3MA9A

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
216
structure length
197
Chain Sequence
MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 100
structure length 197
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ma9A00
2CMRA 3MA9A 3MACA
chains in the Genus database with same CATH superfamily
4QX8B 4HEAA 2NWBA 5ABFA 4ZEYA 2VB6A 5LG4A 5EK2A 1HNXT 2X0HA 2VWAA 2CWYA 1WYBA 4GYSA 3JAFA 1OEDA 2JMKA 2NW8A 4LMLA 5HAXA 3Q5XA 3C4WA 4TZ4C 3FZLB 3NBXX 2W62A 4TX5A 1N36T 4CI2B 3F2EA 1KEYA 2EHOA 4QH5A 4UF0B 2DCFA 3RYFE 1EZ3A 2BBJA 1V9DA 4QH4A 2YEVC 2XQ5A 5AQVB 5LG3A 4GKKT 3P4PA 4HWIB 2W61A 1M62A 2KSRA 4G63A 3QOFA 4KMCA 4AKLA 2XQ4A 5LP6E 2XAJB 2XM2A 1FMWA 2CA5A 3RGLA 4FI5A 5FMNA 2V5CA 1HG5A 3DTOA 3C98B 5AFUL 4LF8T 2H3RA 4E7ZA 3X1DA 4GK0E 5FY7A 4DV5T 3VU7H 2VVNA 3JC6C 5AQNB 4F8HA 4AQYT 4GYRA 4EEBA 2MOZA 5HWXA 5CJ5A 4YHHT 2LSYA 1MNEA 3FXDB 2ZMAA 3MACA 4IDNA 1W0AA 4JI6T 5BR8T 1SHZC 2WQYA 4PFPA 3KV9A 5F8PA 3SRZA 4ILAA 2XPKA 4KUMB 4UVCB 2JQQA 4HFEA 2XAFB 1Y01A 2AE9A 3RHWA 3N2GE 3N2KE 4HWDA 2L9QA 2QA7A 3AEBA 2X51A 1AJ3A 3HKEE 5HCJA 3AEAA 4O4IE 5FXVA 1IBLT 4DR1T 2XAQB 5LHGB 3T8OA 2G0UA 3TLUA 1KNPA 4AKHA 2BG9C 4UXNB 5CGMA 5JR9C 2JQHA 5L3BB 4WBOA 4K0KT 1LKXA 3K1SA 1R8IA 2PJQA 5AQFB 3EAMA 4DIDB 3RPUA 4LF9T 2PBIA 3E08A 1NWMX 5CFBA 4X64T 2W00A 3UU5A 1UGOA 3UUNA 2X9HA 1BR2A 1VCTA 2UXNB 2PFVA 1D1AA 3M3ZB 1ZHCA 3UUXB 4JI0T 1MIWA 4KHZF 4YXDA 2M6IA 2YKSA 3MA9A 3QB5K 5L4EA 2L8KA 5AQOB 5LBQB 1D0XA 4YSYA 3HR0A 3AA7B 2CBIA 4M1PA 2YDRA 3GN5B 4EIWA 4HWFA 2X9YA 2V6YB 4FJOA 1HR0T 5LGNB 2XY8B 2XQAA 2CLYB 2JRKA 3LG7A 1XZYA 3UFEA 2WDRA 4X62T 3ZYMA 3PU3A 4PFOA 5JRCB 1HTJF 2WWUA 3CWZB 4LMJA 2FJAA 3VKGA 1X9BA 2V7KA 1T98A 3ZCJA 4U3CA 4IDOA 2KNDA 2VL0A 5C8YE 2CM0A 4JI5T 3TLWA 4BJNA 4EZHA 4XAXB 2XM1A 5LYJE 4WBNE 3PUWF 2D2SA 3ABVA 3PUZF 2IW5B 4HE8A 3RQWA 4CQIA 3K3OA 4OYJA 4OHFA 4QHOA 2E9XA 3AXJA 5FXWA 3ANWA 2XASB 1E2AA 4BA9A 2X0LB 3IHRA 4PK6A 4O2BE 1OEDC 3L3PA 4ZS2A 2BKOA 3AE4A 4MBQA 3AE3A 5LA6E 2CRBA 5JDMA 3RX6A 2EHOC 5CB4E 1YKHB 2DWGA 2BKPA 4X5TA 3BK9A 2OA5A 2UUAT 3N9QA 1JNZA 3RLFF 2CXLA 1XNRT 1IAPA 4O2AE 2CPTA 2WZHA 5ADXL 3AA6B 3I9YA 2HN2A 4JUYA 2H7OA 1NEKA 2VKHA 2ZLYA 3ZJ1A 3MXZA 3PTRB 2C5JA 4JLEA 4ILBA 3Q5EA 4KX6A 4HWCA 2F4VT 2LKHA 1B7TA 3LBXA 2W67A 1Z0PA 3RIFA 2NOXA 1E1HB 4ZHQE 4DR4T 2X9XA 3TLVA 2V7JA 1WCRA 3AE1A 2QRXA 4HTEA 4XZCA 3PU8A 1X79A 3QK6A 2CE7A 2J4GA 3WAJA 3JC6D 4BAYB 4YJ2E 2E5LT 2JMHA 2GK9A 4DV3T 3PUAA 2XJ7A 2XQYA 3AE6A 4C90A 3V5SA 5HYAA 4DO0A 5JDGA 2CXDA 4IDZA 2CEAA 2VKDA 2VVSA 4A97A 1HNZT 3ONLC 4WYVA 2H7VC 4EXTA 2KXPB 4UV8B 4DBQA 1VCSA 1MMNA 4LFAT 3LK42 1US7B 2D0UA 2V6XA 5LXTE 2NTYA 3UT5E 1BR4A 4U72A 4E7SA 2LJLA 4DR3T 1XNQT 4HFIA 3IBPA 2DWKA 5HWYA 3AE5A 2NW7A 2XQ7A 1SE7A 3C51A 3VHLA 2JQ9A 5F3JA 3FZHB 4HN9A 2WS3A 3EUHA 3DP7A 2IIUA 3RKGA 5C3JA 3ZT5A 2LKGA 3N9PA 4MHCA 4DR7T 3JCFA 1KFYA 4WNKA 1W09A 4ISSA 3V5UA 4U7YA 3PUYF 5AQPB 2LSJA 4OX9T 3W15B 1D0YA 3D0TA 2BS4A 5H6QB 2BBHA 4XBFB 2K3WA 2BG9B 2H88A 4CN6A 3FZMB 3B13A 2IHR1 4H63H 3O1JA 3RH3A 5DQVA 4JBWF 1LVFA 4U74A 2ODVA 4B3ST 3BQLA 3FZKB 1T8BA 4AQFA 1YD8G 5JTGA 3FBZA 3SOLA 1D0ZA 1XDPA 4YHJA 1WFDA 1U4QA 2NP9A 1UK5A 4LMKA 1N32T 3C64A 3KBTA 4IE4A 3PDYA 3M65A 3O1IA 4B3TT 2E9XC 4L5GA 3EDVA 2ZM6T 2BG9E 4V1Av 4H9PC 4TN7B 1ZP0A 3ZYLA 4YJ3E 5ETWA 3CK6A 4TNVA 4UVAB 1HG2A 1BR0A 4L0RA 3A7MA 2WDQA 2L3LA 5DQWA 4Q25A 4DUZT 5HXSA 1G73A 2Z6EA 4PNIA 2VL8A 1NENA 3ZMZB 5AQUB 3JAEA 2WU5A 1HFAA 4YSZA 1HS7A 4O4HE 3JADA 2AXDS 2J62A 4G2AA 3AE8A 4YY3T 3UUMA 4LF7T 1CHUA 2N1GA 3VRAA 5A1LA 3I0QA 3N9NA 1XMQT 4DBRA 5JREA 4UELA 3RC3A 4GOUA 4AIUA 3E22E 4PJJA 4ZI3C 2ACZA 3UU8A 3KV5A 4A98A 3AA0B 3OVUA 5JDHA 3OJAA 3PUSA 4DNDA 3KFWX 1XWMA 1WLXA 4NXNT 4HFCA 2XAHB 5FXXA 3PE0A 2OLTA 4P0BA 5DABA 5JDLA 2IMLA 4PJLA 2MAWA 2EHOB 2RP4A 4JEHB 4EB6E 3ETVA 4P09A 4ASKA 4PK5A 1Z8UA 3N5LA 5LB7B 4H9NC 3C4XA 5FL0A 4HGAA 4B6XA 3ESLA 1QUUA 4CXXA 3I9WA 3ZMTB 5L3CB 2W66A 3ETUA 2QGSA 2IUBA 4J2CA 3GN5A 2A72A 1O3XA 1LVKA 3S4UA 4LFCT 1I6ZA 5AQSB 4U7IA 3HL6A 1OEDE 2W0GA 3K3NA 5JRCA 3P4SA 2E5VA 3UULA 2D9DA 3ZSTA 1MMGA 2M67A 2X67A 3N9MA 3E0ZA 2V7IA 1WRDA 3AAIA 3CX8B 3KINB 3SFEA 2QYWA 2D5UA 2Q9QD 3RC8A 2KT9A 3ZT7A 2UXDT 5ABHA 4JI8T 4U33A 4EGWA 3AEDA 4GKJT 3H37A 5AQQB 