3VFI A;  4ML6 A;  4YQV A;  1F9M A;  1B9X C;  2GQL A;  7GSS A;  2EIQ A;  3GL5 A;  3L9U A;  4IQ1 A;  4JBB A;  3CSH A;  1F37 A;  2CA8 A;  1Q98 A;  3RBT A;  1GUH A;  3UAP A;  2HLS A;  1K0D A;  4MPF A;  3EWL A;  1PL1 A;  1K3O A;  2VD0 A;  4MA9 A;  3F3Q A;  2H6Z A;  2C1Y A;  4HZ4 A;  5KN3 A;  1SJZ A;  1TJD A;  4DSS B;  2FWH A;  2GZZ A;  2B6M A;  3EU4 A;  4BL7 A;  3BCI A;  3LOR A;  3TJG A;  2E2M A;  5L71 A;  3EMX A;  4N10 A;  3WT2 A;  5ELG A;  4OD7 A;  4L5O A;  2XC2 A;  2J23 A;  1EOG A;  1K3L A;  3KMO A;  3CTG A;  2K8V A;  1KTE A;  2FY6 A;  1THO A;  17GS A;  5A4U A;  3EVI A;  5FT3 A;  3UVH A;  2L6C A;  1T7P B;  1GL8 A;  3A5W A;  4WBR D;  2H1D A;  4ZXG A;  2VM2 A;  1WMJ A;  1XWA A;  4NV5 A;  2VLT A;  3EIN A;  1T4Z A;  1XVQ A;  1QUW A;  1OKT A;  1TDI A;  2F8F A;  1FW1 A;  3DYR A;  4MZB A;  1PRX A;  2RII A;  1F2E A;  3HJP A;  3GRX A;  5H5S A;  3GX0 A;  1ERV A;  3F0I A;  4XIH A;  2I1U A;  4LL1 B;  1XVW A;  1M9A A;  2FA8 A;  3ZMK A;  1JZO A;  3UAR A;  1SU9 A;  4N0V A;  4HEA 2;  1LU4 A;  4KSO A;  1DE1 A;  2KUC A;  1USB A;  3O76 A;  3QD9 A;  3A2X A;  18GS A;  5ABR A;  3GV1 A;  1V2A A;  4WET A;  1V58 A;  3EUR A;  2DJ1 A;  2LJR A;  2B5Y A;  3RPP A;  3JCM L;  2GT5 A;  2HZF A;  3GSS A;  1TP9 A;  4EL1 A;  1G6Y A;  1T1V A;  2VM1 A;  2LV3 A;  3BJ5 A;  1R4W A;  2AV4 A;  4KW6 A;  3IDV A;  1HNC A;  4V1A g;  2MMO A;  5C00 A;  1K0O A;  1XW5 A;  4BVX A;  2TRC P;  3FY7 A;  1XW9 A;  2ON5 A;  1GWC A;  2TIR A;  4YQM A;  3WGE A;  1F3A A;  4X1U A;  1GSF A;  3IHQ A;  1B48 A;  4IW9 A;  3MSZ A;  2H72 A;  4OO5 A;  4XHM A;  3J7Y b;  2M72 A;  5ECL B;  2IMD A;  3IC4 A;  2HSY A;  1A2L A;  1OKD A;  4PUR A;  1AQX A;  1ERW A;  4JRR A;  4DSR A;  5KEJ A;  1O8W A;  3C1R A;  3GNJ A;  3H4K A;  5DCG A;  4YQU A;  3M0F A;  1X9M B;  4WR4 A;  1A8L A;  1ACV A;  1IYH A;  4HQZ A;  4D73 B;  5CRW A;  2M80 A;  4ECC A;  1TI1 A;  2K8S A;  5IO0 A;  4EDY A;  4NV2 A;  1M2B A;  2OKA A;  3RPN A;  8GSS A;  4ISD A;  4F2I A;  3WGD A;  3HVV A;  1TI3 A;  2HYX A;  4YAP A;  1PGT A;  2X8G A;  4AJ7 A;  3HKR A;  1R5P A;  1S3D A;  1YZX A;  2H01 A;  3LYK A;  2ON7 A;  3D5J A;  1O8X A;  3FR9 A;  1TK5 B;  3FYG A;  3HY2 A;  1R5A A;  1ZCP A;  5ENU A;  2MMA A;  3LJR A;  2FD3 A;  4P3Y B;  4IVF A;  3F63 A;  4POB A;  3C7M A;  2LRN A;  3KMN A;  2YNX A;  1Y6E A;  5B6N A;  4MJA A;  1TK8 B;  3A2W A;  5GZZ B;  3D21 A;  1FVJ A;  3KEB A;  2GSQ A;  3H93 A;  3D6I A;  3GTU A;  1T00 A;  3G7Y A;  1U6T A;  4Q5R A;  4L5L A;  3TKP A;  5JCU A;  4YAV A;  1TK0 B;  1XW6 A;  2VD1 A;  3GKM A;  2BTO T;  4MH3 A;  4KB3 A;  4NMU A;  5IQY A;  3TRQ A;  3UBL A;  1XWB A;  1YEX A;  3GH9 A;  4AGS A;  1XZO A;  2JZS A;  4ZL9 A;  3CBU A;  2GZY A;  1U3I A;  4RQX A;  4JE1 A;  3IA1 A;  22GS A;  1MDK A;  1XWG A;  1BED A;  3QFB C;  4DVC A;  2YJH A;  1PSQ A;  4IQA A;  2XPE A;  3UL3 A;  2HT9 A;  2R6K A;  3EMP A;  1SYR A;  1MDI A;  3TJB A;  3ED3 A;  1ILO A;  2N5A A;  3LG6 A;  2XHF A;  1WOU A;  2FWE A;  2YJ7 A;  2L57 A;  1A24 A;  2IMK A;  2FNO A;  1ZZY A;  4DEJ A;  3APS A;  3Q19 A;  1XCC A;  1S3A A;  3VK9 A;  19GS A;  1KEB A;  2VUP A;  4MZW A;  1TRS A;  1EGR A;  4ACS A;  4Q5Q A;  3P8W A;  5ECM B;  1JZW A;  2X8H A;  4HDE A;  4HS1 A;  3IOS A;  3GIX A;  2LQO A;  1YJ6 A;  5KN0 A;  3KGK A;  4N0Z A;  2OE0 A;  4H86 A;  4O7H A;  1J0F A;  1XBS A;  3F6D A;  2EIO A;  2LTK A;  3MNG A;  2HE3 A;  3DGQ A;  2MMN A;  1WIK A;  2KHP A;  1ERT A;  1URM A;  2ZCT A;  4KCA A;  3FZ5 A;  4HJ2 A;  2WRT A;  5D9T A;  3TKR A;  1J08 A;  3RHB A;  4HU9 A;  4HJM A;  3M9J A;  2HNL A;  2C80 A;  2PU9 C;  2DML A;  4TXO B;  2RLI A;  4XS4 A;  1BYE A;  2HRF A;  6GSX A;  1R26 A;  2KP1 A;  1VF2 A;  3VWV A;  3RHC A;  1TRW A;  4L0U A;  5EPF A;  3C71 A;  1FG4 A;  5C04 A;  3KCM A;  2QC7 A;  2L59 A;  1V98 A;  2L4C A;  1DE2 A;  4TR1 A;  1WP0 A;  6GSY A;  2CX4 A;  2YWN A;  5CP1 A;  4V2N A;  1TTZ A;  5H5Q A;  12GS A;  2JAC A;  4K9Z A;  2DC5 A;  1SK1 A;  2GDR A;  2OAC A;  2LRC A;  2BMX A;  4JED A;  3WYW A;  1A2M A;  2YV7 A;  3ZRD A;  3C1S A;  4LMV A;  3WT1 A;  5GST A;  4O32 A;  5B8B A;  2IME A;  1KNG A;  1OE7 A;  3FRC A;  2LJA A;  2F3M A;  4F9Z A;  4GXZ A;  2C0F A;  4TXO A;  1TRV A;  4JU5 A;  3TGZ A;  3HJM A;  2REM A;  2I9H A;  2PPT A;  1SEN A;  1Z9H A;  4IBP A;  1YKC A;  2MBS A;  3TOU A;  2DBC A;  2NPB A;  5J9B A;  5IM9 A;  2AAW A;  3KXO A;  2YWO A;  1OE8 A;  1GTA A;  4FYC A;  3HZ4 A;  3FZA A;  3QCP A;  1ERU A;  3VUR A;  4O5R A;  2CVK A;  3KJY A;  2DJ0 A;  1VF4 A;  3KH9 A;  3GHA A;  3UEM A;  2X8C A;  2NTO