3MA9A

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
216
structure length
197
Chain Sequence
MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords Transmembrane glycoprotein
total genus 100
structure length 197
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ma9A00
3MA9A 2CMRA 3MACA
chains in the Genus database with same CATH superfamily
1UUSA 4PK6A 4CN6A 3IF8B 5EK4A 3E08A 3FB2A 4H9NC 3N2GE 5EZYE 4B3RT 2XQYA 1NENA 2DI4A 3CVRA 5HWYA 4ILBA 3UTKA 3UFEA 3VU7H 2XY8B 3LG7A 2WU2A 3P4RA 2J47A 3AA0B 5AQIB 4AIUA 4DBQA 2BDEA 3A7MA 2XQ8A 4TV9E 3UUXB 3UQ7A 2FJBA 5A1LA 3ZSSA 2V6XA 3FZHB 2X66A 3JC6C 2KINB 2CWOA 4DVDA 4HWDA 3RIFA 3N2KE 2W67A 2CMRA 2LSIA 3QB5A 3RKGA 4B6XA 3W15B 1XWMA 3CPZA 5JR9A 5JVDE 4HFCA 4M1PA 3TKLB 4HKAA 1LVKA 3N9QA 3FZMB 4AKRB 3UU6A 5HWXA 5JR9C 4IHJE 1MNDA 3MKDA 2X0YA 5DJQC 4LF4T 3RYFE 2XQ4A 2LRKA 2X9XA 3QB5K 3RKOA 2DLRA 3TLVA 2BKPA 4TZ4C 5KDMC 3L8RA 2CBJA 1S94A 2DNXA 2EHOB 4TNWA 1HNZT 1OEDE 1CUNA 1YQ3A 3HL6A 3K8PC 2Y6XA 1YXRA 2BG9C 1ZOYA 2FJEA 4XZCA 5L3FB 4GOUA 2NTYA 3H3MA 2KWIB 3AA7B 3ANWB 3PV0F 3OBVE 4JUYA 3SFDA 2XZEA 2WZHA 3HKBE 4ZS2A 2LRLA 1BR4A 3UFGA 2YKSA 3ZMZB 3AECA 4E7SA 1ZV4X 3UUMA 3PE0A 5LG3A 3RQWA 4IGUA 4TX5A 1IAPA 3FBZA 5LHGB 1UX4A 3P4QA 4X66T 3KBTA 3HKCE 3LJCA 4ZI3C 2VK9A 5KX5E 4LFCT 5HCMA 2WCAA 5J2TE 3CMLA 4YT0A 4AKIA 5HXHA 3FZFB 5BR8T 5AQHB 1XDOA 4ZI2C 5LYJE 1XMOT 2XQ3A 3ZMSB 4KX6A 1V9DA 1DU2A 3A5XA 3MACA 5LJMA 2CM0A 4X65T 3AAEB 3PUWF 3PJAJ 3ZT5A 3PJAA 4JI7T 3AE5A 3DP7A 2WWVA 2CCQA 5FNVE 1SE7A 3EABA 3VHLA 2LKHA 3UUNA 5JR9B 4DR5T 2A3DA 4DR4T 4PJJA 4ZI3D 5HXEA 1BR2A 1MIVA 1OEDC 3DTOA 1Y01A 3UU8A 3J9X1 3RC8A 3C4ZA 1M62A 4OX9T 2FJAA 5LNKA 1HR0T 4YTPA 5AQPB 3AEFA 5JREA 5HEHA 3ZCIA 1T72A 3BQIA 1Z0PA 5LGNB 4LFAT 2Z6EA 5H6QB 2PJQA 3G06A 2D0TA 2I6HA 1HX1B 4DR6T 2N2NA 2OV9A 3AA1B 3AEEA 5BMVE 2UXBT 3UT5E 4U31A 4COFA 1HTJF 1R8IA 4UF0B 3T8OA 5IUXA 2N1GA 4HGAA 2W61A 3F57A 3ONLC 3KV5A 4IE5A 2X51A 3KINB 3PUXF 3OPCA 4PAGA 3RC3A 4YHHT 3M65A 1JNZA 2G0UA 2BZBA 3KV6A 2IC6A 4U2ZA 1E7PA 5LOVE 5LCYA 3ZJ2A 3GWHA 2E5LT 4TNVA 2QA7A 5F5WA 4JI2T 5C2TA 4JI3T 2XM1A 4DUYT 1ZEEA 2H3RA 3NZQA 4X62T 1UK5A 2WSSV 3IBPA 2BG9A 4WW0A 3C4WA 3UQ4A 5KMGP 4P0AA 1I6ZA 3KBUA 3ONJA 3QK6A 2YDRA 3RIUA 1T7SA 2VWAA 2DL1A 4MHCA 5FY1A 2L3LA 4ZZCA 4EIWA 5LHIB 1IBMT 4L0RA 3ZC0A 5ADXL 3WAKA 2V5CA 2W00A 3PU8A 5HXRA 3NBXX 5AQVB 2BKOA 2JQ9A 1YKEB 2E9XD 1UCUA 1MIYA 3AXJA 3MXZA 3O1IA 3C50A 4U7YA 5FYMA 5LBQB 1FIOA 1XZYA 3CX8B 3MA9A 5AQMB 5IWAT 3O9XA 3RHWA 5AQSB 3Q9DA 2Y48B 2ODVA 2I0MA 1MMAA 1KNZA 2VQFT 2YINA 2XQ5A 2GK9A 3BK9A 3KDSE 3DJBA 1KEYA 2WU5A 1YQ4A 3RX6A 2YU2A 2JJ9A 2KXPB 3HKDE 2F4VT 4QX8B 1N36T 3D0TA 4L5GA 4X1KE 2V7KA 2SPCA 2CRBA 2WAUA 3OKQA 2HN2A 5ABHA 2CWYA 2K24A 3P4SA 2V8SV 4O4LE 1HG2A 3S4UA 2WMOA 4IDPA 5JDLA 3RQUA 1MMGA 3B13A 3B5MA 4U2YA 4YSXA 4U7IA 4A98A 1VRBA 5LXTE 3O1HA 3UU5A 4UVAB 2JRKA 2VVSA 4HWIB 5DQVA 2XJ7A 5LHHB 5FY7A 4DNDA 4JYAT 5LJNA 4LFBT 3Q2MA 4YY3T 3SFEA 4WNKA 2YDSA 3AE7A 3H37A 1GQEA 5AFUL 5JRCA 4UEMA 2BBJA 2FUPA 3K3NA 4UR9A 4UVCB 2K48A 4IE6A 1WFDA 3EAMA 1Z8UA 4K0UA 3RIUC 5JDHA 4JI8T 2BG9B 1J5ET 3ZMUB 1G73A 1L0VA 4X1YE 4PK5A 2J4GA 4BA9A 3L09A 3PTRB 2FBWA 1OEDA 2CEAA 2BKNA 1WR6A 2V7IA 4X20E 5CGMA 2VQET 1HNXT 4H9PC 4I0UA 2Q9QA 4LF7T 4DMVA 2QGSA 2UXDT 4KUMB 2AE9A 2BS4A 3KFWX 5LP6E 2BVMA 3AAAB 4A97A 2HH7A 4LF6T 1IJ6A 3EDUA 2LKGA 2KLQA 4QH4A 3SOLA 2K3WA 4AQGA 4IIJE 4ISTA 4EV6A 4PW8A 5AQUB 4AISA 4LF5T 4JV5T 1UGOA 3EHZA 3MJXA 4O4HE 4LMKA 5AQTB 4X5TA 4YLHA 5AQRB 3AVSA 3OJAA 4QWNB 2B76A 3ZLIA 3ZT7A 4JLEA 2DHRA 4ZEYA 5ABEA 2VB6A 2LSGA 4H9SE 4I55E 5HEOA 4FJOA 3AVRA 3N2OA 4TUYE 5LG4A 1M7KA 1QLBA 2X9WA 4EB6E 4B3TT 2NW7A 3A8YC 2R6GF 3N5LA 5CA0E 1US7B 2CXDA 4BAYB 1T98A 5HYAA 2DWGA 2MOZA 4EEBA 5L3BB 4CI3B 2IAKA 3AE4A 3T1YT 2WDQA 1EZ3A 4JEUB 2UUAT 2CA5A 1J1JA 3IEEA 3AE8A 3JAEA 4Q25A 4ZI2D 1QSDA 4AI6A 4ILUA 4HWHA 4PJNA 4YTMA 2V7JA 3O1JA 2YEVC 3ZMTB 2D9DA 5KXJA 3ZYMA 2ODUA 4CXWA 5L3DB 3ZSTA 1D1BA 2X68A 4G2AA 4O2BE 4QX7B 2C5IT 3NRYA 1T8BA 3GA8A 2C5KT 1SUMB 4EYYR 2UXNB 3QUJA 3QNUA 4ILCA 4DO0A 4P0BA 3LDQB 5FVKA 3RYIE 4CXXA 3GN5B 3RYHE 3B57A 4ZOLE 3SS1A 1XNRT 2YU1A 3FXEB 1HFAA 2N9DA 2W2UA 1BR1A 2WDVA 2ZM8A 1KNRA 4P1NA 2L9QA 2B1EA 3ZJ1A 1X79A 3HI2A 3IHRA 2XSAA 1KF6A 