3HKCE 2XUEA 2KWHA 3ZCIA 1SUMB 3RKOA 4TWDA 2RA1A 3A8YC 4ZI2C 2VQFT 3Q5DA 4QKNA 2MBGA 4TV8E 4YLHA 4EYYR 2WM9A 4IE5A 3MZKB 2WY2A 4C91A 3PJAJ 3ONJA 3C50A 2Q9QB 2XQ3A 4JI1T 4EAHA 2VURA 4UR9A 2BKNA 2C0SA 3N9LA 3MKDA 3O4XE 4AQFC 5L4HA 3I1AA 2KMFA 3N9OA 5AQTB 1S35A 2WAUA 3Q9DA 2LSIA 2VK9A 3L39A 3ZMSB 2DNXA 3BQIA 2J47A 3RQUA 4ZS3A 5AQIB 3UU4A 2XQ9A 3CVRA 3TLSA 4AKIA 2SPCA 4JV5T 4A5XA 4HFVA 2BVMA 4PW8A 1YQ3A 4IDPA 5HEJA 4UV9B 3VR8A 1OXZA 4AQGA 3P8CD 2NTXA 2XHEB 5AQJB 4HKAA 4X66T 4H9QC 5KXJA 4NUUA 2NR4A 4GIWA 2V5DA 2B76A 1MIYA 5ABEA 1MMAA 3J9X1 3EHZA 2XTLA 4CXWA 2WB5A 1XDOA 2JQKA 5AQGB 4DV1T 4H9SE 2MYSA 4I0UA 1JNRA 2IDOB 2FBWA 5KX5E 2YINA 4U31A 2X0YA 2UUCT 1UCUA 4HFDA 5HEOA 1ZV4X 5LNKA 1FEWA 1H7CA 5LGUB 2C5IT 3ZC1A 5LHHB 1WR0A 4QX7B 2OV9A 3AECA 4DV0T 4HFHA 3H3MA 2PTFA 4U2ZA 4DV6T 3PUVF 5E0OA 4ILUA 4MLKA 4K0UA 5EZYE 2K9AA 3QB5A 3WAKA 4CZZB 2XQ8A 2HPLA 2BS2A 1DU2A 4LF6T 3U78A 4YTMA 3LJCA 4COFA 4DV7T 5CA1E 2KINB 5FVLA 2XSBA 3UU3A 3AVSA 3CQCB 3Q5WA 2UXBT 1D1BA 5LJMA 5C2TA 2CWOA 4ZZCA 3RRWA 3ZMUB 3OTOT 3CIRA 4IHJE 4U2YA 4WW0A 1FJGT 1WYCA 4IDQA 3EVYA 2MTQA 3AE9A 1KNZA 3OYZA 4DV4T 3T1YT 2WMNA 4A56A 1HF8A 3ONXA 3B57A 3LK2B 1Y64B 3LBXB 3IEEA 4BJMA 2YN6A 2V1DB 3AB3B 4Z8XA 1W9RA 4IREA 5JH7E 2RPAA 2WDVA 2V8SV 4DV2T 1BR1A 4AISA 3PUXF 5LGTB 2WSSV 3AAEB 3CX7B 3KDSE 5BMVE 2M6BA 1IBKT 4X65T 4QWNB 1HX8A 2W63A 4O4JE 2CXFA 4I43B 4B3MT 1YXRA 2YU2A 4CI1B 5JDNA 3H3AA 4YTNA 3FB2A 2D0TA 5HXEA 3RI5A 3NKZA 4P0AA 1OWAA 3RIAA 3IA3A 4QH1A 1MIVA 2LSKA 5HEUA 4IGUA 1QSDA 2JPFA 4UF0A 5F5WA 5H6RB 4YSXA 5JR9B 1UX4A 4EYUA 4ZXLA 5FKYA 1T72A 2ZM0A 1ZOYA 3FZFB 1T7SA 3KV6A 1J1JA 3CKDA 4L9IA 2DHRA 3AE2A 4IE6A 4KBMB 4TWFA 2QVAA 4EV6A 5HEGA 5FXZA 2WZIA 2A3DA 3ZSSA 1LRZA 5ABGA 3PUQA 1FIOA 3UFGA 2X9WA 2VASA 3ZJ2A 3P4RA 2UU9T 3ZEFB 3AEFA 5EK4A 2WMOA 4QXHB 4DR5T 2LRKA 4IE0A 5J2UE 4DVDA 4LF5T 5LBMA 5IHYA 1L0VA 3R84B 4ERRA 5GONE 3AEEA 3ZLIA 4DMVA 2IC6A 1ZKEA 4TNWA 4ZOLE 3K8PC 3ZMVB 3OYXA 4JYAT 2B1EA 2CCQA 3PV0F 2EHOD 4WZXA 4H9RC 3OPCA 3P50A 2V7LA 3NVOA 4X1YE 3ZT6A 3AVRA 1YQ4A 4MALA 4IL4A 1N34T 1NAFA 3FHNA 3SS1A 2LM2A 2W2UA 4ANJA 4CXYA 2LHNA 5ABFB 5JDQA 4QXCB 5AQMB 1OEDB 3FXEB 1SA0E 2IAKA 3OBVE 2I6HA 2BZBA 1HCIA 2N2NA 2K48A 3AA1B 3Q2MA 2ODUA 2HHHT 5IYZE 4JI3T 2XQ6A 3LFMA 3U3IA 4QXBB 2KLQA 3O1HA 3GMIA 4ILCA 2BDEA 5AQLB 2V6YA 2Y8DA 3LDQB 3ZN0B 2H89A 1IZNB 2XSAA 5FNVE 2KWIB 2PG8A 2UXCT 3HKDE 5CA0E 3CQXC 1YW0A 3P7IA 5HXHA 4AKRB 4OFZA 5J0ZA 5FY1A 4B3RT 1MNDA 2FJBA 2KZ7B 3RIUA 1MMDA 4TV9E 5DJQC 3LK3B 4IE7A 2LOPA 2LM9A 1IJ5A 3HI2A 3UQ4A 2Q9QA 3SWHA 3SFDA 3PUGA 4EOZB 2YK0A 4OYKA 3CX6B 4N78D 4CN1A 5JVDE 3UTKA 3UUBA 3WI3A 1S94A 1M7KA 4EEDA 5LMNT 3LSVA 3C4ZA 2Y6XA 5AQKB 2VQET 2XZEA 2CHOA 3RYCE 3P4QA 1WR6A 4I4TE 5LHIB 3J7Yq 4X20E 3KBUA 1KF6A 2VKJA 2C5KT 1D1CA 3P4WA 4PJMA 2CHNA 5M4YA 5JDFA 4NUVA 5J1GA 5EK3A 4ADZA 4F6RC 2V7MA 1E7PA 3CQGB 3RF1A 4IIJE 3RRCA 4YT0A 5FY0A 2DI4A 2BVLA 3F31A 2JIWA 2FJDA 3L8RA 2ZM8A 4AKGA 3F57A 1UX5A 5AQRB 4MFRA 2E8IA 4H9OC 4I55E 2K24A 2ES0A 4ISTA 4ZZBA 3AE7A 3EABA 3GWHA 3VRBA 1UURA 4DUYT 3QC9A 3R6NA 4Z91A 3EDUA 3HA4A 4X1KE 2FJEA 4AI6A 3ZN1B 1J5WA 3CMLA 4PJNA 2BS3A 4H63V 2LT3A 3QUJA 4JEUB 1CUNA 5L3DB 5KMGP 2WBLA 4YFSA 2CMRA 3L09A 2E9XD 3RYHE 2HPJA 1U5PA 3NRYA 3HKBE 1N33T 4JI4T 1G8XA 4HWHA 1GQEA 2YOEA 3NRXA 2J1DG 2UXXB 3O9XA 2DLRA 4CI3B 3A5XA 1FMVA 4EZ4A 4GK5E 1QLBA 4I50E 3K3QC 3TKLB 2ACXA 3MK7C 3NZQA 4DR6T 1IJ6A 2IC9A 5LMUT 4PK4A 3TLTA 4O4LE 2E9XB 2YU1A 1HNWT 3AXJB 2JJ9A 2WCAA 4O8SA 5HXRA 5L3GB 3ANWB 4ZI3D 4NIQA 2UUBT 2E2AA 3AAAB 4IT4A 2X68A 3VR9A 2WWVA 1VOMA 3VKHA 2XAGB 5TAOA 2VKOA 4UIGA 3ZYKA 2LLYA 2HH7A 4LF4T 5FL1A 2P9BA 5HEHA 3EI0A 4HFBA 3ZKRA 5FYMA 1I94T 3BQKA 4YTPA 5IWAT 2N9DA 5HXCA 2I0MA 3AEGA 2MPKA 2BG9A 3UU6A 4TWHA 2A2FX 5JR9A 3UQ7A 3NWIA 5JQGE 2CLYC 4NXMT 2YDQA 2HN1A 2LOSA 4JI2T 5J2TE 3I0OA 1KNRA 4OK0A 3ZC0A 4DR2T 3KVBA 5HCMA 5FVKA 4IL9A 3RIUC 1W0BA 4NPPA 2ZM2A 1HX1B 5AQHB 2Q9QC 2LSGA 3ZPOA 2FUPA 4AXPA 1VRBA 5IUXA 4TUYE 4X1IE 1ZEEA 1YKEB 2LE8A 5L3FB 1UUSA 3QNUA 2R6GF 5LCYA 2NW9A 5LOVE 3DJBA 1IBMT 4CN4A 3N2OA 4UEMA 2X66A 2LEHA 5L3EB 2YDSA 3G06A 3NZPA 2DL1A 5LJNA 4UVBB 2WP9A 1KK7A 4ZI7E 3RYIE 5L47A 4KP3C 3OKQA 3CPZA 2I59A 2V26A 4KHPT 2CBJA 5L2LA 4DMWA 3PURA 3PJAA 3T1HT 2Y48B 3B5MA 3IF8B 3FBLA 3KV4A 3MJXA 4P1NA 5FP3A 4ZI2D 3KVAA 5KDMC 2A9UA 2LRLA 4KI0F 2K5BB 4Z90A 1XMOT 4PAGA 1J5ET 2WU2A 4LFBT 2LHRA 3GA8A 2W4XA 4JI7T