A;  1HNA A;  1X0R A;  2MYG A;  3P90 A;  1QK8 A;  1LBK A;  5IMA A;  3TKS E;  1WJK A;  1GRX A;  2E2G A;  3DML A;  4JZQ A;  5IOW A;  2WDU A;  2CQ9 A;  2VOC A;  3L78 A;  1QQ2 A;  1U3A A;  4MJE A;  2HI7 A;  4IHU A;  5CRG A;  2LEG A;  2RM6 A;  4X0X A;  1EWX A;  4ZB9 A;  1V57 A;  1NHY A;  1QXH A;  2GTU A;  1X9W B;  2F8A A;  2H70 A;  3ZVJ A;  1AQW A;  4K6X A;  5G2Z A;  2I81 A;  2FWG A;  3LXT A;  3D22 A;  2V1M A;  2VLV A;  3FR3 A;  3MDK A;  3ZIT A;  4NHW A;  1MTC A;  5EL8 A;  4WKW A;  2LNS A;  2P31 A;  2RM5 A;  4IKH A;  4TXV A;  1K0C A;  5DAK A;  2O89 A;  5J41 A;  3PIN A;  1OC9 A;  4NHZ A;  2MZC A;  2H73 A;  1M9B A;  1GSD A;  4OWY A;  4POM A;  2DJ2 A;  5CAX A;  3HXS A;  5ECP B;  1SD9 A;  4KUN A;  4IS0 A;  2GST A;  1BX9 A;  4MF5 A;  5ID2 A;  4CDO A;  4Q5F A;  1K0N A;  2EC4 A;  2YWI A;  1SYX A;  4EUY A;  4EXJ A;  3HVX A;  3L0H A;  1SKS B;  3GKN A;  1K0A A;  1GNE A;  1UA5 A;  5JCG A;  1JZR A;  4ZB6 A;  2R37 A;  2AHE A;  2L5O A;  4ZIJ A;  4I2T A;  4IJI A;  3DWV A;  3APQ A;  1Q4J A;  2B7J A;  4XS1 A;  2FCH A;  3US3 A;  1VF1 A;  2VCX A;  1GP1 A;  3CSI A;  1K3Y A;  2GT6 A;  4FH8 A;  4TOP A;  4KH7 A;  2N5F A;  2H1A A;  4V1A p;  1TKD B;  2H8L A;  1SL2 B;  1YKA A;  4I97 A;  3DVW A;  5IPH A;  2D2Z A;  4IGJ A;  5F0G A;  2V32 A;  3F9U A;  1T8E B;  4PX1 A;  2VCV A;  5ECS A;  3LSZ A;  5IOX A;  14GS A;  5DVB A;  3GKX A;  5ECK B;  4GF0 A;  3EYT A;  3E9J B;  4Q5N A;  1H75 A;  1DUG A;  3LFL A;  4L0W A;  2H6Y A;  3ZYW A;  6GSV A;  4OO4 A;  3DVX A;  3QMX A;  3GH6 A;  5ECO B;  1PN9 A;  4MH2 A;  5LNK e;  3H79 A;  1OAZ A;  2FLS A;  2PVQ A;  2VL9 A;  4K1F A;  2H0I A;  1M99 A;  1XIY A;  4BWS A;  4RI6 A;  4PNG A;  3K8N A;  3SBC A;  1VGL A;  6GSU A;  1X5D A;  3CRT A; 
#chains in the Genus database with same CATH topology
 2DKH A;  3I69 A;  2YZH A;  1EEJ A;  1W89 A;  3O3T A;  4MNN A;  2F51 A;  5E4W A;  1ZYQ B;  3UOM A;  2C8U A;  2C0E A;  1U87 A;  4ZL8 A;  2C3T A;  4MCU A;  3F4T A;  2HSM A;  1G7E A;  1O73 A;  2G2Q A;  3UIW A;  2H76 A;  1GSE A;  4K5R A;  3CMI A;  2JZT A;  1QGV A;  4JR6 A;  2B5X A;  2DJ3 A;  2CZ2 A;  3FEU A;  3GTU B;  3U5R E;  3LQ7 A;  2O87 A;  3EC3 A;  5IMF A;  3L9V A;  3GYK A;  4V2L A;  4E8E A;  2CZ3 A;  3L9S A;  3H1N A;  2KLX A;  2AYT A;  1NSW A;  2DJK A;  2O8V B;  2GSS A;  4GLT A;  3IPZ A;  4XCS A;  2PUK C;  2FWF A;  5D8I A;  3ME7 A;  4K2X A;  4TN8 A;  4OFM A;  2MBT A;  1PA3 A;  5DBQ A;  4TW5 A;  1O85 A;  4G19 A;  5AIX A;  1PL2 A;  2ES7 A;  2LS5 A;  3HVN A;  1A23 A;  5ECQ B;  3O6T A;  4KND A;  4NAX A;  5AGY A;  3DKS A;  1GTU A;  2ZUP A;  3IR4 A;  2H30 A;  2OE3 A;  5A4W A;  5HQP A;  2E7P A;  3ZFB A;  4XRD A;  3BBY A;  3ZFL A;  4MMM A;  13GS A;  1IYI A;  1N8J A;  4V2M A;  5AN1 A;  2I3Y A;  4ULX A;  5DJM A;  1SK0 A;  4LA1 A;  3HYP A;  4PTS A;  5BMU A;  4WXT A;  2LRT A;  1MD3 A;  5EY6 A;  3TKS A;  1FO5 A;  3NZN A;  3HHV A;  4KA0 A;  5ELA A;  4Z7X A;  2DSA A;  3I9V 2;  3BD2 A;  3I6A A;  4FYU A;  1F3B A;  2ZNM A;  3ISO A;  2VLU A;  3IK7 A;  2PGT A;  4NWY A;  1W4V A;  3MAK A;  1ABA A;  3G7I A;  4MAB A;  2QKE A;  3NOF A;  1I9D A;  4LLR A;  3TRX A;  2P0G A;  2VIM A;  5DDL A;  11GS A;  3FHK A;  4K8M A;  4GST A;  4MP4 A;  5H5R A;  1AQV A;  4I6X A;  3ZIJ A;  4YH2 A;  1YEP A;  3VI7 A;  4JR4 A;  1M7T A;  1G6W A;  2GLR A;  2JSZ A;  3D0Z A;  2XBQ A;  1M0U A;  5E59 A;  3E0U A;  4WF5 A;  5HR3 A;  4G9H A;  2H6X A;  4ZIL A;  2C3N A;  4XS4 B;  1EOH A;  2V2G A;  2DJJ A;  3EE2 A;  5G30 A;  1HYU A;  2VCW A;  2Z9S A;  2A4V A;  3N9J A;  4NPB A;  1TW9 A;  2YN1 A;  3UJ1 A;  4LMW A;  1CQG A;  4TR1 B;  1THX A;  3QAV A;  2HRN A;  3CRU A;  2C0G A;  5F05 A;  5DAL A;  1X5E A;  2O7K A;  16GS A;  1GSU A;  1BG5 A;  1V40 A;  4LL4 B;  5F06 A;  1AAZ A;  3TDG A;  1WWJ A;  4HI7 A;  3GA4 A;  1O7U A;  1TXX A;  2R2J A;  3QAW A;  3FK8 A;  5DQS A;  2GQM A;  6GSW A;  5J5N A;  5G5E A;  3KP9 A;  1HNB A;  4F0C A;  3S9F A;  4PGT A;  3ERF A;  4K7N A;  1BJX A;  4CHS A;  1B8X A;  3D4T A;  3TKS C;  1M3J A;  2B3S A;  3MWH A;  1TU7 A;  4KE3 A;  4J56 E;  3L4N A;  1AIU A;  4POL A;  1I5G A;  2CVB A;  1X9S B;  2YCD A;  3TCO A;  3R2Q A;  4HZ2 A;  2LJK A;  2K9F A;  2OBK A;  3HD5 A;  4EIQ A;  4ML1 A;  3FZ4 A;  4PQI A;  9GSS A;  5A5K A;  5D96 A;  3IBH A;  1CQH A;  4ZB8 A;  3QDN A;  1G0T A;  3M1G A;  4HOJ A;  1NHO A;  2IL3 A;  3PR8 A;  1SL0 B;  3E3E A;  4RI7 A;  3G7J A;  2H74 A;  3DD3 A;  4ECB A;  2AJQ B;  1XXU A;  1SJ6 A;  1HD2 A;  2HXK A;  3ERG A;  4EO3 A;  4N30 A;  2CAI A;  1Z6N A;  4K7O A;  1GUK A;  1GLP A;  