3F31A 1O3XA 4H63V 3P4WA 4GK0E 4O4IE 4ZI7E 3TLTA 2W66A 4ANJA 3FBLA 2CE7A 4B3MT 2V7LA 3RPUA 1D0ZA 2E9XC 3HA4A 4HTEA 4UV9B 4UELA 4HE8A 4YSYA 2BG9E 2XAGB 1WYCA 4ADZA 5C3JA 3J7Yq 2OA5A 2Q9QD 5EK3A 1ZKEA 3AE1A 2PBIA 5FMNA 2EHOD 2JMHA 5FL0A 2KWHA 5HEGA 4TWDA 3AEBA 5HXCA 4UIGA 3TLUA 2K5BB 2ZM2A 3CX6B 3E0ZA 4DR2T 4DR1T 5FP3A 3UUBA 3L3PA 4ZZBA 2ACZA 5E0OA 5H6RB 2JQHA 2BS2A 5CA1E 1MIWA 3QOFA 2X67A 4WBOA 3RGLA 5ABFA 2XQ6A 2W0GA 2Y8DA 1IBKT 3SRZA 4JEHB 3R84B 1WCRA 1VCTA 4MALA 4KHZF 4YXDA 4IL9A 3ZC1A 2C0SA 3KV4A 4AQFA 4IE4A 3JC6D 2EHOA 2NR4A 4DR7T 1H7CA 3CIRA 4OFZA 5F8PA 5HCJA 4AXPA 3V5SA 4JI1T 5FXVA 5ABFB 2CLYC 3MK7C 4WYVA 2X9HA 5J1GA 3FZLB 4OK0A 4DV5T 4QH5A 3EVYA 2JQKA 3Q5DA 4DV1T 1NWMX 4CI1B 4OYKA 4I43B 2LT3A 1XNQT 5FXWA 4TWFA 2PTFA 4ZHQE 3KVBA 1QUUA 1KFYA 2IUBA 2WBLA 4IDQA 3AE2A 2WZIA 1LRZA 4L9IA 3AAIA 4V1Av 2JMKA 4MLKA 1J5WA 2XUEA 4ISSA 3Q5WA 4QXBB 4XAXB 5CFBA 5HXSA 2X9YA 1W0AA 2W62A 2X0HA 2ES0A 4DBRA 5JH7E 4GK5E 5JDNA 3PUQA 2WMNA 4HFVA 2E9XA 4AQYT 2RPAA 4J2CA 4K0KT 2IMLA 2VL8A 3ZN1B 3ZMVB 2DCFA 4JI4T 4O8SA 2UU9T 2YOEA 1U5PA 3NWIA 4JI6T 2WB5A 5HAXA 3CWZB 3K3OA 4DV4T 3VKGA 5FY0A 2UXXB 1UX5A 1FEWA 2VASA 2PFVA 1D0YA 2ACXA 2CBIA 2KNDA 4U72A 4ZS3A 3U78A 3UULA 1W9RA 4IDZA 2XSBA 4U33A 4IT4A 1IJ5A 3R6NA 4TN7B 1CHUA 3CQCB 3OYXA 2WY2A 5LGUB 3QC9A 1NAFA 3JCFA 4GIWA 4F8HA 4AKHA 1W09A 3P7IA 3I0QA 2M6IA 1I94T 4CN4A 4LF9T 3RF1A 4GYRA 4HEAA 3OYZA 2FJDA 1WR0A 1FMVA 2KMFA 4YJ3E 4Z8XA 3ZYLA 3IA3A 1MNEA 3RLFF 3JAFA 3AA6B 2XQAA 3NRXA 5LMUT 3LSVA 1YW0A 3NKZA 4DV6T 5GONE 2LEHA 2NP9A 2M6BA 2NWBA 3HR0A 2IHR1 5AQNB 3RIAA 3RRWA 4U3CA 3ZKRA 4HWFA 2W63A 3TLSA 2LJLA 4ASKA 4TWHA 3JADA 4F6RC 2OLTA 4H63H 5J2UE 3ONXA 2UXCT 3VR9A 1E1HB 1HNWT 4OHFA 4UVBB 4HFHA 4CN1A 4OYJA 5AQOB 1AJ3A 4IDOA 3K1SA 2NW9A 3PUAA 4PJMA 3GMIA 2ZM6T 2XASB 3ETUA 1LKXA 4UF0A 3WAJA 4NUVA 3Q5XA 5TAOA 2V1DB 3ANWA 2VURA 1S35A 2IDOB 2YK0A 5LB7B 5L3GB 2CLYB 3ETVA 4DV3T 3E22E 3PUSA 3AEGA 4U74A 2MYSA 3C98B 4PFPA 4DMWA 4YJ2E 4YSZA 2NTXA 4XBFB 3AEDA 5JDMA 3OVUA 4GKJT 4ERRA 5AQJB 2MBGA 3PURA 3UU4A 3AXJB 2YN6A 3CKDA 2VKDA 5FXZA 3U3IA 1HCIA 1SHZC 4I4TE 4QXCB 3VRBA 3C64A 3WI3A 3ZN0B 4CQIA 2LSYA 2HHHT 2BS3A 5L2LA 1XDPA 5EK2A 2LHNA 5AQLB 4JBWF 3I1AA 5IYZE 3CK6A 3FZKB 1X9BA 2JIWA 3HKEE 3LBXB 2A72A 3O4XE 4KHPT 2XPKA 3ZPOA 2MAWA 5IHYA 4UXNB 3EDVA 4KP3C 3PDYA 2XQ9A 1D1CA 2RA1A 2XTLA 3K3QC 3AB3B 3PUVF 5LBMA 4AKGA 2J1DG 2NOXA 4IDNA 5AQKB 4NUUA 4Z91A 4CI2B 4EYUA 4A56A 1XMQT 1SA0E 3KV9A 2QVAA 1FMWA 2V26A 4NXNT 2LSJA 1HF8A 4LMLA 4HWCA 5AQGB 3RYCE 5L3EB 2ZM0A 4YTNA 5F3JA 1BR0A 1OEDB 3AE9A 3N9OA 4DV2T 4KI0F 5FL1A 3OTOT 2Q9QB 3AE3A 4DR3T 2ZLYA 2H7OA 4FI5A 1W0BA 3LBXA 4C90A 4I50E 4GKKT 2LE8A 2MTQA 3AEAA 5FKYA 1D1AA 5JDFA 1N33T 1HS7A 4MBQA 3I9WA 3BQKA 4AQFC 2WDRA 3F2EA 3X1DA 5C8YE 2A9UA 4HFEA 2LM2A 2V6YA 2V7MA 1WRDA 4NPPA 2KT9A 4MFRA 3EI0A 2HPLA 2W4XA 1MMNA 4P09A 2XAFB 4WBNE 5FXXA 2IW5B 3ESLA 3P4PA 4EEDA 2IIUA 3ZEFB 4G63A 4NXMT 5LA6E 3I0OA 4HN9A 4UV8B 3MZKB 4EZHA 2UUBT 5HEUA 1N34T 2WQYA 3ZYKA 4DIDB 2RP4A 4ZXLA 4QHOA 3L39A 4HFBA 4C91A 4DUZT 4DV0T 4O2AE 5AQQB 1IZNB 4QXHB 2LLYA 4H9RC 4EAHA 1HX8A 2PG8A 2AXDS 3N9LA 5AQFB 4NIQA 4LF8T 4AKLA 1NEKA 3N9MA 5FVLA 1JNRA 2XHEB 5ABGA 2KSRA 1OXZA 2V5DA 3N9NA 2E9XB 2CPTA 3ZT6A 5JDQA 3P50A 2D0UA 4EXTA 4PFOA 1G8XA 1WYBA 5LGTB 1UURA 2H88A 2J62A 5DABA 4JI0T 2BBHA 5L4EA 3P8CD 3CQXC 5ETWA 4KMCA 4H9QC 3SWHA 1IBLT 2E2AA 2VL0A 4PNIA 4QH1A 1HG5A 2LHRA 1ZHCA 1MMDA 1Y64B 3N9PA 4GYSA 4IE0A 2QYWA 4KBMB 2K9AA 1B7TA 2JQQA 2BVLA 3FXDB 5DQWA 4A5XA 1U4QA 5JRCB 1WLXA 3RI5A 2WWUA 4HFDA 2NW8A 3VRAA 2XAHB 2M67A 3EUHA 4DV7T 2DWKA 1OWAA 2P9BA 3LK2B 4TV8E 3V5UA 1KK7A 2JPFA 4EOZB 3LK3B 4X64T 3GN5A 2CHOA 4YHJA 4CZZB 2D2SA 3AE6A 2XAQB 2LSKA 1FJGT 2WP9A 1E2AA 1D0XA 2L8KA 3VR8A 3VKHA 2XQ7A 2YDQA 2CHNA 4IL4A 4E7ZA 2X0LB 5HEJA 2C5JA 5L47A 4CXYA 3ZCJA 1N32T 3RRCA 5LMNT 2WS3A 1LVFA 2CXFA 4BJMA 2A2FX 3C51A 2D5UA 3H3AA 3ABVA 5JDGA 2LM9A 1YKHB 2LOPA 2MPKA 2EHOC 4HFIA 3RH3A 5JQGE 2V6YB 2Q9QC 5CJ5A 4BJNA 3CQGB 2HN1A 3LFMA 2WM9A 4B3ST 5L4HA 3PUZF 2IC9A 4LMJA 4YFSA 4Z90A 3M3ZB 3CX7B 3NZPA 2VKJA 4O4JE 5JTGA 2CXLA 2E8IA 4H9OC 4EGWA 5M4YA 1ZP0A 2VVNA 3UU3A 2H89A 2QRXA 2VKHA 4PK4A 3BQLA 3FHNA 3LK42 5CB4E 4EZ4A 3C4XA 4N78D 1VCSA 3NVOA 3Q5EA 4ILAA 5J0ZA 3TLWA 2UUCT 4QKNA 3PU3A 4PJLA 2KZ7B 4X1IE 4JI5T 1KNPA 3T1HT 2XAJB 3KVAA 4IREA 4IE7A 2H7VC 4WZXA 2XM2A 3PUYF 2ZMAA 3I9YA 1YD8G 2I59A 5L3CB 3PUGA 2VKOA 2HPJA 2E5VA 2LOSA 1VOMA