chains in the Genus database with same CATH topology
3O1HA 3GMIA 2BDEA 3I1AA 2KMFA 3N9OA 4QX8B 1S35A 4HEAA 2WAUA 2H7VC 4EXTA 2KXPB 2NWBA 3Q9DA 4UV8B 4DBQA 1MMNA 2LSIA 2Y8DA 3ZN0B 2VK9A 1IZNB 3LK42 2VB6A 3ZMSB 1US7B 2DNXA 3BQIA 5FNVE 2KWIB 5LG4A 2D0UA 5EK2A 2PG8A 3HKDE 5CA0E 3CQXC 2VWAA 2CWYA 4ZS3A 5LXTE 1WYBA 1YW0A 3P7IA 4GYSA 5HXHA 4AKRB 2NTYA 3UT5E 1BR4A 4U72A 2JMKA 4E7SA 2LJLA 4OFZA 2NW8A 5HAXA 3Q5XA 3C4WA 3CVRA 4AKIA 2SPCA 4TZ4C 3NBXX 5FY1A 2W62A 4TX5A 3IBPA 1MNDA 4CI2B 3F2EA 4HFVA 2DWKA 2EHOA 2KZ7B 1MMDA 2BVMA 5HWYA 2NW7A 4PW8A 4TV9E 4UF0B 3LK3B 5DJQC 4IE7A 4UV9B 2DCFA 1OXZA 3RYFE 2LOPA 2LM9A 1EZ3A 4AQGA 3P8CD 1V9DA 2NTXA 2XHEB 1IJ5A 3HI2A 4HKAA 2YEVC 3C51A 2Q9QA 4H9QC 3SWHA 3VHLA 2W61A 4NUUA 4GIWA 5F3JA 1MIYA 1MMAA 4G63A 3PUGA 4KMCA 4HN9A 3J9X1 4AKLA 3EUHA 2XTLA 3DP7A 4CXWA 4EOZB 2YK0A 5LP6E 4OYKA 3CX6B 4N78D 2XAJB 1FMWA 2CA5A 4H9SE 5JVDE 3UTKA 2MYSA 3WI3A 1S94A 4FI5A 5KX5E 5FMNA 2YINA 3N9PA 3C4ZA 4MHCA 2Y6XA 3RYCE 1WR6A 1UCUA 1HG5A 4WNKA 3DTOA 3C98B 4I4TE 5AFUL 2H3RA 5LHIB 4ISSA 3V5UA 4E7ZA 4GK0E 3J7Yq 4X20E 5FY7A 3KBUA 1ZV4X 2VKJA 3VU7H 5LNKA 2LSJA 1FEWA 2C5KT 1H7CA 1D1CA 3JC6C 3W15B 1D0YA 3D0TA 4PJMA 5H6QB 5M4YA 4GYRA 5LGUB 5JDFA 2C5IT 4XBFB 3ZC1A 2MOZA 5HWXA 4NUVA 5J1GA 5LHHB 4QX7B 5EK3A 2LSYA 1MNEA 3B13A 4ADZA 5E0OA 3FXDB 2ZMAA 3MACA 4ILUA 4F6RC 4MLKA 4K0UA 2V7MA 4H63H 5EZYE 3O1JA 1SHZC 2K9AA 3CQGB 4PFPA 3KV9A 4IIJE 5F8PA 3RH3A 3RRCA 3SRZA 3WAKA 4CZZB 4KUMB 5FY0A 2DI4A 2BVLA 4UVCB 3F31A 2HPLA 5DQVA 2JQQA 3U78A 3LJCA 2ZM8A 2XAFB 4AKGA 1LVFA 3F57A 1UX5A 4MFRA 2E8IA 4U74A 2ODVA 4H9OC 4I55E 2K24A 3N2GE 3N2KE 5CA1E 2KINB 2L9QA 2QA7A 2ES0A 3BQLA 4ISTA 3AVSA 3CQCB 3Q5WA 1YD8G 4AQFA 2X51A 3FBZA 3GWHA 1D1BA 3SOLA 5LJMA 1D0ZA 4YHJA 3QC9A 3R6NA 1AJ3A 2CWOA 3HKEE 3RRWA 3EDUA 4O4IE 3ZMUB 1U4QA 2NP9A 3HA4A 5FXVA 4IHJE 4X1KE 2XAQB 4WW0A 5LHGB 3C64A 1WYCA 4AI6A 3EVYA 3KBTA 3PDYA 4IE4A 3M65A 3T8OA 3ZN1B 3O1IA 3CMLA 4PJNA 2G0UA 2E9XC 2MTQA 4AKHA 4L5GA 3EDVA 4H63V 1KNZA 4UXNB 2LT3A 3OYZA 4V1Av 3QUJA 4JEUB 5JR9C 5L3BB 4H9PC 1CUNA 2WMNA 4TN7B 4WBOA 4YJ3E 3ZYLA 5L3DB 5ETWA 1LKXA 5KMGP 2WBLA 4YFSA 4A56A 2CMRA 4UVAB 1HF8A 3L09A 1HG2A 2E9XD 1BR0A 2PJQA 3RYHE 4L0RA 3ONXA 2L3LA 3B57A 2HPJA 3RPUA 5DQWA 2PBIA 3E08A 3LK2B 1NWMX 1Y64B 3LBXB 5HXSA 3IEEA 4BJMA 1U5PA 3NRYA 1G73A 2V1DB 2Z6EA 3HKBE 3AB3B 4PNIA 1G8XA 4Z8XA 5JH7E 2VL8A 3ZMZB 2W00A 1BR1A 3UUNA 3NRXA 1HFAA 2J1DG 2UXXB 5LGTB 1HS7A 2WSSV 2X9HA 3AAEB 4O4HE 3O9XA 3CX7B 3KDSE 4G2AA 5BMVE 1BR2A 2DLRA 4QWNB 3UUMA 2UXNB 4CI3B 1HX8A 2PFVA 1D1AA 2N1GA 5A1LA 2W63A 4O4JE 2CXFA 3A5XA 4I43B 3I0QA 1ZHCA 3N9NA 3UUXB 1FMVA 4DBRA 1MIWA 5JREA 2YU2A 4CI1B 5JDNA 4UELA 4EZ4A 3H3AA 3RC3A 4GK5E 4I50E 3K3QC 3MA9A 4GOUA 3FB2A 2D0TA 5HXEA 3TKLB 2ACXA 2L8KA 4P0AA 3MK7C 1OWAA 3NZQA 5LBQB 1D0XA 3E22E 4PJJA 4ZI3C 1IJ6A 2IC9A 3HR0A 4PK4A 3AA7B 1MIVA 3KV5A 2LSKA 4O4LE 4M1PA 2E9XB 2YU1A 1QSDA 4IGUA 2JPFA 4UF0A 3AA0B 2JJ9A 3GN5B 4O8SA 4EIWA 5HXRA 2X9YA 5H6RB 5L3GB 5JDHA 3ANWB 4ZI3D 4FJOA 5JR9B 1UX4A 5LGNB 3OJAA 2CLYB 4EYUA 3AAAB 2JRKA 3LG7A 3PUSA 4DNDA 2X68A 3KFWX 3UFEA 1WLXA 3ZYMA 2XAHB 3PU3A 1VOMA 3PE0A 4PFOA 5FXXA 5JRCB 2ZM0A 3VKHA 1HTJF 4P0BA 2XAGB 2WWUA 5TAOA 5DABA 2VKOA 3CWZB 5JDLA 3KV6A 4PJLA 3VKGA 2EHOB 2V7KA 3CKDA 1T98A 4L9IA 3ZCJA 2DHRA 4IE6A 4KBMB 4UIGA 2RP4A 4JEHB 4EB6E 3ZYKA 2KNDA 5C8YE 2CM0A 3ETVA 2HH7A 5FXZA 4P09A 4BJNA 2P9BA 4EZHA 2A3DA 4ASKA 1LRZA 4PK5A 4XAXB 3PUQA 5LYJE 5FYMA 4WBNE 2D2SA 3N5LA 1FIOA 2IW5B 3BQKA 4HE8A 4H9NC 2X9WA 2VASA 3C4XA 3ZJ2A 4HGAA 4B6XA 3ESLA 4CQIA 3ZEFB 1QUUA 3K3OA 5EK4A 4OYJA 2N9DA 4OHFA 4CXXA 3I9WA 3ZMTB 5L3CB 2WMOA 4QXHB 5HXCA 3ETUA 4QHOA 2E9XA 2QGSA 4J2CA 3GN5A 5FXWA 4IE0A 3ANWA 5J2UE 4DVDA 2A2FX 5JR9A 2A72A 2XASB 1O3XA 4BA9A 1LVKA 5LBMA 3S4UA 5IHYA 5JQGE 2CLYC 2X0LB 3IHRA 3R84B 4PK6A 4ERRA 4O2BE 3HL6A 3L3PA 4ZS2A 5GONE 2LOSA 2W0GA 5J2TE 4MBQA 3K3NA 3I0OA 5LA6E 4OK0A 5JRCA 3ZC0A 3ZLIA 3KVBA 5JDMA 4DMVA 2IC6A 1ZKEA 3UULA 3RX6A 2EHOC 5CB4E 1YKHB 2DWGA 4ZOLE 3K8PC 3ZMVB 2ZM2A 1MMGA 3BK9A 2OA5A 3OYXA 2B1EA 2CCQA 2M67A 3N9QA 2Q9QC 2X67A 3N9MA 2CXLA 2EHOD 