3MA9H

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
214
Chain Sequence
b'QLVQSGAEVKKPGSSVKVSCKASGGTFNSYAFSWVRQAPGQGLEWMGSIIPIFGTTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYFDTYNNYGFANWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
molecule tags Immune system
source organism Human immunodeficiency virus 1
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
total genus 46
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9H01
1NDGB 1D5MA 2Z93B 5HYJE 1TTGA 1YYMH 1I8IB 4FQ2L 2PR4L 3ARSA 1EAPA 5D7IF 4FQHA 3FCTA 4FQQA 4X6DA 4J2XA 4QHUB 1LEIA 3W9DB 4FG6C 3WN5C 2H26B 1T1ZA 1VENA 3JXAA 3P0YH 4RMRA 2IPKA 5DD6A 3MJ7B 1MUJB 2ED8A 4D8PA 2AAVA 1CL7I 4E41E 2AQ3A 3MLYL 5FGCB 3ZKXB 3B9AA 4CMHC 3N1GC 3CFCH 4PRIA 2KQNA 4OIBA 2IG2L 2Q86A 2V2XB 5HDQH 2L0DA 4LGRB 4GG6F 1RULH 5IMKB 1S7XB 4Y2DC 5C6PB 2R1WA 4QXUL 2F53D 1AQDA 2EDBA 4HXBH 3E6HA 1EAPB 2MQCA 2PNDA 4FFZH 3S98A 5DJ2B 1GPOH 5F7FA 3EO1B 3BKMH 3KGRA 3MRDA 3O4OC 1Y18B 2WINA 4YNYB 3WNMA 3IXTB 4NN7B 3Q2CA 3WDJA 2HVKA 3TT1L 1G7QB 2GUOA 1CICB 1P7QA 2NY2B 3MGAA 4KRLB 4YQXL 1UCBH 3LQZA 1DE4B 4OFIA 5I30L 1G0YR 2EIDA 4YR6A 4GRLA 4IRJD 3TT1H 3UTSD 3WLBB 1A9EA 2IJ0C 1EVUA 3C2AH 2FO4B 3QUMB 3QDMB 5CHNB 2J8UB 5D1XB 4M48H 4X6BB 1JRHH 4I5BA 4LEXL 2XN9A 5KVEH 3TO2A 4XT1C 4YC2B 2P8MA 3LS4L 3RWJA 2G2RA 3CLFL 4Z7WF 5JNYB 1ZHLB 2A9MH 5CP3H 3PGDA 3IDMA 4P57B 4TQEL 3HG1A 1CN4A 2ZJSH 4HC1L 4LCUB 2ATPB 1AGEA 3QQ3B 1HEZB 1QYGL 3GI9H 2DICA 4WWKA 4C56E 5KJRH 1LE5A 1RJYA 1LO2L 4C59B 3P77B 1DQQB 1FYTA 2D7OA 1WF5A 3STZB 5IFJA 5J06A 5D6DC 4OLUH 4RFEA 5JXEC 5LGHH 3BWAA 1DQJB 3WE6A 3KLHD 3BDYH 5EUOA 1XMWA 2HJKA 3UBXA 2DYPD 4UUJA 5IJKC 4HK0B 4S1QH 1TQBC 1BJMA 2UZXB 1KG0A 4RRPG 1FFNB 5J6HB 1EO8L 1S7VA 2VH5L 5ID0A 2FCBA 1QBLH 3FQRA 4JFZL 3HFML 2R23A 4JVWA 2IPKB 5DD6B 1MPAL 1T1ZB 1DL7H 2FIRT 2ZCHL 3W9DA 1CLCA 2JJWA 4AEIL 3ROLB 2HG5A 3MJ9A 3MLWL 2XRAH 5IF0A 1A7NL 3KPNB 3BYYA 3LRGA 1VFUA 5CEXB 1IRAY 4QXUH 4OUOA 1A1OA 1Z2KA 3ZHDA 1QR1B 4FN0A 1E28B 4JRYA 2XQYK 2E9IA 3LKRA 4NHCH 1BQHG 3PDOB 1XH3B 5AWNL 3ROOA 2HT2C 4JFDA 3I6KB 3WMSA 4PJ7B 4XXCC 5HHPB 1MQKH 4L4TA 4UAOB 5CZKA 5K93A 4YXKL 3EO1A 1MFCH 3OAYK 2F5AH 4U6VL 2EIZA 1MY5A 2O61B 3TFKC 2AABH 3BI9X 4H20H 2HLAA 1T04A 5CILL 3INUL 3QJHB 4ZPTA 4LIQE 1WC7A 4QGYA 4P5TA 5DMYA 4ZOCA 3IKCB 2X4PB 3C5SB 3BDBA 2RBLA 4M7KH 5IBTL 4X99B 3KYKL 2NZIA 3VA2C 2VLKD 5F7DA 4K3HA 3RZCC 3NCBB 4YQXH 1UM5L 4EDWH 1YDPA 1FLTX 3MCLL 1MCBA 1HXMB 5F6IB 4I0PB 1YEGH 1C5CL 1S9XA 2Q20A 1N2RA 4P4KB 5LWYL 3GSVA 4Q6IA 4OD1L 4TUKH 1M4KA 2KL6A 3TBYB 4M7ZC 3RL2B 5DC9B 5DK0A 2XKNA 2W0PA 3QT2A 4XPGH 3BZEB 3MLZL 3KYMB 1C16B 3O4OB 3SBWC 4ZD3L 2ESVD 4AEFA 1P6FA 1JWMA 2EE6A 1W8OA 4QXWA 4KKLD 1MFNA 2DI8A 3R0MA 4JANA 2WBJD 3WFBL 5HI5C 4BH7B 3QWOA 3NOIA 1RZ7H 1AGEB 1UEMA 1U3HB 4OQTA 3UTZA 4I3RH 2EDTA 1HH6A 3HKFA 1U93A 3VXOB 1R5WB 2Q1EA 3BSZL 4UIKL 3Q6FA 1Q0XL 4DGVH 1P7HL 5KSBB 1T83A 4XPHL 4AL8H 5C0DB 35C8H 5JHDE 4GW5A 4I2XE 3SKMB 2DIBA 3TYGH 5ICZA 5I8OH 1XZ0B 3OHXB 3CFIC 2VC2H 1XCTA 5DHYA 2A6DB 3B2VL 1K85A 4OZIB 4UOW1 4G9FE 4MAYC 2GFBB 5EUOE 3RU8H 4MNGA 1WIOA 2DTMH 4L9LA 3WO4B 1OGTA 3WFCH 1QA9B 4WTZG 2AKRB 4Q74A 2LU3A 3Q5YA 2QADB 3MRGB 5IVXF 3OX8A 1TCRB 4H8WL 3VFGH 3QH3B 4X4YA 3ULUH 4LAQH 2VLRD 2R2HA 1BP3B 5EO9B 3BP6B 1YEJL 5CJOL 3B9DA 