chains in the Genus database with same CATH topology
4PK6A 3IF8B 5EK4A 3E08A 3FB2A 4H9NC 3N2GE 5EZYE 2XQYA 2DI4A 3CVRA 5HWYA 3UTKA 3UFEA 3VU7H 3LG7A 3AA0B 2BDEA 4TV9E 3UUXB 5A1LA 2X66A 3JC6C 2KINB 2CWOA 3N2KE 2CMRA 2LSIA 4B6XA 3W15B 3CPZA 5JR9A 5JVDE 4M1PA 3TKLB 4HKAA 1LVKA 3N9QA 4AKRB 5HWXA 5JR9C 4IHJE 1MNDA 3MKDA 5DJQC 3RYFE 2X9XA 3RKOA 2DLRA 4TZ4C 5KDMC 2DNXA 2EHOB 1CUNA 3K8PC 3HL6A 2Y6XA 5L3FB 4XZCA 4GOUA 2NTYA 2KWIB 3AA7B 3ANWB 4JUYA 3OBVE 3HKBE 4ZS2A 3ZMZB 1BR4A 4E7SA 1ZV4X 3UUMA 3PE0A 4IGUA 4TX5A 1IAPA 3FBZA 5LHGB 1UX4A 3KBTA 3HKCE 3LJCA 4ZI3C 2VK9A 5KX5E 5J2TE 3CMLA 4AKIA 5HXHA 4ZI2C 3ZMSB 1V9DA 3A5XA 3MACA 5LJMA 2CM0A 3AAEB 3DP7A 2CCQA 5FNVE 3VHLA 3UUNA 5JR9B 2A3DA 4PJJA 4ZI3D 5HXEA 1BR2A 1MIVA 3DTOA 3RC8A 3J9X1 3C4ZA 5LNKA 5JREA 3ZCIA 3BQIA 1Z0PA 5LGNB 2Z6EA 5H6QB 2PJQA 2D0TA 2N2NA 3AA1B 5BMVE 3UT5E 1HTJF 3T8OA 4UF0B 2N1GA 4HGAA 2W61A 3F57A 3KV5A 4IE5A 2X51A 3KINB 4PAGA 3RC3A 3M65A 2G0UA 2BZBA 3KV6A 2IC6A 5LOVE 3ZJ2A 3GWHA 2QA7A 1ZEEA 2H3RA 3NZQA 2WSSV 3IBPA 4WW0A 4P0AA 3C4WA 5KMGP 3KBUA 3QK6A 2VWAA 5FY1A 4MHCA 3ZC0A 2L3LA 5LHIB 4EIWA 4L0RA 5ADXL 3WAKA 2W00A 3PU8A 5HXRA 3NBXX 5LCYA 2E9XD 1YKEB 3MXZA 1MIYA 1UCUA 3O1IA 5FYMA 5LBQB 3C50A 3SWHA 3O9XA 1FIOA 3MA9A 3CX8B 3Q9DA 2Y48B 2ODVA 1MMAA 1KNZA 2YINA 3BK9A 2GK9A 3KDSE 3RX6A 3DJBA 4DMWA 4DBQA 3ZEFB 2YU2A 2JJ9A 2KXPB 3HKDE 4QX8B 3D0TA 4L5GA 4X1KE 2V7KA 2SPCA 3OKQA 2WAUA 5L3GB 2CWYA 2K24A 3S4UA 4O4LE 1HG2A 2WMOA 5JDLA 1MMGA 3B13A 1VRBA 5LXTE 3O1HA 4UVAB 2JRKA 5DQVA 5LHHB 5FY7A 4DNDA 5LJNA 3Q2MA 4WNKA 5JRCA 3H37A 5AFUL 4UEMA 3K3NA 4UVCB 2K48A 4IE6A 5JDHA 4K0UA 3ZMUB 1G73A 4X1YE 4PK5A 4BA9A 3L09A 3PTRB 2CEAA 1WR6A 2V7IA 4X20E 4H9PC 2Q9QA 4DMVA 2QGSA 4KUMB 3KFWX 5LP6E 2BVMA 3AAAB 2HH7A 1IJ6A 3EDUA 2KLQA 5L3DB 3SOLA 4AQGA 4IIJE 4ISTA 4PW8A 3MJXA 4O4HE 4YLHA 3ZLIA 3AVSA 3OJAA 4QWNB 5LYJE 4JLEA 2DHRA 2VB6A 2LSGA 4H9SE 4I55E 4FJOA 3AVRA 3N2OA 4TUYE 5LG4A 2X9WA 4EB6E 2NW7A 3N5LA 5CA0E 1US7B 2CXDA 4BAYB 1T98A 5HYAA 2DWGA 2MOZA 4CI3B 2IAKA 1EZ3A 4JEUB 2CA5A 3IEEA 4ZI2D 1QSDA 4AI6A 4ILUA 4PJNA 2V7JA 3O1JA 2YEVC 3ZMTB 3ZYMA 2ODUA 4CXWA 1D1BA 2X68A 4G2AA 4O2BE 4QX7B 2C5IT 3NRYA 3GA8A 2C5KT 4EYYR 2UXNB 3QUJA 4DO0A 4P0BA 3RYIE 4CXXA 3GN5B 3RYHE 3B57A 4ZOLE 3SS1A 3FXEB 2YU1A 1HFAA 2N9DA 2ZM8A 1BR1A 4DVDA 2L9QA 2B1EA 3ZJ1A 1X79A 3HI2A 3IHRA 3F31A 4H63V 1O3XA 4GK0E 4O4IE 4ZI7E 3FBLA 2CE7A 2V7LA 3RPUA 1D0ZA 2E9XC 3HA4A 4HTEA 4UV9B 4UELA 4HE8A 2XAGB 1WYCA 4ADZA 3J7Yq 2OA5A 2Q9QD 5EK3A 1ZKEA 5FMNA 2PBIA 2EHOD 2JMHA 2KWHA 5HXCA 4UIGA 2K5BB 2ZM2A 3CX6B 3E0ZA 5FP3A 3L3PA 5E0OA 5H6RB 5CA1E 1MIWA 2X67A 4WBOA 2W0GA 2Y8DA 3SRZA 4JEHB 3R84B 4MALA 3ZC1A 2C0SA 3KV4A 4AQFA 4IE4A 3JC6D 2EHOA 1H7CA 4OFZA 5F8PA 4AXPA 3V5SA 5FXVA 2CLYC 3MK7C 2X9HA 5J1GA 4OK0A 3EVYA 1NWMX 4CI1B 4OYKA 4I43B 2LT3A 5FXWA 4ZHQE 3KVBA 1QUUA 4V1Av 2WBLA 4ANJA 1LRZA 4L9IA 3AAIA 2JMKA 4MLKA 2XUEA 4ISSA 4QXBB 3Q5WA 4XAXB 5HXSA 2X9YA 2W62A 4DBRA 2ES0A 5JH7E 4GK5E 5JDNA 3PUQA 2WMNA 4HFVA 2E9XA 4J2CA 2VL8A 3ZN1B 3ZMVB 2DCFA 4O8SA 1U5PA 5HAXA 3CWZB 3K3OA 3VKGA 5FY0A 2UXXB 1UX5A 1FEWA 2VASA 2KNDA 1D0YA 2ACXA 2PFVA 4U72A 4ZS3A 3U78A 3UULA 4IDZA 3R6NA 1IJ5A 4TN7B 3CQCB 3OYXA 2HPJA 5LGUB 3QC9A 1NAFA 4GIWA 4AKHA 3P7IA 3I0QA 4GYRA 4HEAA 3OYZA 1FMVA 2KMFA 4YJ3E 4Z8XA 3ZYLA 1MNEA 3NRXA 3AA6B 1YW0A 5GONE 2LEHA 2NP9A 3HR0A 2NWBA 3RRWA 2W63A 2LJLA 4ASKA 4F6RC 5J2UE 4H63H 3ONXA 1E1HB 4OHFA 4UVBB 4OYJA 1AJ3A 2NW9A 3PUAA 4PJMA 3GMIA 2XASB 3ETUA 1LKXA 4UF0A 3WAJA 4NUVA 3Q5XA 5TAOA 2V1DB 3ANWA 1S35A 2YK0A 2CLYB 3ETVA 3E22E 3PUSA 4U74A 2MYSA 3C98B 4PFPA 4YJ2E 2NTXA 4XBFB 5JDMA 4ERRA 2MBGA 3PURA 5FXZA 3CKDA 2VKDA 3U3IA 5L3BB 1HCIA 1SHZC 4I4TE 4QXCB 3WI3A 3C64A 4CQIA 3ZN0B 2LSYA 5L2LA 5EK2A 2LHNA 3I1AA 5IYZE 3HKEE 3LBXB 2A72A 3O4XE 3ZPOA 5IHYA 4UXNB 3EDVA 4KP3C 3PDYA 1D1CA 2RA1A 2XTLA 3K3QC 3AB3B 4AKGA 5LBMA 2J1DG 2NOXA 4EYUA 4NUUA 4CI2B 4A56A 1SA0E 3KV9A 1FMWA 2V26A 2LSJA 1HF8A 3RYCE 5L3EB 2ZM0A 5F3JA 1BR0A 3N9OA 2Q9QB 2ZLYA 2H7OA 4FI5A 3LBXA 4C90A 4I50E 2LE8A 2MTQA 1D1AA 5JDFA 1HS7A 4MBQA 3I9WA 3BQKA 4AQFC 3F2EA 5C8YE 2V7MA 1WRDA 2KT9A 4MFRA 2HPLA 1MMNA 4P09A 2XAFB 4WBNE 5FXXA 2IW5B 3ESLA 4G63A 5LA6E 3I0OA 4HN9A 4UV8B 3MZKB 4EZHA 3ZYKA 2RP4A 4QHOA 4C91A 4O2AE 1IZNB 4QXHB 4EAHA 4H9RC 1HX8A 2PG8A 3N9LA 4AKLA 3N9MA 2XHEB 1OXZA 3N9NA 2E9XB 5JDQA 2D0UA 4EXTA 4PFOA 1G8XA 1WYBA 5LGTB 5DABA 3P8CD 3CQXC 5ETWA 4KMCA 4H9QC 4PNIA 1HG5A 2LHRA 1ZHCA 1MMDA 1Y64B 3N9PA 4GYSA 4IE0A 4KBMB 2K9AA 1B7TA 2JQQA 2BVLA 3FXDB 5DQWA 5JRCB 1U4QA 1WLXA 2WWUA 2NW8A 2XAHB 3EUHA 2M67A 2DWKA 1OWAA 2P9BA 3LK2B 4TV8E 3V5UA 1KK7A 2JPFA 4EOZB 3LK3B 3GN5A 4CZZB 4YHJA 2D2SA 2XAQB 2LSKA 3VKHA 1D0XA 2L8KA 4E7ZA 4CXYA 2X0LB 2C5JA 3ZCJA 3RRCA 1LVFA 2CXFA 4BJMA 2A2FX 3C51A 2D5UA 3H3AA 5JDGA 2LM9A 1YKHB 2LOPA 5JQGE 2EHOC 3RH3A 2Q9QC 4BJNA 3CQGB 3LFMA 2WM9A 2IC9A 4YFSA 4O4JE 3CX7B 3NZPA 2VKJA 2CXLA 2E8IA 4H9OC 5M4YA 2VKHA 4PK4A 3BQLA 3FHNA 3LK42 5CB4E 4EZ4A 3C4XA 4N78D 4QKNA 3PU3A 4PJLA 2KZ7B 4X1IE 2XAJB 3KVAA 4IE7A 2H7VC 2ZMAA 3I9YA 1YD8G 2I59A 5L3CB 3PUGA 2VKOA 1S94A 2LOSA 1VOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MA9 A;  2CMR A;  3MAC A; 
#chains in the Genus database with same CATH topology
 1UUS A;  4PK6 A;  4CN6 A;  3IF8 B;  5EK4 A;  3E08 A;  3FB2 A;  4H9N C;  3N2G E;  5EZY E;  4B3R T;  2XQY A;  1NEN A;  2DI4 A;  3CVR A;  5HWY A;  4ILB A;  3UTK A;  3UFE A;  3VU7 H;  2XY8 B;  3LG7 A;  2WU2 A;  3P4R A;  2J47 A;  3AA0 B;  5AQI B;  4AIU A;  4DBQ A;  2BDE A;  3A7M A;  2XQ8 A;  4TV9 E;  3UUX B;  3UQ7 A;  2FJB A;  5A1L A;  3ZSS A;  2V6X A;  3FZH B;  2X66 A;  3JC6 C;  2KIN B;  2CWO A;  4DVD A;  4HWD A;  3RIF A;  3N2K E;  2W67 A;  2CMR A;  2LSI A;  3QB5 A;  3RKG A;  4B6X A;  3W15 B;  1XWM A;  3CPZ A;  5JR9 A;  5JVD E;  4HFC A;  4M1P A;  3TKL B;  4HKA A;  1LVK A;  3N9Q A;  3FZM B;  4AKR B;  3UU6 A;  5HWX A;  5JR9 C;  4IHJ E;  1MND A;  3MKD A;  2X0Y A;  5DJQ C;  4LF4 T;  3RYF E;  2XQ4 A;  2LRK A;  2X9X A;  3QB5 K;  3RKO A;  2DLR A;  3TLV A;  2BKP A;  4TZ4 C;  5KDM C;  3L8R A;  2CBJ A;  1S94 A;  2DNX A;  2EHO B;  4TNW A;  1HNZ T;  1OED E;  1CUN A;  1YQ3 A;  3HL6 A;  3K8P C;  2Y6X A;  1YXR A;  2BG9 C;  1ZOY A;  2FJE A;  4XZC A;  5L3F B;  4GOU A;  2NTY A;  3H3M A;  2KWI B;  3AA7 B;  3ANW B;  3PV0 F;  3OBV E;  4JUY A;  3SFD A;  2XZE A;  2WZH A;  3HKB E;  4ZS2 A;  2LRL A;  1BR4 A;  3UFG A;  2YKS A;  3ZMZ B;  3AEC A;  4E7S A;  1ZV4 X;  3UUM A;  3PE0 A;  5LG3 A;  3RQW A;  4IGU A;  4TX5 A;  1IAP A;  3FBZ A;  5LHG B;  1UX4 A;  3P4Q A;  4X66 T;  3KBT A;  3HKC E;  3LJC A;  4ZI3 C;  2VK9 A;  5KX5 E;  4LFC T;  5HCM A;  2WCA A;  5J2T E;  3CML A;  4YT0 A;  4AKI A;  5HXH A;  3FZF B;  5BR8 T;  5AQH B;  1XDO A;  4ZI2 C;  5LYJ E;  1XMO T;  2XQ3 A;  3ZMS B;  4KX6 A;  1V9D A;  1DU2 A;  3A5X A;  3MAC A;  5LJM A;  2CM0 A;  4X65 T;  3AAE B;  3PUW F;  3PJA J;  3ZT5 A;  3PJA A;  4JI7 T;  3AE5 A;  3DP7 A;  2WWV A;  2CCQ A;  5FNV E;  1SE7 A;  3EAB A;  3VHL A;  2LKH A;  3UUN A;  5JR9 B;  4DR5 T;  2A3D A;  4DR4 T;  4PJJ A;  4ZI3 D;  5HXE A;  1BR2 A;  1MIV A;  1OED C;  3DTO A;  1Y01 A;  3UU8 A;  3J9X 1;  3RC8 A;  3C4Z A;  1M62 A;  4OX9 T;  2FJA A;  5LNK A;  1HR0 T;  4YTP A;  5AQP B;  3AEF A;  5JRE A;  5HEH A;  3ZCI A;  1T72 A;  3BQI A;  1Z0P A;  5LGN B;  4LFA T;  2Z6E A;  5H6Q B;  2PJQ A;  3G06 A;  2D0T A;  2I6H A;  1HX1 B;  4DR6 T;  2N2N A;  2OV9 A;  3AA1 B;  3AEE A;  5BMV E;  2UXB T;  3UT5 E;  4U31 A;  4COF A;  1HTJ F;  1R8I A;  4UF0 B;  3T8O A;  5IUX A;  2N1G A;  4HGA A;  2W61 A;  3F57 A;  3ONL C;  3KV5 A;  4IE5 A;  2X51 A;  3KIN B;  3PUX F;  3OPC A;  4PAG A;  3RC3 A;  4YHH T;  3M65 A;  1JNZ A;  2G0U A;  2BZB A;  3KV6 A;  2IC6 A;  4U2Z A;  1E7P A;  5LOV E;  5LCY A;  3ZJ2 A;  3GWH A;  2E5L T;  4TNV A;  2QA7 A;  5F5W A;  4JI2 T;  5C2T A;  4JI3 T;  2XM1 A;  4DUY T;  1ZEE A;  2H3R A;  3NZQ A;  4X62 T;  1UK5 A;  2WSS V;  3IBP A;  2BG9 A;  4WW0 A;  3C4W A;  3UQ4 A;  5KMG P;  4P0A A;  1I6Z A;  3KBU A;  3ONJ A;  3QK6 A;  2YDR A;  3RIU A;  1T7S A;  2VWA A;  2DL1 A;  4MHC A;  5FY1 A;  2L3L A;  4ZZC A;  4EIW A;  5LHI B;  1IBM T;  4L0R A;  3ZC0 A;  5ADX L;  3WAK A;  2V5C A;  2W00 A;  3PU8 A;  5HXR A;  3NBX X;  5AQV B;  2BKO A;  2JQ9 A;  1YKE B;  2E9X D;  1UCU A;  1MIY A;  3AXJ A;  3MXZ A;  3O1I A;  3C50 A;  4U7Y