3E0ZA 2LSGA 2V7IA 4H9RC 3ZPOA 1IAPA 4AXPA 1WRDA 3AAIA 3CX8B 1VRBA 2V7LA 4X1YE 4O2AE 4TUYE 3AVRA 4X1IE 1ZEEA 4MALA 1YKEB 3KINB 2LE8A 2D5UA 5ADXL 5L3FB 3AA6B 3I9YA 1NAFA 5LCYA 2Q9QD 2NW9A 5LOVE 3RC8A 3DJBA 2KT9A 3FHNA 4JUYA 3SS1A 3N2OA 4UEMA 2H7OA 2ZLYA 2VKHA 2X66A 3ZJ1A 3H37A 3MXZA 3PTRB 4ANJA 2C5JA 2LEHA 5L3EB 3HKCE 4CXYA 2LHNA 3NZPA 4JLEA 5LJNA 4UVBB 2XUEA 1KK7A 4ZI7E 2KWHA 3RYIE 3ZCIA 3RKOA 1B7TA 3LBXA 4KP3C 1Z0PA 3OKQA 5JDQA 3CPZA 2NOXA 1E1HB 2I59A 2V26A 2RA1A 4ZHQE 4QXCB 2X9XA 3FXEB 1SA0E 2V7JA 2IAKA 5L2LA 4ZI2C 3OBVE 4DMWA 2BZBA 4HTEA 4QKNA 4XZCA 1HCIA 3PU8A 1X79A 2N2NA 2MBGA 2K48A 3AA1B 3PURA 4TV8E 2Y48B 3QK6A 2CE7A 3IF8B 3FBLA 3WAJA 4YLHA 3KV4A 3JC6D 3MJXA 4BAYB 4YJ2E 5FP3A 4EYYR 2WM9A 4ZI2D 3KVAA 5KDMC 4IE5A 2JMHA 2GK9A 3MZKB 3Q2MA 4C91A 3PUAA 3C50A 2Q9QB 2ODUA 2K5BB 2XQYA 5IYZE 4C90A 4PAGA 3V5SA 4EAHA 2C0SA 3N9LA 5HYAA 3MKDA 4DO0A 5JDGA 3LFMA 3U3IA 2CXDA 4IDZA 4QXBB 2LHRA 3GA8A 2CEAA 2VKDA 3O4XE 2KLQA 4AQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CMR A;  3MA9 A;  3MAC A; 
#chains in the Genus database with same CATH topology
 4QX8 B;  4HEA A;  2NWB A;  5ABF A;  4ZEY A;  2VB6 A;  5LG4 A;  5EK2 A;  1HNX T;  2X0H A;  2VWA A;  2CWY A;  1WYB A;  4GYS A;  3JAF A;  1OED A;  2JMK A;  2NW8 A;  4LML A;  5HAX A;  3Q5X A;  3C4W A;  4TZ4 C;  3FZL B;  3NBX X;  2W62 A;  4TX5 A;  1N36 T;  4CI2 B;  3F2E A;  1KEY A;  2EHO A;  4QH5 A;  4UF0 B;  2DCF A;  3RYF E;  1EZ3 A;  2BBJ A;  1V9D A;  4QH4 A;  2YEV C;  2XQ5 A;  5AQV B;  5LG3 A;  4GKK T;  3P4P A;  4HWI B;  2W61 A;  1M62 A;  2KSR A;  4G63 A;  3QOF A;  4KMC A;  4AKL A;  2XQ4 A;  5LP6 E;  2XAJ B;  2XM2 A;  1FMW A;  2CA5 A;  3RGL A;  4FI5 A;  5FMN A;  2V5C A;  1HG5 A;  3DTO A;  3C98 B;  5AFU L;  4LF8 T;  2H3R A;  4E7Z A;  3X1D A;  4GK0 E;  5FY7 A;  4DV5 T;  3VU7 H;  2VVN A;  3JC6 C;  5AQN B;  4F8H A;  4AQY T;  4GYR A;  4EEB A;  2MOZ A;  5HWX A;  5CJ5 A;  4YHH T;  2LSY A;  1MNE A;  3FXD B;  2ZMA A;  3MAC A;  4IDN A;  1W0A A;  4JI6 T;  5BR8 T;  1SHZ C;  2WQY A;  4PFP A;  3KV9 A;  5F8P A;  3SRZ A;  4ILA A;  2XPK A;  4KUM B;  4UVC B;  2JQQ A;  4HFE A;  2XAF B;  1Y01 A;  2AE9 A;  3RHW A;  3N2G E;  3N2K E;  4HWD A;  2L9Q A;  2QA7 A;  3AEB A;  2X51 A;  1AJ3 A;  3HKE E;  5HCJ A;  3AEA A;  4O4I E;  5FXV A;  1IBL T;  4DR1 T;  2XAQ B;  5LHG B;  3T8O A;  2G0U A;  3TLU A;  1KNP A;  4AKH A;  2BG9 C;  4UXN B;  5CGM A;  5JR9 C;  2JQH A;  5L3B B;  4WBO A;  4K0K T;  1LKX A;  3K1S A;  1R8I A;  2PJQ A;  5AQF B;  3EAM A;  4DID B;  3RPU A;  4LF9 T;  2PBI A;  3E08 A;  1NWM X;  5CFB A;  4X64 T;  2W00 A;  3UU5 A;  1UGO A;  3UUN A;  2X9H A;  1BR2 A;  1VCT A;  2UXN B;  2PFV A;  1D1A A;  3M3Z B;  1ZHC A;  3UUX B;  4JI0 T;  1MIW A;  4KHZ F;  4YXD A;  2M6I A;  2YKS A;  3MA9 A;  3QB5 K;  5L4E A;  2L8K A;  5AQO B;  5LBQ B;  1D0X A;  4YSY A;  3HR0 A;  3AA7 B;  2CBI A;  4M1P A;  2YDR A;  3GN5 B;  4EIW A;  4HWF A;  2X9Y A;  2V6Y B;  4FJO A;  1HR0 T;  5LGN B;  2XY8 B;  2XQA A;  2CLY B;  2JRK A;  3LG7 A;  1XZY A;  3UFE A;  2WDR A;  4X62 T;  3ZYM A;  3PU3 A;  4PFO A;  5JRC B;  1HTJ F;  2WWU A;  3CWZ B;  4LMJ A;  2FJA A;  3VKG A;  1X9B A;  2V7K A;  1T98 A;  3ZCJ A;  4U3C A;  4IDO A;  2KND A;  2VL0 A;  5C8Y E;  2CM0 A;  4JI5 T;  3TLW A;  4BJN A;  4EZH A;  4XAX B;  2XM1 A;  5LYJ E;  4WBN E;  3PUW F;  2D2S A;  3ABV A;  3PUZ F;  2IW5 B;  4HE8 A;  3RQW A;  4CQI A;  3K3O A;  4OYJ A;  4OHF A;  4QHO A;  2E9X A;  3AXJ A;  5FXW A;  3ANW A;  2XAS B;  1E2A A;  4BA9 A;  2X0L B;  3IHR A;  4PK6 A;  4O2B E;  1OED C;  3L3P A;  4ZS2 A;  2BKO A;  3AE4 A;  4MBQ A;  3AE3 A;  5LA6 E;  2CRB A;  5JDM A;  3RX6 A;  2EHO C;  5CB4 E;  1YKH B;  2DWG A;  2BKP A;  4X5T A;  3BK9 A;  2OA5 A;  2UUA T;  3N9Q A;  1JNZ A;  3RLF F;  2CXL A;  1XNR T;  1IAP A;  4O2A E;  2CPT A;  2WZH A;  5ADX L;  3AA6 B;  3I9Y A;  2HN2 A;  4JUY A;  2H7O A;  1NEK A;  2VKH A;  2ZLY A;  3ZJ1 A;  3MXZ A;  3PTR B;  2C5J A;  4JLE A;  4ILB A;  3Q5E A;  4KX6 A;  4HWC A;  2F4V T;  2LKH A;  1B7T A;  3LBX A;  2W67 A;  1Z0P A;  3RIF A;  2NOX A;  1E1H B;  4ZHQ E;  4DR4 T;  2X9X A;  3TLV A;  2V7J A;  1WCR A;  3AE1 A;  2QRX A;  4HTE A;  4XZC A;  3PU8 A;  1X79 A;  3QK6 A;  2CE7 A;  2J4G A;  3WAJ A;  