3MA9A

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
216
structure length
197
Chain Sequence
b'MQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAGHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLEGQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 100
structure length 197
sequence length 216
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ma9A00
3MACA 3MA9A 2CMRA
chains in the Genus database with same CATH superfamily
2AXDS 4EZHA 3U3IA 3AE7A 3MXZA 2UUAT 4UIGA 2FBWA 3EAMA 2W63A 3CQCB 3QB5K 3RYHE 2BKPA 2EHOD 2VVSA 2WM9A 4DV7T 1WR0A 1FIOA 2CEAA 5FL1A 1YD8G 3CMLA 5IYZE 2IC9A 4QXCB 4QHOA 2VQET 5ABFB 2V1DB 4OYJA 5LJMA 5HEHA 5LGTB 2QRXA 4PFPA 4LF6T 4X65T 3RC8A 3OBVE 3RGLA 3BK9A 3MJXA 3SFDA 1D1AA 2WB5A 4ZXLA 2CHNA 5BMVE 2D2SA 4LF9T 2CXLA 1HFAA 3CK6A 3RH3A 4IT4A 2ODVA 5L2LA 4YJ3E 4JI2T 2BBJA 4JI4T 2YU2A 1XMOT 2XQ6A 4LMJA 4U31A 4EYUA 3HI2A 4NUUA 4BJNA 5FNVE 3Q9DA 3MZKB 2LRLA 1SA0E 3MKDA 5CFBA 1U5PA 3TKLB 3EDVA 4IL4A 3EHZA 3RYCE 1WR6A 3I0QA 3CVRA 4UF0A 3DTOA 2BKNA 2N1GA 3PTRB 3O1JA 4DR7T 2LSIA 3AVSA 5LB7B 1N36T 5LGNB 2KWIB 5KX5E 5FY1A 1UGOA 1LRZA 4C90A 2B76A 3GN5A 4I55E 3BQKA 3E08A 1SUMB 2D5UA 2MTQA 4ZHQE 5ABEA 4U74A 1HNXT 4YY3T 5JRCA 2BS4A 2A3DA 3T1HT 2YN6A 1M62A 2D9DA 3VKGA 4YHHT 2J4GA 4YSXA 2C5JA 3AXJB 3IF8B 4GKJT 4EIWA 5IUXA 4HWCA 2JMHA 1D0YA 5CGMA 5HXCA 3EABA 4HWIB 4JI1T 2DCFA 4C91A 4WBOA 1ZP0A 5HEJA 5C2TA 2L3LA 2P9BA 1FJGT 3AVRA 4IREA 4HN9A 1OEDC 2Y48B 2XM1A 2ODUA 1T7SA 4LFCT 2PFVA 4AQFC 3SFEA 5AQQB 5HXEA 4ZZCA 3SS1A 1I6ZA 2QA7A 5ADXL 3UQ7A 2WU2A 3C51A 2X0HA 3HL6A 5FL0A 4U33A 4EEDA 3P8CD 2RA1A 1R8IA 1W9RA 2V26A 2FUPA 3RKGA 4LMLA 2LJLA 3JCFA 3PJAJ 3L39A 3LK3B 4IE5A 5J0ZA 3K3OA 3RRCA 1OXZA 3PDYA 2V7LA 5FVLA 4TV9E 2R6GF 3P7IA 3Q5XA 4AXPA 4ILUA 2WY2A 4XAXB 3A5XA 3C4ZA 5HCJA 3TLSA 4DMVA 5AQPB 2BZBA 3WAJA 4U3CA 2Y6XA 1IBMT 2LSYA 2WU5A 5AQKB 1E1HB 2WS3A 3GA8A 3EVYA 4YSZA 1BR0A 3AA0B 4ZI2D 1E7PA 2FJEA 3MK7C 4CN4A 4F8HA 1MMNA 2WSSV 5DABA 3TLWA 3KV4A 4MLKA 5FYMA 4IE4A 3TLUA 1W0BA 2WWUA 4AQGA 4WZXA 3JAEA 1OEDE 4EGWA 5HAXA 3ANWA 5KDMC 3PUYF 4U7IA 2BS3A 2VB6A 2W66A 4EYYR 2E8IA 3AA1B 4IDOA 4GOUA 4PJNA 4ANJA 4H9OC 4OX9T 2YU1A 4DV3T 3NZQA 5LHHB 5L4EA 4X20E 2YDRA 4PJJA 2J1DG 3AE3A 4IE7A 3Q2MA 5FXZA 4HFBA 1OEDB 3K8PC 4WYVA 5HXSA 2RPAA 3B5MA 4JEUB 2HPLA 1V9DA 2YOEA 2CBIA 4BA9A 4TNVA 1YQ3A 3N2GE 5HCMA 3T1YT 3AAIA 2K48A 4M1PA 4H9NC 1WYBA 5CA0E 4GK5E 3GMIA 4DVDA 1JNRA 3PUZF 2CMRA 4I4TE 4YJ2E 4HE8A 2E9XA 4K0KT 4CXYA 5LNKA 4OHFA 3ZC0A 3AA7B 3HKBE 4PK5A 5LP6E 2H89A 4CI3B 2OA5A 5AQHB 1WYCA 3JC6C 5EK3A 4AIUA 1KNRA 3UQ4A 3J7Yq 2G0UA 2Q9QA 2D0UA 4NXNT 3D0TA 3N9LA 4IDQA 3UU4A 2CWOA 4P0BA 1VOMA 1XNQT 3WAKA 2A72A 4DMWA 5AQFB 4MHCA 3VRAA 2NWBA 2OV9A 3FZMB 3R84B 3HKCE 5AQVB 1IZNB 3C4XA 2Y8DA 2GK9A 3OYXA 5AQSB 3RF1A 3NWIA 3FBZA 1J5ET 2CE7A 2A2FX 3BQLA 2M6BA 3DP7A 5LG4A 1U4QA 2Q9QC 1MMDA 2XUEA 3F31A 2ZMAA 3E22E 1UX4A 3LJCA 4QX7B 2BG9C 4NIQA 5JTGA 4YTPA 1IBKT 2HH7A 1J1JA 3AEAA 2XAHB 4JLEA 4DR5T 1QLBA 3UFEA 5AQOB 3KINB 1ZV4X 3Q5DA 4X62T 2BKOA 3CQGB 3LFMA 3ZMTB 2ACZA 2V6YA 3LG7A 5L3BB 4HFHA 2QGSA 2XQYA 1MMAA 4O2BE 3Q5EA 3UU3A 5LOVE 2LM9A 4V1Av 5LMNT 4YFSA 3N9QA 3L09A 2V6XA 4GK0E 3NRXA 3ZMSB 2XSBA 3AEBA 4HEAA 2KZ7B 2X0YA 5L3CB 3ZC1A 2IMLA 5KXJA 3KBUA 2K9AA 2K24A 4KMCA 3AEGA 1HF8A 3JADA 4JI7T 4COFA 2UXXB 1D1BA 4B3RT 2WDVA 1G73A 2SPCA 4O2AE 2XQ5A 2LKGA 1FMWA 3FB2A 1S35A 2C5IT 3A7MA 3PUGA 3ZMUB 2DWGA 3PV0F 3SOLA 1LKXA 2JMKA 5JDHA 3NKZA 2UU9T 2DNXA 1LVFA 1SE7A 4TUYE 2NR4A 2IAKA 4KHPT 3RQUA 2BG9E 2XAGB 4K0UA 2YDQA 4O8SA 4J2CA 1Y64B 3H3AA 2WZHA 5LJNA 1UK5A 3ZYKA 3PJAA 1N32T 4LF5T 3F2EA 1I94T 5AQIB 4OYKA 3CX8B 3CIRA 4JYAT 5LCYA 3T8OA 2WAUA 1YKHB 4IE0A 2Q9QB 4CXXA 5BR8T 5CJ5A 3V5SA 4HWDA 2BG9B 5CB4E 5H6QB 4E7ZA 4DUZT 2VURA 3OVUA 1FMVA 3I9YA 5FKYA 2PBIA 2NP9A 1MNEA 2JRKA 4H63H 2X66A 2XQ9A 1ZKEA 3IHRA 4DNDA 2H7VC 2LHRA 3ZT5A 5L3EB 4EAHA 3ZJ2A 2VKOA 5FMNA 4NUVA 2NOXA 4EB6E 1QUUA 5M4YA 4UELA 5AQLB 4CI1B 3AE9A 3PE0A 3Q5WA 2X9WA 4ZEYA 4PK6A 1G8XA 4QH5A 2X0LB 5FXWA 5JH7E 2NTYA 2JJ9A 3LBXB 4CN1A 4GIWA 1IJ6A 3SWHA 1ZEEA 3VKHA 3LK2B 2LOSA 3ZMZB 1GQEA 4DR6T 2WDRA 3VR8A 2V6YB 2F4VT 1CHUA 1XMQT 4AI6A 2VVNA 4P0AA 2FJBA 2XQ7A 5JDGA 2KT9A 4PJMA 3RPUA 2VL8A 1UX5A 2DI4A 3PUVF 2W67A 3RIAA 2ZLYA 