2DLX A;  2OA7 A;  1XOA A;  2VO4 A;  1RW1 A;  4KSM A;  1M2D A;  2DIY A;  5A4V A;  3MIX A;  2B5E A;  2G0F A;  4K5S A;  2IMI A;  3UBK A;  5LCZ A;  5ECR B;  2LNT A;  2IFQ B;  2A2S A;  5DAK B;  1GLQ A;  1OC9 B;  3VI5 A;  3Q74 A;  1EEM A;  2NVL A;  2WZ9 A;  3IE3 A;  2JSY A;  5G31 A;  5AIS A;  4Z2T A;  5ID2 B;  1YY7 A;  1FAA A;  4OFT A;  1EGO A;  2KOK A;  1O81 A;  1NW2 A;  4NXI A;  2TRX A;  3KIJ A;  3M8N A;  4PNF A;  2R3X A;  3ME8 A;  4MF6 A;  2CVD A;  4GRF A;  3LGC A;  5J9C A;  2K18 A;  2YWM A;  2FGX A;  2HRK A;  5J3R A;  1A0F A;  1A0R P;  3W6G A;  2GZP A;  4GQF A;  1WPI A;  1ZOF A;  2CAQ A;  2E0Q A;  2VL2 A;  1YDK A;  1NM3 A;  4KDU A;  4KCE A;  4KDY A;  3TOT A;  2HRA A;  1T4Y A;  4KDX A;  1V9W A;  5HR2 A;  4ILF A;  3IK9 A;  1PKW A;  3ZIV A;  4XS6 A;  2I4A A;  2DIZ A;  2IFQ A;  2NDO A;  4YKG A;  3LYP A;  4FO5 A;  1AUC A;  2YOI A;  3CQF A;  4CW9 A;  5KOW A;  4GCI A;  5DCH A;  2JZR A;  3APO A;  2JU5 A;  3Q18 A;  3J7Y k;  1SKR B;  1XWC A;  5G5F A;  1K0M A;  5ECI B;  1ZYE A;  1SKW B;  1G7O A;  2H0G A;  1OC8 A;  1A2J A;  3M9K A;  1F6M C;  4K0G A;  3UMA A;  3VPQ A;  1JLW A;  4HQS A;  5AIV A;  3DRN A;  1GUL A;  4GQC A;  1PX7 A;  2VCQ A;  1ML6 A;  5CO3 A;  1MEK A;  1FOH A;  2LQQ A;  2IWT A;  4ID0 A;  4MJB A;  4G0K A;  4IN0 A;  1JLV A;  2H1B A;  1Z7P A;  3GMF A;  5KOX A;  5GSS A;  1OVN A;  4I5Q A;  2C3Q A;  3Q6O A;  5IPG A;  1B9Y C;  3FMW A;  4MLY A;  1PN0 A;  2XPD A;  3KZQ A;  1RQM A;  3MYD A;  2OJL A;  1RK4 A;  2WB9 A;  4K2D A;  2IMF A;  3QAG A;  3C8E A;  5G1K A;  1TOF A;  4ZL7 A;  3EU3 A;  3VWX A;  4DSS A;  3VLN A;  4WEY A;  4I8B A;  4OMV A;  1Y25 A;  2CX3 A;  1EP8 A;  3KM6 A;  3F6F A;  3HCZ A;  5CNW A;  1Z3E A;  1UN2 A;  1TRU A;  2LKU A;  2XBI A;  4EKZ A;  4ECI A;  4AJ6 A;  1XOB A;  3VWU A;  4EF0 A;  1FOV A;  2OBI A;  2FHE A;  4XRA A;  4PQ1 A;  2VL2 C;  2BJX A;  4QL7 A;  2YAN A;  1FVK A;  1JHB A;  1O6J A;  3WD6 A;  4O92 A;  3ZL5 A;  5HFK A;  4N11 A;  5KN2 A;  1HQO A;  3F8U A;  4MPG A;  3GN3 A;  1WE0 A;  4IP6 A;  4J57 E;  2WFC A;  3ZLP A;  1GH2 A;  2OAD A;  4Z2U A;  1ZMA A;  2X99 A;  2MMZ A;  4QQ7 A;  3ZRE A;  1J9B A;  1MDJ A;  1VRS D;  1KBN A;  4TRX A;  1GSQ A;  3TJK A;  2HSH A;  1QFN A;  4KAE A;  4PQH A;  3FZ9 A;  4TVE A;  5CRH A;  3A5I A;  4USS A;  2QSI A;  3DXB A;  4GSN A;  4BPY A;  1ON4 A;  2YP6 A;  1DBY A;  5IO2 A;  3GUS A;  4FYB A;  3ERW A;  5IIZ A;  3TJJ A;  1R7H A;  1WRY A;  1GUM A;  3ZML A;  2GVP A;  3IRA A;  2NBS A;  4I2U A;  2YZU A;  2R4V A;  5JCW A;  3IXR A;  4WR5 A;  3LWA A;  3TJF A;  2B1L A;  5F8B A;  3GKK A;  3U6V A;  4F82 A;  3KTL A;  3DEX A;  4RQR A;  2H75 A;  3HDC A;  3CXG A;  4EE0 A;  1ZYP A;  4GSS A;  3SWL A;  2VAF A;  2M46 A;  1GSS A;  2PWJ A;  1SK2 A;  1AC1 A;  1XG8 A;  4CY6 A;  6GSS A;  1K0B A;  1AW9 A;  3TRP A;  1QMV A;  3LEF A;  4HUA A;  2H1G A;  1XPV A;  1M2A A;  3ZTL A;  2PER A;  4X43 A;  3H8Q A;  2WGR A;  2H66 A;  5BRT A;  3TUE A;  2HZE B;  4F03 A;  2JAD A;  5B7C A;  5D9X A;  1N2A A;  4BA7 A;  3HA9 A;  4HU7 A;  5J4U A;  4F0B A;  3EPT A;  1H4O A;  2YPM A;  3V1W A;  3TKQ A;  2VL3 A;  1PKZ A;  1SJI A;  1ZGN A;  4OCE A;  1XWK A;  4QL9 A;  4RUV A;  2H71 A;  3BCK A;  6GST A;  3CYN A;  3IHG A;  3F3R A;  1EZK A;  1ST9 A;  2RUE A;  3LW9 A;  1OC3 A;  5JWQ B;  3LXZ A;  2GQK A;  1YF0 A;  1GTI A;  2JL4 A;  1PX6 A;  1B4P A;  3KTB A;  20GS A;  5IMZ A;  4WBJ A;  5ECN B;  3VWW A;  1EV4 A;  2OE1 A;  4DSQ A;  5HR1 A;  2V6K A;  1FB0 A;  4D73 A;  3WGX A;  5IMV A;  3IV4 A;  5EVO A;  1C72 A;  3F4R A;  2KP2 A;  2EIR A;  2H0H A;  1A8Y A;  3ZVJ D;  2HZE A;  2AUV A;  3PGT A;  2L5L A;  2A2R A;  5DAL B;  1X5C A;  1SD8 A;  2FA4 A;  2R5G A;  5CYY A;  4Z2R A;  1U88 A;  3M3M A;  3W8S A;  4A5P A;  3RDW A;  4AJ8 A;  4IJ3 A;  4MJC A;  3DIE A;  2V6O A;  2PMT A;  3GUR A;  4TKY A;  2B7K A;  2IN3 A;  5IMC A;  2L4Q A;  1ZYN A;  5D73 A;  2WJU A;  3D4M A;  2WS2 A;  2GSR A;  1E2Y A;  1E6B A;  4ZBB A;  1LJR A;  1JZD A;  2WUL A;  2A4H A;  2X64 A;  5D9V A;  3HJO A;  2IJY A;  5HFG A;  3A2V A;  3R3E A;  2CV4 A;  5F07 A;  3AY8 A;  3GFK A;  3FW2 A;  5ECH B;  4OFN A;  1PQN A;  2IIY A;  2J9H A;  1JFU A;  2P5R A;  3PPU A;  5GAN D;  5DQY A;  3HZ8 A;  1Z6M A;  1BQ7 A;  3CTF A;  5D9W A;  4IP1 A;  2LUS A;  1FHE A;  4ECJ A;  3IC8 A;  1EP7 A;  2FUG 2;  3G9B A;  1AXD A;  2HFD A;  3QPM A;  1Z7R A;  1GSY A;  4IEL A;  1FB6 A;  3KD0 A;  5GAP D;  10GS A;  5FWG A;  4TR4 A;  5KN1 A;  2LST A;  1XFL A;  3IAM 2;  3N5O A;  4G2E A;  2F9S A;  4TR0 A;  4AF2 A;  1YQ1 A;  3QOU A;  