4MX7B 3KWWA 2FSEB 3C2AL 2LQRA 1U91B 4QOKB 3QG6B 1WBYA 5AZ2L 1CGUA 4MCZA 1B4JL 2E7HA 3DVIA 2AXGA 4DN4H 1BFSA 5ETUB 5IFAL 4PJCE 1KC5L 1IGYB 5GRJL 2HRLA 3L5JA 4GAJL 5IJKA 2YKLL 5DRWA 3VFUB 2YPLA 4FQCL 1QBBA 4Z5RB 1SQ2N 3R0NA 1SY6A 1UKQA 1RD6A 2Z91B 1D5BB 5JPNA 2AK4B 3EJZC 2VDKH 5F1SA 3TCLA 1I9JL 5D5MB 1MWAA 1VGKA 4HZLB 5DR5L 4PRBA 5ERWB 4GW4B 4LLWB 4NZRL 3B8SA 7CGTA 4FQQB 4X6DB 1ZAGA 1NLBL 2FX9L 1RZKH 2WBJC 2F54D 1GXEA 4LSQL 4N0CD 4DFHA 4KI5C 3OL2A 3ALWA 3O41B 5J11C 2FEDC 3SO5A 2YK1L 4MNHA 1BVKA 1CFSB 5KVFL 5T1DL 1FBIH 2X6MA 4DCQA 2CMRL 3VI4F 5GSVB 3G9VA 4YBQC 3TBWB 1KXQE 2WMPA 3QUKA 4XZUB 1K4CA 4K7FA 4JZJA 4OD1H 1CU4H 1JWMB 4OCRL 3GM0A 5EU6B 4NHUB 4ZS6D 1FBIL 3DARA 3JWOH 2OZ4H 4I9WD 4YK4B 1TJHH 1SEQL 1SM3L 1E4JA 4PJ9A 4WNQB 3V5HA 4K7PH 1MI5B 4XXCA 1ORSA 4IRJC 2W92A 1G6RH 2PXYD 4ZFZB 3M1BA 4WCYL 1BFVL 3TFKD 1Q9LA 2X4SA 3IFOA 1S5HB 2VXUL 4L3ED 3GI8L 2MNUA 3X11A 4RFOL 5BXFB 3HUJA 1BAFH 4JY5L 4XP4L 3LH2H 3DRTB 4DKEL 4XPHH 4HWBL 4BZ1H 5E6IA 4TVPL 3SE8L 1Z5LA 1DQLH 2OLDA 4TVPD 3B43A 1A1NA 4HX1B 3SE3C 3W9EA 3G08A 1CQYA 2NY5H 4PJFE 1EAJA 4HGKC 4YDVB 1YQVL 4LSVL 2EXWC 3U6RA 4U1LA 4OLXH 1ZEAH 1BFOA 2DWEB 3L5XH 2HFEA 3ZE0F 1VADB 1P9MC 1U92A 1XR8B 5FUOH 3SQOH 1U8IA 3MLTA 3GFUA 2Z35A 3L3OA 2F5BH 3UTTB 1D5XA 2ADFH 4TUJB 1HDMA 1IGML 2APBA 3QDHA 2R39A 3PWJA 3FTGB 5D6DA 4RCAA 2EDLA 2D4DA 1T1YB 3V5DA 4UNUA 1R3JB 5E8NA 5BVPL 3G5VA 3WL9B 2NW2A 2OK0L 5E8DL 3T0DA 3MUJA 2BJMH 5KOMC 4UT6H 2FL5B 5H37G 5F3BA 5IQ7L 5F1IA 1NCTA 1DEEB 4PLOB 5F21B 4LCUA 4QYOB 2I24N 1FNGB 3OJDA 1KSRA 1R3KB 4NZRH 1NKOA 3CK0H 2NY3B 1ZHLA 2CD0A 3SDDB 4NZJA 4R0LB 2R0LH 4FTVA 5JHDA 1QSFE 1UJ3C 35C8L 4MJ4A 4ZO7A 1U6AH 2EDDA 4BSWB 4FQJL 2MKWA 2RQ8A 1QQDA 2FYYB 1N4XH 4JM2F 2RAMA 3KDMA 3QUML 4MJ5A 4RNRA 4XH2B 5IFJB 3LKSA 4IHOA 1DQQA 4AK1A 4YFLF 1T3FB 4GMTH 4QRRE 2CIKB 1MRDL 2YPVH 3P4MA 1AH1A 1F00I 2E6PA 2OL3H 4P23D 1A7NH 4EI6B 4IOFC 4YNYA 4KDTA 3LPGA 3ARUA 3G6DH 2UWEA 1NGZA 3MRJB 2Z31B 4QRQA 5BVJA 5EIIB 1ZGLM 4YHZL 1JGEB 1NANH 3VGDA 3IAQA 2XTLA 3LRHA 4P4RA 2OJEB 5AAWA 1CFTA 5FO7B 3TN0D 4UTBH 3GZKA 3S35H 1UEYA 4ACPA 3MBED 1XF3A 2MJWA 3MACH 4E5XA 2YMXL 1TNMA 3MYZA 2VC2L 1HHGB 1VA9A 3N50A 2WZPD 3T3PF 3OXRB 5E95B 2OR9L 1JF1B 4Z0BL 4PRPE 4NKMA 2GTZB 4JZOB 3P30H 5GISH 1GHFL 2ZUWA 1B0WA 4JHBA 4K3JL 3HR5A 2VIRA 1ZANL 2ICEB 3CFBA 4XC3H 3STLB 4YK4C 3FB6A 1GGIL 4JPWL 4N0UA 4KROC 1GCFA 3W39B 4QF1B 4UT7L 3O8XB 2X4UB 4M1DL 2B39A 4JFHE 1GGYA 4R4FL 2HTKD 2DQGH 2IBZX 1UQSA 3NIGF 2IWGA 3CX5J 4LVHB 3MRHB 1CFSA 3O6FD 4UIMA 1IAKB 5F7MC 4I9WE 1CXIA 1AE6H 1PZUB 3KYNA 3GHEH 4KVNL 4P59H 3VI3F 3BP7A 3GO1H 1JYNA 5DGRA 5EBWA 2COQA 4Z0XA 2APWA 3ULVD 1A3LH 3I6LD 1U58A 2EECA 4MDJA 4P9HH 3GSNL 4PRDA 5IQ7H 1MRFH 1NDGA 1OW0C 2Z93A 3QIBD 4WEBL 3KVQA 3D18B 1X5GA 4A6YB 3FO0H 3FAXA 3JWDC 4NZDA 1ES0B 3ARBA 1NFIA 3MLXH 4HLZG 4Z95H 5FO9B 5HDBE 4GG6B 3T2PA 3MRBB 4WNQA 2F54E 2YD1A 4I48A 2D9CA 5ANMB 4XBPA 4TSCH 4AENA 4K8RC 1IGCL 5IHZB 4LLVA 5HDLA 1AP2B 2LVCA 3TNNB 4N0UE 1AKJD 4HWEH 4V1DA 3O4LB 2HWZH 2VSCA 1U8LA 25C8L 3H7BB 3U0WL 2H3NA 1T5WA 1NGQL 5DEZA 3FB8B 5E8EA 1V3LA 4WHDA 3IU3B 3TESA 5IVZB 5KOVC 2W9DL 5DMKB 2X9XA 2VZVA 1VERA 4WI6A 4B7IA 3FT2B 3L5WA 3VFRB 4N9GB 4YBLB 5IFHH 1I8LA 2P8MB 4IDJH 1F2XK 4U0RB 4P99A 2NZ9C 2VZOA 1N5YH 5DT1L 1JFQL 1AKJB 3WJLC 5EN2B 4WHYH 