3UT5E 4YT0A 3KDSE 4DO0A 2LHNA 1CUNA 4YTMA 4UVBB 4E7SA 4DR1T 4IGUA 1MMGA 2XM2A 5LHIB 3RYFE 2JQ9A 4P1NA 1HNWT 5LBQB 4EZ4A 4DBRA 1BR4A 5HXHA 4QX8B 4G2AA 3AE1A 2WP9A 3QNUA 1QSDA 2XPKA 5JDFA 1Y01A 4YXDA 4H63V 3ZCJA 4CQIA 3O9XA 3O4XE 2BVLA 4HTEA 5LA6E 4XBFB 4DR4T 2ZM2A 1JNZA 3AE2A 2CHOA 4XZCA 4GKKT 3L3PA 5L3DB 4PJLA 3P4RA 1UURA 2XSAA 3N2KE 3AE5A 5LYJE 2WWVA 3HA4A 3PUSA 5J2TE 5TAOA 2FJDA 4Z8XA 5HEGA 2E2AA 4IIJE 1VRBA 3CKDA 4JEHB 4EV6A 4O4JE 3TLVA 3MACA 4AQYT 3VR9A 5LBMA 5J1GA 1B7TA 1Z8UA 3FXDB 2K5BB 4L0RA 5GONE 3ZEFB 3AEDA 2N2NA 3OYZA 2CXDA 1OWAA 1J5WA 4A56A 4ISSA 2X9YA 2YDSA 4UF0B 3PUAA 4AKHA 1UUSA 3N2OA 4DV4T 2CCQA 2JPFA 5FXXA 2LKHA 4OK0A 1ZOYA 1BR2A 1KFYA 4I43B 1MIVA 3WI3A 4KX6A 2MYSA 3GN5B 2C5KT 2AE9A 3UUMA 2WQYA 2XJ7A 4X1IE 2DLRA 4PK4A 4X64T 2KINB 5JRCB 4ILBA 2NTXA 1W09A 3VRBA 2DHRA 4IHJE 5AQRB 2VWAA 3KV6A 4DR2T 4L9IA 2B1EA 2CLYC 1WLXA 3UU5A 3PUXF 3JC6D 1NWMX 3CX6B 4YLHA 3K1SA 3N9PA 5ABFA 2H3RA 4X66T 2UUCT 3QUJA 2DWKA 5EK2A 1S94A 3S4UA 2VQFT 2X51A 2ES0A 2XHEB 2J62A 4LFAT 4O4LE 1HX8A 4HFVA 3QK6A 4UVAB 2M6IA 4DBQA 1XNRT 2HN1A 5ABGA 4QH4A 2JQHA 2LRKA 2K3WA 3KV9A 2ACXA 2NW9A 3FZLB 3ZSTA 4Z91A 2WZIA 2Q9QD 5HYAA 2E9XC 1BR1A 2M67A 1YQ4A 4A97A 5HEOA 3RYIE 4ADZA 4B3TT 2V7KA 3TLTA 5F8PA 5FVKA 3H3MA 3AAAB 4DR3T 3ZYLA 2KSRA 2J47A 1HCIA 4LF4T 2LOPA 3PUWF 4LFBT 3KBTA 2LLYA 3UU8A 2NW7A 3QOFA 4KI0F 3I0OA 2XAFB 2LSGA 2XQ4A 4U2YA 2BBHA 4O4HE 4WW0A 2XASB 3P50A 2IIUA 2WDQA 5ABHA 2I6HA 4L5GA 3UFGA 1YXRA 4TNWA 4ILCA 3RIFA 5JDNA 4IL9A 3QC9A 3EDUA 4MFRA 2XAJB 4U72A 3ANWB 4KP3C 4FJOA 2CBJA 1MNDA 3AEEA 3ZMVB 4H9PC 2CLYB 4MBQA 3ZT7A 5L3FB 3UU6A 1SHZC 3HR0A 4BAYB 5IHYA 2CA5A 2CM0A 2VASA 1DU2A 2XAQB 3FZFB 3ETVA 4EXTA 2ZM6T 1XDOA 3FBLA 3ZPOA 1US7B 4CI2B 2LT3A 1N34T 2IUBA 3I9WA 5JQGE 2EHOA 3AECA 1EZ3A 3O1IA 4HWHA 4B6XA 3P4WA 2QVAA 4KHZF 2D0TA 4UV9B 3AE4A 2BDEA 5LMUT 3RHWA 3LDQB 4HFDA 4IDPA 2OLTA 3PUQA 1HG5A 5AQGB 5DQVA 5CA1E 3KFWX 2LSKA 4MALA 3E0ZA 5FP3A 4NPPA 4HGAA 2E9XB 3ZT6A 3NVOA 5JR9A 4AKLA 4ZZBA 1HTJF 2EHOC 3AB3B 4QKNA 4TWDA 3BQIA 3C4WA 4HFIA 3ONJA 1HS7A 2VKJA 1N33T 4N78D 2Z6EA 3ESLA 3ZLIA 3EI0A 3IEEA 1KNPA 2V8SV 2N9DA 2MPKA 3RKOA 5HWYA 4UXNB 2V7MA 2CXFA 2KNDA 5JR9C 2HPJA 2XQ8A 4H9SE 5EK4A 4OFZA 3FZKB 4F6RC 2LM2A 1T98A 4A5XA 4PAGA 5JREA 5J2UE 2WCAA 4DIDB 4BJMA 3FZHB 3OPCA 1HG2A 5DQWA 4TX5A 3ZN1B 1AJ3A 4DV2T 3OTOT 4DV0T 3AE6A 1D0XA 2FJAA 4B3MT 2XQ3A 3RC3A 4JBWF 4IDNA 1XWMA 2JIWA 3EUHA 3FHNA 1XZYA 4U7YA 5E0OA 3P4SA 4CN6A 1OEDA 4JUYA 4QXBB 3OJAA 3AAEB 1H7CA 4AQFA 2X67A 3N5LA 4ZI3D 3IBPA 3B57A 3PU3A 5LG3A 4I50E 4TN7B 1WFDA 4ILAA 5HEUA 5KMGP 2LEHA 4EEBA 4QH1A 1FEWA 3NBXX 4Z90A 4X5TA 2KXPB 2WMNA 3QB5A 4GYSA 4ZI3C 2MBGA 2HN2A 2KMFA 3R6NA 4JI0T 4I0UA 3X1DA 2IC6A 2VKHA 2EHOB 3L8RA 4ASKA 2IW5B 5AQUB 2VL0A 1VCTA 1E2AA 4UVCB 1XDPA 3HKEE 4QWNB 4X1KE 4O4IE 4X1YE 4H9RC 3ZYMA 4ZI7E 2L8KA 1KK7A 2W00A 4FI5A 5AQNB 4WNKA 3C50A 1L0VA 3FXEB 2L9QA 2I59A 4P09A 4KBMB 3ABVA 4JV5T 3RI5A 2PJQA 5JR9B 5C8YE 4LMKA 2W61A 2CPTA 1UCUA 3ONLC 2V5CA 2E5LT 2E5VA 3ZKRA 3KVAA 3N9OA 5FY7A 4JI6T 3N9NA 4Q25A 2QYWA 3UUBA 2W2UA 5JDQA 3ZCIA 2WMOA 4JI5T 5FXVA 2RP4A 1X79A 2W0GA 1KF6A 3CWZB 2PTFA 4PW8A 4WBNE 4QXHB 4HFCA 3AEFA 3ETUA 3IA3A 5L3GB 3PU8A 3VHLA 4TWHA 1LVKA 1D0ZA 4UR9A 3A8YC 2MOZA 4ZS3A 4AKIA 2X9XA 3U78A 3SRZA 3HKDE 3K3NA 2LSJA 4ZS2A 4TZ4C 5AQMB 5AQTB 4PNIA 3RIUA 4HWFA 5H6RB 4AISA 1IAPA 5L47A 3C98B 1X9BA 2XQAA 5LXTE 3M3ZB 2HHHT 4ZI2C 3UTKA 4DV1T 3ZSSA 4B3ST 2BVMA 5F3JA 2VKDA 2W4XA 4H9QC 4GYRA 4LF8T 3PURA 2YINA 3H37A 1NENA 4YTNA 4TV8E 4NXMT 2CWYA 2X9HA 4HKAA 4JI3T 1KEYA 2XZEA 1HNZT 4LF7T 3RIUC 2YEVC 2X68A 3CPZA 4EOZB 4G63A 5HWXA 2V7IA 2UUBT 5F5WA 5LGUB 4DV6T 3AE8A 4A98A 4AKGA 2BS2A 3LSVA 3GWHA 2VK9A 2V7JA 3G06A 1MIYA 3RRWA 4UV8B 3RQWA 4DUYT 4YHJA 2E9XD 2WBLA 3F57A 3K3QC 3N9MA 3P4PA 2LE8A 1MIWA 3CX7B 1YW0A 3J9X1 4UEMA 3ZJ1A 3CQXC 2ZM0A 1IBLT 4IE6A 5LHGB 2V5DA 1HX1B 2UXDT 2UXNB 5JDMA 2KWHA 3C64A 4JI8T 2H7OA 2PG8A 3AA6B 4PFOA 5JDLA 3UULA 2MAWA 2XTLA 4DV5T 2C0SA 3NRYA 4CXWA 1T8BA 5JVDE 1WRDA 1VCSA 2KLQA 5IWAT 5HXRA 2BG9A 3ZN0B 1W0AA 1WCRA 3B13A 2JQKA 1D1CA 2I0MA 4AKRB 3NZPA 4TWFA 2DL1A 4ISTA 1NEKA 5L4HA 4YSYA 3RX6A 4CZZB 1T72A 3O1HA 2UXCT 5C3JA 5ETWA 3JAFA 1KNZA 1M7KA 4U2ZA 3KVBA 2JQQA 2ZM8A 2H88A 4KUMB 3RLFF 1NAFA 2NW8A 3ONXA 5EZYE 3LK42 5A1LA 3P4QA 3KV5A 5FY0A 2W62A 2IDOB 3DJBA 3W15B 3MA9A 1IJ5A 4HFEA 3M65A 3UUXB 4ERRA 5AQJB 1Z0PA 3AXJA 2CRBA 3LBXA 2UXBT 1HR0T 3OKQA 1ZHCA 2IHR1 2A9UA 3I1AA 5DJQC 2YK0A 3VU7H 2YKSA 1YKEB 2XY8B 4IDZA 3V5UA 1O3XA 5AFUL 4ZOLE 3UUNA