3JC6 D;  4BAY B;  4YJ2 E;  2E5L T;  2JMH A;  2GK9 A;  4DV3 T;  3PUA A;  2XJ7 A;  2XQY A;  3AE6 A;  4C90 A;  3V5S A;  5HYA A;  4DO0 A;  5JDG A;  2CXD A;  4IDZ A;  2CEA A;  2VKD A;  2VVS A;  4A97 A;  1HNZ T;  3ONL C;  4WYV A;  2H7V C;  4EXT A;  2KXP B;  4UV8 B;  4DBQ A;  1VCS A;  1MMN A;  4LFA T;  3LK4 2;  1US7 B;  2D0U A;  2V6X A;  5LXT E;  2NTY A;  3UT5 E;  1BR4 A;  4U72 A;  4E7S A;  2LJL A;  4DR3 T;  1XNQ T;  4HFI A;  3IBP A;  2DWK A;  5HWY A;  3AE5 A;  2NW7 A;  2XQ7 A;  1SE7 A;  3C51 A;  3VHL A;  2JQ9 A;  5F3J A;  3FZH B;  4HN9 A;  2WS3 A;  3EUH A;  3DP7 A;  2IIU A;  3RKG A;  5C3J A;  3ZT5 A;  2LKG A;  3N9P A;  4MHC A;  4DR7 T;  3JCF A;  1KFY A;  4WNK A;  1W09 A;  4ISS A;  3V5U A;  4U7Y A;  3PUY F;  5AQP B;  2LSJ A;  4OX9 T;  3W15 B;  1D0Y A;  3D0T A;  2BS4 A;  5H6Q B;  2BBH A;  4XBF B;  2K3W A;  2BG9 B;  2H88 A;  4CN6 A;  3FZM B;  3B13 A;  2IHR 1;  4H63 H;  3O1J A;  3RH3 A;  5DQV A;  4JBW F;  1LVF A;  4U74 A;  2ODV A;  4B3S T;  3BQL A;  3FZK B;  1T8B A;  4AQF A;  1YD8 G;  5JTG A;  3FBZ A;  3SOL A;  1D0Z A;  1XDP A;  4YHJ A;  1WFD A;  1U4Q A;  2NP9 A;  1UK5 A;  4LMK A;  1N32 T;  3C64 A;  3KBT A;  4IE4 A;  3PDY A;  3M65 A;  3O1I A;  4B3T T;  2E9X C;  4L5G A;  3EDV A;  2ZM6 T;  2BG9 E;  4V1A v;  4H9P C;  4TN7 B;  1ZP0 A;  3ZYL A;  4YJ3 E;  5ETW A;  3CK6 A;  4TNV A;  4UVA B;  1HG2 A;  1BR0 A;  4L0R A;  3A7M A;  2WDQ A;  2L3L A;  5DQW A;  4Q25 A;  4DUZ T;  5HXS A;  1G73 A;  2Z6E A;  4PNI A;  2VL8 A;  1NEN A;  3ZMZ B;  5AQU B;  3JAE A;  2WU5 A;  1HFA A;  4YSZ A;  1HS7 A;  4O4H E;  3JAD A;  2AXD S;  2J62 A;  4G2A A;  3AE8 A;  4YY3 T;  3UUM A;  4LF7 T;  1CHU A;  2N1G A;  3VRA A;  5A1L A;  3I0Q A;  3N9N A;  1XMQ T;  4DBR A;  5JRE A;  4UEL A;  3RC3 A;  4GOU A;  4AIU A;  3E22 E;  4PJJ A;  4ZI3 C;  2ACZ A;  3UU8 A;  3KV5 A;  4A98 A;  3AA0 B;  3OVU A;  5JDH A;  3OJA A;  3PUS A;  4DND A;  3KFW X;  1XWM A;  1WLX A;  4NXN T;  4HFC A;  2XAH B;  5FXX A;  3PE0 A;  2OLT A;  4P0B A;  5DAB A;  5JDL A;  2IML A;  4PJL A;  2MAW A;  2EHO B;  2RP4 A;  4JEH B;  4EB6 E;  3ETV A;  4P09 A;  4ASK A;  4PK5 A;  1Z8U A;  3N5L A;  5LB7 B;  4H9N C;  3C4X A;  5FL0 A;  4HGA A;  4B6X A;  3ESL A;  1QUU A;  4CXX A;  3I9W A;  3ZMT B;  5L3C B;  2W66 A;  3ETU A;  2QGS A;  2IUB A;  4J2C A;  3GN5 A;  2A72 A;  1O3X A;  1LVK A;  3S4U A;  4LFC T;  1I6Z A;  5AQS B;  4U7I A;  3HL6 A;  1OED E;  2W0G A;  3K3N A;  5JRC A;  3P4S A;  2E5V A;  3UUL A;  2D9D A;  3ZST A;  1MMG A;  2M67 A;  2X67 A;  3N9M A;  3E0Z A;  2V7I A;  1WRD A;  3AAI A;  3CX8 B;  3KIN B;  3SFE A;  2QYW A;  2D5U A;  2Q9Q D;  3RC8 A;  2KT9 A;  3ZT7 A;  2UXD T;  5ABH A;  4JI8 T;  4U33 A;  4EGW A;  3AED A;  4GKJ T;  3H37 A;  5AQQ B;  3HKC E;  2XUE A;  2KWH A;  3ZCI A;  1SUM B;  3RKO A;  4TWD A;  2RA1 A;  3A8Y C;  4ZI2 C;  2VQF T;  3Q5D A;  4QKN A;  2MBG A;  4TV8 E;  4YLH A;  4EYY R;  2WM9 A;  4IE5 A;  3MZK B;  2WY2 A;  4C91 A;  3PJA J;  3ONJ A;  3C50 A;  2Q9Q B;  2XQ3 A;  4JI1 T;  4EAH A;  2VUR A;  4UR9 A;  2BKN A;  2C0S A;  3N9L A;  3MKD A;  3O4X E;  4AQF C;  5L4H A;  3I1A A;  2KMF A;  3N9O A;  5AQT B;  1S35 A;  2WAU A;  3Q9D A;  2LSI A;  2VK9 A;  3L39 A;  3ZMS B;  2DNX A;  3BQI A;  2J47 A;  3RQU A;  4ZS3 A;  5AQI B;  3UU4 A;  2XQ9 A;  3CVR A;  3TLS A;  4AKI A;  2SPC A;  4JV5 T;  4A5X A;  4HFV A;  2BVM A;  4PW8 A;  1YQ3 A;  4IDP A;  5HEJ A;  4UV9 B;  3VR8 A;  1OXZ A;  4AQG A;  3P8C D;  2NTX A;  2XHE B;  5AQJ B;  4HKA A;  4X66 T;  4H9Q C;  5KXJ A;  4NUU A;  2NR4 A;  4GIW A;  2V5D A;  2B76 A;  1MIY A;  5ABE A;  1MMA A;  3J9X 1;  3EHZ A;  2XTL A;  4CXW A;  2WB5 A;  1XDO A;  2JQK A;  5AQG B;  4DV1 T;  4H9S E;  2MYS A;  4I0U A;  1JNR A;  2IDO B;  2FBW A;  5KX5 E;  2YIN A;  4U31 A;  2X0Y A;  2UUC T;  1UCU A;  4HFD A;  5HEO A;  1ZV4 X;  5LNK A;  1FEW A;  1H7C A;  5LGU B;  2C5I T;  3ZC1 A;  5LHH B;  1WR0 A;  4QX7 B;  2OV9 A;  3AEC A;  4DV0 T;  4HFH A;  3H3M A;  2PTF A;  4U2Z A;  4DV6 T;  3PUV F;  5E0O A;  4ILU A;  4MLK A;  4K0U A;  5EZY E;  2K9A A;  3QB5 A;  3WAK A;  4CZZ B;  2XQ8 A;  2HPL A;  2BS2 A;  1DU2 A;  4LF6 T;  3U78 A;  4YTM A;  3LJC A;  4COF A;  4DV7 T;  5CA1 E;  2KIN B;  5FVL A;  2XSB A;  3UU3 A;  3AVS A;  3CQC B;  3Q5W