3KPRA 2H2SD 1NGWB 2GK0A 3W5NA 4K8RL 2NX5B 3EFDH 1FQ9C 1G6RB 5IFHL 1UACL 4W4OC 3VH8A 4XP5H 2R2BB 3IT8D 3OR6B 2WANA 4JO1H 1GZPA 4KK9D 4OV5B 2X1OA 1UGNA 5J3HC 3K7UA 4Y2OA 1RY7B 2FWOB 2UZYB 1Q0YL 1A4JA 2HLFD 4WVRA 4POYA 2P8PA 2DTSA 2UZIH 1RU9H 3AMKA 4PRBB 2GJ6E 2YK1H 1OD7A 5JHLH 3Q6GL 3TCLB 1KGCD 4G8EB 3O9WA 5E8DH 4JG1H 5MERB 5LAXA 2ORBH 3S3PA 4NBXB 3SDCA 3FO2B 1P4LA 5B21A 5BOZG 5TDNA 5KTEL 3GHEL 2MPAL 4XX1E 2OYPA 1UM6H 1QVOA 4M5ZH 1A6UL 5CGYC 4K71C 1A6AA 1KTLB 3TWCH 1I1FB 5CSZA 5DD5L 5SWQB 3JZ7A 4X7DC 5EPMA 2AXGB 1AXTL 2C3HA 2X70A 3H42H 4RIRB 4ODUA 4HMCA 1ZT4A 1KJVB 1FL3B 4N0YL 5I75C 2VYRE 2R4RH 3QUYB 4GKSA 4BJLA 4BK4A 1MCPH 3P0YL 3SDDA 2HLAB 1OP3K 3QNXB 1F11A 4LRIC 4OCWL 4L8CB 3QH3A 4X4YB 1W0VA 5ADOH 2DQDH 1VEOA 1CFNB 2EIZB 1N6QL 4FQ2H 4RISL 1H3GA 4J3WA 3RX7A 5HTSA 4MXWL 3VXRB 1JZ6A 1Q9LB 5J57B 1N59B 5SWZB 3NMEA 2YN3A 4RGMB 1P4IH 2IALB 1GZQA 4ORGB 4EOWH 1AY1L 3PG2A 1U8JB 1SYSA 5CJQH 5F93C 3DMMD 1ZT7B 5I1EL 2MQ3A 4X4ME 1UENA 1DR9A 3LN5A 4M1GH 1TVHB 3WD5H 1EPFA 3RL2A 1VFAA 5D7SL 5C7XL 1EEUA 3RNKA 2BDNL 3T0EA 2YXMA 4FFWC 4HJ0D 5F1KC 3UTSB 3DXAD 4JY6A 2UV3A 1BFOB 1UFUA 2DWEA 3VXRA 2IFFH 2JJTA 3JV5A 5AYUH 1A1MB 4HPOH 2DRUA 4HUWA 5C0CB 2FD6H 2HTLC 4OF6A 4BYHA 4GH7B 5SWSD 4IRSD 3IVKA 3EIFA 1Z0NA 3MROB 3G9AB 4Z7OF 4M7JL 3WXWH 1MHPH 3QA3B 1D9KA 4WY7H 2BVYA 3SGDI 1N2RB 4HS8H 4JFYB 4L8SA 4KQ3L 5J12B 3KXFD 2CKNA 4W6WB 4JZNB 3RPIB 2NY4D 2JJVA 4PRHA 5E5MA 4D9QE 3N1FC 4I13B 1E6JH 3C5ZC 5HVWA 1QLRA 3B4NA 4JM2D 1I3RB 4XB8A 1R3LA 5E08L 2ZSWA 1BX2B 3B9KC 5K9KB 1N6VA 3MRGA 4G8FA 3QUXC 1BLNA 3IDMB 4LLUB 4JG0L 3V4VH 3W0WB 4YZFE 5J13B 4EDXB 2EDWA 2O5XH 2VB5A 2X09A 5JXEA 4H88L 4X6CE 4UT9L 2VL4A 4XPTH 4UDTA 5E94A 5FDWB 4NWTH 1WWCA 4A6YH 4WU5B 5CGTA 3ZO0A 1J8HB 3ZYOA 4NYLA 4OKDA 2PO6A 3UTTE 1I1YA 1SYVB 5J1AB 3BP6A 4G6KH 3LEYL 4LVHC 1SEBB 3OR7B 4QGTA 4P49A 5BQ7A 2NXYC 1OGAE 1GC1L 1QHPA 5JMRA 5FYKU 4UUJB 4MQ7B 1ZLUH 3MA7A 4Z8FH 4WI7A 4X80L 2AK4D 3FN3A 3MRFA 4HULB 3IFLH 1C5BL 4MHHG 4Z18A 4BQ6A 4V2CB 5C07E 1V8HA 2Y9RT 5M94B 2FRGP 4M03A 4I3RL 1GC1H 2QHRL 4ODTH 5IR1B 3S9DB 1T1WB 4RAHA 3VWKD 1K3IA 3A0OA 2A77H 2EXYC 4OGYL 1T1XB 3NABL 4KTDL 5D1QC 3CDCA 3CC5A 1Q9KA 1RFDL 4MDIB 1MFAH 3OF6A 3GBNH 1OTSD 5IVXE 3WE6B 4AIZB 2EXWD 4HKJB 1J0JA 3MRMB 3QDGD 5IHUL 1UACH 1YDPB 4UU9B 3S37L 4X7TB 4J3TA 1LK2A 1AGFA 4RAUB 1JNHB 2B4CH 4XPBL 5KW9H 2WAHA 2VXQH 4QTHB 5AYQA 2J8UA 5D1XA 3PNWA 3BE1L 4MNGE 5EU6D 3L1OL 5JLZA 3RWIA 3W2DH 4WWKB 3DI2B 3HNVL 3OG4B 2DM4A 2RJMA 1RHHA 4R90H 4GT7A 1HQ4B 2O93L 4EVNA 4GKNA 3SOBL 3ZTJH 1I8IA 4TUOB 1KJ2B 4QTIL 1FE8H 4MA8L 3BHBA 3BQUA 2AEPL 1MHEB 5JA8B 4X6EA 4GAFB 4PPTA 3MV11 1BD2A 2NY0B 4L3CA 3MGTA 2BSSB 3M8OH 3PHQA 4JRXB 1WQVT 1T03H 5IUSA 3UO1L 1MJ8H 4PP1D 2J6EA 1MAKA 2ARJQ 5DVOA 4ERSH 5I8KH 1F5WA 4JY4A 3RI5K 3U46A 2VDRL 1I85A 3HC3H 1EO7A 4LK4A 4NN6B 2C7UB 3SDAD 1RIHL 3CUPA 4FP8L 2EZ0D 4ZOAA 5ANME 1JV5B 3WV0A 2X2YA 3LEXA 2NY6D 4HS6B 2YD7A 4D3CH 3MRBA 3DXAB 1HQRA 1DBAH 3DVGB 5ECJE 2D0GA 4Z7QE 2VABB 4NWTL 1CYGA 4RSVA 1QSFA 4U49A 3NFSL 1S7RA 3GSNH 5C07B 3KJ4C 2WIIB 5IW3A 1U8PA 2JCCE 4CMHB 5EZLB 3H9SB 2HFTA 5JOPE 4NQEA 3V95A 1UC6A 1Z6JT 4L4VD 4NBYB 4HUXB 3NGBB 2IANE 2GAZB 3MLWH 3MV7E 4OLUL 1NBYA 2FZ3A 3BGMB 2XTJC 2XKSA 4WTWA 2J4WH 2PW2B 1JHTA 3EFFA 2FGWL 3P77A 1JNLH 2IADB 2QBWA 3V6ZB 