3M9UA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
300
structure length
288
Chain Sequence
SLINARLIAFEDQWVPALNAPLKQAILADSQDAQLAAAMTYSVLAGGKRLRPLLTVATMQSLGVTFVPERHWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAGDGLLTLAFQWLTATDLPATMQAALVQALATAAGPSGMVAGQAKDIQSEHVNLPLSQLRVLHKEKTGALLHYAVQAGLILGQAPEAQWPAYLQFADAFGLAFQIYDDILDVVSSDEAKNTYPGKLGLIGANQALIDTIHSGQAALQGLPTSTQRDDLAAFFSYFDTERVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl-diphosphate synthase
publication title Crystal Structure of Geranylgeranyl Pyrophosphate Synthase from Lactobacillus Brevis Atcc 367
rcsb
source organism Lactobacillus brevis
molecule tags Transferase
total genus 110
structure length 288
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3m9uA00
3S4JA 2J5CA 2Q9YA 4PVXF 1WL0A 4GAXA 3ACXA 4F6VA 3CC9A 4NG6A 4WK5A 3WCLA 5IKHA 3SDRA 4KPDA 3Q2ZA 3LDWA 4JVJF 2E93A 3ACYA 2OPMA 2ZCSA 3KRAB 5ERNA 1V4IA 1N1BA 4DI5A 4KVWA 1YHKA 3WJKA 1RQJA 2F8ZF 2AEKA 3LJIA 3PDEA 2Z4WA 3KRCA 2Q9ZA 3LGZB 1VG2A 3ZOUA 3WE9A 4E9ZA 4XQTF 5JV0F 3Q2QA 4KFAA 3APZA 3WEFA 2VF6A 3VJ8A 1VG7A 3S9VA 3MAVA 5DIQF 3V1VA 2E8VA 2OA6A 3KB9A 4KPJA 3OACB 1N23A 3WCCA 2Z52A 3ICKA 2E94A 2F7MF 2J1PA 3OABA 4L2XF 5A0JA 2Z4YA 3LEEA 5AHUB 5DGMF 4UMJA 3LK5A 3V66A 1YYSA 4LTVA 1YYUA 5EASA 3TC1A 1WKZA 4H5EF 3N45F 4RXEA 4QPFA 1WL1A 3EZ3A 3N0FA 1WL2A 5JUZF 1V4KA 4JYXA 4LFEA 4NKFA 4E9UA 3WCHA 5ILYA 3ICNA 3RYEA 2I19A 4KUXA 5IL3A 2ONHA 2Z7HA 2F9KF 3LMDA 4KVYA 3AE0A 3TS7A 4JZXA 4PVYF 4KK2A 5DGSF 2O1OA 4NFIF 4GP2A 4MC3A 4KWDA 5CG5A 2ZY1A 2RAHA 5A0KA 4KQUA 3KRFA 2F94F 2ZEUA 4KQSA 3B7LA 2PS4A 3DYHA 2E8XA 1RQIA 4HD1A 4LZ3A 4P0XA 3VJ9A 3ZCDA 4OKZA 1VG4A 1UBWA 1PS1A 3N1VF 2E92A 1RTRA 3Q1OA 3QQVA 5ER8A 1UBVA 4RXCA 2ONGA 2E8WA 3VJBA 5DJRF 4ZQ8A 1WL3A 4LLSA 4MC0A 2AZKA 5DHIA 3ASXA 5B0JA 4FJQA 2PS8A 4NFKF 5KSXF 4XQSF 4LZ0A 3WCAA 4DZWA 3OYRA 4EA0A 3AQCB 4LA5A 4LFVF 3KRCB 4NFJF 1VG3A 1YYTA 3N5JF 3VJCA 5IMNA 3N3DA 3ICMA 5B0LA 4K10A 4OMGA 5IK9A 2AETA 4MC8A 3LSNA 4LUUA 3LOMA 3M9UA 3DYFA 4OGUA 3CKEA 1VG6A 3RMGA 3WCEA 5B02A 3N46F 4EA1A 4GA3A 2OGDA 3EGTA 3Q30A 2Z4VA 5B00A 3TFVA 5IVGA 1UBYA 4H5CF 2EWGA 3TFPA 2AZJA 4OKMA 3ZL6A 5IK6A 2QISA 3OABB 1YV5A 2Z7IA 2ZCQA 3AQBB 4H5DF 2F89F 4RXAA 1HXGA 3IPIA 3M00A 3LLWA 3KRPA 2J1OA 1JFAA 3EFQA 3QKCA 5ILDA 4NUAA 3P8LA 2Q80A 4DHDA 2F8CF 2E8UA 4JXYA 3SDTA 3G4FA 3LZ9A 5B0KA 5HN9A 1UBXA 3P5RA 5AELA 5ERMA 3WC9A 5DJPF 3ACWA 3PYAA 4XQRF 3G4DA 1YHMA 1HXCA 4KQ5A 5DJVF 3N5HF 3KROA 3ID0A 4DEMF 5A0IA 3SDVA 4DWBA 2PS5A 5DZ2A 4LZCA 4DXJA 3KRFB 5IK0A 5IKAA 3V1XA 4LPHF 5CG6A 5DHKA 5EAUA 4OMHA 5EROA 3N3LF 4LPGF 2P1CA 4Q23A 3N49F 3VJDA 1HX9A 2Z78A 1V4JA 2E91A 3N0GA 2Z4ZA 2Z50A 3UCAA 1YHLA 2E4OA 5IM1A 5B03A 3WEKA 3BNYA 2E8TA 3AQ0A 3M01A 2AZLA 3P41A 4LFGA 5ILHA 5ILJA 1V4EA 2E90A 4NKEA 2H8OA 2FORA 4F6XA 1YYRA 1YJ4A 1N1ZA 4F62A 5B0MA 3WEJA 5ILKA 1YQ7A 1FPSA 3KRAA 1DI1A 