A;  2UXB T;  1D1B A;  5LJM A;  5C2T A;  2CWO A;  4ZZC A;  3RRW A;  3ZMU B;  3OTO T;  3CIR A;  4IHJ E;  4U2Y A;  4WW0 A;  1FJG T;  1WYC A;  4IDQ A;  3EVY A;  2MTQ A;  3AE9 A;  1KNZ A;  3OYZ A;  4DV4 T;  3T1Y T;  2WMN A;  4A56 A;  1HF8 A;  3ONX A;  3B57 A;  3LK2 B;  1Y64 B;  3LBX B;  3IEE A;  4BJM A;  2YN6 A;  2V1D B;  3AB3 B;  4Z8X A;  1W9R A;  4IRE A;  5JH7 E;  2RPA A;  2WDV A;  2V8S V;  4DV2 T;  1BR1 A;  4AIS A;  3PUX F;  5LGT B;  2WSS V;  3AAE B;  3CX7 B;  3KDS E;  5BMV E;  2M6B A;  1IBK T;  4X65 T;  4QWN B;  1HX8 A;  2W63 A;  4O4J E;  2CXF A;  4I43 B;  4B3M T;  1YXR A;  2YU2 A;  4CI1 B;  5JDN A;  3H3A A;  4YTN A;  3FB2 A;  2D0T A;  5HXE A;  3RI5 A;  3NKZ A;  4P0A A;  1OWA A;  3RIA A;  3IA3 A;  4QH1 A;  1MIV A;  2LSK A;  5HEU A;  4IGU A;  1QSD A;  2JPF A;  4UF0 A;  5F5W A;  5H6R B;  4YSX A;  5JR9 B;  1UX4 A;  4EYU A;  4ZXL A;  5FKY A;  1T72 A;  2ZM0 A;  1ZOY A;  3FZF B;  1T7S A;  3KV6 A;  1J1J A;  3CKD A;  4L9I A;  2DHR A;  3AE2 A;  4IE6 A;  4KBM B;  4TWF A;  2QVA A;  4EV6 A;  5HEG A;  5FXZ A;  2WZI A;  2A3D A;  3ZSS A;  1LRZ A;  5ABG A;  3PUQ A;  1FIO A;  3UFG A;  2X9W A;  2VAS A;  3ZJ2 A;  3P4R A;  2UU9 T;  3ZEF B;  3AEF A;  5EK4 A;  2WMO A;  4QXH B;  4DR5 T;  2LRK A;  4IE0 A;  5J2U E;  4DVD A;  4LF5 T;  5LBM A;  5IHY A;  1L0V A;  3R84 B;  4ERR A;  5GON E;  3AEE A;  3ZLI A;  4DMV A;  2IC6 A;  1ZKE A;  4TNW A;  4ZOL E;  3K8P C;  3ZMV B;  3OYX A;  4JYA T;  2B1E A;  2CCQ A;  3PV0 F;  2EHO D;  4WZX A;  4H9R C;  3OPC A;  3P50 A;  2V7L A;  3NVO A;  4X1Y E;  3ZT6 A;  3AVR A;  1YQ4 A;  4MAL A;  4IL4 A;  1N34 T;  1NAF A;  3FHN A;  3SS1 A;  2LM2 A;  2W2U A;  4ANJ A;  4CXY A;  2LHN A;  5ABF B;  5JDQ A;  4QXC B;  5AQM B;  1OED B;  3FXE B;  1SA0 E;  2IAK A;  3OBV E;  2I6H A;  2BZB A;  1HCI A;  2N2N A;  2K48 A;  3AA1 B;  3Q2M A;  2ODU A;  2HHH T;  5IYZ E;  4JI3 T;  2XQ6 A;  3LFM A;  3U3I A;  4QXB B;  2KLQ A;  3O1H A;  3GMI A;  4ILC A;  2BDE A;  5AQL B;  2V6Y A;  2Y8D A;  3LDQ B;  3ZN0 B;  2H89 A;  1IZN B;  2XSA A;  5FNV E;  2KWI B;  2PG8 A;  2UXC T;  3HKD E;  5CA0 E;  3CQX C;  1YW0 A;  3P7I A;  5HXH A;  4AKR B;  4OFZ A;  5J0Z A;  5FY1 A;  4B3R T;  1MND A;  2FJB A;  2KZ7 B;  3RIU A;  1MMD A;  4TV9 E;  5DJQ C;  3LK3 B;  4IE7 A;  2LOP A;  2LM9 A;  1IJ5 A;  3HI2 A;  3UQ4 A;  2Q9Q A;  3SWH A;  3SFD A;  3PUG A;  4EOZ B;  2YK0 A;  4OYK A;  3CX6 B;  4N78 D;  4CN1 A;  5JVD E;  3UTK A;  3UUB A;  3WI3 A;  1S94 A;  1M7K A;  4EED A;  5LMN T;  3LSV A;  3C4Z A;  2Y6X A;  5AQK B;  2VQE T;  2XZE A;  2CHO A;  3RYC E;  3P4Q A;  1WR6 A;  4I4T E;  5LHI B;  3J7Y q;  4X20 E;  3KBU A;  1KF6 A;  2VKJ A;  2C5K T;  1D1C A;  3P4W A;  4PJM A;  2CHN A;  5M4Y A;  5JDF A;  4NUV A;  5J1G A;  5EK3 A;  4ADZ A;  4F6R C;  2V7M A;  1E7P A;  3CQG B;  3RF1 A;  4IIJ E;  3RRC A;  4YT0 A;  5FY0 A;  2DI4 A;  2BVL A;  3F31 A;  2JIW A;  2FJD A;  3L8R A;  2ZM8 A;  4AKG A;  3F57 A;  1UX5 A;  5AQR B;  4MFR A;  2E8I A;  4H9O C;  4I55 E;  2K24 A;  2ES0 A;  4IST A;  4ZZB A;  3AE7 A;  3EAB A;  3GWH A;  3VRB A;  1UUR A;  4DUY T;  3QC9 A;  3R6N A;  4Z91 A;  3EDU A;  3HA4 A;  4X1K E;  2FJE A;  4AI6 A;  3ZN1 B;  1J5W A;  3CML A;  4PJN A;  2BS3 A;  4H63 V;  2LT3 A;  3QUJ A;  4JEU B;  1CUN A;  5L3D B;  5KMG P;  2WBL A;  4YFS A;  2CMR A;  3L09 A;  2E9X D;  3RYH E;  2HPJ A;  1U5P A;  3NRY A;  3HKB E;  1N33 T;  4JI4 T;  1G8X A;  4HWH A;  1GQE A;  2YOE A;  3NRX A;  2J1D G;  2UXX B;  3O9X A;  2DLR A;  4CI3 B;  3A5X A;  1FMV A;  4EZ4 A;  4GK5 E;  1QLB A;  4I50 E;  3K3Q C;  3TKL B;  2ACX A;  3MK7 C;  3NZQ A;  4DR6 T;  1IJ6 A;  2IC9 A;  5LMU T;  4PK4 A;  3TLT A;  4O4L E;  2E9X B;  2YU1 A;  1HNW T;  3AXJ B;  2JJ9 A;  2WCA A;  4O8S A;  5HXR A;  5L3G B;  3ANW B;  4ZI3 D;  4NIQ A;  2UUB T;  2E2A A;  3AAA B;  4IT4 A;  2X68 A;  3VR9 A;  2WWV A;  1VOM A;  3VKH A;  2XAG B;  5TAO A;  2VKO A;  4UIG A;  3ZYK A;  2LLY A;  2HH7 A;  4LF4 T;  5FL1 A;  2P9B A;  5HEH A;  3EI0 A;  4HFB A;  3ZKR A;  5FYM A;  1I94 T;  3BQK A;  4YTP A;  5IWA T;  2N9D A;  5HXC A;  2I0M A;  3AEG A;  2MPK A;  2BG9 A;  3UU6 A;  4TWH A;  2A2F X;  5JR9 A;  3UQ7 A;  3NWI A;  5JQG E;  2CLY C;  4NXM T;  2YDQ A;  2HN1 A;  2LOS A;  4JI2 T;  5J2T E;  3I0O A;  1KNR