1XGUB 1NGYB 4FQ1L 2VABA 4FFZL 3QEQE 3VMPA 3CD4A 4O2EB 4DUXA 1A3RH 3KJ4B 2WK2A 3V2AR 4D0DA 2H26A 4Y2DB 1X5LA 5EUOB 3MCKA 2Q7YB 4G9FB 3FCTB 5JR1H 4GAYA 2HH0L 4NQEB 1A7QH 5AZ2H 4ZFOL 3HE7D 1R24A 1MLBB 5TE7H 4S1RH 4MXWH 3GSQA 1S7TA 3NIDE 4ZSOB 5EFIA 5C07A 1OP5K 1XGYL 4X5WB 2AJYL 4I5BB 3DNKA 2C26A 1DBJL 3TGXA 2MKLC 4C56D 4UILH 1IT9L 3BFOA 4BFGA 3C60A 4P48A 3DX6B 4HUNB 3RVWC 4CAGA 4PG2A 1OGAA 2X9YA 3IJYB 5KS9F 4N8VG 3ULSA 3PGDB 2ORBL 5ALCL 1I1AC 5MEND 2ZOKB 1HOCB 3NCYS 4R26H 5DC4B 3HC4L 3VCLA 3D85A 4NOBA 1FL3A 1VESA 4HWZB 2VLJD 5BW7C 1HIML 1RI8A 1E4XH 4JO2H 2YD3A 5D2LE 4OD2A 1TZHA 1DUZB 5BVJB 4XI5C 1PX3A 1RZJL 5L9DH 4UDTB 3NFPA 1SMAA 1NGZB 5F6HJ 5KTEH 1V7MH 4LQFH 4XMKL 3QUZD 5FM5M 4XVSH 2P5WE 5HI3D 3UTSE 5EU7C 2X7LA 2ZOLA 2R1XA 3MA9H 4ONFL 3WLWC 3MCLH 3SGJC 2VDPH 5KSAC 1KTDB 4ZFGH 4HC1H 3WUWA 4DTGH 1G9NH 3ZYIA 5EORH 4OAWB 4LCCB 1WFUA 3MBXH 4WHCA 5E5MB 3RDTD 1T2QL 3BKCL 3ESVF 4XX1G 3FZUD 1P84J 2PW2A 1AD0B 4OT1L 4KVCL 5SWSE 3OKYA 1DFBH 1TZIA 1SY6H 4PYGA 3GKZA 4NJ9H 3ZHLA 2FHFA 3EJJX 2BVQA 2DIAA 2FH6A 3NACH 1WTLA 5GGSY 5KBNC 2X1WL 1EGJH 1U42A 2H6PB 5D7JC 1MCJA 1T2QH 3BKCH 1BOYA 3ILQC 3MRRB 2BRRH 1J5OL 1RZJC 2HJFA 1U8PB 4YLQT 2W0FB 1NEUA 5JNYA 2EDYA 1AO7A 3UJIH 3IDJB 1K2DB 4FQXC 5IK3A 4YHKH 1AI1H 1NCAH 4ONOA 5IESH 4ONGH 3TN0B 2GK0B 3CNKA 4J4PD 2GYSA 1JGUL 5INCB 3QCUH 3DRQA 3QPXH 4QRPA 4QNPE 3MOAH 3VXNA 4HG4J 1WWAX 4OZGF 3ARFC 4O2CB 2EDFA 1TVHA 2CRIA 3SKMA 5D7LE 4KAQH 1QSZA 3S97C 1D5IH 3NH7H 1BBDL 1INEL 1K4DA 1UVQB 5C3TA 4CADB 3D0LB 3GJEA 1G7JB 4LLMA 1N3NB 1CE6A 1OF2A 2JJSA 2JTDA 3CVHH 3UMTA 3T2QA 1I7TA 3SDYH 1FVCB 4HKBB 4PRIE 3GMPB 3D25B 5E8OA 4ELME 1OP9A 1KCSL 4RGND 5KVGH 3VG9B 3LSOA 3BPNC 3LY6A 5FK9A 5D93B 1KJ2A 4MLSA 3T3PE 4H1LB 1L7IH 2IMNA 2P5ED 3TH4T 4JKPH 4V1DB 5E1AB 5TGBB 3O2VL 5C0CE 4DZBB 1H3PH 3QYCA 2VDOL 4P4KC 3GMRB 1KT2B 1JZ8A 4Z7WE 1QZ1A 4JFXB 4IIQB 4NNXB 4GG6A 4TNWF 4D3CL 3UYOD 5I16A 5ITFA 4OI8A 4QHLB 2VOTA 2Q3ZA 3QSKB 4MNHB 3JV6B 2VDQL 5C70A 1C1EH 2GTWB 2VDRH 1P4BL 4POZC 1GGIH 3LQAC 4YWGL 3FQUA 4QRUA 3D48R 5DTFA 1M6OB 1BJ1J 3V4PL 2UWEE 1A47A 4P5TB 4OCSH 2KH2B 4LEXH 4AMKL 4KQ4H 1EX0A 4O02L 3O3EB 3CK0L 4WO4B 3GHBL 3CMOH 2J4WL 2IAMB 3L3JA 1RIHH 4WUKH 5IMOB 5ACZA 5I73C 4G9FD 1OB1B 1NBVH 3ULUE 5I71C 1D6EB 1Q1JL 1V3MA 1AGCB 3CAFA 3BMWA 2VE6A 4HHAB 3B9KD 1DZBA 1DVFB 3GMLB 1CBVH 4JRYB 1IGYA 1MFDH 1BZ7A 3RHWK 1N7ML 5HYIA 3BP4B 4LNRB 5FAAA 3KPRE 5LGJB 1ZA6B 5FF6B 3N85L 4TSAH 2AW2A 3ZE0E 1W72A 3IU4L 3CDGB 2N56A 4FZ8L 4JY5H 3L3DA 5D5MA 4JFFB 2V2WB 3RTQB 5C0IA 2DQJL 3FQXA 5IP4A 4KDWA 4AY0A 1A7QL 2YPVL 1SVCP 1DVFC 4YHZH 1PKOA 3KPOA 2YD6A 4JFDE 3CSYB 4ZPVB 1ZT4B 1FE8L 4TVPH 1G7LB 1GGUA 1JPST 3QEUA 4PD4K 3MV8D 4XP6L 1RFDH 2VLKE 1BQHA 4EI5A 3D87B 2VMFA 2AJ3B 2RFXB 2OXHA 3NCCB 2Q8BL 4QRPE 3SHSA 1H3TA 1YNKH 3RNQB 4EI6A 5C09A 4ELMA 3VG9C 1CE6B 2ZOKA 4LPCA 4L8BB 5BS0B 1OAUH 2X5PA 4XNYH 4LVOC 5FA3A 5F9OH 4LPUA 3HR6A 3RRQA 4ZTOH 5LAXB 5E6ZA 3U2SB 5IWLC 4NCDA 4FG6D 2DL2A 4QTIH 3HZYB 3QHTC 1JWSA 1ORQB 5F7WC 5E2TH 2P7TA 3EYFA 3PWNB 4O5LL 1JN6B 1J1PL 4GXUM 4PY7B 1MFBL 2XZAH 3DJ9A 4DGYL 2XXMB 5GGRB 1BPVA 3NZ8B 2HT3C 4MQ7A 1NAMA 4DQOL 4AIXA 2F15A 1YJDL 2Z31D 1BF8A 1ZT7A 1U8QB 2FJGB 2VXTL 3G6AB 32C2B 3U9UB 5FB8B 5D2NA 1XF2A 2V9QA 2PN5A 4R4BA 3D39D 4ALAL 5DYOA 1FIEA 1TIUA 3MZTA 1A14H 4PGJA 