chains in the Genus database with same CATH topology
4PJLA 1D0XA 3AA7B 3ZC0A 4EZHA 3HKBE 3U3IA 4PK5A 5LP6E 3MXZA 3N2KE 5LYJE 4CI3B 4UIGA 2OA5A 3HA4A 3RC3A 1WYCA 3JC6C 3PUSA 5J2TE 5EK3A 5TAOA 4Z8XA 2W63A 3CQCB 4IIJE 1VRBA 3CKDA 4JEHB 4O4JE 3MACA 3RYHE 5LBMA 3EUHA 5J1GA 3J7Yq 3FHNA 1B7TA 3FXDB 2EHOD 2G0UA 2K5BB 2D0UA 2Q9QA 4L0RA 5GONE 3ZEFB 2WM9A 2N2NA 3D0TA 3N9LA 2CXDA 3OYZA 5E0OA 1OWAA 1FIOA 2CWOA 4A56A 4P0BA 2CEAA 1YD8G 4JUYA 4ISSA 1VOMA 4QXBB 3CMLA 5IYZE 3OJAA 2X9YA 2IC9A 3AAEB 3WAKA 4QXCB 1H7CA 4QHOA 4UF0B 3PUAA 4AQFA 4AKHA 2V1DB 3N2OA 2A72A 4DMWA 2X67A 3N5LA 4OYJA 5LJMA 4MHCA 2NWBA 2CCQA 5LGTB 4ZI3D 3UUNA 2JPFA 3IBPA 5FXXA 3B57A 3PU3A 3R84B 4OK0A 4PFPA 3HKCE 1BR2A 4I50E 4TN7B 3RC8A 3OBVE 1IZNB 3C4XA 2Y8DA 3BK9A 3MJXA 1D1AA 2GK9A 3OYXA 5KMGP 2LEHA 4I43B 5BMVE 1MIVA 2D2SA 3WI3A 3FBZA 2CE7A 2MYSA 3GN5B 2A2FX 2C5KT 2CXLA 3BQLA 1HFAA 3RH3A 3UUMA 3DP7A 2ODVA 1FEWA 5LG4A 1U4QA 3NBXX 2Q9QC 5L2LA 1MMDA 4X1IE 2XUEA 2DLRA 4YJ3E 3F31A 2ZMAA 4PK4A 2KXPB 3E22E 2WMNA 2KINB 1UX4A 2YU2A 5JRCB 3LJCA 2NTXA 2DHRA 4GYSA 4IHJE 4QX7B 4ZI3C 2MBGA 2VWAA 4EYUA 2KMFA 3HI2A 2HH7A 3KV6A 4NUUA 3R6NA 4BJNA 4L9IA 2IC6A 2VKHA 2EHOB 4ASKA 5FNVE 2XAHB 3Q9DA 3MZKB 4JLEA 2IW5B 3UFEA 1SA0E 3MKDA 1U5PA 2B1EA 3EDVA 3KINB 3TKLB 2CLYC 1ZV4X 4UVCB 1WLXA 3HKEE 4QWNB 4X1KE 3RYCE 4O4IE 3CQGB 4X1YE 4H9RC 1WR6A 3JC6D 3ZYMA 1NWMX 4ZI7E 3LFMA 3ZMTB 2L8KA 3CX6B 1KK7A 2W00A 3LG7A 3I0QA 4FI5A 5L3BB 4YLHA 3CVRA 4WNKA 3C50A 2QGSA 2XQYA 4UF0A 3N9PA 1MMAA 3DTOA 3FXEB 4O2BE 2L9QA 2I59A 2H3RA 2N1GA 3PTRB 4P09A 3QUJA 4KBMB 2DWKA 3O1JA 2LSIA 3AVSA 2PJQA 5EK2A 5JR9B 5LGNB 2KWIB 5C8YE 1S94A 5LOVE 2W61A 5KX5E 3S4UA 2X51A 2ES0A 2LM9A 1UCUA 2XHEB 4V1Av 4O4LE 1HX8A 3KVAA 4HFVA 3N9OA 5FY1A 1LRZA 3QK6A 3N9QA 4YFSA 4C90A 3GN5A 3L09A 4I55E 5FY7A 3BQKA 3N9NA 4GK0E 3E08A 4UVAB 3NRXA 3ZMSB 2D5UA 2MTQA 4ZHQE 5JDQA 3ZCIA 2WMOA 4DBQA 4HEAA 2KZ7B 4U74A 5FXVA 2RP4A 5L3CB 1X79A 3ZC1A 2W0GA 3CWZB 5JRCA 4PW8A 4WBNE 4QXHB 3KBUA 2K9AA 2K24A 2A3DA 3ETUA 4KMCA 3KV9A 1HF8A 2ACXA 2NW9A 5L3GB 2Q9QD 2UXXB 1D1BA 3VKGA 5HYAA 3PU8A 1G73A 2SPCA 2E9XC 2C5JA 1BR1A 4O2AE 3VHLA 2M67A 1LVKA 1D0ZA 3IF8B 2MOZA 4ZS3A 4AKIA 1FMWA 3FB2A 4EIWA 2X9XA 3U78A 3SRZA 3HKDE 1S35A 3K3NA 2LSJA 2JMHA 1D0YA 2C5IT 4ZS2A 3PUGA 5HXCA 4TZ4C 3ZMUB 2DWGA 4PNIA 3SOLA 3RYIE 2DCFA 4ADZA 1LKXA 2JMKA 5H6RB 1IAPA 5JDHA 2V7KA 4C91A 4WBOA 5F8PA 3C98B 2DNXA 1LVFA 3AAAB 3ZYLA 5LXTE 4TUYE 1HCIA 2L3LA 4ZI2C 3UTKA 2P9BA 2LOPA 3KBTA 2IAKA 3AVRA 2NW7A 2BVMA 5F3JA 4HN9A 2VKDA 2XAGB 4H9QC 4K0UA 3I0OA 4GYRA 2XAFB 4O8SA 4J2CA 2LSGA 1Y64B 3H3AA 3PURA 2YINA 5LJNA 2Y48B 3H37A 3ZYKA 2ODUA 4TV8E 2PFVA 4O4HE 4AQFC 4WW0A 2CWYA 2X9HA 2XASB 3F2EA 4HKAA 4OYKA 3CX8B 5HXEA 4L5GA 3SS1A 2YEVC 5LCYA 2QA7A 5ADXL 3T8OA 2WAUA 2X68A 1YKHB 3C51A 3CPZA 4IE0A 4EOZB 2Q9QB 3HL6A 4G63A 5HWXA 4CXXA 2V7IA 5JDNA 5LGUB 3V5SA 3P8CD 4AKGA 2RA1A 3GWHA 5CB4E 2V26A 3QC9A 5H6QB 2LJLA 4E7ZA 2VK9A 3EDUA 3LK3B 4MFRA 2XAJB 1FMVA 2V7JA 3I9YA 4IE5A 4U72A 3K3OA 3ANWB 3RRCA 1MIYA 1OXZA 2PBIA 3RRWA 4UV8B 3PDYA 2V7LA 4KP3C 2NP9A 4FJOA 1MNEA 1MNDA 2JRKA 3ZMVB 4H9PC 4TV9E 2CLYB 4H63H 4MBQA 2X66A 3P7IA 1ZKEA 4YHJA 3IHRA 3Q5XA 4DNDA 2H7VC 4AXPA 2E9XD 2LHRA 4ILUA 4XAXB 2WBLA 3F57A 5L3EB 4EAHA 5L3FB 3K3QC 3A5XA 3C4ZA 3N9MA 3ZJ2A 4DMVA 1SHZC 2VKOA 2BZBA 3HR0A 3WAJA 4BAYB 5FMNA 4NUVA 2LE8A 2NOXA 1MIWA 5IHYA 3CX7B 1YW0A 2Y6XA 3J9X1 4EB6E 2CA5A 2LSYA 4UEMA 3CQXC 3ZJ1A 2ZM0A 2CM0A 2VASA 4IE6A 1E1HB 1QUUA 5LHGB 2XAQB 3GA8A 3ETVA 4EXTA 5M4YA 4UELA 3EVYA 4CI1B 1BR0A 3AA0B 3FBLA 3ZPOA 1US7B 3PE0A 3Q5WA 2X9WA 4CI2B 2UXNB 4ZI2D 2LT3A 5JDMA 3I9WA 4PK6A 2KWHA 3C64A 1G8XA 2H7OA 2EHOA 5JQGE 2X0LB 2PG8A 3MK7C 1EZ3A 3AA6B 3O1IA 1MMNA 4PFOA 5FXWA 2WSSV 4B6XA 5JDLA 2NTYA 5JH7E 2D0TA 2JJ9A 3LBXB 4GIWA 4UV9B 1IJ6A 3SWHA 3UULA 1ZEEA 2BDEA 3VKHA 3LK2B 2LOSA 3ZMZB 2XTLA 5DABA 2C0SA 3NRYA 4CXWA 5JVDE 3KV4A 1WRDA 2KLQA 4MLKA 5HXRA 5FYMA 3ZN0B 3PUQA 4IE4A 3B13A 4AI6A 1HG5A 2WWUA 5DQVA 5CA1E 1D1CA 4AKRB 4P0AA 3NZPA 4AQGA 3KFWX 