3M02A 1ZW5A 5IMPA 1EZFA 2PS7A 1HXAA 3ICZA 4LIXA 2FTZA 4RNQA 4LLTA 3LVSA 3VJAA 5HNAA 3LG5A 4RXDA 3WCBA 3NPRA 4DWGA 3BNXA 5IN8A 5DGNF 3MZVA 3DYGA 4LTZA 3P8RA 4FP4A 3M0GA 2OPNA 3NRIA 3OACA 3KBKA 3WEIA 3KRPB 3NF2A 3WCIA 3ZMCA 3VJEA 3SDUA 4LOBA 1DGPA 5B01A 3WJOA 5ILZA 2DH4A 1N24A 5H9DA 4EA2A 4QXSF 2Z4XA 3NPKA 3SAEA 3IBAA 5ILIA 4P0WA 3SDQA 2ZCOA 2ZEVA 3WSAA 5IMIA 3CP6A 5HN7A 3KROB 3P5PA 2F92F 4JXNA 2Q58A 3WCJA 4JZBA 1WMWA 1N21A 4KVDA 4LXWA 3WEHA 3WEGA 3RBMA 2E95A 4KKMA 1N22A 5AFXA 3N6KF 4E1EA 3WSBA 3WJNA 5HN8A 5JV2F 3WCDA 3LGKA 3N1WF 3RYWA 5E8KA 3TFNA 4N9UA 3WCFA 3W7FA 2ZCRA 5JA0F 1HM4A 4LA6A 1N20A 4GP1A 5AYPA 3WCMA 3PH7A 5JV1F 1WY0A 3PYBA 3ADZA 5I1UA 5C05A 1KIYA 3WCGA 1V4HA 1HM7A 4N1ZF 4RYPA 1KIZA 5IL8A 3PKOA 2PS6A 4P0VA 4KVIA 5DW7A 2AELA 1JFGA 3ZMBA 1YYQA 5EATA 5B0IA 5E8LA 5E8HA
chains in the Genus database with same CATH superfamily
3S4JA 2J5CA 2Q9YA 4PVXF 1WL0A 4GAXA 3ACXA 4F6VA 3CC9A 4NG6A 4WK5A 3WCLA 5IKHA 3SDRA 4KPDA 3Q2ZA 3LDWA 4JVJF 2E93A 3ACYA 2OPMA 2ZCSA 3KRAB 5ERNA 1V4IA 1N1BA 4DI5A 4KVWA 1YHKA 3WJKA 1RQJA 2F8ZF 2AEKA 3LJIA 3PDEA 2Z4WA 3KRCA 2Q9ZA 3LGZB 1VG2A 3ZOUA 3WE9A 4E9ZA 4XQTF 5JV0F 3Q2QA 4KFAA 3APZA 3WEFA 2VF6A 3VJ8A 1VG7A 3S9VA 3MAVA 5DIQF 3V1VA 2E8VA 2OA6A 3KB9A 4KPJA 3OACB 1N23A 3WCCA 2Z52A 3ICKA 2E94A 2F7MF 2J1PA 3OABA 4L2XF 5A0JA 2Z4YA 3LEEA 5AHUB 5DGMF 4UMJA 3LK5A 3V66A 1YYSA 4LTVA 1YYUA 5EASA 3TC1A 1WKZA 4H5EF 3N45F 4RXEA 4QPFA 1WL1A 3EZ3A 3N0FA 1WL2A 5JUZF 1V4KA 4JYXA 4LFEA 4NKFA 4E9UA 3WCHA 5ILYA 3ICNA 3RYEA 2I19A 4KUXA 5IL3A 2ONHA 2Z7HA 2F9KF 3LMDA 4KVYA 3AE0A 3TS7A 4JZXA 4PVYF 4KK2A 5DGSF 2O1OA 4NFIF 4GP2A 4MC3A 4KWDA 5CG5A 2ZY1A 2RAHA 5A0KA 4KQUA 3KRFA 2F94F 2ZEUA 4KQSA 3B7LA 2PS4A 3DYHA 2E8XA 1RQIA 4HD1A 4LZ3A 4P0XA 3VJ9A 3ZCDA 4OKZA 1VG4A 1UBWA 1PS1A 3N1VF 2E92A 1RTRA 3Q1OA 3QQVA 5ER8A 1UBVA 4RXCA 2ONGA 2E8WA 3VJBA 5DJRF 4ZQ8A 1WL3A 4LLSA 4MC0A 2AZKA 5DHIA 3ASXA 5B0JA 4FJQA 2PS8A 4NFKF 5KSXF 4XQSF 4LZ0A 3WCAA 4DZWA 3OYRA 4EA0A 3AQCB 4LA5A 4LFVF 3KRCB 4NFJF 1VG3A 1YYTA 3N5JF 3VJCA 5IMNA 3N3DA 3ICMA 5B0LA 4K10A 4OMGA 5IK9A 2AETA 4MC8A 3LSNA 4LUUA 3LOMA 3M9UA 3DYFA 4OGUA 3CKEA 1VG6A 3RMGA 3WCEA 5B02A 3N46F 4EA1A 4GA3A 2OGDA 3EGTA 3Q30A 2Z4VA 5B00A 3TFVA 5IVGA 1UBYA 4H5CF 2EWGA 3TFPA 2AZJA 4OKMA 3ZL6A 5IK6A 2QISA 3OABB 1YV5A 2Z7IA 2ZCQA 3AQBB 4H5DF 2F89F 4RXAA 1HXGA 3IPIA 3M00A 3LLWA 3KRPA 2J1OA 1JFAA 3EFQA 3QKCA 5ILDA 4NUAA 3P8LA 2Q80A 4DHDA 2F8CF 2E8UA 4JXYA 3SDTA 3G4FA 3LZ9A 5B0KA 5HN9A 1UBXA 3P5RA 5AELA 5ERMA 3WC9A 5DJPF 3ACWA 3PYAA 4XQRF 3G4DA 1YHMA 1HXCA 4KQ5A 5DJVF 3N5HF 3KROA 3ID0A 4DEMF 5A0IA 3SDVA 4DWBA 2PS5A 5DZ2A 4LZCA 4DXJA 3KRFB 5IK0A 5IKAA 3V1XA 4LPHF 5CG6A 5DHKA 5EAUA 4OMHA 5EROA 3N3LF 4LPGF 2P1CA 4Q23A 3N49F 3VJDA 1HX9A 2Z78A 1V4JA 2E91A 3N0GA 2Z4ZA 2Z50A 3UCAA 1YHLA 2E4OA 5IM1A 5B03A 3WEKA 3BNYA 2E8TA 3AQ0A 3M01A 2AZLA 3P41A 4LFGA 5ILHA 5ILJA 1V4EA 