1CFNA 3HMXA 1UH3A 1JE6A 3PP4L 3T0BA 2R29L 4XI5D 4LSSL 1BFVH 1UJ3A 3GSQB 3OAZH 4LHUD 3GI8H 3O6LL 5E2WH 1ZLVK 5D7KD 3QAZB 4KUZH 2EH7L 5DQDL 4JHWL 4JRXD 4PRPA 4JQIL 3BGAA 3P3YA 4R2GC 3K74B 4PRHB 2LU4A 1K8IB 1IM9A 3CVHB 2IAMC 3QO1A 2H3NB 4ZUUA 1CLOH 5J3HD 4WW1B 1CFQA 5IB4B 5IBUG 3O3BA 3C8DA 3MLUH 1RIUH 4DKEH 1DUYA 2DQJH 5IMLB 5D70H 2VITA 3LCYA 3V8CA 1NCBH 3KNBB 4K94H 3SQOL 3OV6A 4Q6YA 5T3ZH 3MROA 4HJ0C 5E1AA 2QQQA 3HUJB 5HXMA 1YQVH 4LSVH 1TQBB 3WFCL 2BX5A 1Y0LB 1NL0L 4IMLB 1OTTD 4YE4H 3UC0L 3CPLA 3BIAX 1Y6KR 4WFGD 1U3JA 3CX2A 4OZHF 5I19L 3QXAA 4LSTH 4CVZA 4WUUE 3VI3E 1PW3A 4LP5A 3H3PH 4RFEB 1NFDF 2MTPA 2EYRB 1RJZB 4HIHA 3KXFB 1UXWA 5CP7B 1BBDH 3F7YA 1F3JA 1H9VA 4XNZB 4O02H 5DI8A 2M26A 4QHNA 3MMEB 5C0ND 3H7LA 5GGSB 2DQIL 5LWYH 3MFGB 3WS3A 2NYYC 4HPYH 1NC4A 3UZQA 5HY9A 5B22A 2GJZB 3FQNA 5CJBA 4Y16A 4FXKA 4YFDB 4DGIL 4HMEA 4XNUH 1YECH 5A16A 4PJAA 1ZVSA 4NZTL 1BVLA 5T1KB 5GGQL 5EB9A 4HUXA 3EZ8A 1KJMA 1NBVL 5H37H 3OGCA 4QYOA 4Q9RL 1LGVA 4JREB 3ES6B 3GSUA 3MV7A 4QHKI 1X5ZA 4M5ZL 2FL5A 5F3BB 4KQ4L 4KFZC 2DI7A 4PJAE 1DN0B 2Q8AH 1E4KA 4JM4L 1MFDL 3I3BA 4YWGH 2D31B 4RAUA 1UXWB 5CP7A 5D96C 8FABB 5IESL 1MI5E 2FX7L 2XYCA 4ZSOE 1M05B 1R6VA 3D9AL 2KDGA 1VFMA 4TOYL 4M3JA 2VUYA 2HWZL 1JF5A 3O6LH 3ET9F 2QV2A 3OG6B 4NT6B 5CBEA 1XR8A 1X9QA 4PLNC 2C3VB 3AXLB 5DD5H 3VW3L 3O3DA 3GNMH 1EGJL 4Z6AT 5JIIA 3AC0A 3G6JB 2P8PB 1G7LA 1AQDB 3VA6A 3PWPD 3HI1B 4KZEH 2PW1A 1CG9A 4HUKB 1OWWA 5BV7B 3MGTB 1I3UA 1KFAH 2X9WA 4URTB 2XFXA 1GOGA 1UZ6E 1A9EB 1KULA 2UY6A 3IDYB 4G8GD 2XWBA 3WIFA 2VERN 5C0CD 1ZTXH 1OTTC 1OAKL 2AXJA 2BFVH 4NQVA 2OL3A 2AV7B 4HWUA 3TBSB 2ERJC 3HE6C 1PAMA 5MEPA 4PRNA 1CXHA 5DEFB 2F58H 4J23A 2A0LC 4JFZH 2CDFA 3DYOA 3U7YL 5DHYB 3DWTA 3DSFH 4JO2L 3IAPA 4JG1L 4NO0B 3K4DA 4XCFL 5CJXC 3BP5B 4C54A 4ZFFB 4NNPL 3ARVA 4N90D 4KKBD 4X8JA 4JRYE 4KK8C 3BZ4A 4G6AD 2P45B 5KSUA 4NKQB 1S5IL 4ZYKB 3SCMB 1FRGH 4E9LA 2FBJL 5KSVA 5E4EB 1B2WH 5I1HH 3AREC 3MFFA 2VDPL 1ZK9A 1OQXA 1RIVL 4O51A 1A6WH 2R0KL 3GSWA 1TZGH 5D2NB 5CKAA 1J18A 4MD0B 4YXKH 5C0JB 1LO2H 4S1DC 4X9BA 1OY3B 3MJ8B 5EG6C 3UTSA 4F33B 5DQ9A 4WENB 5DK0B 1T83C 3OKLA 3C6LA 3PWVA 3GRWH 5FYJD 2ZJSL 4Y8DC 2DIJA 3PWVB 1NFDE 4JN2A 1JZ7A 1N64H 4JQVC 1J1XL 1QYGH 3GI9L 1JMXA 2ADGB 3K81A 5C08D 1DBKH 3ZE1F 3QXWA 4Y0GA 4Z7VF 2J5LB 3HAEB 2OTUA 5I8CA 3K8KA 4LQ1A 2Z31C 4MB4A 3O81A 1UB5A 1U58B 3QP3A 2FNBA 2HT3D 4JY6B 1TPXC 1BMGA 3HG1D 1U6AL 3QFJA 4KV5E 3PQYD 4RBPH 1JP5A 2IFGA 3QHZH 3GM8A 2Y6SD 2CGRH 2X44D 5LBSH 3WFHB 4X7EC 1YEDB 1EH9A 3CH1A 2BNRB 3E3QE 2IEPA 4LPVA 4U6HA 5C0GB 2CR3A 4OUUB 5D7IE 3T4AB 1PKQA 4ODHH 2LTQB 5BZWB 4KI5E 1R3LB 3OKKA 3V5KA 3Q5TA 4X6FB 4Y4KB 3RI5F 4ZPVA 3TT3L 1DANT 2CGRL 4IOIB 4HEPG 3RZCB 5DEFA 2X89A 3W39A 3E8UH 4PJ5A 1G7MB 4OIIH 3FMGL 1MHEA 5JDSB 2QSCL 5KS9A 1JZ2A 3QQ9C 2P42B 5D5ME 2ZSVA 2BZDA 4KRPD 4AIOA 3QIBB 4XCEB 3QDJB 1IJ9A 4U2YA 5DS8B 4Z7VB 4RA0C 1MHHA 3PWNA 3PWUB 1R3IH 5E99L 2DLFH 2YD4A 1I4FA 1MNUH 1YMHB 3DETD 3MRLA 4RWYH 4KRPC 5JOEA 5T1KD 3VXUB 1IZJA 5DMIH 4DCQB 3WXVH 5ENWA 3WNKA 3WN5A 1GGCH 2W9EH 4U1MB 1QACA 1U8QA 2FJGA 2UYLB 4FNLH 2GT9B 3LIZH 4H0HB 2YPLB 2UVFA 2HMID 4M7ZB 4PG9A 1FC2D 4IOFD 4M6OL 3ZSTA 2BP3A 4G9DB 4YZFF 2OJZL 5FUZL 5EZOL 5HHOA 5E6IC 1AC6A 3CDYA 3C8HA 2DKMA 1OAQH 2ICWJ 2G5BA 4P2OD 4AJ0A 2NY6B 3EYVA 1TQCB 1VFBA 