2LSKA 4ISTA 5HAXA 4MALA 5JDGA 3ANWA 5KDMC 2KT9A 3E0ZA 3RX6A 5FP3A 4CZZB 4HGAA 2E9XB 4PJMA 3O1HA 3RPUA 2VL8A 5ETWA 5JR9A 1UX5A 2DI4A 4AKLA 1HTJF 1KNZA 2ZLYA 2VB6A 3KVBA 3UT5E 2JQQA 2ZM8A 2EHOC 4EYYR 3KDSE 3AB3B 2E8IA 4QKNA 3AA1B 4KUMB 4DO0A 2LHNA 3BQIA 4GOUA 1NAFA 1CUNA 4PJNA 4ANJA 4H9OC 4UVBB 4E7SA 3C4WA 2NW8A 4IGUA 2YU1A 1MMGA 3NZQA 3ONXA 3RYFE 5LHHB 5LHIB 1HS7A 5EZYE 3LK42 4X20E 5LBQB 4DBRA 4EZ4A 5A1LA 2VKJA 3KV5A 4PJJA 2J1DG 2W62A 5FY0A 1BR4A 5HXHA 4N78D 4IE7A 3Q2MA 5FXZA 2Z6EA 3ESLA 3ZLIA 4QX8B 4G2AA 3IEEA 3K8PC 5HXSA 3DJBA 4JEUB 3MA9A 3W15B 2HPLA 2N9DA 1IJ5A 1V9DA 3RKOA 1QSDA 4UXNB 5HWYA 5JDFA 2V7MA 2CXFA 3M65A 3UUXB 4ERRA 1Z0PA 2KNDA 4BA9A 5JR9C 2HPJA 3LBXA 4H63V 3ZCJA 4CQIA 3N2GE 4H9SE 5EK4A 3OKQA 4OFZA 1ZHCA 3O9XA 4F6RC 3AAIA 3O4XE 2K48A 3I1AA 4M1PA 5DJQC 2BVLA 4H9NC 1T98A 2YK0A 1WYBA 4HTEA 5LA6E 4XBFB 5CA0E 4PAGA 5JREA 5J2UE 4GK5E 3GMIA 2ZM2A 4BJMA 4DVDA 3VU7H 1HG2A 5DQWA 4TX5A 3ZN1B 1AJ3A 2CMRA 4I4TE 1YKEB 4YJ2E 4HE8A 4IDZA 1O3XA 3V5UA 5AFUL 2E9XA 4ZOLE 4XZCA 4CXYA 5LNKA 3L3PA 4OHFA 5L3DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAC A;  3MA9 A;  2CMR A; 
#chains in the Genus database with same CATH topology
 2AXD S;  4EZH A;  3U3I A;  3AE7 A;  3MXZ A;  2UUA T;  4UIG A;  2FBW A;  3EAM A;  2W63 A;  3CQC B;  3QB5 K;  3RYH E;  2BKP A;  2EHO D;  2VVS A;  2WM9 A;  4DV7 T;  1WR0 A;  1FIO A;  2CEA A;  5FL1 A;  1YD8 G;  3CML A;  5IYZ E;  2IC9 A;  4QXC B;  4QHO A;  2VQE T;  5ABF B;  2V1D B;  4OYJ A;  5LJM A;  5HEH A;  5LGT B;  2QRX A;  4PFP A;  4LF6 T;  4X65 T;  3RC8 A;  3OBV E;  3RGL A;  3BK9 A;  3MJX A;  3SFD A;  1D1A A;  2WB5 A;  4ZXL A;  2CHN A;  5BMV E;  2D2S A;  4LF9 T;  2CXL A;  1HFA A;  3CK6 A;  3RH3 A;  4IT4 A;  2ODV A;  5L2L A;  4YJ3 E;  4JI2 T;  2BBJ A;  4JI4 T;  2YU2 A;  1XMO T;  2XQ6 A;  4LMJ A;  4U31 A;  4EYU A;  3HI2 A;  4NUU A;  4BJN A;  5FNV E;  3Q9D A;  3MZK B;  2LRL A;  1SA0 E;  3MKD A;  5CFB A;  1U5P A;  3TKL B;  3EDV A;  4IL4 A;  3EHZ A;  3RYC E;  1WR6 A;  3I0Q A;  3CVR A;  4UF0 A;  3DTO A;  2BKN A;  2N1G A;  3PTR B;  3O1J A;  4DR7 T;  2LSI A;  3AVS A;  5LB7 B;  1N36 T;  5LGN B;  2KWI B;  5KX5 E;  5FY1 A;  1UGO A;  1LRZ A;  4C90 A;  2B76 A;  3GN5 A;  4I55 E;  3BQK A;  3E08 A;  1SUM B;  2D5U A;  2MTQ A;  4ZHQ E;  5ABE A;  4U74 A;  1HNX T;  4YY3 T;  5JRC A;  2BS4 A;  2A3D A;  3T1H T;  2YN6 A;  1M62 A;  2D9D A;  3VKG A;  4YHH T;  2J4G A;  4YSX A;  2C5J A;  3AXJ B;  3IF8 B;  4GKJ T;  4EIW A;  5IUX A;  4HWC A;  2JMH A;  1D0Y A;  5CGM A;  5HXC A;  3EAB A;  4HWI B;  4JI1 T;  2DCF A;  4C91 A;  4WBO A;  1ZP0 A;  5HEJ A;  5C2T A;  2L3L A;  2P9B A;  1FJG T;  3AVR A;  4IRE A;  4HN9 A;  1OED C;  2Y48 B;  2XM1 A;  2ODU A;  1T7S A;  4LFC T;  2PFV A;  4AQF C;  3SFE A;  5AQQ B;  5HXE A;  4ZZC A;  3SS1 A;  1I6Z A;  2QA7 A;  5ADX L;  3UQ7 A;  2WU2 A;  3C51 A;  2X0H A;  3HL6 A;  5FL0 A;  4U33 A;  4EED A;  3P8C D;  2RA1 A;  1R8I A;  1W9R A;  2V26 A;  2FUP A;  3RKG A;  4LML A;  2LJL A;  3JCF A;  3PJA J;  3L39 A;  3LK3 B;  4IE5 A;  5J0Z A;  3K3O A;  3RRC A;  1OXZ A;  3PDY A;  2V7L A;  5FVL A;  4TV9 E;  2R6G F;  3P7I A;  3Q5X A;  4AXP A;  4ILU A;  2WY2 A;  4XAX B;  3A5X A;  3C4Z A;  5HCJ A;  3TLS A;  4DMV A;  5AQP B;  2BZB A;  3WAJ A;  4U3C A;  2Y6X A;  1IBM T;  2LSY A;  2WU5 A;  5AQK B;  1E1H B;  2WS3 A;  3GA8 A;  3EVY A;  4YSZ A;  1BR0 A;  3AA0 B;  4ZI2 D;  1E7P A;  2FJE A;  3MK7 C;  4CN4 A;  4F8H A;  1MMN A;  2WSS V;  5DAB A;  3TLW A;  3KV4 A;  4MLK A;  5FYM A;  4IE4 A;  3TLU A;  1W0B A;  2WWU A;  4AQG A;  4WZX A;  3JAE A;  1OED E;  4EGW A;  5HAX A;  3ANW A;  5KDM C;  3PUY F;  4U7I A;  2BS3 A;  2VB6 A;  2W66 A;  4EYY R;  2E8I A;  3AA1 B;  4IDO A;  4GOU A;  4PJN A;  4ANJ A;  4H9O C;  4OX9 T;  2YU1 A;  4DV3 T;  3NZQ A;  5LHH B;  5L4E A;  4X20 E;  2YDR A;  4PJJ A;  2J1D G;  3AE3 A;  4IE7 A;  3Q2M A;  5FXZ A;  4HFB A;  1OED B;  3K8P C;  4WYV A;  5HXS A;  2RPA A;  3B5M A;  4JEU B;  2HPL A;  1V9D A;  2YOE A;  2CBI A;  4BA9 A;  4TNV A;  1YQ3 A;  3N2G E;  5HCM A;  3T1Y T;  3AAI A;  2K48 A;  4M1P A;  4H9N C;  1WYB A;  5CA0 E;  4GK5 E;  3GMI A;  4DVD A;  1JNR A;  3PUZ F;  2CMR A;  4I4T E;  4YJ2 E;  4HE8 A;  2E9X A;  4K0K T;  4CXY A;  5LNK A;  4OHF A;  3ZC0 