4K0N A;  2VCZ A;  4BVY B;  2AB6 A;  4PXO A;  5G1L A;  3C73 A;  4PUF C;  5B8A A;  4TR3 A;  4KF9 A;  1BAY A;  4J2F A;  2PBJ A;  5LD0 A;  4BWQ A;  3FR6 A;  4HSC X;  1GTB A;  5B6M A;  3GST A;  2R0C A;  3GX8 A;  5JWO B;  4MK3 A;  1PMT A;  1S3C A;  3KH7 A;  3NIV A;  2P5Q A;  3GL3 A;  5DJL A;  1Z5Y E;  3KP8 A;  3I43 A;  2WCI A;  5FHI A;  2H19 A;  3W8J A;  2YV9 A;  2IPA A;  2C4J A;  2O85 A;  5IMD A;  1SL1 B;  4EC0 A;  4XTS A;  3QR6 A;  4L8E A;  3FKF A;  5HFI A;  4KGI A;  2K6V A;  5JWR B;  2GS3 A;  4MF7 A;  4E8H A;  5HR0 A;  1PD2 1;  4BVY A;  1DSB A;  1GNW A;  5COH A;  4EVM A;  4ZBD A;  3BOA A;  1TU8 A;  4EDZ A;  4ZBA A;  1EV9 A;  2A2P A;  4MDC A;  2PN8 A;  1MD4 A;  1OYJ A;  3IAS 2;  1T3B A;  2RUF A;  1YF1 A;  5D93 A;  3ZZX A;  3VPT A;  3CSJ A;  2N5B A;  4PUA A;  2VCT A;  4OCF A;  3UVT A;  1B4Q A;  2ALB A;  4FIW A;  4KX4 A;  3PH9 A;  1UVZ A;  4K7I A;  3RAZ A;  3TB2 A;  1VF3 A;  2DMM A;  4MZC A;  4GWR A;  5CRE A;  1ZL9 A;  5INY A;  4WF4 A;  3P2A A;  3HVS A;  5CRD A;  3A3T A;  4CY8 A;  3OR5 A;  2B1K A;  2X49 A;  2QGV A;  3QFA C;  4GTU A;  3P7X A;  2PVO C;  1UC7 A;  2GGT A;  3F4S A;  2C0D A;  4POK A;  2L6D A;  2V41 A;  2CT6 A;  4G10 A;  3VFI A;  4ML6 A;  4YQV A;  1F9M A;  1B9X C;  2GQL A;  7GSS A;  2EIQ A;  3GL5 A;  3L9U A;  4IQ1 A;  4JBB A;  2DKI A;  3CSH A;  1F37 A;  2CA8 A;  1Q98 A;  3RBT A;  1GUH A;  3UAP A;  2HLS A;  1K0D A;  4MPF A;  3EWL A;  1PL1 A;  1K3O A;  2VD0 A;  4MA9 A;  3F3Q A;  2H6Z A;  2C1Y A;  4HZ4 A;  5KN3 A;  1SJZ A;  1TJD A;  4DSS B;  2FWH A;  2GZZ A;  2B6M A;  3EU4 A;  4BL7 A;  3BCI A;  3LOR A;  3TJG A;  2E2M A;  5L71 A;  3EMX A;  4N10 A;  3WT2 A;  5ELG A;  4OD7 A;  4L5O A;  2XC2 A;  2J23 A;  1EOG A;  1K3L A;  3KMO A;  3CTG A;  2K8V A;  1KTE A;  2FY6 A;  1THO A;  17GS A;  4EIP A;  5A4U A;  3EVI A;  5FT3 A;  3UVH A;  2L6C A;  1T7P B;  1GL8 A;  3A5W A;  4WBR D;  2H1D A;  4ZXG A;  2VM2 A;  1WMJ A;  1XWA A;  4NV5 A;  2VLT A;  3EIN A;  1T4Z A;  1XVQ A;  1QUW A;  1OKT A;  1TDI A;  2F8F A;  1FW1 A;  3DYR A;  4MZB A;  1PRX A;  2RII A;  1F2E A;  3HJP A;  3GRX A;  5H5S A;  3GX0 A;  1ERV A;  3F0I A;  4XIH A;  2I1U A;  4LL1 B;  1XVW A;  1M9A A;  2FA8 A;  4G0L A;  3ZMK A;  1JZO A;  3UAR A;  1SU9 A;  4N0V A;  4HEA 2;  1LU4 A;  4KSO A;  1DE1 A;  2KUC A;  1USB A;  3O76 A;  3QD9 A;  3A2X A;  18GS A;  5ABR A;  3GV1 A;  1V2A A;  4WET A;  1V58 A;  3EUR A;  2DJ1 A;  2LJR A;  2B5Y A;  3RPP A;  3JCM L;  2GT5 A;  4YKF A;  2HZF A;  3GSS A;  1TP9 A;  4EL1 A;  1G6Y A;  1T1V A;  1S3R A;  2VM1 A;  2LV3 A;  3BJ5 A;  1R4W A;  2AV4 A;  4KW6 A;  2R0P A;  1HNC A;  3IDV A;  2MMO A;  4V1A g;  5C00 A;  1K0O A;  1XW5 A;  4BVX A;  2TRC P;  3FY7 A;  1XW9 A;  2ON5 A;  1GWC A;  2TIR A;  4YQM A;  3WGE A;  1F3A A;  4X1U A;  1GSF A;  3IHQ A;  1B48 A;  4IW9 A;  3MSZ A;  2H72 A;  4OO5 A;  4XHM A;  3J7Y b;  2M72 A;  5ECL B;  2IMD A;  3IC4 A;  2HSY A;  1A2L A;  1OKD A;  4PUR A;  1AQX A;  1ERW A;  4JRR A;  4DSR A;  5KEJ A;  1O8W A;  3C1R A;  3GNJ A;  3H4K A;  5DCG A;  4YQU A;  3M0F A;  1X9M B;  4WR4 A;  1A8L A;  1ACV A;  1IYH A;  4HQZ A;  4D73 B;  5CRW A;  2M80 A;  4ECC A;  1TI1 A;  2K8S A;  5IO0 A;  4EDY A;  4NV2 A;  1M2B A;  2OKA A;  3RPN A;  8GSS A;  4ISD A;  4F2I A;  3WGD A;  3HVV A;  1TI3 A;  2HYX A;  4YAP A;  1PGT A;  2X8G A;  4AJ7 A;  3HKR A;  1R5P A;  1S3D A;  1YZX A;  2H01 A;  3LYK A;  2ON7 A;  3D5J A;  1O8X A;  3FR9 A;  4O5Q A;  1TK5 B;  3FYG A;  3HY2 A;  1R5A A;  1ZCP A;  5ENU A;  2MMA A;  3LJR A;  2FD3 A;  4P3Y B;  4IVF A;  3F63 A;  4POB A;  3C7M A;  2LRN A;  3KMN A;  2YNX A;  1Y6E A;  5B6N A;  4MJA A;  1TK8 B;  3A2W A;  5GZZ B;  3D21 A;  1FVJ A;  3KEB A;  2GSQ A;  3H93 A;  3D6I A;  3GTU A;  1T00 A;  3G7Y A;  1U6T A;  4Q5R A;  4L5L A;  3TKP A;  5JCU A;  4YAV A;  1TK0 B;  1XW6 A;  2VD1 A;  3GKM A;  2BTO T;  4MH3 A;  4KB3 A;  4NMU A;  5IQY A;  3TRQ A;  3UBL A;  1XWB A;  1YEX A;  3GH9 A;  4AGS A;  1XZO A;  2JZS A;  4ZL9 A;  3CBU A;  2GZY A;  1U3I A;  4RQX A;  4JE1 A;  3IA1 A;  22GS A;  1MDK A;  1XWG A;  1BED A;  3QFB C;  4DVC A;  2YJH A;  1PSQ A;  4IQA A;  2XPE A;  3UL3 A;  2HT9 A;  2R6K A;  3EMP A;  1SYR A;  1MDI A;  3TJB A;  3ED3 A;  1ILO A;  2N5A A;  3LG6 A;  2XHF A;  1WOU A;  2FWE A;  2YJ7 A;  2L57 A;  1A24 A;  2IMK A;  2FNO A;  1ZZY A;  1PFO A;  4DEJ A;  3APS A;  3Q19 A;  1XCC A;  1S3A A;  3VK9 A;  19GS A;  1KEB A;  2VUP A;  4MZW A;  1TRS A;  1EGR A;  4ACS A;  4Q5Q A;  3P8W A;  5ECM B;  1JZW A;  2X8H A;  4HDE A;  4HS1 A;  3IOS A;  3GIX A;  2LQO A;  1YJ6 