2E90A 4NKEA 2H8OA 2FORA 4F6XA 1YYRA 1YJ4A 1N1ZA 4F62A 5B0MA 3WEJA 5ILKA 1YQ7A 1FPSA 3KRAA 1DI1A 3M02A 1ZW5A 5IMPA 1EZFA 2PS7A 1HXAA 3ICZA 4LIXA 2FTZA 4RNQA 4LLTA 3LVSA 3VJAA 5HNAA 3LG5A 4RXDA 3WCBA 3NPRA 4DWGA 3BNXA 5IN8A 5DGNF 3MZVA 3DYGA 4LTZA 3P8RA 4FP4A 3M0GA 2OPNA 3NRIA 3OACA 3KBKA 3WEIA 3KRPB 3NF2A 3WCIA 3ZMCA 3VJEA 3SDUA 4LOBA 1DGPA 5B01A 3WJOA 5ILZA 2DH4A 1N24A 5H9DA 4EA2A 4QXSF 2Z4XA 3NPKA 3SAEA 3IBAA 5ILIA 4P0WA 3SDQA 2ZCOA 2ZEVA 3WSAA 5IMIA 3CP6A 5HN7A 3KROB 3P5PA 2F92F 4JXNA 2Q58A 3WCJA 4JZBA 1WMWA 1N21A 4KVDA 4LXWA 3WEHA 3WEGA 3RBMA 2E95A 4KKMA 1N22A 5AFXA 3N6KF 4E1EA 3WSBA 3WJNA 5HN8A 5JV2F 3WCDA 3LGKA 3N1WF 3RYWA 5E8KA 3TFNA 4N9UA 3WCFA 3W7FA 2ZCRA 5JA0F 1HM4A 4LA6A 1N20A 4GP1A 5AYPA 3WCMA 3PH7A 5JV1F 1WY0A 3PYBA 3ADZA 5I1UA 5C05A 1KIYA 3WCGA 1V4HA 1HM7A 4N1ZF 4RYPA 1KIZA 5IL8A 3PKOA 2PS6A 4P0VA 4KVIA 5DW7A 2AELA 1JFGA 3ZMBA 1YYQA 5EATA 5B0IA 5E8LA 5E8HA
chains in the Genus database with same CATH topology
3S4JA 2J5CA 2Q9YA 4PVXF 1WL0A 4GAXA 3ACXA 4F6VA 3CC9A 4NG6A 4WK5A 3WCLA 5IKHA 3SDRA 4KPDA 3Q2ZA 3LDWA 4JVJF 2E93A 3ACYA 2OPMA 2ZCSA 3KRAB 5ERNA 1V4IA 1N1BA 4DI5A 4KVWA 1YHKA 3WJKA 1RQJA 2F8ZF 2AEKA 3LJIA 3PDEA 2Z4WA 3KRCA 2Q9ZA 3LGZB 1VG2A 3ZOUA 3WE9A 4E9ZA 4XQTF 5JV0F 3Q2QA 4KFAA 3APZA 3WEFA 2VF6A 3VJ8A 1VG7A 3S9VA 3MAVA 5DIQF 3V1VA 2E8VA 2OA6A 3KB9A 4KPJA 3OACB 1N23A 3WCCA 2Z52A 3ICKA 2E94A 2F7MF 2J1PA 3OABA 4L2XF 5A0JA 2Z4YA 3LEEA 5AHUB 5DGMF 4UMJA 3LK5A 3V66A 1YYSA 4LTVA 1YYUA 5EASA 3TC1A 1WKZA 4H5EF 3N45F 4RXEA 4QPFA 1WL1A 3EZ3A 3N0FA 1WL2A 5JUZF 1V4KA 4JYXA 4LFEA 4NKFA 4E9UA 3WCHA 5ILYA 3ICNA 3RYEA 2I19A 4KUXA 5IL3A 2ONHA 2Z7HA 2F9KF 3LMDA 4KVYA 3AE0A 3TS7A 4JZXA 4PVYF 4KK2A 5DGSF 2O1OA 4NFIF 4GP2A 4MC3A 4KWDA 5CG5A 2ZY1A 2RAHA 5A0KA 4KQUA 3KRFA 2F94F 2ZEUA 4KQSA 3B7LA 2PS4A 3DYHA 2E8XA 1RQIA 4HD1A 4LZ3A 4P0XA 3VJ9A 3ZCDA 4OKZA 1VG4A 1UBWA 1PS1A 3N1VF 2E92A 1RTRA 3Q1OA 3QQVA 5ER8A 1UBVA 4RXCA 2ONGA 2E8WA 3VJBA 5DJRF 4ZQ8A 1WL3A 4LLSA 4MC0A 2AZKA 5DHIA 3ASXA 5B0JA 4FJQA 2PS8A 4NFKF 5KSXF 4XQSF 4LZ0A 3WCAA 4DZWA 3OYRA 4EA0A 3AQCB 4LA5A 4LFVF 3KRCB 4NFJF 1VG3A 1YYTA 3N5JF 3VJCA 5IMNA 3N3DA 3ICMA 5B0LA 4K10A 4OMGA 5IK9A 2AETA 4MC8A 3LSNA 4LUUA 3LOMA 3M9UA 3DYFA 4OGUA 3CKEA 1VG6A 3RMGA 3WCEA 5B02A 3N46F 4EA1A 4GA3A 2OGDA 3EGTA 3Q30A 2Z4VA 5B00A 3TFVA 5IVGA 1UBYA 4H5CF 2EWGA 3TFPA 2AZJA 4OKMA 3ZL6A 5IK6A 2QISA 3OABB 1YV5A 2Z7IA 2ZCQA 3AQBB 4H5DF 2F89F 4RXAA 1HXGA 3IPIA 3M00A 3LLWA 3KRPA 2J1OA 1JFAA 3EFQA 3QKCA 5ILDA 4NUAA 3P8LA 2Q80A 4DHDA 2F8CF 2E8UA 4JXYA 3SDTA 3G4FA 3LZ9A 5B0KA 5HN9A 1UBXA 3P5RA 5AELA 5ERMA 3WC9A 5DJPF 3ACWA 3PYAA 4XQRF 3G4DA 1YHMA 1HXCA 4KQ5A 5DJVF 3N5HF 3KROA 3ID0A 4DEMF 5A0IA 3SDVA 4DWBA 2PS5A 5DZ2A 4LZCA 4DXJA 3KRFB 5IK0A 5IKAA 3V1XA 4LPHF 5CG6A 5DHKA 5EAUA 4OMHA 5EROA 3N3LF 4LPGF 2P1CA 4Q23A 3N49F 3VJDA 1HX9A 2Z78A 1V4JA 2E91A 3N0GA 2Z4ZA 2Z50A 