4FRWA 4NNYA 2IAMA 3ETBF 5IMOA 5DUMH 5I30H 1KCRH 2PO6C 3L1OH 1L7TL 1GIGL 2WWMC 1M7IA 3K4AA 1YEEH 3VGEA 3AS2A 4OD3L 2JIXD 3GSOA 2VN4A 4HQQH 2X4RA 7FABH 1TCRA 2MCPH 4JB9L 1FZMA 3MXWH 3V0VA 3MUGB 3IDUA 4M48L 1ZLWK 3BVNA 5E2UL 2CO7B 3PE9A 4Y1AA 5HHXL 3EGSA 5LQBH 2P5WB 5DJYB 1NDMB 2APVA 4JZJC 2QQKL 2NPLX 3MBEB 1I9JH 4LGPB 1KJVA 4P9ML 4RX4A 3SGEH 5IB1B 2EEAA 5IB1A 4LKCA 3MOBH 4LMQI 4M7LL 1RSFA 2N7AA 1XIWA 5FDWA 5T1DH 1MCSA 1ZMYA 5IV2A 3QUYC 3U36A 3BEWB 4ALAH 4DZBA 1KFAL 1IAIM 4I8DA 4AG4H 4CN4A 5DDHB 4EDXA 4BUHA 4PJ7E 5ID1B 2FX7H 4POZD 1T7VA 3V0VB 3EYOA 1R3KA 5HGDB 4Y1AE 2WBJA 1QD0A 5LGKA 3QUMH 4G6AC 4K94L 2B0SL 4MNQD 4ZO8A 2BRQA 1CLYH 4JVUA 5C0EB 3GGWB 1G9EA 4DVBA 4OTXL 3IKKA 4O9HL 2WINB 5BV7H 1YYML 1OAZL 1QEWB 4U6HB 5C0GA 1NMCB 3CH1B 4U1GC 2BOBB 3MOQA 4U6XA 2H2SC 1IC7H 4JPVL 1U8IB 3MLTB 1VGEH 3OKOB 1S9XB 5CD5D 2VE6B 1MWAB 1VGKB 4HHAA 1JK8A 4OIAA 2VNCA 1S78D 4UINL 5BVPH 3U7YH 1CZ8L 1F97A 4LLQB 2ZUUA 5IK3B 3SDXE 2VTFA 3FAWA 3L3JB 2OTUB 4XWGL 1K5NA 1UXSB 4WO4A 1INQA 2QHLA 3ARFD 1I4FB 1YMHA 4J3XA 4HK0A 2YWZA 3DHMA 1NBYB 2VLRA 3HC4H 5F7EL 3GSUB 2XZQL 3MV7B 4K7PX 5J89A 4RDQG 2NY3C 4GBXD 2VXQL 4YE4L 4U6XB 3UTOA 2HKFH 3LN5B 4K8RD 4XBGA 1FSKB 1WVZA 2XZQH 1J05A 4C57C 4WU7B 3UTTD 2VXTH 3ZKXC 3V0AC 3R06A 4GMSH 1SJHB 2E27H 5KAQF 3VFWB 2FX9H 5L2JB 4Q9QL 2GEEA 1J9CT 1P53A 4NSKA 2CLVB 5IB2A 2XG5A 1QLEL 2X4UA 12E8H 1G9MC 2X7LB 3QIBC 4X8JB 3K1KC 1MCOH 3MODH 1RZ8B 5LXGH 2BVOA 3MYJA 5L6YH 1SVZA 5J6GB 5GGVL 2ICEA 3CFBB 3ULVC 4KGLA 3MJ9L 5MI0B 3TYFB 4EN3B 1FIGL 4F80A 1UB5B 4KV5F 4APQC 4X80H 4KUZL 5DQDH 1AD9A 1TXKA 4XWOD 4I0KA 5CKGA 2DJ4A 2F54A 3GMMA 1BOGB 4H26A 4X0KB 5DHXB 1FFOB 1ZS8A 1SJXA 4WFHE 1A7RL 3QNZA 2DBLH 4KHTL 4NQVB 1IEAA 2B5IC 4MAUH 3ULUC 5I1LA 3GHBH 4J1UA 3WIHH 4N8CL 3DX6A 4Z7NE 5HYJB 2F53E 3PHOA 4FZEL 5C09B 3VFTB 2G60L 3O9WB 5MERA 4ZAKA 3A67L 4YXHL 3DTXA 4D9QD 4J6RL 4U05A 5EFIB 4F9LA 5EIIA 2Z8RA 1CBVL 1OLLA 3EKCA 3QQ3A 3ES6A 1UQSB 2P43B 4DAGL 1JWUB 1KTDA 4LARL 4O00A 1EBAA 5INDA 2WWKT 3ZKND 4S2SA 4ZYKA 3SJVA 5DRWB 2AJSH 3B5GA 5DK2B 4P4KA 4YEFA 3ZKQD 3UAJC 4R0LA 2JJUA 4HCRH 3IAGC 2B7DT 3QQ4B 5GRVK 1XGTA 2NMSA 4XRCB 3X12A 2IADA 2YD5A 3V6ZA 3KYOB 4GRMA 3SPVA 1YEFH 3OAYH 5GZOD 1K6QH 4IHOB 1HILB 4S11A 3LIZL 4KKNA 1CDJA 5AWNH 3LKNB 2O5YL 5C7XH 5MEPB 5HYJA 1BHGA 4OLZH 4GRLB 4MAYD 4OLVL 4MA7L 2M8XA 4ZXBC 1BZ9B 2LABA 4PJAB 4R7NB 3RUGF 2IFFL 4LEOA 4OCYL 3K1DA 1B4JH 2PXYB 4LKXA 1KCRL 4OV6F 5E99H 2DD8H 3INUH 1KXVC 4A2MA 4MNGB 3B2UD 3GKWH 5LQBL 3D5OF 3ZT7A 4EBQH 3KLHC 1G84A 2MCPL 3VCLB 1CLZL 3ARZA 3Q3GB 3B3IB 4WI2A 5CUSH 5D1ZB 4X6CB 2NY7L 4NUJB 3E6HB 4F7TA 2AJVL 2ZPKL 1HHHA 3U7WH 3MCKB 1J1XH 1R5WA 2D4FA 2AXHA 1O7SA 2X42A 4PJXA 3VXSE 5L2JA 3UPRB 3ZE2F 1QFWI 1OHQA 1CICA 2CK0H 2B0SH 2Y5TB 5BJTB 1F90L 5A3IC 3BMVA 5DJXA 2EIEA 2VQUA 4Y4FC 3GMOB 2FECI 2H1PH 2ZZUT 3GK8L 3KYMA 4D9RD 1AGBB 2HJKB 3UBXB 1JGUH 3UPCA 2PYEB 3QCTL 3IF1B 4WW2B 2HRPL 5AEAA 3AM8C 3VRIB 4HAGA 4ZD3H 3RWCA 3FQTB 3RAJL 2EE3A 5K33A 4FZ8H 4QTHA 4S10A 1KB5A 5TGBA 3RWDB 3GJFH 2GCYA 4FXKB 4ELMF 1QSFB 4F7MA 1J5OH 3K8MA 4AQOA 5E9DA 4ODVL 5D9SB 1BM3H 4PBXA 5DVNA 4JCMA 4GQPH 5A2IH 5CEZH 3FMGH 3R06B 5EUKB 1C12B 4I18A 1WICA 3MRNB 1XGQB 1A22B 4NQCB 1MF2H 4PJDE 4S1QL 4KPHH 4NHCL 4UV7L 3ARRA 2DLFL 4YXLL 2IH1A 1II4E 3CFDA 3VXNB 2B1HH 4JPWH 1I7ZB 