A;  5KN0 A;  3KGK A;  4N0Z A;  2OE0 A;  4H86 A;  4O7H A;  1J0F A;  1XBS A;  3F6D A;  2EIO A;  2LTK A;  3MNG A;  2HE3 A;  3DGQ A;  2MMN A;  1WIK A;  2KHP A;  1ERT A;  1URM A;  2ZCT A;  2UZ8 A;  4KCA A;  3FZ5 A;  4HJ2 A;  2WRT A;  5D9T A;  2X4A A;  3TKR A;  1J08 A;  3RHB A;  4HU9 A;  4HJM A;  3M9J A;  2HNL A;  2C80 A;  2PU9 C;  2DML A;  4TXO B;  2RLI A;  4XS4 A;  1BYE A;  2HRF A;  6GSX A;  1R26 A;  2KP1 A;  1VF2 A;  3VWV A;  3RHC A;  1TRW A;  4L0U A;  5EPF A;  3C71 A;  1FG4 A;  5C04 A;  3KCM A;  2QC7 A;  2L59 A;  1V98 A;  2L4C A;  4O5U A;  1DE2 A;  4TR1 A;  1WP0 A;  6GSY A;  2CX4 A;  2YWN A;  5CP1 A;  4V2N A;  1TTZ A;  5H5Q A;  12GS A;  2JAC A;  4K9Z A;  2DC5 A;  1SK1 A;  2GDR A;  2OAC A;  2LRC A;  2BMX A;  4JED A;  3WYW A;  1A2M A;  2YV7 A;  3ZRD A;  3C1S A;  4LMV A;  4ICY A;  3WT1 A;  5GST A;  4O32 A;  5B8B A;  2IME A;  1KNG A;  1OE7 A;  3FRC A;  2LJA A;  2F3M A;  4F9Z A;  4GXZ A;  2C0F A;  4TXO A;  1TRV A;  4JU5 A;  3TGZ A;  3HJM A;  2REM A;  2I9H A;  2PPT A;  1SEN A;  1Z9H A;  4IBP A;  1YKC A;  2MBS A;  3TOU A;  2DBC A;  2NPB A;  5J9B A;  5IM9 A;  2AAW A;  4FQU A;  3KXO A;  2YWO A;  1OE8 A;  1GTA A;  4FYC A;  3HZ4 A;  3FZA A;  3QCP A;  1ERU A;  3VUR A;  4O5R A;  2CVK A;  3KJY A;  2DJ0 A;  1VF4 A;  3KH9 A;  3GHA A;  3UEM A;  4BL7 B;  2X8C A;  2NTO A;  1HNA A;  1X0R A;  2MYG A;  3P90 A;  1QK8 A;  4G0I A;  1LBK A;  5IMA A;  3TKS E;  1WJK A;  1GRX A;  2E2G A;  3DML A;  4JZQ A;  5IOW A;  2WDU A;  2CQ9 A;  2VOC A;  3L78 A;  1QQ2 A;  1U3A A;  4MJE A;  2HI7 A;  4IHU A;  5CRG A;  2LEG A;  2RM6 A;  4X0X A;  1EWX A;  4ZB9 A;  1V57 A;  1NHY A;  1QXH A;  2GTU A;  1X9W B;  2R0G A;  2F8A A;  2H70 A;  3ZVJ A;  1AQW A;  4K6X A;  5G2Z A;  2I81 A;  2FWG A;  3LXT A;  3D22 A;  2V1M A;  2VLV A;  3FR3 A;  3MDK A;  3ZIT A;  4NHW A;  1MTC A;  5EL8 A;  4WKW A;  2LNS A;  2P31 A;  2RM5 A;  4IKH A;  4TXV A;  1K0C A;  5DAK A;  2O89 A;  5J41 A;  3PIN A;  1OC9 A;  4NHZ A;  2MZC A;  2H73 A;  1M9B A;  1GSD A;  4OWY A;  4POM A;  2DJ2 A;  5CAX A;  3HXS A;  5ECP B;  1SD9 A;  4KUN A;  4IS0 A;  2GST A;  1BX9 A;  4MF5 A;  5ID2 A;  4CDO A;  4Q5F A;  1K0N A;  2EC4 A;  2YWI A;  1SYX A;  4EUY A;  4EXJ A;  3HVX A;  3L0H A;  1SKS B;  3GKN A;  1K0A A;  1GNE A;  1UA5 A;  5JCG A;  1JZR A;  4ZB6 A;  2R37 A;  2AHE A;  2L5O A;  4ZIJ A;  4I2T A;  4IJI A;  3DWV A;  3APQ A;  1Q4J A;  2B7J A;  1M3I A;  2FCH A;  4XS1 A;  3US3 A;  1VF1 A;  2VCX A;  1GP1 A;  3CSI A;  1K3Y A;  2GT6 A;  4FH8 A;  4TOP A;  4KH7 A;  2N5F A;  2QA2 A;  2H1A A;  4BIK A;  4V1A p;  4BVX B;  1TKD B;  2H8L A;  1SL2 B;  1YKA A;  4I97 A;  3DVW A;  5IPH A;  2D2Z A;  4IGJ A;  5F0G A;  2V32 A;  3F9U A;  1T8E B;  4PX1 A;  2VCV A;  5ECS A;  3LSZ A;  5IOX A;  14GS A;  5DVB A;  3GKX A;  5ECK B;  4GF0 A;  3EYT A;  3E9J B;  4Q5N A;  1H75 A;  1DUG A;  3LFL A;  4L0W A;  2H6Y A;  3ZYW A;  6GSV A;  4OO4 A;  3DVX A;  3QMX A;  3GH6 A;  5ECO B;  1PN9 A;  4MH2 A;  4X4J A;  5LNK e;  3H79 A;  1OAZ A;  2FLS A;  2PVQ A;  2QA1 A;  2VL9 A;  4K1F A;  2H0I A;  1M99 A;  1XIY A;  4BWS A;  4RI6 A;  4PNG A;  3K8N A;  3SBC A;  1VGL A;  6GSU A;  1X5D A;  3CRT A; 
#chains in the Genus database with same CATH homology
 2DKH A;  3I69 A;  2YZH A;  1EEJ A;  1W89 A;  3O3T A;  4MNN A;  2F51 A;  5E4W A;  1ZYQ B;  3UOM A;  2C8U A;  2C0E A;  1U87 A;  4ZL8 A;  2C3T A;  4MCU A;  3F4T A;  2HSM A;  1G7E A;  1O73 A;  2G2Q A;  3UIW A;  2H76 A;  1GSE A;  4K5R A;  3CMI A;  2JZT A;  1QGV A;  4JR6 A;  2B5X A;  2DJ3 A;  2CZ2 A;  3FEU A;  3GTU B;  3U5R E;  3LQ7 A;  2O87 A;  3EC3 A;  5IMF A;  3L9V A;  3GYK A;  4V2L A;  4E8E A;  2CZ3 A;  3L9S A;  3H1N A;  2KLX A;  2AYT A;  1NSW A;  2DJK A;  2O8V B;  2GSS A;  4GLT A;  3IPZ A;  4XCS A;  2PUK C;  2FWF A;  5D8I A;  3ME7 A;  4K2X A;  4TN8 A;  4OFM A;  2MBT A;  1PA3 A;  5DBQ A;  4TW5 A;  1O85 A;  4G19 A;  5AIX A;  1PL2 A;  2ES7 A;  2LS5 A;  1A23 A;  5ECQ B;  3O6T A;  4KND A;  4NAX A;  5AGY A;  3DKS A;  1GTU A;  2ZUP A;  3IR4 A;  2H30 A;  2OE3 A;  5A4W A;  5HQP A;  2E7P A;  3ZFB A;  4XRD A;  3BBY A;  3ZFL A;  4MMM A;  13GS A;  1IYI A;  1N8J A;  4V2M A;  5AN1 A;  2I3Y A;  4ULX A;  5DJM A;  1SK0 A;  4LA1 A;  3HYP A;  4PTS A;  5BMU A;  4WXT A;  2LRT A;  1MD3 A;  5EY6 A;  3TKS A;  1FO5 A;  3NZN A;  3HHV A;  4KA0 A;  5ELA A;  4Z7X A;  2DSA A;  3I9V 2;  3BD2 A;  3I6A A;  4FYU A;  1F3B A;  2ZNM A;  3ISO A;  2VLU A;  3IK7 A;  2PGT A;  4NWY A;  1W4V A;  3MAK A;  1ABA A;  3G7I A;  4MAB A;  2QKE A;  3NOF A;  1I9D A;  4LLR A;  3TRX A;  