A;  5FYM A;  5LBQ B;  1FIO A;  1XZY A;  3CX8 B;  3MA9 A;  5AQM B;  5IWA T;  3O9X A;  3RHW A;  5AQS B;  3Q9D A;  2Y48 B;  2ODV A;  2I0M A;  1MMA A;  1KNZ A;  2VQF T;  2YIN A;  2XQ5 A;  2GK9 A;  3BK9 A;  3KDS E;  3DJB A;  1KEY A;  2WU5 A;  1YQ4 A;  3RX6 A;  2YU2 A;  2JJ9 A;  2KXP B;  3HKD E;  2F4V T;  4QX8 B;  1N36 T;  3D0T A;  4L5G A;  4X1K E;  2V7K A;  2SPC A;  2CRB A;  2WAU A;  3OKQ A;  2HN2 A;  5ABH A;  2CWY A;  2K24 A;  3P4S A;  2V8S V;  4O4L E;  1HG2 A;  3S4U A;  2WMO A;  4IDP A;  5JDL A;  3RQU A;  1MMG A;  3B13 A;  3B5M A;  4U2Y A;  4YSX A;  4U7I A;  4A98 A;  1VRB A;  5LXT E;  3O1H A;  3UU5 A;  4UVA B;  2JRK A;  2VVS A;  4HWI B;  5DQV A;  2XJ7 A;  5LHH B;  5FY7 A;  4DND A;  4JYA T;  5LJN A;  4LFB T;  3Q2M A;  4YY3 T;  3SFE A;  4WNK A;  2YDS A;  3AE7 A;  3H37 A;  1GQE A;  5AFU L;  5JRC A;  4UEM A;  2BBJ A;  2FUP A;  3K3N A;  4UR9 A;  4UVC B;  2K48 A;  4IE6 A;  1WFD A;  3EAM A;  1Z8U A;  4K0U A;  3RIU C;  5JDH A;  4JI8 T;  2BG9 B;  1J5E T;  3ZMU B;  1G73 A;  1L0V A;  4X1Y E;  4PK5 A;  2J4G A;  4BA9 A;  3L09 A;  3PTR B;  2FBW A;  1OED A;  2CEA A;  2BKN A;  1WR6 A;  2V7I A;  4X20 E;  5CGM A;  2VQE T;  1HNX T;  4H9P C;  4I0U A;  2Q9Q A;  4LF7 T;  4DMV A;  2QGS A;  2UXD T;  4KUM B;  2AE9 A;  2BS4 A;  3KFW X;  5LP6 E;  2BVM A;  3AAA B;  4A97 A;  2HH7 A;  4LF6 T;  1IJ6 A;  3EDU A;  2LKG A;  2KLQ A;  4QH4 A;  3SOL A;  2K3W A;  4AQG A;  4IIJ E;  4IST A;  4EV6 A;  4PW8 A;  5AQU B;  4AIS A;  4LF5 T;  4JV5 T;  1UGO A;  3EHZ A;  3MJX A;  4O4H E;  4LMK A;  5AQT B;  4X5T A;  4YLH A;  5AQR B;  3AVS A;  3OJA A;  4QWN B;  2B76 A;  3ZLI A;  3ZT7 A;  4JLE A;  2DHR A;  4ZEY A;  5ABE A;  2VB6 A;  2LSG A;  4H9S E;  4I55 E;  5HEO A;  4FJO A;  3AVR A;  3N2O A;  4TUY E;  5LG4 A;  1M7K A;  1QLB A;  2X9W A;  4EB6 E;  4B3T T;  2NW7 A;  3A8Y C;  2R6G F;  3N5L A;  5CA0 E;  1US7 B;  2CXD A;  4BAY B;  1T98 A;  5HYA A;  2DWG A;  2MOZ A;  4EEB A;  5L3B B;  4CI3 B;  2IAK A;  3AE4 A;  3T1Y T;  2WDQ A;  1EZ3 A;  4JEU B;  2UUA T;  2CA5 A;  1J1J A;  3IEE A;  3AE8 A;  3JAE A;  4Q25 A;  4ZI2 D;  1QSD A;  4AI6 A;  4ILU A;  4HWH A;  4PJN A;  4YTM A;  2V7J A;  3O1J A;  2YEV C;  3ZMT B;  2D9D A;  5KXJ A;  3ZYM A;  2ODU A;  4CXW A;  5L3D B;  3ZST A;  1D1B A;  2X68 A;  4G2A A;  4O2B E;  4QX7 B;  2C5I T;  3NRY A;  1T8B A;  3GA8 A;  2C5K T;  1SUM B;  4EYY R;  2UXN B;  3QUJ A;  3QNU A;  4ILC A;  4DO0 A;  4P0B A;  3LDQ B;  5FVK A;  3RYI E;  4CXX A;  3GN5 B;  3RYH E;  3B57 A;  4ZOL E;  3SS1 A;  1XNR T;  2YU1 A;  3FXE B;  1HFA A;  2N9D A;  2W2U A;  1BR1 A;  2WDV A;  2ZM8 A;  1KNR A;  4P1N A;  2L9Q A;  2B1E A;  3ZJ1 A;  1X79 A;  3HI2 A;  3IHR A;  2XSA A;  1KF6 A;  3F31 A;  1O3X A;  4H63 V;  3P4W A;  4GK0 E;  4O4I E;  4ZI7 E;  3TLT A;  2W66 A;  4ANJ A;  3FBL A;  2CE7 A;  4B3M T;  2V7L A;  3RPU A;  1D0Z A;  2E9X C;  3HA4 A;  4HTE A;  4UV9 B;  4UEL A;  4HE8 A;  4YSY A;  2BG9 E;  2XAG B;  1WYC A;  4ADZ A;  5C3J A;  3J7Y q;  2OA5 A;  2Q9Q D;  5EK3 A;  1ZKE A;  3AE1 A;  2PBI A;  5FMN A;  2EHO D;  2JMH A;  5FL0 A;  2KWH A;  5HEG A;  4TWD A;  3AEB A;  5HXC A;  4UIG A;  3TLU A;  2K5B B;  2ZM2 A;  3CX6 B;  3E0Z A;  4DR2 T;  4DR1 T;  5FP3 A;  3UUB A;  3L3P A;  4ZZB A;  2ACZ A;  5E0O A;  5H6R B;  2JQH A;  2BS2 A;  5CA1 E;  1MIW A;  3QOF A;  2X67 A;  4WBO A;  3RGL A;  5ABF A;  2XQ6 A;  2W0G A;  2Y8D A;  1IBK T;  3SRZ A;  4JEH B;  3R84 B;  1WCR A;  1VCT A;  4MAL A;  4KHZ F;  4YXD A;  4IL9 A;  3ZC1 A;  2C0S A;  3KV4 A;  4AQF A;  4IE4 A;  3JC6 D;  2EHO A;  2NR4 A;  4DR7 T;  1H7C A;  3CIR A;  4OFZ A;  5F8P A;  5HCJ A;  4AXP A;  3V5S A;  4JI1 T;  5FXV A;  5ABF B;  2CLY C;  3MK7 C;  4WYV A;  2X9H A;  5J1G A;  3FZL B;  4OK0 A;  4DV5 T;  4QH5 A;  3EVY A;  2JQK A;  3Q5D A;  4DV1 T;  1NWM X;  4CI1 B;  4OYK A;  4I43 B;  2LT3 A;  1XNQ T;  5FXW A;  4TWF A;  2PTF A;  4ZHQ E;  3KVB A;  1QUU A;  1KFY A;  2IUB A;  2WBL A;  4IDQ A;  3AE2 A;  2WZI A;  1LRZ A;  4L9I A;  3AAI A;  4V1A v;  2JMK A;  4MLK A;  1J5W A;  2XUE A;  4ISS A;  3Q5W A;  4QXB B;  4XAX B;  5CFB A;  5HXS A;  2X9Y A;  1W0A A;  2W62 A;  2X0H A;  2ES0 A;  4DBR A;  5JH7 E;  4GK5 E;  5JDN A;  3PUQ A;  2WMN A;  4HFV A;  2E9X A;  4AQY T;  2RPA A;  4J2C A;  4K0K T;  