3UCAA 1YHLA 2E4OA 5IM1A 5B03A 3WEKA 3BNYA 2E8TA 3AQ0A 3M01A 2AZLA 3P41A 4LFGA 5ILHA 5ILJA 1V4EA 2E90A 4NKEA 2H8OA 2FORA 4F6XA 1YYRA 1YJ4A 1N1ZA 4F62A 5B0MA 3WEJA 5ILKA 1YQ7A 1FPSA 3KRAA 1DI1A 3M02A 1ZW5A 5IMPA 1EZFA 2PS7A 1HXAA 3ICZA 4LIXA 2FTZA 4RNQA 4LLTA 3LVSA 3VJAA 5HNAA 3LG5A 4RXDA 3WCBA 3NPRA 4DWGA 3BNXA 5IN8A 5DGNF 3MZVA 3DYGA 4LTZA 3P8RA 4FP4A 3M0GA 2OPNA 3NRIA 3OACA 3KBKA 3WEIA 3KRPB 3NF2A 3WCIA 3ZMCA 3VJEA 3SDUA 4LOBA 1DGPA 5B01A 3WJOA 5ILZA 2DH4A 1N24A 5H9DA 4EA2A 4QXSF 2Z4XA 3NPKA 3SAEA 3IBAA 5ILIA 4P0WA 3SDQA 2ZCOA 2ZEVA 3WSAA 5IMIA 3CP6A 5HN7A 3KROB 3P5PA 2F92F 4JXNA 2Q58A 3WCJA 4JZBA 1WMWA 1N21A 4KVDA 4LXWA 3WEHA 3WEGA 3RBMA 2E95A 4KKMA 1N22A 5AFXA 3N6KF 4E1EA 3WSBA 3WJNA 5HN8A 5JV2F 3WCDA 3LGKA 3N1WF 3RYWA 5E8KA 3TFNA 4N9UA 3WCFA 3W7FA 2ZCRA 5JA0F 1HM4A 4LA6A 1N20A 4GP1A 5AYPA 3WCMA 3PH7A 5JV1F 1WY0A 3PYBA 3ADZA 5I1UA 5C05A 1KIYA 3WCGA 1V4HA 1HM7A 4N1ZF 4RYPA 1KIZA 5IL8A 3PKOA 2PS6A 4P0VA 4KVIA 5DW7A 2AELA 1JFGA 3ZMBA 1YYQA 5EATA 5B0IA 5E8LA 5E8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S4J A;  2J5C A;  2Q9Y A;  4PVX F;  1WL0 A;  4GAX A;  3ACX A;  4F6V A;  3CC9 A;  4NG6 A;  4WK5 A;  3WCL A;  5IKH A;  3SDR A;  4KPD A;  3Q2Z A;  3LDW A;  4JVJ F;  2E93 A;  3ACY A;  2OPM A;  2ZCS A;  3KRA B;  5ERN A;  1V4I A;  1N1B A;  4DI5 A;  4KVW A;  1YHK A;  3WJK A;  1RQJ A;  2F8Z F;  2AEK A;  3LJI A;  3PDE A;  2Z4W A;  3KRC A;  2Q9Z A;  3LGZ B;  1VG2 A;  3ZOU A;  3WE9 A;  4E9Z A;  4XQT F;  5JV0 F;  3Q2Q A;  4KFA A;  3APZ A;  3WEF A;  2VF6 A;  3VJ8 A;  1VG7 A;  3S9V A;  3MAV A;  5DIQ F;  3V1V A;  2E8V A;  2OA6 A;  3KB9 A;  4KPJ A;  3OAC B;  1N23 A;  3WCC A;  2Z52 A;  3ICK A;  2E94 A;  2F7M F;  2J1P A;  3OAB A;  4L2X F;  5A0J A;  2Z4Y A;  3LEE A;  5AHU B;  5DGM F;  4UMJ A;  3LK5 A;  3V66 A;  1YYS A;  4LTV A;  1YYU A;  5EAS A;  3TC1 A;  1WKZ A;  4H5E F;  3N45 F;  4RXE A;  4QPF A;  1WL1 A;  3EZ3 A;  3N0F A;  1WL2 A;  5JUZ F;  1V4K A;  4JYX A;  4LFE A;  4NKF A;  4E9U A;  3WCH A;  5ILY A;  3ICN A;  3RYE A;  2I19 A;  4KUX A;  5IL3 A;  2ONH A;  2Z7H A;  2F9K F;  3LMD A;  4KVY A;  3AE0 A;  3TS7 A;  4JZX A;  4PVY F;  4KK2 A;  5DGS F;  2O1O A;  4NFI F;  4GP2 A;  4MC3 A;  4KWD A;  5CG5 A;  2ZY1 A;  2RAH A;  5A0K A;  4KQU A;  3KRF A;  2F94 F;  2ZEU A;  4KQS A;  3B7L A;  2PS4 A;  3DYH A;  2E8X A;  1RQI A;  4HD1 A;  4LZ3 A;  4P0X A;  3VJ9 A;  3ZCD A;  4OKZ A;  1VG4 A;  1UBW A;  1PS1 A;  3N1V F;  2E92 A;  1RTR A;  3Q1O A;  3QQV A;  5ER8 A;  1UBV A;  4RXC A;  2ONG A;  2E8W A;  3VJB A;  5DJR F;  4ZQ8 A;  1WL3 A;  4LLS A;  4MC0 A;  2AZK A;  5DHI A;  3ASX A;  5B0J A;  4FJQ A;  2PS8 A;  4NFK F;  5KSX F;  4XQS F;  4LZ0 A;  3WCA A;  4DZW A;  3OYR A;  4EA0 A;  3AQC B;  4LA5 A;  4LFV F;  3KRC B;  4NFJ F;  1VG3 A;  1YYT A;  3N5J F;  3VJC A;  5IMN A;  3N3D A;  3ICM A;  5B0L A;  4K10 A;  4OMG A;  5IK9 A;  