4L9LC 5DJZB 5DHVH 4Y2DD 3WLBA 4BFEA 4N8VB 2VXSH 4H20L 4XP6H 4R97C 4XAKD 5EZIH 1GPOL 1FH5H 5KVEL 2YEZA 3BO8B 3L3GB 4HS8L 4PV8A 4MJIA 4X9IA 3F12A 1B6DA 4H25B 3VXUD 3K2UL 2AS5M 3CU1A 4YDKL 4M8QB 1PY4A 2XN9D 4K07A 5E7FA 1EFXA 1JFQH 3T77B 4BQCA 2AK1H 4U1HA 3NTCL 4WUKL 2R0WL 1FZOB 5DURD 2H45A 3T8XA 3QG6A 1T6WA 4LQFL 4RBPK 4XMKH 3HUJE 3VFSA 2YPKA 1BQUA 1DSFL 1T89A 2R56H 1QNZH 4LMQE 4X6CF 3O6FB 2AP2A 5F97E 2C1PA 2AK1L 4B53A 2X4RB 1C5CH 4PRHE 1EUUA 4DKFH 3HI6L 1T4KB 1M1SA 1GVIA 4L8BA 2Q87A 1M7DA 2D03L 4PIRF 3HMXL 1JRHI 2RFXA 4P2CG 1P1ZA 4JFFA 3IFPB 3MJ7A 5BZDA 3HPLB 3NFPB 3FHAA 4S1SH 1PDKA 3RJDA 1QBML 3D25A 1YQ2A 5E8OB 4K3DH 4HUVA 1A7BA 4MQXD 4JFHD 1TVBB 4ODXA 4F2MA 2PUQT 4I0PD 4F3FB 4YDJA 4AM0A 4HJJL 5A16B 1VPOL 3RGVB 3QULB 2FBOJ 4HFWA 4IMKA 2DQUL 1DCLA 1YEKL 3EOTH 1KNOA 1SYVA 4LCYB 4ESKA 1RULL 3VH8B 1O5DT 3I3DA 4LVEA 4PY7A 4X6BA 1B0RA 5DUPH 5CJ8A 5L7XL 3MRLB 2EO1A 1S9VB 4L1HA 3H42L 3HPLA 2ENYA 3V4UH 3P73B 1LQSR 1IBGL 2JB6B 3VGHA 3BUTA 1KIQA 4KZEL 4RGNC 1DANU 2AEWA 1K2DA 2K1MA 5EU4A 1WGOA 3P9MA 2X1XR 3L7EA 4FQ1H 1LWRA 2A9NL 4WDIA 5TE4L 1GZQB 4ORGA 3SDXF 3ALXA 2D7NA 4L4TD 1NLDL 3N1MC 1NBZA 4Y7MA 2JE8A 3UTZB 1DJSA 2E9JA 2ILLA 3H2WA 3BW9A 2VJXA 2YD2A 3GMNA 3K2MC 5IIEA 4XPBH 3L5XL 3U0TA 4AT6A 4YHML 4RDQF 1F11B 3QNXA 4IJ3C 3AAZB 3JTSA 3NFNB 2GAZA 3VRIA 3MRIB 4FQXD 1BJ8A 3GJFB 4QRRD 1SMOA 4Y19D 3TO4A 4CRPA 5C0BA 3BRFA 5HYSG 2NX5E 2XTJD 5FECB 2V7NB 2J8OA 2A6JA 2ZPKH 3U7WL 4LSTL 3NTCH 4OF7A 2ADGA 3U4BH 3LD8B 1QVOB 1Z9SA 3ARTA 1N3NA 1ITBB 3T77A 5TPWH 1NCWH 1JPSL 1JTTA 3IDIB 1A6ZB 1NFDB 3OKKB 4TULL 4L5FL 3W82A 2YKLH 5FYLH 2FATL 4LNRA 1JL8A 4GW5B 5ICZB 3RDTC 2GJ6A 3C2SA 4RA3A 1CIUA 4LDEB 1TJHL 3M8OL 4QRPB 3TZVB 4J3OC 1PSKL 4PJCB 4N8CH 5C6WH 4R6UA 4JQIH 1J0YA 2F53B 5F1NB 4FQJH 3V6OA 2DMBA 4ODBD 4HIEA 4YHYC 4R97B 3C6SB 1RUQH 2P1YA 3O4LE 3BIKA 4GFTB 5HI3C 4JGJA 4F7MB 4P46D 3B5TA 3NFSH 1A7PH 2GQHA 1UZ8B 3HC0B 4P2YA 2XZZA 1Z9MA 4LLYB 3T2NH 1ZHKA 1H3VA 4J3VA 3MLVH 4PJIA 3PF2A 4HKXA 3E0GA 4EVNB 3AGVA 1TVBA 2G60H 1X4XA 4X6DE 3GBNL 1M6OA 2X4TA 4FA8A 4N0FA 4WFFD 1QR4A 4PJFA 5E2VH 5ERWA 3QO0B 3AB0B 1C12A 2NY3D 4GBXC 1C5DA 3QIWA 1PG7L 3FQRB 3QIUB 5DD3H 3MSPA 1EUTA 1N0LA 3RKPA 3V52H 3NIDF 4X7TA 4S1RL 3VGBA 2QL1A 5D93C 3WNOA 3WUWB 5CD3B 2HT2D 5CBAB 1KG0B 2NY2D 4PP2A 3O0RH 2G9HA 4PRAB 1T04B 3TV3L 3K2UH 5CD5C 4K7PL 3MLYH 3U4EA 3HE7C 5T5FL 5DJCB 4OI7A 1ED3A 1X3DA 1CT8B 1MIEL 5T33L 1GGBL 3CZJA 3NCJL 2Q8BH 1UH4A 2IQ9L 3CSYA 4NT6A 3ESUF 4BZ1L 5C08E 4WDIB 4NQDD 1C08A 1WITA 1QR1A 1L6ZA 3PWLA 2ZOLB 1OAXH 2F19L 4MD4B 4PGBA 4YXLH 3VXRD 3CIQA 1LD9B 4V1DE 1NFKA 3PJSA 2XWBB 2W65B 5IHUH 5F6HI 5GS0D 5D7LA 2EEDA 2C3WA 3C60B 3MNWA 3TZVD 1BIIB 1K8DA 1GHFH 5LXGL 2E6JA 4PUBH 4MS8D 3RP1A 2ITCB 3DBXB 5HHQB 3C5JA 3QUYD 1CGYA 3C5JB 3HCVA 1Q8MA 4CDGC 1LO3H 4ZTPH 1CFBA 5DRXA 2IC2A 5JHDB 2ADFL 5TQ0H 1KIRB 5D8JH 4LRIA 4J8RA 2C3VA 3Q6FB 4Y16B 5B39A 4XTRD 3H0TB 4PRHD 3WSQH 5HHXH 3KLSA 4HUVB 3CSGA 4APQB 1G0XA 5JPMA 1T03L 3QWOB 5K9OA 4XCYB 2AJXH 1NC2B 5I76B 5FUCC 3RWDA 2BY2A 1JHTB 1S7QA 5IG7A 4LLDA 4QHMB 2NQCA 1P2CA 1BECA 1DQDL 5K9QG 3RY4A 3V5DB 3FT4B 3DMMB 5DJ2A 1ADQL 3CXHJ 1NCNA 3MC0A 3O6FC 4XP4H 2ICCA 3QQ4A 2PYEA 4G8GE 1A2YB 1IGIL 3OKNA 1C7TA 4X5LA 4LVNC 3UBXI 1IEHA 4L3EA 3UZEA 3LZFH 3MPCA 2KZ1B 3JV6A 3KYAA 2X4QA 5IBUB 5JW4R 