2IML A;  2VL8 A;  3ZN1 B;  3ZMV B;  2DCF A;  4JI4 T;  4O8S A;  2UU9 T;  2YOE A;  1U5P A;  3NWI A;  4JI6 T;  2WB5 A;  5HAX A;  3CWZ B;  3K3O A;  4DV4 T;  3VKG A;  5FY0 A;  2UXX B;  1UX5 A;  1FEW A;  2VAS A;  2PFV A;  1D0Y A;  2ACX A;  2CBI A;  2KND A;  4U72 A;  4ZS3 A;  3U78 A;  3UUL A;  1W9R A;  4IDZ A;  2XSB A;  4U33 A;  4IT4 A;  1IJ5 A;  3R6N A;  4TN7 B;  1CHU A;  3CQC B;  3OYX A;  2WY2 A;  5LGU B;  3QC9 A;  1NAF A;  3JCF A;  4GIW A;  4F8H A;  4AKH A;  1W09 A;  3P7I A;  3I0Q A;  2M6I A;  1I94 T;  4CN4 A;  4LF9 T;  3RF1 A;  4GYR A;  4HEA A;  3OYZ A;  2FJD A;  1WR0 A;  1FMV A;  2KMF A;  4YJ3 E;  4Z8X A;  3ZYL A;  3IA3 A;  1MNE A;  3RLF F;  3JAF A;  3AA6 B;  2XQA A;  3NRX A;  5LMU T;  3LSV A;  1YW0 A;  3NKZ A;  4DV6 T;  5GON E;  2LEH A;  2NP9 A;  2M6B A;  2NWB A;  3HR0 A;  2IHR 1;  5AQN B;  3RIA A;  3RRW A;  4U3C A;  3ZKR A;  4HWF A;  2W63 A;  3TLS A;  2LJL A;  4ASK A;  4TWH A;  3JAD A;  4F6R C;  2OLT A;  4H63 H;  5J2U E;  3ONX A;  2UXC T;  3VR9 A;  1E1H B;  1HNW T;  4OHF A;  4UVB B;  4HFH A;  4CN1 A;  4OYJ A;  5AQO B;  1AJ3 A;  4IDO A;  3K1S A;  2NW9 A;  3PUA A;  4PJM A;  3GMI A;  2ZM6 T;  2XAS B;  3ETU A;  1LKX A;  4UF0 A;  3WAJ A;  4NUV A;  3Q5X A;  5TAO A;  2V1D B;  3ANW A;  2VUR A;  1S35 A;  2IDO B;  2YK0 A;  5LB7 B;  5L3G B;  2CLY B;  3ETV A;  4DV3 T;  3E22 E;  3PUS A;  3AEG A;  4U74 A;  2MYS A;  3C98 B;  4PFP A;  4DMW A;  4YJ2 E;  4YSZ A;  2NTX A;  4XBF B;  3AED A;  5JDM A;  3OVU A;  4GKJ T;  4ERR A;  5AQJ B;  2MBG A;  3PUR A;  3UU4 A;  3AXJ B;  2YN6 A;  3CKD A;  2VKD A;  5FXZ A;  3U3I A;  1HCI A;  1SHZ C;  4I4T E;  4QXC B;  3VRB A;  3C64 A;  3WI3 A;  3ZN0 B;  4CQI A;  2LSY A;  2HHH T;  2BS3 A;  5L2L A;  1XDP A;  5EK2 A;  2LHN A;  5AQL B;  4JBW F;  3I1A A;  5IYZ E;  3CK6 A;  3FZK B;  1X9B A;  2JIW A;  3HKE E;  3LBX B;  2A72 A;  3O4X E;  4KHP T;  2XPK A;  3ZPO A;  2MAW A;  5IHY A;  4UXN B;  3EDV A;  4KP3 C;  3PDY A;  2XQ9 A;  1D1C A;  2RA1 A;  2XTL A;  3K3Q C;  3AB3 B;  3PUV F;  5LBM A;  4AKG A;  2J1D G;  2NOX A;  4IDN A;  5AQK B;  4NUU A;  4Z91 A;  4CI2 B;  4EYU A;  4A56 A;  1XMQ T;  1SA0 E;  3KV9 A;  2QVA A;  1FMW A;  2V26 A;  4NXN T;  2LSJ A;  1HF8 A;  4LML A;  4HWC A;  5AQG B;  3RYC E;  5L3E B;  2ZM0 A;  4YTN A;  5F3J A;  1BR0 A;  1OED B;  3AE9 A;  3N9O A;  4DV2 T;  4KI0 F;  5FL1 A;  3OTO T;  2Q9Q B;  3AE3 A;  4DR3 T;  2ZLY A;  2H7O A;  4FI5 A;  1W0B A;  3LBX A;  4C90 A;  4I50 E;  4GKK T;  2LE8 A;  2MTQ A;  3AEA A;  5FKY A;  1D1A A;  5JDF A;  1N33 T;  1HS7 A;  4MBQ A;  3I9W A;  3BQK A;  4AQF C;  2WDR A;  3F2E A;  3X1D A;  5C8Y E;  2A9U A;  4HFE A;  2LM2 A;  2V6Y A;  2V7M A;  1WRD A;  4NPP A;  2KT9 A;  4MFR A;  3EI0 A;  2HPL A;  2W4X A;  1MMN A;  4P09 A;  2XAF B;  4WBN E;  5FXX A;  2IW5 B;  3ESL A;  3P4P A;  4EED A;  2IIU A;  3ZEF B;  4G63 A;  4NXM T;  5LA6 E;  3I0O A;  4HN9 A;  4UV8 B;  3MZK B;  4EZH A;  2UUB T;  5HEU A;  1N34 T;  2WQY A;  3ZYK A;  4DID B;  2RP4 A;  4ZXL A;  4QHO A;  3L39 A;  4HFB A;  4C91 A;  4DUZ T;  4DV0 T;  4O2A E;  5AQQ B;  1IZN B;  4QXH B;  2LLY A;  4H9R C;  4EAH A;  1HX8 A;  2PG8 A;  2AXD S;  3N9L A;  5AQF B;  4NIQ A;  4LF8 T;  4AKL A;  1NEK A;  3N9M A;  5FVL A;  1JNR A;  2XHE B;  5ABG A;  2KSR A;  1OXZ A;  2V5D A;  3N9N A;  2E9X B;  2CPT A;  3ZT6 A;  5JDQ A;  3P50 A;  2D0U A;  4EXT A;  4PFO A;  1G8X A;  1WYB A;  5LGT B;  1UUR A;  2H88 A;  2J62 A;  5DAB A;  4JI0 T;  2BBH A;  5L4E A;  3P8C D;  3CQX C;  5ETW A;  4KMC A;  4H9Q C;  3SWH A;  1IBL T;  2E2A A;  2VL0 A;  4PNI A;  4QH1 A;  1HG5 A;  2LHR A;  1ZHC A;  1MMD A;  1Y64 B;  3N9P A;  4GYS A;  4IE0 A;  2QYW A;  4KBM B;  2K9A A;  1B7T A;  2JQQ A;  2BVL A;  3FXD B;  5DQW A;  4A5X A;  1U4Q A;  5JRC B;  1WLX A;  3RI5 A;  2WWU A;  4HFD A;  2NW8 A;  3VRA A;  2XAH B;  2M67 A;  3EUH A;  4DV7 T;  2DWK A;  1OWA A;  2P9B A;  3LK2 B;  4TV8 E;  3V5U A;  1KK7 A;  2JPF A;  4EOZ B;  3LK3 B;  4X64 T;  3GN5 A;  2CHO A;  4YHJ A;  4CZZ B;  2D2S A;  3AE6 A;  2XAQ B;  2LSK A;  1FJG T;  2WP9 A;  1E2A A;  1D0X A;  2L8K A;  3VR8 A;  3VKH A;  2XQ7 A;  2YDQ A;  2CHN A;  4IL4 A;  4E7Z A;  2X0L B;  5HEJ A;  2C5J A;  5L47 A;  4CXY A;  3ZCJ A;  1N32 T;  3RRC A;  5LMN T;  2WS3 A;  1LVF A;  