2AET A;  4MC8 A;  3LSN A;  4LUU A;  3LOM A;  3M9U A;  3DYF A;  4OGU A;  3CKE A;  1VG6 A;  3RMG A;  3WCE A;  5B02 A;  3N46 F;  4EA1 A;  4GA3 A;  2OGD A;  3EGT A;  3Q30 A;  2Z4V A;  5B00 A;  3TFV A;  5IVG A;  1UBY A;  4H5C F;  2EWG A;  3TFP A;  2AZJ A;  4OKM A;  3ZL6 A;  5IK6 A;  2QIS A;  3OAB B;  1YV5 A;  2Z7I A;  2ZCQ A;  3AQB B;  4H5D F;  2F89 F;  4RXA A;  1HXG A;  3IPI A;  3M00 A;  3LLW A;  3KRP A;  2J1O A;  1JFA A;  3EFQ A;  3QKC A;  5ILD A;  4NUA A;  3P8L A;  2Q80 A;  4DHD A;  2F8C F;  2E8U A;  4JXY A;  3SDT A;  3G4F A;  3LZ9 A;  5B0K A;  5HN9 A;  1UBX A;  3P5R A;  5AEL A;  5ERM A;  3WC9 A;  5DJP F;  3ACW A;  3PYA A;  4XQR F;  3G4D A;  1YHM A;  1HXC A;  4KQ5 A;  5DJV F;  3N5H F;  3KRO A;  3ID0 A;  4DEM F;  5A0I A;  3SDV A;  4DWB A;  2PS5 A;  5DZ2 A;  4LZC A;  4DXJ A;  3KRF B;  5IK0 A;  5IKA A;  3V1X A;  4LPH F;  5CG6 A;  5DHK A;  5EAU A;  4OMH A;  5ERO A;  3N3L F;  4LPG F;  2P1C A;  4Q23 A;  3N49 F;  3VJD A;  1HX9 A;  2Z78 A;  1V4J A;  2E91 A;  3N0G A;  2Z4Z A;  2Z50 A;  3UCA A;  1YHL A;  2E4O A;  5IM1 A;  5B03 A;  3WEK A;  3BNY A;  2E8T A;  3AQ0 A;  3M01 A;  2AZL A;  3P41 A;  4LFG A;  5ILH A;  5ILJ A;  1V4E A;  2E90 A;  4NKE A;  2H8O A;  2FOR A;  4F6X A;  1YYR A;  1YJ4 A;  1N1Z A;  4F62 A;  5B0M A;  3WEJ A;  5ILK A;  1YQ7 A;  1FPS A;  3KRA A;  1DI1 A;  3M02 A;  1ZW5 A;  5IMP A;  1EZF A;  2PS7 A;  1HXA A;  3ICZ A;  4LIX A;  2FTZ A;  4RNQ A;  4LLT A;  3LVS A;  3VJA A;  5HNA A;  3LG5 A;  4RXD A;  3WCB A;  3NPR A;  4DWG A;  3BNX A;  5IN8 A;  5DGN F;  3MZV A;  3DYG A;  4LTZ A;  3P8R A;  4FP4 A;  3M0G A;  2OPN A;  3NRI A;  3OAC A;  3KBK A;  3WEI A;  3KRP B;  3NF2 A;  3WCI A;  3ZMC A;  3VJE A;  3SDU A;  4LOB A;  1DGP A;  5B01 A;  3WJO A;  5ILZ A;  2DH4 A;  1N24 A;  5H9D A;  4EA2 A;  4QXS F;  2Z4X A;  3NPK A;  3SAE A;  3IBA A;  5ILI A;  4P0W A;  3SDQ A;  2ZCO A;  2ZEV A;  3WSA A;  5IMI A;  3CP6 A;  5HN7 A;  3KRO B;  3P5P A;  2F92 F;  4JXN A;  2Q58 A;  3WCJ A;  4JZB A;  1WMW A;  1N21 A;  4KVD A;  4LXW A;  3WEH A;  3WEG A;  3RBM A;  2E95 A;  4KKM A;  1N22 A;  5AFX A;  3N6K F;  4E1E A;  3WSB A;  3WJN A;  5HN8 A;  5JV2 F;  3WCD A;  3LGK A;  3N1W F;  3RYW A;  5E8K A;  3TFN A;  4N9U A;  3WCF A;  3W7F A;  2ZCR A;  5JA0 F;  1HM4 A;  4LA6 A;  1N20 A;  4GP1 A;  5AYP A;  3WCM A;  3PH7 A;  5JV1 F;  1WY0 A;  3PYB A;  3ADZ A;  5I1U A;  5C05 A;  1KIY A;  3WCG A;  1V4H A;  1HM7 A;  4N1Z F;  4RYP A;  1KIZ A;  5IL8 A;  3PKO A;  2PS6 A;  4P0V A;  4KVI A;  5DW7 A;  2AEL A;  1JFG A;  3ZMB A;  1YYQ A;  5EAT A;  5B0I A;  5E8L A;  5E8H A; 
#chains in the Genus database with same CATH topology