A;  4OK0 A;  3ZC0 A;  4DR2 T;  3KVB A;  5HCM A;  5FVK A;  4IL9 A;  3RIU C;  1W0B A;  4NPP A;  2ZM2 A;  1HX1 B;  5AQH B;  2Q9Q C;  2LSG A;  3ZPO A;  2FUP A;  4AXP A;  1VRB A;  5IUX A;  4TUY E;  4X1I E;  1ZEE A;  1YKE B;  2LE8 A;  5L3F B;  1UUS A;  3QNU A;  2R6G F;  5LCY A;  2NW9 A;  5LOV E;  3DJB A;  1IBM T;  4CN4 A;  3N2O A;  4UEM A;  2X66 A;  2LEH A;  5L3E B;  2YDS A;  3G06 A;  3NZP A;  2DL1 A;  5LJN A;  4UVB B;  2WP9 A;  1KK7 A;  4ZI7 E;  3RYI E;  5L47 A;  4KP3 C;  3OKQ A;  3CPZ A;  2I59 A;  2V26 A;  4KHP T;  2CBJ A;  5L2L A;  4DMW A;  3PUR A;  3PJA A;  3T1H T;  2Y48 B;  3B5M A;  3IF8 B;  3FBL A;  3KV4 A;  3MJX A;  4P1N A;  5FP3 A;  4ZI2 D;  3KVA A;  5KDM C;  2A9U A;  2LRL A;  4KI0 F;  2K5B B;  4Z90 A;  1XMO T;  4PAG A;  1J5E T;  2WU2 A;  4LFB T;  2LHR A;  3GA8 A;  2W4X A;  4JI7 T; 
#chains in the Genus database with same CATH homology
 3O1H A;  3GMI A;  2BDE A;  3I1A A;  2KMF A;  3N9O A;  4QX8 B;  1S35 A;  4HEA A;  2WAU A;  2H7V C;  4EXT A;  2KXP B;  2NWB A;  3Q9D A;  4UV8 B;  4DBQ A;  1MMN A;  2LSI A;  2Y8D A;  3ZN0 B;  2VK9 A;  1IZN B;  3LK4 2;  2VB6 A;  3ZMS B;  1US7 B;  2DNX A;  3BQI A;  5FNV E;  2KWI B;  5LG4 A;  2D0U A;  5EK2 A;  2PG8 A;  3HKD E;  5CA0 E;  3CQX C;  2VWA A;  2CWY A;  4ZS3 A;  5LXT E;  1WYB A;  1YW0 A;  3P7I A;  4GYS A;  5HXH A;  4AKR B;  2NTY A;  3UT5 E;  1BR4 A;  4U72 A;  2JMK A;  4E7S A;  2LJL A;  4OFZ A;  2NW8 A;  5HAX A;  3Q5X A;  3C4W A;  3CVR A;  4AKI A;  2SPC A;  4TZ4 C;  3NBX X;  5FY1 A;  2W62 A;  4TX5 A;  3IBP A;  1MND A;  4CI2 B;  3F2E A;  4HFV A;  2DWK A;  2EHO A;  2KZ7 B;  1MMD A;  2BVM A;  5HWY A;  2NW7 A;  4PW8 A;  4TV9 E;  4UF0 B;  3LK3 B;  5DJQ C;  4IE7 A;  4UV9 B;  2DCF A;  1OXZ A;  3RYF E;  2LOP A;  2LM9 A;  1EZ3 A;  4AQG A;  3P8C D;  1V9D A;  2NTX A;  2XHE B;  1IJ5 A;  3HI2 A;  4HKA A;  2YEV C;  3C51 A;  2Q9Q A;  4H9Q C;  3SWH A;  3VHL A;  2W61 A;  4NUU A;  4GIW A;  5F3J A;  1MIY A;  1MMA A;  4G63 A;  3PUG A;  4KMC A;  4HN9 A;  3J9X 1;  4AKL A;  3EUH A;  2XTL A;  3DP7 A;  4CXW A;  4EOZ B;  2YK0 A;  5LP6 E;  4OYK A;  3CX6 B;  4N78 D;  2XAJ B;  1FMW A;  2CA5 A;  4H9S E;  5JVD E;  3UTK A;  2MYS A;  3WI3 A;  1S94 A;  4FI5 A;  5KX5 E;  5FMN A;  2YIN A;  3N9P A;  3C4Z A;  4MHC A;  2Y6X A;  3RYC E;  1WR6 A;  1UCU A;  1HG5 A;  4WNK A;  3DTO A;  3C98 B;  4I4T E;  5AFU L;  2H3R A;  5LHI B;  4ISS A;  3V5U A;  4E7Z A;  4GK0 E;  3J7Y q;  4X20 E;  5FY7 A;  3KBU A;  1ZV4 X;  2VKJ A;  3VU7 H;  5LNK A;  2LSJ A;  1FEW A;  2C5K T;  1H7C A;  1D1C A;  3JC6 C;  3W15 B;  1D0Y A;  3D0T A;  4PJM A;  5H6Q B;  5M4Y A;  4GYR A;  5LGU B;  5JDF A;  2C5I T;  4XBF B;  3ZC1 A;  2MOZ A;  5HWX A;  4NUV A;  5J1G A;  5LHH B;  4QX7 B;  5EK3 A;  2LSY A;  1MNE A;  3B13 A;  4ADZ A;  5E0O A;  3FXD B;  2ZMA A;  3MAC A;  4ILU A;  4F6R C;  4MLK A;  4K0U A;  2V7M A;  4H63 H;  5EZY E;  3O1J A;  1SHZ C;  2K9A A;  3CQG B;  4PFP A;  3KV9 A;  4IIJ E;  5F8P A;  3RH3 A;  3RRC A;  3SRZ A;  3WAK A;  4CZZ B;  4KUM B;  5FY0 A;  2DI4 A;  2BVL A;  4UVC B;  3F31 A;  2HPL A;  5DQV A;  2JQQ A;  3U78 A;  3LJC A;  2ZM8 A;  2XAF B;  4AKG A;  1LVF A;  3F57 A;  1UX5 A;  4MFR A;  2E8I A;  4U74 A;  2ODV A;  4H9O C;  4I55 E;  2K24 A;  3N2G E;  3N2K E;  5CA1 E;  2KIN B;  2L9Q A;  2QA7 A;  2ES0 A;  3BQL A;  4IST A;  3AVS A;  3CQC B;  3Q5W A;  1YD8 G;  4AQF A;  2X51 A;  3FBZ A;  3GWH A;  1D1B A;  3SOL A;  5LJM A;  1D0Z A;  4YHJ A;  3QC9 A;  3R6N A;  1AJ3 A;  2CWO A;  3HKE E;  3RRW A;  3EDU A;  4O4I E;  3ZMU B;  1U4Q A;  2NP9 A;  3HA4 A;  5FXV A;  4IHJ E;  4X1K E;  2XAQ B;  4WW0 A;  5LHG B;  3C64 A;  1WYC A;  4AI6 A;  3EVY A;  3KBT A;  3PDY A;  4IE4 A;  3M65 A;  3T8O A;  3ZN1 B;  3O1I A;  3CML A;  4PJN A;  2G0U A;  2E9X C;  2MTQ A;  4AKH A;  4L5G A;  3EDV A;  4H63 V;  1KNZ A;  4UXN B;  2LT3 A;  3OYZ A;  4V1A v;  3QUJ A;  4JEU B;  5JR9 C;  5L3B B;  4H9P C;  1CUN A;  2WMN A;  4TN7 B;  4WBO A;  4YJ3 E;  3ZYL A;  5L3D B;  5ETW A;  1LKX A;  5KMG P;  2WBL A;  4YFS A;  4A56 A;  2CMR A;  4UVA B;  1HF8 A;  3L09 A;  1HG2 A;  2E9X D;  1BR0 A;  2PJQ A;  3RYH E;  4L0R A;  3ONX A;  2L3L A;  3B57 A;  2HPJ A;  3RPU A;  5DQW A;  2PBI A;  3E08 A;  3LK2 B;  1NWM X;  1Y64 B;  3LBX B;  