A;  3AA7 B;  3HKB E;  4PK5 A;  5LP6 E;  2H89 A;  4CI3 B;  2OA5 A;  5AQH B;  1WYC A;  3JC6 C;  5EK3 A;  4AIU A;  1KNR A;  3UQ4 A;  3J7Y q;  2G0U A;  2Q9Q A;  2D0U A;  4NXN T;  3D0T A;  3N9L A;  4IDQ A;  3UU4 A;  2CWO A;  4P0B A;  1VOM A;  1XNQ T;  3WAK A;  2A72 A;  4DMW A;  5AQF B;  4MHC A;  3VRA A;  2NWB A;  2OV9 A;  3FZM B;  3R84 B;  3HKC E;  5AQV B;  1IZN B;  3C4X A;  2Y8D A;  2GK9 A;  3OYX A;  5AQS B;  3RF1 A;  3NWI A;  3FBZ A;  1J5E T;  2CE7 A;  2A2F X;  3BQL A;  2M6B A;  3DP7 A;  5LG4 A;  1U4Q A;  2Q9Q C;  1MMD A;  2XUE A;  3F31 A;  2ZMA A;  3E22 E;  1UX4 A;  3LJC A;  4QX7 B;  2BG9 C;  4NIQ A;  5JTG A;  4YTP A;  1IBK T;  2HH7 A;  1J1J A;  3AEA A;  2XAH B;  4JLE A;  4DR5 T;  1QLB A;  3UFE A;  5AQO B;  3KIN B;  1ZV4 X;  3Q5D A;  4X62 T;  2BKO A;  3CQG B;  3LFM A;  3ZMT B;  2ACZ A;  2V6Y A;  3LG7 A;  5L3B B;  4HFH A;  2QGS A;  2XQY A;  1MMA A;  4O2B E;  3Q5E A;  3UU3 A;  5LOV E;  2LM9 A;  4V1A v;  5LMN T;  4YFS A;  3N9Q A;  3L09 A;  2V6X A;  4GK0 E;  3NRX A;  3ZMS B;  2XSB A;  3AEB A;  4HEA A;  2KZ7 B;  2X0Y A;  5L3C B;  3ZC1 A;  2IML A;  5KXJ A;  3KBU A;  2K9A A;  2K24 A;  4KMC A;  3AEG A;  1HF8 A;  3JAD A;  4JI7 T;  4COF A;  2UXX B;  1D1B A;  4B3R T;  2WDV A;  1G73 A;  2SPC A;  4O2A E;  2XQ5 A;  2LKG A;  1FMW A;  3FB2 A;  1S35 A;  2C5I T;  3A7M A;  3PUG A;  3ZMU B;  2DWG A;  3PV0 F;  3SOL A;  1LKX A;  2JMK A;  5JDH A;  3NKZ A;  2UU9 T;  2DNX A;  1LVF A;  1SE7 A;  4TUY E;  2NR4 A;  2IAK A;  4KHP T;  3RQU A;  2BG9 E;  2XAG B;  4K0U A;  2YDQ A;  4O8S A;  4J2C A;  1Y64 B;  3H3A A;  2WZH A;  5LJN A;  1UK5 A;  3ZYK A;  3PJA A;  1N32 T;  4LF5 T;  3F2E A;  1I94 T;  5AQI B;  4OYK A;  3CX8 B;  3CIR A;  4JYA T;  5LCY A;  3T8O A;  2WAU A;  1YKH B;  4IE0 A;  2Q9Q B;  4CXX A;  5BR8 T;  5CJ5 A;  3V5S A;  4HWD A;  2BG9 B;  5CB4 E;  5H6Q B;  4E7Z A;  4DUZ T;  2VUR A;  3OVU A;  1FMV A;  3I9Y A;  5FKY A;  2PBI A;  2NP9 A;  1MNE A;  2JRK A;  4H63 H;  2X66 A;  2XQ9 A;  1ZKE A;  3IHR A;  4DND A;  2H7V C;  2LHR A;  3ZT5 A;  5L3E B;  4EAH A;  3ZJ2 A;  2VKO A;  5FMN A;  4NUV A;  2NOX A;  4EB6 E;  1QUU A;  5M4Y A;  4UEL A;  5AQL B;  4CI1 B;  3AE9 A;  3PE0 A;  3Q5W A;  2X9W A;  4ZEY A;  4PK6 A;  1G8X A;  4QH5 A;  2X0L B;  5FXW A;  5JH7 E;  2NTY A;  2JJ9 A;  3LBX B;  4CN1 A;  4GIW A;  1IJ6 A;  3SWH A;  1ZEE A;  3VKH A;  3LK2 B;  2LOS A;  3ZMZ B;  1GQE A;  4DR6 T;  2WDR A;  3VR8 A;  2V6Y B;  2F4V T;  1CHU A;  1XMQ T;  4AI6 A;  2VVN A;  4P0A A;  2FJB A;  2XQ7 A;  5JDG A;  2KT9 A;  4PJM A;  3RPU A;  2VL8 A;  1UX5 A;  2DI4 A;  3PUV F;  2W67 A;  3RIA A;  2ZLY A;  3UT5 E;  4YT0 A;  3KDS E;  4DO0 A;  2LHN A;  1CUN A;  4YTM A;  4UVB B;  4E7S A;  4DR1 T;  4IGU A;  1MMG A;  2XM2 A;  5LHI B;  3RYF E;  2JQ9 A;  4P1N A;  1HNW T;  5LBQ B;  4EZ4 A;  4DBR A;  1BR4 A;  5HXH A;  4QX8 B;  4G2A A;  3AE1 A;  2WP9 A;  3QNU A;  1QSD A;  2XPK A;  5JDF A;  1Y01 A;  4YXD A;  4H63 V;  3ZCJ A;  4CQI A;  3O9X A;  3O4X E;  2BVL A;  4HTE A;  5LA6 E;  4XBF B;  4DR4 T;  2ZM2 A;  1JNZ A;  3AE2 A;  2CHO A;  4XZC A;  4GKK T;  3L3P A;  5L3D B;  4PJL A;  3P4R A;  1UUR A;  2XSA A;  3N2K E;  3AE5 A;  5LYJ E;  2WWV A;  3HA4 A;  3PUS A;  5J2T E;  5TAO A;  2FJD A;  4Z8X A;  5HEG A;  2E2A A;  4IIJ E;  1VRB A;  3CKD A;  4JEH B;  4EV6 A;  4O4J E;  3TLV A;  3MAC A;  4AQY T;  3VR9 A;  5LBM A;  5J1G A;  1B7T A;  1Z8U A;  3FXD B;  2K5B B;  4L0R A;  5GON E;  3ZEF B;  3AED A;  2N2N A;  3OYZ A;  2CXD A;  1OWA A;  1J5W A;  4A56 A;  4ISS A;  2X9Y A;  2YDS A;  4UF0 B;  3PUA A;  4AKH A;  1UUS A;  3N2O A;  4DV4 T;  2CCQ A;  2JPF A;  5FXX A;  2LKH A;  4OK0 A;  1ZOY A;  1BR2 A;  1KFY A;  4I43 B;  1MIV A;  3WI3 A;  4KX6 A;  2MYS A;  3GN5 B;  2C5K T;  2AE9 A;  3UUM A;  2WQY A;  2XJ7 A;  4X1I E;  2DLR A;  4PK4 A;  4X64 T;  2KIN B;  5JRC B;  4ILB A;  2NTX A;  1W09 A;  3VRB A;  2DHR A;  4IHJ E;  5AQR B;  2VWA A;  3KV6 A;  4DR2 T;  4L9I A;  2B1E A;  2CLY C;  1WLX A;  3UU5 A;  3PUX F;  3JC6 D;  1NWM X;  3CX6 B;  4YLH A;  3K1S A;  3N9P A;  5ABF A;  2H3R A;  4X66 T;  2UUC T;  3QUJ A;  2DWK A;  5EK2 A;  1S94 A;  3S4U A;  2VQF T;  2X51 A;  2ES0 A;  2XHE B;  2J62 A;  4LFA T;  4O4L E;  1HX8 A;  4HFV A;  3QK6 A;  4UVA B;  2M6I A;  4DBQ A;  1XNR T;  