 3S4J A;  2J5C A;  2Q9Y A;  4PVX F;  1WL0 A;  4GAX A;  3ACX A;  4F6V A;  3CC9 A;  4NG6 A;  4WK5 A;  3WCL A;  5IKH A;  3SDR A;  4KPD A;  3Q2Z A;  3LDW A;  4JVJ F;  2E93 A;  3ACY A;  2OPM A;  2ZCS A;  3KRA B;  5ERN A;  1V4I A;  1N1B A;  4DI5 A;  4KVW A;  1YHK A;  3WJK A;  1RQJ A;  2F8Z F;  2AEK A;  3LJI A;  3PDE A;  2Z4W A;  3KRC A;  2Q9Z A;  3LGZ B;  1VG2 A;  3ZOU A;  3WE9 A;  4E9Z A;  4XQT F;  5JV0 F;  3Q2Q A;  4KFA A;  3APZ A;  3WEF A;  2VF6 A;  3VJ8 A;  1VG7 A;  3S9V A;  3MAV A;  5DIQ F;  3V1V A;  2E8V A;  2OA6 A;  3KB9 A;  4KPJ A;  3OAC B;  1N23 A;  3WCC A;  2Z52 A;  3ICK A;  2E94 A;  2F7M F;  2J1P A;  3OAB A;  4L2X F;  5A0J A;  2Z4Y A;  3LEE A;  5AHU B;  5DGM F;  4UMJ A;  3LK5 A;  3V66 A;  1YYS A;  4LTV A;  1YYU A;  5EAS A;  3TC1 A;  1WKZ A;  4H5E F;  3N45 F;  4RXE A;  4QPF A;  1WL1 A;  3EZ3 A;  3N0F A;  1WL2 A;  5JUZ F;  1V4K A;  4JYX A;  4LFE A;  4NKF A;  4E9U A;  3WCH A;  5ILY A;  3ICN A;  3RYE A;  2I19 A;  4KUX A;  5IL3 A;  2ONH A;  2Z7H A;  2F9K F;  3LMD A;  4KVY A;  3AE0 A;  3TS7 A;  4JZX A;  4PVY F;  4KK2 A;  5DGS F;  2O1O A;  4NFI F;  4GP2 A;  4MC3 A;  4KWD A;  5CG5 A;  2ZY1 A;  2RAH A;  5A0K A;  4KQU A;  3KRF A;  2F94 F;  2ZEU A;  4KQS A;  3B7L A;  2PS4 A;  3DYH A;  2E8X A;  1RQI A;  4HD1 A;  4LZ3 A;  4P0X A;  3VJ9 A;  3ZCD A;  4OKZ A;  1VG4 A;  1UBW A;  1PS1 A;  3N1V F;  2E92 A;  1RTR A;  3Q1O A;  3QQV A;  5ER8 A;  1UBV A;  4RXC A;  2ONG A;  2E8W A;  3VJB A;  5DJR F;  4ZQ8 A;  1WL3 A;  4LLS A;  4MC0 A;  2AZK A;  5DHI A;  3ASX A;  5B0J A;  4FJQ A;  2PS8 A;  4NFK F;  5KSX F;  4XQS F;  4LZ0 A;  3WCA A;  4DZW A;  3OYR A;  4EA0 A;  3AQC B;  4LA5 A;  4LFV F;  3KRC B;  4NFJ F;  1VG3 A;  1YYT A;  3N5J F;  3VJC A;  5IMN A;  3N3D A;  3ICM A;  5B0L A;  4K10 A;  4OMG A;  5IK9 A;  2AET A;  4MC8 A;  3LSN A;  4LUU A;  3LOM A;  3M9U A;  3DYF A;  4OGU A;  3CKE A;  1VG6 A;  3RMG A;  3WCE A;  5B02 A;  3N46 F;  4EA1 A;  4GA3 A;  2OGD A;  3EGT A;  3Q30 A;  2Z4V A;  5B00 A;  3TFV A;  5IVG A;  1UBY A;  4H5C F;  2EWG A;  3TFP A;  2AZJ A;  4OKM A;  3ZL6 A;  5IK6 A;  2QIS A;  3OAB B;  1YV5 A;  2Z7I A;  2ZCQ A;  3AQB B;  4H5D F;  2F89 F;  4RXA A;  1HXG A;  3IPI A;  3M00 A;  3LLW A;  3KRP A;  2J1O A;  1JFA A;  3EFQ A;  3QKC A;  5ILD A;  4NUA A;  3P8L A;  2Q80 A;  4DHD A;  2F8C F;  2E8U A;  4JXY A;  3SDT A;  3G4F A;  3LZ9 A;  5B0K A;  5HN9 A;  1UBX A;  3P5R A;  5AEL A;  5ERM A;  3WC9 A;  5DJP F;  3ACW A;  3PYA A;  4XQR F;  3G4D A;  1YHM A;  1HXC A;  4KQ5 A;  5DJV F;  3N5H F;  3KRO A;  3ID0 A;  4DEM F;  5A0I A;  3SDV A;  4DWB A;  2PS5 A;  5DZ2 A;  4LZC A;  4DXJ A;  3KRF B;  5IK0 A;  5IKA A;  3V1X A;  4LPH F;  5CG6 A;  5DHK A;  5EAU A;  4OMH A;  5ERO A;  3N3L F;  4LPG F;  2P1C A;  4Q23 A;  3N49 F;  3VJD A;  1HX9 A;  2Z78 A;  1V4J A;  2E91 A;  3N0G A;  2Z4Z A;  2Z50 A;  3UCA A;  1YHL A;  2E4O A;  5IM1 A;  5B03 A;  3WEK A;  3BNY A;  2E8T A;  3AQ0 A;  3M01 A;  2AZL A;  3P41 A;  4LFG A;  5ILH A;  5ILJ A;  1V4E A;  2E90 A;  4NKE A;  2H8O A;  2FOR A;  4F6X A;  1YYR A;  1YJ4 A;  1N1Z A;  4F62 A;  5B0M A;  3WEJ A;  5ILK A;  1YQ7 A;  1FPS