2P0G A;  2VIM A;  5DDL A;  11GS A;  3FHK A;  4K8M A;  4GST A;  4MP4 A;  5H5R A;  1AQV A;  4I6X A;  3ZIJ A;  4YH2 A;  1YEP A;  3VI7 A;  4JR4 A;  1M7T A;  1G6W A;  2GLR A;  2JSZ A;  3D0Z A;  2XBQ A;  1M0U A;  5E59 A;  3E0U A;  4WF5 A;  5HR3 A;  4G9H A;  2H6X A;  4ZIL A;  2C3N A;  4XS4 B;  1EOH A;  2V2G A;  2DJJ A;  3EE2 A;  5G30 A;  1HYU A;  2VCW A;  2Z9S A;  2A4V A;  3N9J A;  4NPB A;  1TW9 A;  2YN1 A;  3UJ1 A;  4LMW A;  1CQG A;  4TR1 B;  1THX A;  3QAV A;  2HRN A;  3CRU A;  2C0G A;  5F05 A;  5DAL A;  1X5E A;  2O7K A;  16GS A;  1GSU A;  1BG5 A;  1V40 A;  4LL4 B;  5F06 A;  1AAZ A;  3TDG A;  1WWJ A;  4HI7 A;  3GA4 A;  1O7U A;  1TXX A;  2R2J A;  3QAW A;  3FK8 A;  5DQS A;  2GQM A;  6GSW A;  5J5N A;  5G5E A;  3KP9 A;  1HNB A;  4F0C A;  3S9F A;  4PGT A;  3ERF A;  4K7N A;  1BJX A;  4CHS A;  1B8X A;  3D4T A;  3TKS C;  2B3S A;  3MWH A;  1TU7 A;  4KE3 A;  4J56 E;  3L4N A;  1AIU A;  4POL A;  1I5G A;  2CVB A;  1X9S B;  2YCD A;  3TCO A;  3R2Q A;  4HZ2 A;  2LJK A;  2K9F A;  2OBK A;  3HD5 A;  4EIQ A;  4ML1 A;  3FZ4 A;  4PQI A;  9GSS A;  5A5K A;  5D96 A;  3IBH A;  1CQH A;  4ZB8 A;  3QDN A;  1G0T A;  3M1G A;  4HOJ A;  1NHO A;  2IL3 A;  3PR8 A;  1SL0 B;  3E3E A;  4RI7 A;  3G7J A;  2H74 A;  3DD3 A;  4ECB A;  2AJQ B;  1XXU A;  1SJ6 A;  1HD2 A;  2HXK A;  3ERG A;  4EO3 A;  4N30 A;  2CAI A;  1Z6N A;  4K7O A;  1GUK A;  1GLP A;  2DLX A;  2OA7 A;  1XOA A;  2VO4 A;  1RW1 A;  4KSM A;  1M2D A;  2DIY A;  5A4V A;  3MIX A;  2B5E A;  2G0F A;  4K5S A;  2IMI A;  3UBK A;  5LCZ A;  5ECR B;  2LNT A;  2IFQ B;  2A2S A;  5DAK B;  1GLQ A;  1OC9 B;  3VI5 A;  3Q74 A;  1EEM A;  2NVL A;  2WZ9 A;  3IE3 A;  2JSY A;  5G31 A;  5AIS A;  4Z2T A;  5ID2 B;  1YY7 A;  1FAA A;  4OFT A;  1EGO A;  2KOK A;  1O81 A;  1NW2 A;  4NXI A;  2TRX A;  3KIJ A;  3M8N A;  4PNF A;  2R3X A;  3ME8 A;  4MF6 A;  2CVD A;  4GRF A;  3LGC A;  5J9C A;  2K18 A;  2YWM A;  2FGX A;  2HRK A;  5J3R A;  1A0F A;  1A0R P;  3W6G A;  2GZP A;  4GQF A;  1WPI A;  1ZOF A;  2CAQ A;  2E0Q A;  2VL2 A;  1YDK A;  1NM3 A;  4KDU A;  4KCE A;  4KDY A;  3TOT A;  2HRA A;  1T4Y A;  4KDX A;  1V9W A;  5HR2 A;  4ILF A;  3IK9 A;  1PKW A;  3ZIV A;  4XS6 A;  2I4A A;  2DIZ A;  2IFQ A;  2NDO A;  4YKG A;  3LYP A;  4FO5 A;  1AUC A;  2YOI A;  4CW9 A;  5KOW A;  4GCI A;  5DCH A;  2JZR A;  3APO A;  2JU5 A;  3Q18 A;  3J7Y k;  1SKR B;  1XWC A;  5G5F A;  1K0M A;  5ECI B;  1ZYE A;  1SKW B;  1G7O A;  2H0G A;  1OC8 A;  1A2J A;  3M9K A;  1F6M C;  4K0G A;  3UMA A;  3VPQ A;  1JLW A;  4HQS A;  5AIV A;  3DRN A;  1GUL A;  4GQC A;  1PX7 A;  2VCQ A;  1ML6 A;  5CO3 A;  1MEK A;  1FOH A;  2LQQ A;  2IWT A;  4ID0 A;  4MJB A;  4G0K A;  4IN0 A;  1JLV A;  2H1B A;  1Z7P A;  3GMF A;  5KOX A;  5GSS A;  1OVN A;  4I5Q A;  2C3Q A;  3Q6O A;  5IPG A;  1B9Y C;  3FMW A;  4MLY A;  1PN0 A;  2XPD A;  3KZQ A;  1RQM A;  3MYD A;  2OJL A;  1RK4 A;  2WB9 A;  4K2D A;  2IMF A;  3QAG A;  3C8E A;  5G1K A;  1TOF A;  4ZL7 A;  3EU3 A;  3VWX A;  4DSS A;  3VLN A;  4WEY A;  4I8B A;  4OMV A;  1Y25 A;  2CX3 A;  1EP8 A;  3KM6 A;  3F6F A;  3HCZ A;  5CNW A;  1Z3E A;  1UN2 A;  1TRU A;  2LKU A;  2XBI A;  4EKZ A;  4ECI A;  4AJ6 A;  1XOB A;  3VWU A;  4EF0 A;  1FOV A;  2OBI A;  2FHE A;  4XRA A;  4PQ1 A;  2VL2 C;  2BJX A;  4QL7 A;  2YAN A;  1FVK A;  1JHB A;  1O6J A;  3WD6 A;  4O92 A;  3ZL5 A;  5HFK A;  4N11 A;  5KN2 A;  1HQO A;  3F8U A;  4MPG A;  3GN3 A;  1WE0 A;  4IP6 A;  4J57 E;  2WFC A;  3ZLP A;  1GH2 A;  2OAD A;  4Z2U A;  1ZMA A;  2X99 A;  2MMZ A;  4QQ7 A;  3ZRE A;  1J9B A;  1MDJ A;  1VRS D;  1KBN A;  4TRX A;  1GSQ A;  3TJK A;  2HSH A;  1QFN A;  4KAE A;  4PQH A;  3FZ9 A;  4TVE A;  5CRH A;  3A5I A;  4USS A;  2QSI A;  3DXB A;  4GSN A;  4BPY A;  1ON4 A;  2YP6 A;  1DBY A;  5IO2 A;  3GUS A;  4FYB A;  3ERW A;  5IIZ A;  3TJJ A;  1R7H A;  1WRY A;  1GUM A;  3ZML A;  2GVP A;  3IRA A;  2NBS A;  4I2U A;  2YZU A;  2R4V A;  5JCW A;  3IXR A;  4WR5 A;  3LWA A;  3TJF A;  2B1L A;  5F8B A;  3GKK A;  3U6V A;  4F82 A;  3KTL A;  3DEX A;  4RQR A;  2H75 A;  3HDC A;  3CXG A;  4EE0 A;  1ZYP A;  4GSS A;  3SWL A;  2VAF A;  2M46 A;  1GSS A;  2PWJ A;  1SK2 A;  1AC1 A;  4CY6 A;  6GSS A;  1K0B A;  1AW9 A;  3TRP A;  1QMV A;  3LEF A;  4HUA A;  2H1G A;  1XPV A;  1M2A A;  3ZTL A;  2PER A;  4X43 A;  3H8Q A;  2WGR A;  2H66 A;  5BRT A;  3TUE A;  2HZE B;  4F03 A;  2JAD A;  5B7C A;  5D9X A;  1N2A A;  4BA7 A;  3HA9 A;  4HU7 A;  5J4U A;  4F0B A;  3EPT A;  1H4O A;  2YPM A;  3V1W A;  3TKQ A;  2VL3 A;  1PKZ A;  1SJI A;  1ZGN A;  4OCE A;  1XWK A;  4QL9 