2HN1 A;  5ABG A;  4QH4 A;  2JQH A;  2LRK A;  2K3W A;  3KV9 A;  2ACX A;  2NW9 A;  3FZL B;  3ZST A;  4Z91 A;  2WZI A;  2Q9Q D;  5HYA A;  2E9X C;  1BR1 A;  2M67 A;  1YQ4 A;  4A97 A;  5HEO A;  3RYI E;  4ADZ A;  4B3T T;  2V7K A;  3TLT A;  5F8P A;  5FVK A;  3H3M A;  3AAA B;  4DR3 T;  3ZYL A;  2KSR A;  2J47 A;  1HCI A;  4LF4 T;  2LOP A;  3PUW F;  4LFB T;  3KBT A;  2LLY A;  3UU8 A;  2NW7 A;  3QOF A;  4KI0 F;  3I0O A;  2XAF B;  2LSG A;  2XQ4 A;  4U2Y A;  2BBH A;  4O4H E;  4WW0 A;  2XAS B;  3P50 A;  2IIU A;  2WDQ A;  5ABH A;  2I6H A;  4L5G A;  3UFG A;  1YXR A;  4TNW A;  4ILC A;  3RIF A;  5JDN A;  4IL9 A;  3QC9 A;  3EDU A;  4MFR A;  2XAJ B;  4U72 A;  3ANW B;  4KP3 C;  4FJO A;  2CBJ A;  1MND A;  3AEE A;  3ZMV B;  4H9P C;  2CLY B;  4MBQ A;  3ZT7 A;  5L3F B;  3UU6 A;  1SHZ C;  3HR0 A;  4BAY B;  5IHY A;  2CA5 A;  2CM0 A;  2VAS A;  1DU2 A;  2XAQ B;  3FZF B;  3ETV A;  4EXT A;  2ZM6 T;  1XDO A;  3FBL A;  3ZPO A;  1US7 B;  4CI2 B;  2LT3 A;  1N34 T;  2IUB A;  3I9W A;  5JQG E;  2EHO A;  3AEC A;  1EZ3 A;  3O1I A;  4HWH A;  4B6X A;  3P4W A;  2QVA A;  4KHZ F;  2D0T A;  4UV9 B;  3AE4 A;  2BDE A;  5LMU T;  3RHW A;  3LDQ B;  4HFD A;  4IDP A;  2OLT A;  3PUQ A;  1HG5 A;  5AQG B;  5DQV A;  5CA1 E;  3KFW X;  2LSK A;  4MAL A;  3E0Z A;  5FP3 A;  4NPP A;  4HGA A;  2E9X B;  3ZT6 A;  3NVO A;  5JR9 A;  4AKL A;  4ZZB A;  1HTJ F;  2EHO C;  3AB3 B;  4QKN A;  4TWD A;  3BQI A;  3C4W A;  4HFI A;  3ONJ A;  1HS7 A;  2VKJ A;  1N33 T;  4N78 D;  2Z6E A;  3ESL A;  3ZLI A;  3EI0 A;  3IEE A;  1KNP A;  2V8S V;  2N9D A;  2MPK A;  3RKO A;  5HWY A;  4UXN B;  2V7M A;  2CXF A;  2KND A;  5JR9 C;  2HPJ A;  2XQ8 A;  4H9S E;  5EK4 A;  4OFZ A;  3FZK B;  4F6R C;  2LM2 A;  1T98 A;  4A5X A;  4PAG A;  5JRE A;  5J2U E;  2WCA A;  4DID B;  4BJM A;  3FZH B;  3OPC A;  1HG2 A;  5DQW A;  4TX5 A;  3ZN1 B;  1AJ3 A;  4DV2 T;  3OTO T;  4DV0 T;  3AE6 A;  1D0X A;  2FJA A;  4B3M T;  2XQ3 A;  3RC3 A;  4JBW F;  4IDN A;  1XWM A;  2JIW A;  3EUH A;  3FHN A;  1XZY A;  4U7Y A;  5E0O A;  3P4S A;  4CN6 A;  1OED A;  4JUY A;  4QXB B;  3OJA A;  3AAE B;  1H7C A;  4AQF A;  2X67 A;  3N5L A;  4ZI3 D;  3IBP A;  3B57 A;  3PU3 A;  5LG3 A;  4I50 E;  4TN7 B;  1WFD A;  4ILA A;  5HEU A;  5KMG P;  2LEH A;  4EEB A;  4QH1 A;  1FEW A;  3NBX X;  4Z90 A;  4X5T A;  2KXP B;  2WMN A;  3QB5 A;  4GYS A;  4ZI3 C;  2MBG A;  2HN2 A;  2KMF A;  3R6N A;  4JI0 T;  4I0U A;  3X1D A;  2IC6 A;  2VKH A;  2EHO B;  3L8R A;  4ASK A;  2IW5 B;  5AQU B;  2VL0 A;  1VCT A;  1E2A A;  4UVC B;  1XDP A;  3HKE E;  4QWN B;  4X1K E;  4O4I E;  4X1Y E;  4H9R C;  3ZYM A;  4ZI7 E;  2L8K A;  1KK7 A;  2W00 A;  4FI5 A;  5AQN B;  4WNK A;  3C50 A;  1L0V A;  3FXE B;  2L9Q A;  2I59 A;  4P09 A;  4KBM B;  3ABV A;  4JV5 T;  3RI5 A;  2PJQ A;  5JR9 B;  5C8Y E;  4LMK A;  2W61 A;  2CPT A;  1UCU A;  3ONL C;  2V5C A;  2E5L T;  2E5V A;  3ZKR A;  3KVA A;  3N9O A;  5FY7 A;  4JI6 T;  3N9N A;  4Q25 A;  2QYW A;  3UUB A;  2W2U A;  5JDQ A;  3ZCI A;  2WMO A;  4JI5 T;  5FXV A;  2RP4 A;  1X79 A;  2W0G A;  1KF6 A;  3CWZ B;  2PTF A;  4PW8 A;  4WBN E;  4QXH B;  4HFC A;  3AEF A;  3ETU A;  3IA3 A;  5L3G B;  3PU8 A;  3VHL A;  4TWH A;  1LVK A;  1D0Z A;  4UR9 A;  3A8Y C;  2MOZ A;  4ZS3 A;  4AKI A;  2X9X A;  3U78 A;  3SRZ A;  3HKD E;  3K3N A;  2LSJ A;  4ZS2 A;  4TZ4 C;  5AQM B;  5AQT B;  4PNI A;  3RIU A;  4HWF A;  5H6R B;  4AIS A;  1IAP A;  5L47 A;  3C98 B;  1X9B A;  2XQA A;  5LXT E;  3M3Z B;  2HHH T;  4ZI2 C;  3UTK A;  4DV1 T;  3ZSS A;  4B3S T;  2BVM A;  5F3J A;  2VKD A;  2W4X A;  4H9Q C;  4GYR A;  4LF8 T;  3PUR A;  2YIN A;  3H37 A;  1NEN A;  4YTN A;  4TV8 E;  4NXM T;  2CWY A;  2X9H A;  4HKA A;  4JI3 T;  1KEY A;  2XZE A;  1HNZ T;  4LF7 T;  3RIU C;  2YEV C;  2X68 A;  3CPZ A;  4EOZ B;  4G63 A;  5HWX A;  2V7I A;  2UUB T;  5F5W A;  5LGU B;  4DV6 T;  3AE8 A;  4A98 A;  4AKG A;  2BS2 A;  3LSV A;  3GWH A;  2VK9 A;  2V7J A;  3G06 A;  1MIY A;  3RRW A;  4UV8 B;  3RQW A;  4DUY T;  4YHJ A;  2E9X D;  2WBL A;  3F57 A;  3K3Q C;  3N9M A;  3P4P A;  2LE8 A;  1MIW A;  3CX7 B;  1YW0 A;  3J9X 1;  4UEM A;  3ZJ1 A;  3CQX C;  2ZM0 A;  1IBL T;  4IE6 A;  5LHG B;  2V5D A;  1HX1 B;  2UXD T;  2UXN B;  5JDM A;  2KWH A;  3C64 A;  4JI8 T;  2H7O A;  2PG8 A;  3AA6 