A;  3KRA A;  1DI1 A;  3M02 A;  1ZW5 A;  5IMP A;  1EZF A;  2PS7 A;  1HXA A;  3ICZ A;  4LIX A;  2FTZ A;  4RNQ A;  4LLT A;  3LVS A;  3VJA A;  5HNA A;  3LG5 A;  4RXD A;  3WCB A;  3NPR A;  4DWG A;  3BNX A;  5IN8 A;  5DGN F;  3MZV A;  3DYG A;  4LTZ A;  3P8R A;  4FP4 A;  3M0G A;  2OPN A;  3NRI A;  3OAC A;  3KBK A;  3WEI A;  3KRP B;  3NF2 A;  3WCI A;  3ZMC A;  3VJE A;  3SDU A;  4LOB A;  1DGP A;  5B01 A;  3WJO A;  5ILZ A;  2DH4 A;  1N24 A;  5H9D A;  4EA2 A;  4QXS F;  2Z4X A;  3NPK A;  3SAE A;  3IBA A;  5ILI A;  4P0W A;  3SDQ A;  2ZCO A;  2ZEV A;  3WSA A;  5IMI A;  3CP6 A;  5HN7 A;  3KRO B;  3P5P A;  2F92 F;  4JXN A;  2Q58 A;  3WCJ A;  4JZB A;  1WMW A;  1N21 A;  4KVD A;  4LXW A;  3WEH A;  3WEG A;  3RBM A;  2E95 A;  4KKM A;  1N22 A;  5AFX A;  3N6K F;  4E1E A;  3WSB A;  3WJN A;  5HN8 A;  5JV2 F;  3WCD A;  3LGK A;  3N1W F;  3RYW A;  5E8K A;  3TFN A;  4N9U A;  3WCF A;  3W7F A;  2ZCR A;  5JA0 F;  1HM4 A;  4LA6 A;  1N20 A;  4GP1 A;  5AYP A;  3WCM A;  3PH7 A;  5JV1 F;  1WY0 A;  3PYB A;  3ADZ A;  5I1U A;  5C05 A;  1KIY A;  3WCG A;  1V4H A;  1HM7 A;  4N1Z F;  4RYP A;  1KIZ A;  5IL8 A;  3PKO A;  2PS6 A;  4P0V A;  4KVI A;  5DW7 A;  2AEL A;  1JFG A;  3ZMB A;  1YYQ A;  5EAT A;  5B0I A;  5E8L A;  5E8H A; 
#chains in the Genus database with same CATH homology
 3S4J A;  2J5C A;  2Q9Y A;  4PVX F;  1WL0 A;  4GAX A;  3ACX A;  4F6V A;  3CC9 A;  4NG6 A;  4WK5 A;  3WCL A;  5IKH A;  3SDR A;  4KPD A;  3Q2Z A;  3LDW A;  4JVJ F;  2E93 A;  3ACY A;  2OPM A;  2ZCS A;  3KRA B;  5ERN A;  1V4I A;  1N1B A;  4DI5 A;  4KVW A;  1YHK A;  3WJK A;  1RQJ A;  2F8Z F;  2AEK A;  3LJI A;  3PDE A;  2Z4W A;  3KRC A;  2Q9Z A;  3LGZ B;  1VG2 A;  3ZOU A;  3WE9 A;  4E9Z A;  4XQT F;  5JV0 F;  3Q2Q A;  4KFA A;  3APZ A;  3WEF A;  2VF6 A;  3VJ8 A;  1VG7 A;  3S9V A;  3MAV A;  5DIQ F;  3V1V A;  2E8V A;  2OA6 A;  3KB9 A;  4KPJ A;  3OAC B;  1N23 A;  3WCC A;  2Z52 A;  3ICK A;  2E94 A;  2F7M F;  2J1P A;  3OAB A;  4L2X F;  5A0J A;  2Z4Y A;  3LEE A;  5AHU B;  5DGM F;  4UMJ A;  3LK5 A;  3V66 A;  1YYS A;  4LTV A;  1YYU A;  5EAS A;  3TC1 A;  1WKZ A;  4H5E F;  3N45 F;  4RXE A;  4QPF A;  1WL1 A;  3EZ3 A;  3N0F A;  1WL2 A;  5JUZ F;  1V4K A;  4JYX A;  4LFE A;  4NKF A;  4E9U A;  3WCH A;  5ILY A;  3ICN A;  3RYE A;  2I19 A;  4KUX A;  5IL3 A;  2ONH A;  2Z7H A;  2F9K F;  3LMD A;  4KVY A;  3AE0 A;  3TS7 A;  4JZX A;  4PVY F;  4KK2 A;  5DGS F;  2O1O A;  4NFI F;  4GP2 A;  4MC3 A;  4KWD A;  5CG5 A;  2ZY1 A;  2RAH A;  5A0K A;  4KQU A;  3KRF A;  2F94 F;  2ZEU A;  4KQS A;  3B7L A;  2PS4 A;  3DYH A;  2E8X A;  1RQI A;  4HD1 A;  4LZ3 A;  4P0X A;  3VJ9 A;  3ZCD A;  4OKZ A;  1VG4 A;  1UBW A;  1PS1 A;  3N1V F;  2E92 A;  1RTR A;  3Q1O A;  3QQV A;  5ER8 A;  1UBV A;  4RXC A;  2ONG A;  2E8W A;  3VJB A;  5DJR F;  4ZQ8 A;  1WL3 A;  4LLS A;  4MC0 A;  2AZK A;  5DHI A;  3ASX A;  5B0J A;  4FJQ A;  2PS8 A;  4NFK F;  5KSX F;  4XQS F;  4LZ0 A;  3WCA A;  4DZW A;  3OYR A;  4EA0 A;  3AQC B;  4LA5 A;  4LFV F;  3KRC B;  4NFJ F;  1VG3 A;  1YYT A;  3N5J F;  3VJC A;  5IMN A;  3N3D A;  3ICM A;  5B0L A;  4K10 A;  4OMG A;  5IK9 A;  2AET A;  4MC8 A;  3LSN A;  4LUU A;  3LOM A;  3M9U A;  3DYF A;  4OGU A;  3CKE A;  1VG6 A;  3RMG A;  3WCE A;  5B02 A;  3N46 F;  4EA1 A;  4GA3 A;  2OGD A;  3EGT A;  3Q30 A;  2Z4V A;  5B00 A;  3TFV A;  5IVG A;  1UBY A;  4H5C F;  2EWG A;  3TFP A;  2AZJ A;  4OKM A;  3ZL6 A;  5IK6 A;  2QIS A;  3OAB B;  1YV5 A;  2Z7I A;  2ZCQ A;  3AQB B;  4H5D F;  2F89 F;  4RXA A;  1HXG A;  3IPI A;  3M00 A;  3LLW A;  3KRP A;  2J1O A;  1JFA A;  3EFQ A;  3QKC A;  5ILD A;  4NUA A;  3P8L A;  2Q80 A;  4DHD A;  2F8C F;  2E8U A;  4JXY A;  3SDT A;  3G4F A;  3LZ9 A;  5B0K A;  5HN9 A;  1UBX A;  3P5R A;  5AEL A;  5ERM A;  3WC9 A;  5DJP F;  3ACW A;  3PYA A;  4XQR F;  3G4D A;  1YHM A;  1HXC A;  4KQ5 A;  5DJV F;  3N5H F;  3KRO A;  3ID0 A;  4DEM F;  5A0I A;  3SDV A;  4DWB A;  2PS5 A;  5DZ2 A;  4LZC A;  4DXJ A;  3KRF B;  5IK0 A;  5IKA A;  3V1X A;  4LPH F;  5CG6 A;  5DHK A;  5EAU A;  4OMH A;  5ERO A;  3N3L F;  4LPG F;  2P1C A;  4Q23 A;  3N49 F;  3VJD A;  1HX9 A;  2Z78 A;  1V4J A;  2E91 A;  3N0G A;  2Z4Z A;  2Z50 A;  3UCA A;  1YHL A;  2E4O A;  5IM1 A;  5B03 A;  3WEK A;  3BNY A;  2E8T A;  3AQ0 A;  3M01 A;  2AZL A;  3P41 A;  4LFG A;  5ILH A;  5ILJ A;  1V4E A;  2E90 A;  4NKE A;  2H8O A;  2FOR A;  4F6X A;  1YYR A;  1YJ4 A;  1N1Z A;  4F62 A;  5B0M A;  3WEJ A;  5ILK A;  1YQ7 A;  1FPS A;  3KRA A;  1DI1 A;  3M02 A;  1ZW5 A;  5IMP A;  1EZF A;  2PS7 A;  1HXA A;  3ICZ A;  4LIX A;  2FTZ A;  4RNQ A;  4LLT A;  3LVS A;  3VJA A;  5HNA A;  3LG5 A;  4RXD A;  3WCB A;  3NPR A;  4DWG A;  3BNX A;  5IN8 A;  5DGN F;  3MZV A;  3DYG A;  4LTZ A;  3P8R A;  4FP4 A;  3M0G A;  2OPN A;  3NRI A;  3OAC A;  3KBK A;  3WEI A;  3KRP B;  3NF2 A;  3WCI A;  3ZMC A;  3VJE A;  3SDU A;  4LOB A;  1DGP A;  5B01 A;  3WJO A;  5ILZ A;  2DH4 A;  1N24 A;  5H9D A;  4EA2 A;  4QXS F;  2Z4X A;  3NPK A;  3SAE A;  3IBA A;  5ILI A;  4P0W A;  3SDQ A;  2ZCO A;  2ZEV A;  3WSA A;  5IMI A;  3CP6 A;  5HN7 A;  3KRO B;  3P5P A;  2F92 F;  4JXN A;  2Q58 A;  3WCJ A;  4JZB A;  1WMW A;  1N21 A;  4KVD A;  4LXW A;  3WEH A;  3WEG A;  3RBM A;  2E95 A;  4KKM A;  1N22 A;  5AFX A;  3N6K F;  4E1E A;  3WSB A;  3WJN A;  5HN8 A;  5JV2 F;  3WCD A;  3LGK A;  3N1W F;  3RYW A;  5E8K A;  3TFN A;  4N9U A;  3WCF A;  3W7F A;  2ZCR A;  5JA0 F;  1HM4 A;  4LA6 A;  1N20 A;  4GP1 A;  5AYP A;  3WCM A;  3PH7 A;  5JV1 F;  1WY0 A;  3PYB A;  3ADZ A;  5I1U A;  5C05 A;  1KIY A;  3WCG A;  1V4H A;  1HM7 A;  4N1Z F;  4RYP A;  1KIZ A;  5IL8 A;  3PKO A;  2PS6 A;  4P0V A;  4KVI A;  5DW7 A;  2AEL A;  1JFG A;  3ZMB A;  1YYQ A;  5EAT A;  5B0I A;  5E8L A;  5E8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...