A;  4RUV A;  2H71 A;  3BCK A;  6GST A;  3CYN A;  3IHG A;  3F3R A;  1EZK A;  1ST9 A;  2RUE A;  3LW9 A;  1OC3 A;  5JWQ B;  3LXZ A;  2GQK A;  1YF0 A;  1GTI A;  2JL4 A;  1PX6 A;  1B4P A;  3KTB A;  20GS A;  5IMZ A;  4WBJ A;  5ECN B;  3VWW A;  1EV4 A;  2OE1 A;  4DSQ A;  5HR1 A;  2V6K A;  1FB0 A;  4D73 A;  3WGX A;  5IMV A;  3IV4 A;  5EVO A;  1C72 A;  3F4R A;  2KP2 A;  2EIR A;  2H0H A;  1A8Y A;  3ZVJ D;  2HZE A;  2AUV A;  3PGT A;  2L5L A;  2A2R A;  5DAL B;  1X5C A;  1SD8 A;  2FA4 A;  2R5G A;  5CYY A;  4Z2R A;  1U88 A;  3M3M A;  3W8S A;  4A5P A;  3RDW A;  4AJ8 A;  4IJ3 A;  4MJC A;  3DIE A;  2V6O A;  2PMT A;  3GUR A;  4TKY A;  2B7K A;  2IN3 A;  5IMC A;  2L4Q A;  1ZYN A;  5D73 A;  2WJU A;  3D4M A;  2WS2 A;  2GSR A;  1E2Y A;  1E6B A;  4ZBB A;  1LJR A;  1JZD A;  2WUL A;  2A4H A;  2X64 A;  5D9V A;  3HJO A;  2IJY A;  5HFG A;  3A2V A;  3R3E A;  2CV4 A;  5F07 A;  3AY8 A;  3GFK A;  3FW2 A;  5ECH B;  4OFN A;  1PQN A;  2IIY A;  2J9H A;  1JFU A;  2P5R A;  3PPU A;  5GAN D;  5DQY A;  3HZ8 A;  1Z6M A;  1BQ7 A;  3CTF A;  5D9W A;  4IP1 A;  2LUS A;  1FHE A;  4ECJ A;  3IC8 A;  1EP7 A;  2FUG 2;  3G9B A;  1AXD A;  2HFD A;  3QPM A;  1Z7R A;  1GSY A;  4IEL A;  1FB6 A;  3KD0 A;  5GAP D;  10GS A;  5FWG A;  4TR4 A;  5KN1 A;  2LST A;  1XFL A;  3IAM 2;  3N5O A;  4G2E A;  2F9S A;  4TR0 A;  4AF2 A;  1YQ1 A;  3QOU A;  4K0N A;  2VCZ A;  4BVY B;  2AB6 A;  4PXO A;  5G1L A;  3C73 A;  4PUF C;  5B8A A;  4TR3 A;  4KF9 A;  1BAY A;  4J2F A;  2PBJ A;  5LD0 A;  4BWQ A;  3FR6 A;  1GTB A;  5B6M A;  3GST A;  2R0C A;  3GX8 A;  5JWO B;  4MK3 A;  1PMT A;  1S3C A;  3KH7 A;  3NIV A;  2P5Q A;  3GL3 A;  5DJL A;  1Z5Y E;  3KP8 A;  3I43 A;  2WCI A;  5FHI A;  2H19 A;  3W8J A;  2YV9 A;  2IPA A;  2C4J A;  2O85 A;  5IMD A;  1SL1 B;  4EC0 A;  4XTS A;  3QR6 A;  4L8E A;  3FKF A;  5HFI A;  4KGI A;  2K6V A;  5JWR B;  2GS3 A;  4MF7 A;  4E8H A;  5HR0 A;  1PD2 1;  4BVY A;  1DSB A;  1GNW A;  5COH A;  4EVM A;  4ZBD A;  3BOA A;  1TU8 A;  4EDZ A;  4ZBA A;  1EV9 A;  2A2P A;  4MDC A;  2PN8 A;  1MD4 A;  1OYJ A;  3IAS 2;  1T3B A;  2RUF A;  1YF1 A;  5D93 A;  3ZZX A;  3VPT A;  3CSJ A;  2N5B A;  4PUA A;  2VCT A;  4OCF A;  3UVT A;  1B4Q A;  2ALB A;  4FIW A;  4KX4 A;  3PH9 A;  1UVZ A;  4K7I A;  3RAZ A;  3TB2 A;  1VF3 A;  2DMM A;  4MZC A;  4GWR A;  5CRE A;  1ZL9 A;  5INY A;  4WF4 A;  3P2A A;  3HVS A;  5CRD A;  3A3T A;  4CY8 A;  3OR5 A;  2B1K A;  2X49 A;  2QGV A;  3QFA C;  4GTU A;  3P7X A;  2PVO C;  1UC7 A;  2GGT A;  3F4S A;  2C0D A;  4POK A;  2L6D A;  2V41 A;  2CT6 A;  4G10 A;  3VFI A;  4ML6 A;  4YQV A;  1F9M A;  1B9X C;  2GQL A;  7GSS A;  2EIQ A;  3GL5 A;  3L9U A;  4IQ1 A;  4JBB A;  2DKI A;  3CSH A;  1F37 A;  2CA8 A;  1Q98 A;  3RBT A;  1GUH A;  3UAP A;  2HLS A;  1K0D A;  4MPF A;  3EWL A;  1PL1 A;  1K3O A;  2VD0 A;  4MA9 A;  3F3Q A;  2H6Z A;  2C1Y A;  4HZ4 A;  5KN3 A;  1SJZ A;  1TJD A;  4DSS B;  2FWH A;  2GZZ A;  2B6M A;  3EU4 A;  4BL7 A;  3BCI A;  3LOR A;  3TJG A;  2E2M A;  5L71 A;  3EMX A;  4N10 A;  3WT2 A;  5ELG A;  4OD7 A;  4L5O A;  2XC2 A;  2J23 A;  1EOG A;  1K3L A;  3KMO A;  3CTG A;  2K8V A;  1KTE A;  2FY6 A;  1THO A;  17GS A;  4EIP A;  5A4U A;  3EVI A;  5FT3 A;  3UVH A;  2L6C A;  1T7P B;  1GL8 A;  3A5W A;  4WBR D;  2H1D A;  4ZXG A;  2VM2 A;  1WMJ A;  1XWA A;  4NV5 A;  2VLT A;  3EIN A;  1T4Z A;  1XVQ A;  1QUW A;  1OKT A;  1TDI A;  2F8F A;  1FW1 A;  3DYR A;  4MZB A;  1PRX A;  2RII A;  1F2E A;  3HJP A;  3GRX A;  5H5S A;  3GX0 A;  1ERV A;  3F0I A;  4XIH A;  2I1U A;  4LL1 B;  1XVW A;  1M9A A;  2FA8 A;  4G0L A;  3ZMK A;  1JZO A;  3UAR A;  1SU9 A;  4N0V A;  4HEA 2;  1LU4 A;  4KSO A;  1DE1 A;  2KUC A;  1USB A;  3O76 A;  3QD9 A;  3A2X A;  18GS A;  5ABR A;  3GV1 A;  1V2A A;  4WET A;  1V58 A;  3EUR A;  2DJ1 A;  2LJR A;  2B5Y A;  3RPP A;  3JCM L;  2GT5 A;  4YKF A;  2HZF A;  3GSS A;  1TP9 A;  4EL1 A;  1G6Y A;  1T1V A;  2VM1 A;  2LV3 A;  3BJ5 A;  1R4W A;  2AV4 A;  4KW6 A;  2R0P A;  1HNC A;  3IDV A;  2MMO A;  4V1A g;  5C00 A;  1K0O A;  1XW5 A;  4BVX A;  2TRC P;  3FY7 A;  1XW9 A;  2ON5 A;  1GWC A;  2TIR A;  4YQM A;  3WGE A;  1F3A A;  4X1U A;  1GSF A;  3IHQ A;  1B48 A;  4IW9 A;  3MSZ A;  2H72 A;  4OO5 A;  4XHM A;  3J7Y b;  2M72 A;  5ECL B;  2IMD A;  3IC4 A;  2HSY A;  1A2L A;  1OKD A;  4PUR A;  1AQX A;  1ERW A;  4JRR A;  4DSR A;  5KEJ A;  1O8W A;  3C1R A;  3GNJ A;  3H4K A;  5DCG A;  4YQU A;  3M0F A;  1X9M B;  4WR4 A;  1A8L A;  1ACV A;  1IYH A;  4HQZ A;  4D73 B;  5CRW A;  2M80 A;  4ECC A;  1TI1 A;  2K8S A;  5IO0 A;  4EDY A;  