2CXF A;  4BJM A;  2A2F X;  3C51 A;  2D5U A;  3H3A A;  3ABV A;  5JDG A;  2LM9 A;  1YKH B;  2LOP A;  2MPK A;  2EHO C;  4HFI A;  3RH3 A;  5JQG E;  2V6Y B;  2Q9Q C;  5CJ5 A;  4BJN A;  3CQG B;  2HN1 A;  3LFM A;  2WM9 A;  4B3S T;  5L4H A;  3PUZ F;  2IC9 A;  4LMJ A;  4YFS A;  4Z90 A;  3M3Z B;  3CX7 B;  3NZP A;  2VKJ A;  4O4J E;  5JTG A;  2CXL A;  2E8I A;  4H9O C;  4EGW A;  5M4Y A;  1ZP0 A;  2VVN A;  3UU3 A;  2H89 A;  2QRX A;  2VKH A;  4PK4 A;  3BQL A;  3FHN A;  3LK4 2;  5CB4 E;  4EZ4 A;  3C4X A;  4N78 D;  1VCS A;  3NVO A;  3Q5E A;  4ILA A;  5J0Z A;  3TLW A;  2UUC T;  4QKN A;  3PU3 A;  4PJL A;  2KZ7 B;  4X1I E;  4JI5 T;  1KNP A;  3T1H T;  2XAJ B;  3KVA A;  4IRE A;  4IE7 A;  2H7V C;  4WZX A;  2XM2 A;  3PUY F;  2ZMA A;  3I9Y A;  1YD8 G;  2I59 A;  5L3C B;  3PUG A;  2VKO A;  2HPJ A;  2E5V A;  2LOS A;  1VOM A; 
#chains in the Genus database with same CATH homology
 4PK6 A;  3IF8 B;  5EK4 A;  3E08 A;  3FB2 A;  4H9N C;  3N2G E;  5EZY E;  2XQY A;  2DI4 A;  3CVR A;  5HWY A;  3UTK A;  3UFE A;  3VU7 H;  3LG7 A;  3AA0 B;  2BDE A;  4TV9 E;  3UUX B;  5A1L A;  2X66 A;  3JC6 C;  2KIN B;  2CWO A;  3N2K E;  2CMR A;  2LSI A;  4B6X A;  3W15 B;  3CPZ A;  5JR9 A;  5JVD E;  4M1P A;  3TKL B;  4HKA A;  1LVK A;  3N9Q A;  4AKR B;  5HWX A;  5JR9 C;  4IHJ E;  1MND A;  3MKD A;  5DJQ C;  3RYF E;  2X9X A;  3RKO A;  2DLR A;  4TZ4 C;  5KDM C;  2DNX A;  2EHO B;  1CUN A;  3K8P C;  3HL6 A;  2Y6X A;  5L3F B;  4XZC A;  4GOU A;  2NTY A;  2KWI B;  3AA7 B;  3ANW B;  4JUY A;  3OBV E;  3HKB E;  4ZS2 A;  3ZMZ B;  1BR4 A;  4E7S A;  1ZV4 X;  3UUM A;  3PE0 A;  4IGU A;  4TX5 A;  1IAP A;  3FBZ A;  5LHG B;  1UX4 A;  3KBT A;  3HKC E;  3LJC A;  4ZI3 C;  2VK9 A;  5KX5 E;  5J2T E;  3CML A;  4AKI A;  5HXH A;  4ZI2 C;  3ZMS B;  1V9D A;  3A5X A;  3MAC A;  5LJM A;  2CM0 A;  3AAE B;  3DP7 A;  2CCQ A;  5FNV E;  3VHL A;  3UUN A;  5JR9 B;  2A3D A;  4PJJ A;  4ZI3 D;  5HXE A;  1BR2 A;  1MIV A;  3DTO A;  3RC8 A;  3J9X 1;  3C4Z A;  5LNK A;  5JRE A;  3ZCI A;  3BQI A;  1Z0P A;  5LGN B;  2Z6E A;  5H6Q B;  2PJQ A;  2D0T A;  2N2N A;  3AA1 B;  5BMV E;  3UT5 E;  1HTJ F;  3T8O A;  4UF0 B;  2N1G A;  4HGA A;  2W61 A;  3F57 A;  3KV5 A;  4IE5 A;  2X51 A;  3KIN B;  4PAG A;  3RC3 A;  3M65 A;  2G0U A;  2BZB A;  3KV6 A;  2IC6 A;  5LOV E;  3ZJ2 A;  3GWH A;  2QA7 A;  1ZEE A;  2H3R A;  3NZQ A;  2WSS V;  3IBP A;  4WW0 A;  4P0A A;  3C4W A;  5KMG P;  3KBU A;  3QK6 A;  2VWA A;  5FY1 A;  4MHC A;  3ZC0 A;  2L3L A;  5LHI B;  4EIW A;  4L0R A;  5ADX L;  3WAK A;  2W00 A;  3PU8 A;  5HXR A;  3NBX X;  5LCY A;  2E9X D;  1YKE B;  3MXZ A;  1MIY A;  1UCU A;  3O1I A;  5FYM A;  5LBQ B;  3C50 A;  3SWH A;  3O9X A;  1FIO A;  3MA9 A;  3CX8 B;  3Q9D A;  2Y48 B;  2ODV A;  1MMA A;  1KNZ A;  2YIN A;  3BK9 A;  2GK9 A;  3KDS E;  3RX6 A;  3DJB A;  4DMW A;  4DBQ A;  3ZEF B;  2YU2 A;  2JJ9 A;  2KXP B;  3HKD E;  4QX8 B;  3D0T A;  4L5G A;  4X1K E;  2V7K A;  2SPC A;  3OKQ A;  2WAU A;  5L3G B;  2CWY A;  2K24 A;  3S4U A;  4O4L E;  1HG2 A;  2WMO A;  5JDL A;  1MMG A;  3B13 A;  1VRB A;  5LXT E;  3O1H A;  4UVA B;  2JRK A;  5DQV A;  5LHH B;  5FY7 A;  4DND A;  5LJN A;  3Q2M A;  4WNK A;  5JRC A;  3H37 A;  5AFU L;  4UEM A;  3K3N A;  4UVC B;  2K48 A;  4IE6 A;  5JDH A;  4K0U A;  3ZMU B;  1G73 A;  4X1Y E;  4PK5 A;  4BA9 A;  3L09 A;  3PTR B;  2CEA A;  1WR6 A;  2V7I A;  4X20 E;  4H9P C;  2Q9Q A;  4DMV A;  2QGS A;  4KUM B;  3KFW X;  5LP6 E;  2BVM A;  3AAA B;  2HH7 A;  1IJ6 A;  3EDU A;  2KLQ A;  5L3D B;  3SOL A;  4AQG A;  4IIJ E;  4IST A;  4PW8 A;  3MJX A;  4O4H E;  4YLH A;  3ZLI A;  3AVS A;  3OJA A;  4QWN B;  5LYJ E;  4JLE A;  2DHR A;  2VB6 A;  2LSG A;  4H9S E;  4I55 E;  4FJO A;  3AVR A;  3N2O A;  4TUY E;  5LG4 A;  2X9W A;  4EB6 E;  2NW7 A;  3N5L A;  5CA0 E;  1US7 B;  2CXD A;  4BAY B;  1T98 A;  5HYA A;  2DWG A;  2MOZ A;  4CI3 B;  2IAK A;  1EZ3 A;  4JEU B;  2CA5 A;  3IEE A;  4ZI2 D;  1QSD A;  4AI6 A;  4ILU A;  4PJN A;  2V7J A;  3O1J A;  2YEV C;  3ZMT B;  3ZYM A;  2ODU A;  4CXW A;  1D1B A;  2X68 A;  4G2A A;  4O2B E;  4QX7 B;  2C5I T;  3NRY A;  3GA8 A;  2C5K T;  4EYY R;  2UXN B;  3QUJ A;  4DO0 A;  4P0B A;  3RYI E;  4CXX A;  3GN5 B;  3RYH E;  3B57 A;  4ZOL E;  3SS1 A;  3FXE B;  2YU1 A;  