B;  4PFO A;  5JDL A;  3UUL A;  2MAW A;  2XTL A;  4DV5 T;  2C0S A;  3NRY A;  4CXW A;  1T8B A;  5JVD E;  1WRD A;  1VCS A;  2KLQ A;  5IWA T;  5HXR A;  2BG9 A;  3ZN0 B;  1W0A A;  1WCR A;  3B13 A;  2JQK A;  1D1C A;  2I0M A;  4AKR B;  3NZP A;  4TWF A;  2DL1 A;  4IST A;  1NEK A;  5L4H A;  4YSY A;  3RX6 A;  4CZZ B;  1T72 A;  3O1H A;  2UXC T;  5C3J A;  5ETW A;  3JAF A;  1KNZ A;  1M7K A;  4U2Z A;  3KVB A;  2JQQ A;  2ZM8 A;  2H88 A;  4KUM B;  3RLF F;  1NAF A;  2NW8 A;  3ONX A;  5EZY E;  3LK4 2;  5A1L A;  3P4Q A;  3KV5 A;  5FY0 A;  2W62 A;  2IDO B;  3DJB A;  3W15 B;  3MA9 A;  1IJ5 A;  4HFE A;  3M65 A;  3UUX B;  4ERR A;  5AQJ B;  1Z0P A;  3AXJ A;  2CRB A;  3LBX A;  2UXB T;  1HR0 T;  3OKQ A;  1ZHC A;  2IHR 1;  2A9U A;  3I1A A;  5DJQ C;  2YK0 A;  3VU7 H;  2YKS A;  1YKE B;  2XY8 B;  4IDZ A;  3V5U A;  1O3X A;  5AFU L;  4ZOL E;  3UUN A; 
#chains in the Genus database with same CATH homology
 4PJL A;  1D0X A;  3AA7 B;  3ZC0 A;  4EZH A;  3HKB E;  3U3I A;  4PK5 A;  5LP6 E;  3MXZ A;  3N2K E;  5LYJ E;  4CI3 B;  4UIG A;  2OA5 A;  3HA4 A;  3RC3 A;  1WYC A;  3JC6 C;  3PUS A;  5J2T E;  5EK3 A;  5TAO A;  4Z8X A;  2W63 A;  3CQC B;  4IIJ E;  1VRB A;  3CKD A;  4JEH B;  4O4J E;  3MAC A;  3RYH E;  5LBM A;  3EUH A;  5J1G A;  3J7Y q;  3FHN A;  1B7T A;  3FXD B;  2EHO D;  2G0U A;  2K5B B;  2D0U A;  2Q9Q A;  4L0R A;  5GON E;  3ZEF B;  2WM9 A;  2N2N A;  3D0T A;  3N9L A;  2CXD A;  3OYZ A;  5E0O A;  1OWA A;  1FIO A;  2CWO A;  4A56 A;  4P0B A;  2CEA A;  1YD8 G;  4JUY A;  4ISS A;  1VOM A;  4QXB B;  3CML A;  5IYZ E;  3OJA A;  2X9Y A;  2IC9 A;  3AAE B;  3WAK A;  4QXC B;  1H7C A;  4QHO A;  4UF0 B;  3PUA A;  4AQF A;  4AKH A;  2V1D B;  3N2O A;  2A72 A;  4DMW A;  2X67 A;  3N5L A;  4OYJ A;  5LJM A;  4MHC A;  2NWB A;  2CCQ A;  5LGT B;  4ZI3 D;  3UUN A;  2JPF A;  3IBP A;  5FXX A;  3B57 A;  3PU3 A;  3R84 B;  4OK0 A;  4PFP A;  3HKC E;  1BR2 A;  4I50 E;  4TN7 B;  3RC8 A;  3OBV E;  1IZN B;  3C4X A;  2Y8D A;  3BK9 A;  3MJX A;  1D1A A;  2GK9 A;  3OYX A;  5KMG P;  2LEH A;  4I43 B;  5BMV E;  1MIV A;  2D2S A;  3WI3 A;  3FBZ A;  2CE7 A;  2MYS A;  3GN5 B;  2A2F X;  2C5K T;  2CXL A;  3BQL A;  1HFA A;  3RH3 A;  3UUM A;  3DP7 A;  2ODV A;  1FEW A;  5LG4 A;  1U4Q A;  3NBX X;  2Q9Q C;  5L2L A;  1MMD A;  4X1I E;  2XUE A;  2DLR A;  4YJ3 E;  3F31 A;  2ZMA A;  4PK4 A;  2KXP B;  3E22 E;  2WMN A;  2KIN B;  1UX4 A;  2YU2 A;  5JRC B;  3LJC A;  2NTX A;  2DHR A;  4GYS A;  4IHJ E;  4QX7 B;  4ZI3 C;  2MBG A;  2VWA A;  4EYU A;  2KMF A;  3HI2 A;  2HH7 A;  3KV6 A;  4NUU A;  3R6N A;  4BJN A;  4L9I A;  2IC6 A;  2VKH A;  2EHO B;  4ASK A;  5FNV E;  2XAH B;  3Q9D A;  3MZK B;  4JLE A;  2IW5 B;  3UFE A;  1SA0 E;  3MKD A;  1U5P A;  2B1E A;  3EDV A;  3KIN B;  3TKL B;  2CLY C;  1ZV4 X;  4UVC B;  1WLX A;  3HKE E;  4QWN B;  4X1K E;  3RYC E;  4O4I E;  3CQG B;  4X1Y E;  4H9R C;  1WR6 A;  3JC6 D;  3ZYM A;  1NWM X;  4ZI7 E;  3LFM A;  3ZMT B;  2L8K A;  3CX6 B;  1KK7 A;  2W00 A;  3LG7 A;  3I0Q A;  4FI5 A;  5L3B B;  4YLH A;  3CVR A;  4WNK A;  3C50 A;  2QGS A;  2XQY A;  4UF0 A;  3N9P A;  1MMA A;  3DTO A;  3FXE B;  4O2B E;  2L9Q A;  2I59 A;  2H3R A;  2N1G A;  3PTR B;  4P09 A;  3QUJ A;  4KBM B;  2DWK A;  3O1J A;  2LSI A;  3AVS A;  2PJQ A;  5EK2 A;  5JR9 B;  5LGN B;  2KWI B;  5C8Y E;  1S94 A;  5LOV E;  2W61 A;  5KX5 E;  3S4U A;  2X51 A;  2ES0 A;  2LM9 A;  1UCU A;  2XHE B;  4V1A v;  4O4L E;  1HX8 A;  3KVA A;  4HFV A;  3N9O A;  5FY1 A;  1LRZ A;  3QK6 A;  3N9Q A;  4YFS A;  4C90 A;  3GN5 A;  3L09 A;  4I55 E;  5FY7 A;  3BQK A;  3N9N A;  4GK0 E;  3E08 A;  4UVA B;  3NRX A;  3ZMS B;  2D5U A;  2MTQ A;  4ZHQ E;  5JDQ A;  3ZCI A;  2WMO A;  4DBQ A;  4HEA A;  2KZ7 B;  4U74 A;  5FXV A;  2RP4 A;  5L3C B;  1X79 A;  3ZC1 A;  2W0G A;  3CWZ B;  5JRC A;  4PW8 A;  4WBN E;  4QXH B;  3KBU A;  2K9A A;  2K24 A;  2A3D A;  3ETU A;  4KMC A;  3KV9 A;  1HF8 A;  2ACX A;  2NW9 A;  5L3G B;  2Q9Q D;  2UXX B;  1D1B A;  3VKG A;  5HYA A;  3PU8 A;  1G73 A;  2SPC A;  2E9X C;  2C5J A;  1BR1 A;  4O2A E;  3VHL A;  2M67 A;  1LVK A;  1D0Z A;  3IF8 B;  2MOZ A;  4ZS3 A;  4AKI A;  1FMW A;  3FB2 A;  4EIW A;  2X9X A;  3U78 A;  3SRZ A;  3HKD E;  1S35 A;  3K3N A;  2LSJ A;  2JMH A;  1D0Y A;  2C5I T;  4ZS2 A;  