4NV2 A;  1M2B A;  2OKA A;  3RPN A;  8GSS A;  4ISD A;  4F2I A;  3WGD A;  3HVV A;  1TI3 A;  2HYX A;  4YAP A;  1PGT A;  2X8G A;  4AJ7 A;  3HKR A;  1R5P A;  1S3D A;  1YZX A;  2H01 A;  3LYK A;  2ON7 A;  3D5J A;  1O8X A;  3FR9 A;  4O5Q A;  1TK5 B;  3FYG A;  3HY2 A;  1R5A A;  1ZCP A;  5ENU A;  2MMA A;  3LJR A;  2FD3 A;  4P3Y B;  4IVF A;  3F63 A;  4POB A;  3C7M A;  2LRN A;  3KMN A;  2YNX A;  1Y6E A;  5B6N A;  4MJA A;  1TK8 B;  3A2W A;  5GZZ B;  3D21 A;  1FVJ A;  3KEB A;  2GSQ A;  3H93 A;  3D6I A;  3GTU A;  1T00 A;  3G7Y A;  1U6T A;  4Q5R A;  4L5L A;  3TKP A;  5JCU A;  4YAV A;  1TK0 B;  1XW6 A;  2VD1 A;  3GKM A;  2BTO T;  4MH3 A;  4KB3 A;  4NMU A;  5IQY A;  3TRQ A;  3UBL A;  1XWB A;  1YEX A;  3GH9 A;  4AGS A;  1XZO A;  2JZS A;  4ZL9 A;  3CBU A;  2GZY A;  1U3I A;  4RQX A;  4JE1 A;  3IA1 A;  22GS A;  1MDK A;  1XWG A;  1BED A;  3QFB C;  4DVC A;  2YJH A;  1PSQ A;  4IQA A;  2XPE A;  3UL3 A;  2HT9 A;  2R6K A;  3EMP A;  1SYR A;  1MDI A;  3TJB A;  3ED3 A;  1ILO A;  2N5A A;  3LG6 A;  2XHF A;  1WOU A;  2FWE A;  2YJ7 A;  2L57 A;  1A24 A;  2IMK A;  2FNO A;  1ZZY A;  4DEJ A;  3APS A;  3Q19 A;  1XCC A;  1S3A A;  3VK9 A;  19GS A;  1KEB A;  2VUP A;  4MZW A;  1TRS A;  1EGR A;  4ACS A;  4Q5Q A;  3P8W A;  5ECM B;  1JZW A;  2X8H A;  4HDE A;  4HS1 A;  3IOS A;  3GIX A;  2LQO A;  1YJ6 A;  5KN0 A;  3KGK A;  4N0Z A;  2OE0 A;  4H86 A;  4O7H A;  1J0F A;  1XBS A;  3F6D A;  2EIO A;  2LTK A;  3MNG A;  2HE3 A;  3DGQ A;  2MMN A;  1WIK A;  2KHP A;  1ERT A;  1URM A;  2ZCT A;  2UZ8 A;  4KCA A;  3FZ5 A;  4HJ2 A;  2WRT A;  5D9T A;  2X4A A;  3TKR A;  1J08 A;  3RHB A;  4HU9 A;  4HJM A;  3M9J A;  2HNL A;  2C80 A;  2PU9 C;  2DML A;  4TXO B;  2RLI A;  4XS4 A;  1BYE A;  2HRF A;  6GSX A;  1R26 A;  2KP1 A;  1VF2 A;  3VWV A;  3RHC A;  1TRW A;  4L0U A;  5EPF A;  3C71 A;  1FG4 A;  5C04 A;  3KCM A;  2QC7 A;  2L59 A;  1V98 A;  2L4C A;  4O5U A;  1DE2 A;  4TR1 A;  1WP0 A;  6GSY A;  2CX4 A;  2YWN A;  5CP1 A;  4V2N A;  1TTZ A;  5H5Q A;  12GS A;  2JAC A;  4K9Z A;  2DC5 A;  1SK1 A;  2GDR A;  2OAC A;  2LRC A;  2BMX A;  4JED A;  3WYW A;  1A2M A;  2YV7 A;  3ZRD A;  3C1S A;  4LMV A;  4ICY A;  3WT1 A;  5GST A;  4O32 A;  5B8B A;  2IME A;  1KNG A;  1OE7 A;  3FRC A;  2LJA A;  2F3M A;  4F9Z A;  4GXZ A;  2C0F A;  4TXO A;  1TRV A;  4JU5 A;  3TGZ A;  3HJM A;  2REM A;  2I9H A;  2PPT A;  1SEN A;  1Z9H A;  4IBP A;  1YKC A;  2MBS A;  3TOU A;  2DBC A;  2NPB A;  5J9B A;  5IM9 A;  2AAW A;  4FQU A;  3KXO A;  2YWO A;  1OE8 A;  1GTA A;  4FYC A;  3HZ4 A;  3FZA A;  3QCP A;  1ERU A;  3VUR A;  4O5R A;  2CVK A;  3KJY A;  2DJ0 A;  1VF4 A;  3KH9 A;  3GHA A;  3UEM A;  4BL7 B;  2X8C A;  2NTO A;  1HNA A;  1X0R A;  2MYG A;  3P90 A;  1QK8 A;  4G0I A;  1LBK A;  5IMA A;  3TKS E;  1WJK A;  1GRX A;  2E2G A;  3DML A;  4JZQ A;  5IOW A;  2WDU A;  2CQ9 A;  2VOC A;  3L78 A;  1QQ2 A;  1U3A A;  4MJE A;  2HI7 A;  4IHU A;  5CRG A;  2LEG A;  2RM6 A;  4X0X A;  1EWX A;  4ZB9 A;  1V57 A;  1NHY A;  1QXH A;  2GTU A;  1X9W B;  2R0G A;  2F8A A;  2H70 A;  3ZVJ A;  1AQW A;  4K6X A;  5G2Z A;  2I81 A;  2FWG A;  3LXT A;  3D22 A;  2V1M A;  2VLV A;  3FR3 A;  3MDK A;  3ZIT A;  4NHW A;  1MTC A;  5EL8 A;  4WKW A;  2LNS A;  2P31 A;  2RM5 A;  4IKH A;  4TXV A;  1K0C A;  5DAK A;  2O89 A;  5J41 A;  3PIN A;  1OC9 A;  4NHZ A;  2MZC A;  2H73 A;  1M9B A;  1GSD A;  4OWY A;  4POM A;  2DJ2 A;  5CAX A;  3HXS A;  5ECP B;  1SD9 A;  4KUN A;  4IS0 A;  2GST A;  1BX9 A;  4MF5 A;  5ID2 A;  4CDO A;  4Q5F A;  1K0N A;  2EC4 A;  2YWI A;  1SYX A;  4EUY A;  4EXJ A;  3HVX A;  3L0H A;  1SKS B;  3GKN A;  1K0A A;  1GNE A;  1UA5 A;  5JCG A;  1JZR A;  4ZB6 A;  2R37 A;  2AHE A;  2L5O A;  4ZIJ A;  4I2T A;  4IJI A;  3DWV A;  3APQ A;  1Q4J A;  2B7J A;  4XS1 A;  2FCH A;  3US3 A;  1VF1 A;  2VCX A;  1GP1 A;  3CSI A;  1K3Y A;  2GT6 A;  4FH8 A;  4TOP A;  4KH7 A;  2N5F A;  2QA2 A;  2H1A A;  4V1A p;  4BVX B;  1TKD B;  2H8L A;  1SL2 B;  1YKA A;  4I97 A;  3DVW A;  5IPH A;  2D2Z A;  4IGJ A;  5F0G A;  2V32 A;  3F9U A;  1T8E B;  4PX1 A;  2VCV A;  5ECS A;  3LSZ A;  5IOX A;  14GS A;  5DVB A;  3GKX A;  5ECK B;  4GF0 A;  3EYT A;  3E9J B;  4Q5N A;  1H75 A;  1DUG A;  3LFL A;  4L0W A;  2H6Y A;  3ZYW A;  6GSV A;  4OO4 A;  3DVX A;  3QMX A;  3GH6 A;  5ECO B;  1PN9 A;  4MH2 A;  4X4J A;  5LNK e;  3H79 A;  1OAZ A;  2FLS A;  2PVQ A;  2QA1 A;  2VL9 A;  4K1F A;  2H0I A;  1M99 A;  1XIY A;  4BWS A;  4RI6 A;  4PNG A;  3K8N A;  3SBC A;  1VGL A;  6GSU A;  1X5D A;  3CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...