5HXS A;  3IEE A;  4BJM A;  1U5P A;  3NRY A;  1G73 A;  2V1D B;  2Z6E A;  3HKB E;  3AB3 B;  4PNI A;  1G8X A;  4Z8X A;  5JH7 E;  2VL8 A;  3ZMZ B;  2W00 A;  1BR1 A;  3UUN A;  3NRX A;  1HFA A;  2J1D G;  2UXX B;  5LGT B;  1HS7 A;  2WSS V;  2X9H A;  3AAE B;  4O4H E;  3O9X A;  3CX7 B;  3KDS E;  4G2A A;  5BMV E;  1BR2 A;  2DLR A;  4QWN B;  3UUM A;  2UXN B;  4CI3 B;  1HX8 A;  2PFV A;  1D1A A;  2N1G A;  5A1L A;  2W63 A;  4O4J E;  2CXF A;  3A5X A;  4I43 B;  3I0Q A;  1ZHC A;  3N9N A;  3UUX B;  1FMV A;  4DBR A;  1MIW A;  5JRE A;  2YU2 A;  4CI1 B;  5JDN A;  4UEL A;  4EZ4 A;  3H3A A;  3RC3 A;  4GK5 E;  4I50 E;  3K3Q C;  3MA9 A;  4GOU A;  3FB2 A;  2D0T A;  5HXE A;  3TKL B;  2ACX A;  2L8K A;  4P0A A;  3MK7 C;  1OWA A;  3NZQ A;  5LBQ B;  1D0X A;  3E22 E;  4PJJ A;  4ZI3 C;  1IJ6 A;  2IC9 A;  3HR0 A;  4PK4 A;  3AA7 B;  1MIV A;  3KV5 A;  2LSK A;  4O4L E;  4M1P A;  2E9X B;  2YU1 A;  1QSD A;  4IGU A;  2JPF A;  4UF0 A;  3AA0 B;  2JJ9 A;  3GN5 B;  4O8S A;  4EIW A;  5HXR A;  2X9Y A;  5H6R B;  5L3G B;  5JDH A;  3ANW B;  4ZI3 D;  4FJO A;  5JR9 B;  1UX4 A;  5LGN B;  3OJA A;  2CLY B;  4EYU A;  3AAA B;  2JRK A;  3LG7 A;  3PUS A;  4DND A;  2X68 A;  3KFW X;  3UFE A;  1WLX A;  3ZYM A;  2XAH B;  3PU3 A;  1VOM A;  3PE0 A;  4PFO A;  5FXX A;  5JRC B;  2ZM0 A;  3VKH A;  1HTJ F;  4P0B A;  2XAG B;  2WWU A;  5TAO A;  5DAB A;  2VKO A;  3CWZ B;  5JDL A;  3KV6 A;  4PJL A;  3VKG A;  2EHO B;  2V7K A;  3CKD A;  1T98 A;  4L9I A;  3ZCJ A;  2DHR A;  4IE6 A;  4KBM B;  4UIG A;  2RP4 A;  4JEH B;  4EB6 E;  3ZYK A;  2KND A;  5C8Y E;  2CM0 A;  3ETV A;  2HH7 A;  5FXZ A;  4P09 A;  4BJN A;  2P9B A;  4EZH A;  2A3D A;  4ASK A;  1LRZ A;  4PK5 A;  4XAX B;  3PUQ A;  5LYJ E;  5FYM A;  4WBN E;  2D2S A;  3N5L A;  1FIO A;  2IW5 B;  3BQK A;  4HE8 A;  4H9N C;  2X9W A;  2VAS A;  3C4X A;  3ZJ2 A;  4HGA A;  4B6X A;  3ESL A;  4CQI A;  3ZEF B;  1QUU A;  3K3O A;  5EK4 A;  4OYJ A;  2N9D A;  4OHF A;  4CXX A;  3I9W A;  3ZMT B;  5L3C B;  2WMO A;  4QXH B;  5HXC A;  3ETU A;  4QHO A;  2E9X A;  2QGS A;  4J2C A;  3GN5 A;  5FXW A;  4IE0 A;  3ANW A;  5J2U E;  4DVD A;  2A2F X;  5JR9 A;  2A72 A;  2XAS B;  1O3X A;  4BA9 A;  1LVK A;  5LBM A;  3S4U A;  5IHY A;  5JQG E;  2CLY C;  2X0L B;  3IHR A;  3R84 B;  4PK6 A;  4ERR A;  4O2B E;  3HL6 A;  3L3P A;  4ZS2 A;  5GON E;  2LOS A;  2W0G A;  5J2T E;  4MBQ A;  3K3N A;  3I0O A;  5LA6 E;  4OK0 A;  5JRC A;  3ZC0 A;  3ZLI A;  3KVB A;  5JDM A;  4DMV A;  2IC6 A;  1ZKE A;  3UUL A;  3RX6 A;  2EHO C;  5CB4 E;  1YKH B;  2DWG A;  4ZOL E;  3K8P C;  3ZMV B;  2ZM2 A;  1MMG A;  3BK9 A;  2OA5 A;  3OYX A;  2B1E A;  2CCQ A;  2M67 A;  3N9Q A;  2Q9Q C;  2X67 A;  3N9M A;  2CXL A;  2EHO D;  3E0Z A;  2LSG A;  2V7I A;  4H9R C;  3ZPO A;  1IAP A;  4AXP A;  1WRD A;  3AAI A;  3CX8 B;  1VRB A;  2V7L A;  4X1Y E;  4O2A E;  4TUY E;  3AVR A;  4X1I E;  1ZEE A;  4MAL A;  1YKE B;  3KIN B;  2LE8 A;  2D5U A;  5ADX L;  5L3F B;  3AA6 B;  3I9Y A;  1NAF A;  5LCY A;  2Q9Q D;  2NW9 A;  5LOV E;  3RC8 A;  3DJB A;  2KT9 A;  3FHN A;  4JUY A;  3SS1 A;  3N2O A;  4UEM A;  2H7O A;  2ZLY A;  2VKH A;  2X66 A;  3ZJ1 A;  3H37 A;  3MXZ A;  3PTR B;  4ANJ A;  2C5J A;  2LEH A;  5L3E B;  3HKC E;  4CXY A;  2LHN A;  3NZP A;  4JLE A;  5LJN A;  4UVB B;  2XUE A;  1KK7 A;  4ZI7 E;  2KWH A;  3RYI E;  3ZCI A;  3RKO A;  1B7T A;  3LBX A;  4KP3 C;  1Z0P A;  3OKQ A;  5JDQ A;  3CPZ A;  2NOX A;  1E1H B;  2I59 A;  2V26 A;  2RA1 A;  4ZHQ E;  4QXC B;  2X9X A;  3FXE B;  1SA0 E;  2V7J A;  2IAK A;  5L2L A;  4ZI2 C;  3OBV E;  4DMW A;  2BZB A;  4HTE A;  4QKN A;  4XZC A;  1HCI A;  3PU8 A;  1X79 A;  2N2N A;  2MBG A;  2K48 A;  3AA1 B;  3PUR A;  4TV8 E;  2Y48 B;  3QK6 A;  2CE7 A;  3IF8 B;  3FBL A;  3WAJ A;  4YLH A;  3KV4 A;  3JC6 D;  3MJX A;  4BAY B;  4YJ2 E;  5FP3 A;  4EYY R;  2WM9 A;  4ZI2 D;  3KVA A;  5KDM C;  4IE5 A;  2JMH A;  2GK9 A;  3MZK B;  3Q2M A;  4C91 A;  3PUA A;  3C50 A;  2Q9Q B;  2ODU A;  2K5B B;  2XQY A;  5IYZ E;  4C90 A;  4PAG A;  3V5S A;  4EAH A;  2C0S A;  3N9L A;  5HYA A;  3MKD A;  4DO0 A;  5JDG A;  3LFM A;  3U3I A;  2CXD A;  4IDZ A;  4QXB B;  2LHR A;  3GA8 A;  2CEA A;  2VKD A;  3O4X E;  2KLQ A;  4AQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...