3PUG A;  5HXC A;  4TZ4 C;  3ZMU B;  2DWG A;  4PNI A;  3SOL A;  3RYI E;  2DCF A;  4ADZ A;  1LKX A;  2JMK A;  5H6R B;  1IAP A;  5JDH A;  2V7K A;  4C91 A;  4WBO A;  5F8P A;  3C98 B;  2DNX A;  1LVF A;  3AAA B;  3ZYL A;  5LXT E;  4TUY E;  1HCI A;  2L3L A;  4ZI2 C;  3UTK A;  2P9B A;  2LOP A;  3KBT A;  2IAK A;  3AVR A;  2NW7 A;  2BVM A;  5F3J A;  4HN9 A;  2VKD A;  2XAG B;  4H9Q C;  4K0U A;  3I0O A;  4GYR A;  2XAF B;  4O8S A;  4J2C A;  2LSG A;  1Y64 B;  3H3A A;  3PUR A;  2YIN A;  5LJN A;  2Y48 B;  3H37 A;  3ZYK A;  2ODU A;  4TV8 E;  2PFV A;  4O4H E;  4AQF C;  4WW0 A;  2CWY A;  2X9H A;  2XAS B;  3F2E A;  4HKA A;  4OYK A;  3CX8 B;  5HXE A;  4L5G A;  3SS1 A;  2YEV C;  5LCY A;  2QA7 A;  5ADX L;  3T8O A;  2WAU A;  2X68 A;  1YKH B;  3C51 A;  3CPZ A;  4IE0 A;  4EOZ B;  2Q9Q B;  3HL6 A;  4G63 A;  5HWX A;  4CXX A;  2V7I A;  5JDN A;  5LGU B;  3V5S A;  3P8C D;  4AKG A;  2RA1 A;  3GWH A;  5CB4 E;  2V26 A;  3QC9 A;  5H6Q B;  2LJL A;  4E7Z A;  2VK9 A;  3EDU A;  3LK3 B;  4MFR A;  2XAJ B;  1FMV A;  2V7J A;  3I9Y A;  4IE5 A;  4U72 A;  3K3O A;  3ANW B;  3RRC A;  1MIY A;  1OXZ A;  2PBI A;  3RRW A;  4UV8 B;  3PDY A;  2V7L A;  4KP3 C;  2NP9 A;  4FJO A;  1MNE A;  1MND A;  2JRK A;  3ZMV B;  4H9P C;  4TV9 E;  2CLY B;  4H63 H;  4MBQ A;  2X66 A;  3P7I A;  1ZKE A;  4YHJ A;  3IHR A;  3Q5X A;  4DND A;  2H7V C;  4AXP A;  2E9X D;  2LHR A;  4ILU A;  4XAX B;  2WBL A;  3F57 A;  5L3E B;  4EAH A;  5L3F B;  3K3Q C;  3A5X A;  3C4Z A;  3N9M A;  3ZJ2 A;  4DMV A;  1SHZ C;  2VKO A;  2BZB A;  3HR0 A;  3WAJ A;  4BAY B;  5FMN A;  4NUV A;  2LE8 A;  2NOX A;  1MIW A;  5IHY A;  3CX7 B;  1YW0 A;  2Y6X A;  3J9X 1;  4EB6 E;  2CA5 A;  2LSY A;  4UEM A;  3CQX C;  3ZJ1 A;  2ZM0 A;  2CM0 A;  2VAS A;  4IE6 A;  1E1H B;  1QUU A;  5LHG B;  2XAQ B;  3GA8 A;  3ETV A;  4EXT A;  5M4Y A;  4UEL A;  3EVY A;  4CI1 B;  1BR0 A;  3AA0 B;  3FBL A;  3ZPO A;  1US7 B;  3PE0 A;  3Q5W A;  2X9W A;  4CI2 B;  2UXN B;  4ZI2 D;  2LT3 A;  5JDM A;  3I9W A;  4PK6 A;  2KWH A;  3C64 A;  1G8X A;  2H7O A;  2EHO A;  5JQG E;  2X0L B;  2PG8 A;  3MK7 C;  1EZ3 A;  3AA6 B;  3O1I A;  1MMN A;  4PFO A;  5FXW A;  2WSS V;  4B6X A;  5JDL A;  2NTY A;  5JH7 E;  2D0T A;  2JJ9 A;  3LBX B;  4GIW A;  4UV9 B;  1IJ6 A;  3SWH A;  3UUL A;  1ZEE A;  2BDE A;  3VKH A;  3LK2 B;  2LOS A;  3ZMZ B;  2XTL A;  5DAB A;  2C0S A;  3NRY A;  4CXW A;  5JVD E;  3KV4 A;  1WRD A;  2KLQ A;  4MLK A;  5HXR A;  5FYM A;  3ZN0 B;  3PUQ A;  4IE4 A;  3B13 A;  4AI6 A;  1HG5 A;  2WWU A;  5DQV A;  5CA1 E;  1D1C A;  4AKR B;  4P0A A;  3NZP A;  4AQG A;  3KFW X;  2LSK A;  4IST A;  5HAX A;  4MAL A;  5JDG A;  3ANW A;  5KDM C;  2KT9 A;  3E0Z A;  3RX6 A;  5FP3 A;  4CZZ B;  4HGA A;  2E9X B;  4PJM A;  3O1H A;  3RPU A;  2VL8 A;  5ETW A;  5JR9 A;  1UX5 A;  2DI4 A;  4AKL A;  1HTJ F;  1KNZ A;  2ZLY A;  2VB6 A;  3KVB A;  3UT5 E;  2JQQ A;  2ZM8 A;  2EHO C;  4EYY R;  3KDS E;  3AB3 B;  2E8I A;  4QKN A;  3AA1 B;  4KUM B;  4DO0 A;  2LHN A;  3BQI A;  4GOU A;  1NAF A;  1CUN A;  4PJN A;  4ANJ A;  4H9O C;  4UVB B;  4E7S A;  3C4W A;  2NW8 A;  4IGU A;  2YU1 A;  1MMG A;  3NZQ A;  3ONX A;  3RYF E;  5LHH B;  5LHI B;  1HS7 A;  5EZY E;  3LK4 2;  4X20 E;  5LBQ B;  4DBR A;  4EZ4 A;  5A1L A;  2VKJ A;  3KV5 A;  4PJJ A;  2J1D G;  2W62 A;  5FY0 A;  1BR4 A;  5HXH A;  4N78 D;  4IE7 A;  3Q2M A;  5FXZ A;  2Z6E A;  3ESL A;  3ZLI A;  4QX8 B;  4G2A A;  3IEE A;  3K8P C;  5HXS A;  3DJB A;  4JEU B;  3MA9 A;  3W15 B;  2HPL A;  2N9D A;  1IJ5 A;  1V9D A;  3RKO A;  1QSD A;  4UXN B;  5HWY A;  5JDF A;  2V7M A;  2CXF A;  3M65 A;  3UUX B;  4ERR A;  1Z0P A;  2KND A;  4BA9 A;  5JR9 C;  2HPJ A;  3LBX A;  4H63 V;  3ZCJ A;  4CQI A;  3N2G E;  4H9S E;  5EK4 A;  3OKQ A;  4OFZ A;  1ZHC A;  3O9X A;  4F6R C;  3AAI A;  3O4X E;  2K48 A;  3I1A A;  4M1P A;  5DJQ C;  2BVL A;  4H9N C;  1T98 A;  2YK0 A;  1WYB A;  4HTE A;  5LA6 E;  4XBF B;  5CA0 E;  4PAG A;  5JRE A;  5J2U E;  4GK5 E;  3GMI A;  2ZM2 A;  4BJM A;  4DVD A;  3VU7 H;  1HG2 A;  5DQW A;  4TX5 A;  3ZN1 B;  1AJ3 A;  2CMR A;  4I4T E;  1YKE B;  4YJ2 E;  4HE8 A;  4IDZ A;  1O3X A;  3V5U A;  5AFU L;  2E9X A;  4ZOL E;  4XZC A;  4CXY A;  5LNK A;  3L3P A;  4OHF A;  5L3D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...