1HFA A;  2N9D A;  2ZM8 A;  1BR1 A;  4DVD A;  2L9Q A;  2B1E A;  3ZJ1 A;  1X79 A;  3HI2 A;  3IHR A;  3F31 A;  4H63 V;  1O3X A;  4GK0 E;  4O4I E;  4ZI7 E;  3FBL A;  2CE7 A;  2V7L A;  3RPU A;  1D0Z A;  2E9X C;  3HA4 A;  4HTE A;  4UV9 B;  4UEL A;  4HE8 A;  2XAG B;  1WYC A;  4ADZ A;  3J7Y q;  2OA5 A;  2Q9Q D;  5EK3 A;  1ZKE A;  5FMN A;  2PBI A;  2EHO D;  2JMH A;  2KWH A;  5HXC A;  4UIG A;  2K5B B;  2ZM2 A;  3CX6 B;  3E0Z A;  5FP3 A;  3L3P A;  5E0O A;  5H6R B;  5CA1 E;  1MIW A;  2X67 A;  4WBO A;  2W0G A;  2Y8D A;  3SRZ A;  4JEH B;  3R84 B;  4MAL A;  3ZC1 A;  2C0S A;  3KV4 A;  4AQF A;  4IE4 A;  3JC6 D;  2EHO A;  1H7C A;  4OFZ A;  5F8P A;  4AXP A;  3V5S A;  5FXV A;  2CLY C;  3MK7 C;  2X9H A;  5J1G A;  4OK0 A;  3EVY A;  1NWM X;  4CI1 B;  4OYK A;  4I43 B;  2LT3 A;  5FXW A;  4ZHQ E;  3KVB A;  1QUU A;  4V1A v;  2WBL A;  4ANJ A;  1LRZ A;  4L9I A;  3AAI A;  2JMK A;  4MLK A;  2XUE A;  4ISS A;  4QXB B;  3Q5W A;  4XAX B;  5HXS A;  2X9Y A;  2W62 A;  4DBR A;  2ES0 A;  5JH7 E;  4GK5 E;  5JDN A;  3PUQ A;  2WMN A;  4HFV A;  2E9X A;  4J2C A;  2VL8 A;  3ZN1 B;  3ZMV B;  2DCF A;  4O8S A;  1U5P A;  5HAX A;  3CWZ B;  3K3O A;  3VKG A;  5FY0 A;  2UXX B;  1UX5 A;  1FEW A;  2VAS A;  2KND A;  1D0Y A;  2ACX A;  2PFV A;  4U72 A;  4ZS3 A;  3U78 A;  3UUL A;  4IDZ A;  3R6N A;  1IJ5 A;  4TN7 B;  3CQC B;  3OYX A;  2HPJ A;  5LGU B;  3QC9 A;  1NAF A;  4GIW A;  4AKH A;  3P7I A;  3I0Q A;  4GYR A;  4HEA A;  3OYZ A;  1FMV A;  2KMF A;  4YJ3 E;  4Z8X A;  3ZYL A;  1MNE A;  3NRX A;  3AA6 B;  1YW0 A;  5GON E;  2LEH A;  2NP9 A;  3HR0 A;  2NWB A;  3RRW A;  2W63 A;  2LJL A;  4ASK A;  4F6R C;  5J2U E;  4H63 H;  3ONX A;  1E1H B;  4OHF A;  4UVB B;  4OYJ A;  1AJ3 A;  2NW9 A;  3PUA A;  4PJM A;  3GMI A;  2XAS B;  3ETU A;  1LKX A;  4UF0 A;  3WAJ A;  4NUV A;  3Q5X A;  5TAO A;  2V1D B;  3ANW A;  1S35 A;  2YK0 A;  2CLY B;  3ETV A;  3E22 E;  3PUS A;  4U74 A;  2MYS A;  3C98 B;  4PFP A;  4YJ2 E;  2NTX A;  4XBF B;  5JDM A;  4ERR A;  2MBG A;  3PUR A;  5FXZ A;  3CKD A;  2VKD A;  3U3I A;  5L3B B;  1HCI A;  1SHZ C;  4I4T E;  4QXC B;  3WI3 A;  3C64 A;  4CQI A;  3ZN0 B;  2LSY A;  5L2L A;  5EK2 A;  2LHN A;  3I1A A;  5IYZ E;  3HKE E;  3LBX B;  2A72 A;  3O4X E;  3ZPO A;  5IHY A;  4UXN B;  3EDV A;  4KP3 C;  3PDY A;  1D1C A;  2RA1 A;  2XTL A;  3K3Q C;  3AB3 B;  4AKG A;  5LBM A;  2J1D G;  2NOX A;  4EYU A;  4NUU A;  4CI2 B;  4A56 A;  1SA0 E;  3KV9 A;  1FMW A;  2V26 A;  2LSJ A;  1HF8 A;  3RYC E;  5L3E B;  2ZM0 A;  5F3J A;  1BR0 A;  3N9O A;  2Q9Q B;  2ZLY A;  2H7O A;  4FI5 A;  3LBX A;  4C90 A;  4I50 E;  2LE8 A;  2MTQ A;  1D1A A;  5JDF A;  1HS7 A;  4MBQ A;  3I9W A;  3BQK A;  4AQF C;  3F2E A;  5C8Y E;  2V7M A;  1WRD A;  2KT9 A;  4MFR A;  2HPL A;  1MMN A;  4P09 A;  2XAF B;  4WBN E;  5FXX A;  2IW5 B;  3ESL A;  4G63 A;  5LA6 E;  3I0O A;  4HN9 A;  4UV8 B;  3MZK B;  4EZH A;  3ZYK A;  2RP4 A;  4QHO A;  4C91 A;  4O2A E;  1IZN B;  4QXH B;  4EAH A;  4H9R C;  1HX8 A;  2PG8 A;  3N9L A;  4AKL A;  3N9M A;  2XHE B;  1OXZ A;  3N9N A;  2E9X B;  5JDQ A;  2D0U A;  4EXT A;  4PFO A;  1G8X A;  1WYB A;  5LGT B;  5DAB A;  3P8C D;  3CQX C;  5ETW A;  4KMC A;  4H9Q C;  4PNI A;  1HG5 A;  2LHR A;  1ZHC A;  1MMD A;  1Y64 B;  3N9P A;  4GYS A;  4IE0 A;  4KBM B;  2K9A A;  1B7T A;  2JQQ A;  2BVL A;  3FXD B;  5DQW A;  5JRC B;  1U4Q A;  1WLX A;  2WWU A;  2NW8 A;  2XAH B;  3EUH A;  2M67 A;  2DWK A;  1OWA A;  2P9B A;  3LK2 B;  4TV8 E;  3V5U A;  1KK7 A;  2JPF A;  4EOZ B;  3LK3 B;  3GN5 A;  4CZZ B;  4YHJ A;  2D2S A;  2XAQ B;  2LSK A;  3VKH A;  1D0X A;  2L8K A;  4E7Z A;  4CXY A;  2X0L B;  2C5J A;  3ZCJ A;  3RRC A;  1LVF A;  2CXF A;  4BJM A;  2A2F X;  3C51 A;  2D5U A;  3H3A A;  5JDG A;  2LM9 A;  1YKH B;  2LOP A;  5JQG E;  2EHO C;  3RH3 A;  2Q9Q C;  4BJN A;  3CQG B;  3LFM A;  2WM9 A;  2IC9 A;  4YFS A;  4O4J E;  3CX7 B;  3NZP A;  2VKJ A;  2CXL A;  2E8I A;  4H9O C;  5M4Y A;  2VKH A;  4PK4 A;  3BQL A;  3FHN A;  3LK4 2;  5CB4 E;  4EZ4 A;  3C4X A;  4N78 D;  4QKN A;  3PU3 A;  4PJL A;  2KZ7 B;  4X1I E;  2XAJ B;  3KVA A;  4IE7 A;  2H7V C;  2ZMA A;  3I9Y A;  1YD8 G;  2I59 A;  5L3C B;  3PUG A;  2VKO A;  1S94 A;  2LOS A;  1VOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...