1LO4L 2BDNH 1JGVH 3WNNA 4X99A 1NC4B 2F8XC 3G08B 1BQSA 2X4PA 1NCCL 1AP2A 1FDLH 2CJUL 4GKZB 2EDJA 1C5DB 4LU5L 1ZWIB 1ZWIA 2NY1C 3MYJB 1M7XA 2BVTA 1F3JB 3G04A 4EOWL 2CDEB 2GW5A 1U3YA 4NZUL 5IB4A 3HB3D 4O51B 1ACYL 1JTOA 5DJXB 2MFNA 4R96B 2E3VA 2OQJB 3QCUL 4RAVA 4NQCD 1P7QB 5BRZB 3FOLA 2XA8L 4JPVH 5C9JB 3SE3A 3BD4A 1JMZA 4KXZI 4WU5A 3EHBC 3U9PL 1CDYA 5KVGL 3ARWA 4F58L 1ZHNA 4QXGL 1H8SA 4L5FH 2GITA 1C1EL 4NIKB 4EXKA 1I1RA 2FR4A 3HMWH 4MZ3A 2PKDA 3SKJH 4NSKB 3ALPA 4ORZC 3B9VA 2UWEF 2CLRA 5DJAA 2F74B 4WEMB 1T0MA 1AR1D 4JB9H 1L7IL 4D9RE 1I3VA 2NXYD 5CJ5A 5EPMB 4OB5L 2CRYA 3CGTA 1MH5A 5FKPA 3DVNA 1JGLH 3DX8B 1WZ1H 1RUKL 2XFXB 3T65B 1MCWW 4PJ8A 1BD2D 2ZUYA 3RA7H 2Y07H 3OZ9L 4NC1E 1IC5H 3QEQD 1DDHB 3I85A 4QHKJ 5E5UB 4FXGB 4FMFA 5AD0A 2AQ2A 4AMKH 5DRZB 3SDCB 4JLRA 1MFBH 2DQUH 2XZAL 2M2DA 4NQUA 3GRWL 4Z95L 1T1WA 3GB7A 2HFFB 1I8KB 1FL6B 3QUXD 1R3JA 5E8NB 4R3SB 2EE2A 2GSGB 2UVEA 3MLVL 4PJ5E 1CFVH 2DI9A 5I1DB 1D5XB 4UT9H 5FCUL 5MP6H 3MJ9H 3EYOB 1DTUA 1ROWA 1IAMA 4HC1A 4WHYG 3HNSH 1PKQE 1HI6A 5IJVA 1OM3H 1FVDB 1S9YB 1G7PA 2J6EL 1Q9OA 4HKZB 1CXKA 4KKBC 2E7LA 5IOPA 5DT1H 1BBJB 5DHVB 1YPZB 1LE9A 3NA9L 4Y19E 1G7HA 3JWDH 4DVBB 4S0TD 5DJDA 2A6IB 4XPAH 4LCIL 1KUMA 4OCWH 4U1JA 5IEKB 2VR5A 1QBLL 1N7MH 3EGSB 5F9WC 2XZCH 3BPLC 2V7HB 4XNQA 4JRXE 1NMAH 2B2XH 4LSRL 5I1LB 4LLUA 5TE7L 2GJZA 4HWEL 3KJ6L 3IFOB 3RIFK 5EOQH 2V2WA 1H0DB 3BN9D 3RTQA 1SJHA 4ODSH 4F3FA 3OR7A 2YBRB 4NNPH 1QSEA 1UKTA 4KAQL 1HNGA 5T1LA 4YHNA 2NY1D 3RWGB 3MRQA 3IU3A 3Q1SH 5GISL 2DMCA 1INEH 4OFDA 5EU5B 1JNHA 2ZCHH 4JZNA 5LGJA 1X6NA 4ZAKC 5TE4H 4AEIH 3ARDA 4M5YH 4M02A 1FVDA 3W11C 3WIIH 5HGBA 5JW5B 5E24E 1I9RH 4PJEA 1NGPL 3BKYL 1BWMA 1I7RA 1BLNB 1RK1B 4PTTB 1T4KA 5ISZE 4WJ5A 1HIMH 5DJ6A 3CVHL 4Y4HA 1P4BH 4P9HL 1RZGB 4NWUL 5ENWB 2X4OA 3WYRA 1YEIL 4NQXA 2N7BA 5I1KL 1OTUD 1FG2B 3GMQB 4FFYH 3BZFA 3TC9A 4MJ6B 4OF8A 5MENA 3PWJB 1A6UH 2Q6WA 4ZXBB 4N0FB 1NGXB 1TITA 1Z5LB 4LOUD 2VR4A 1YEGL 1OAYH 2QQLH 3IDIA 3S96A 3E2HC 3QIBA 4XCEA 4X4XB 2EKJA 2DM2A 4LFHD 2WNGA 3DVNB 1MRDH 5FOJA 3OPZH 4OLWL 3GMMB 1QRNB 2BY1A 2ZUQC 3OR6A 1UH2A 3IETA 1AD9B 3VD7A 5L88H 1NMBH 4M4PA 4PJXF 1GOFA 4Z7QF 1FFRA 3T0AA 3ZHKA 3DSNA 4YHLH 1NEZB 3UYRH 3SE4A 5ICYA 1EHLL 5KSVB 1FFQA 5EC1B 1KCUH 1JPGA 1RK1A 4PTTA 4F9PC 1OTUC 1AKJA 2W9DH 1FN4B 4Q6IC 5BRZE 3AS0A 4XVJL 1FN4A 1NBQA 4BSVB 1JPFB 5J12C 1UZ6F 3U0WH 2HTKC 2WQRA 3VFWA 4JHAL 4Q7DA 3CFJB 3ABZA 3MRNA 2O5ZL 4P23B 2N4IA 2YSSA 2BSSA 4LU5H 1QSEB 1QRNA 1WFTA 5D71H 4HLZH 4D0BB 1AHWC 3FB8A 4JJHA 5GS1A 1QPPA 1CXFA 1KBGL 1ONQA 2ZKHL 3VRJB 2FB4H 1RHHB 5GS0L 5D1QA 1EEZB 3DRQB 4U1JB 4OZHE 1Z9LA 2NZ9D 2A6IA 3HMWL 2MMXA 5GS1C 4YHIA 1F13A 2AJZA 5FYLE 5KSBE 4OGYH 3K3QA 2VQ1B 1OARH 3LS5L 4LARH 2EC9U 4NM4H 4GG8B 4AIZA 3UC0H 3BE1H 4YDJB 3MUGA 3VXTA 5EWIH 4Z7UB 3T0EB 4OM0L 5F3HB 4QXTB 5C86A 2DJSA 4XVSL 1P84K 1BQHB 2P44B 2CIKA 4JGMA 1XIWC 3NIFE 4KK5C 1KIQB 4HAFA 5CZXC 2BY3A 5DJ0B 4PGEA 3P2TA 5EOTB 3CCHA 1S9VA 4Y4HB 1EEZA 4P46C 3R8QA 4UV4H 1A64A 4PJAF 4G8IB 5FCUH 3GSXA 4NRXA 5B39B 3RX8A 3R4DA 4IMKC 2BVEA 2V7HA 4DFIA 1KIRA 2HFGH 4XNXL 1OPGL 3AS1A 1TZHB 2ADJB 1G6RA 1U8KB 3I9GL 2YUVA 4TN9A 1XCTB 1T5WB 2XQBH 3PDGA 4PREB 2XKUA 3T3MF 4GBXB 1FVEA 4HDIA 3MX0A 4BUGA 2HN7A 3P4LA 3X13B 5FYKL 3G5XB 3W0WA 4ZQKB 1IC5L 4M93C 3X12B 1QA9A 2B1AL 2C1PB 4N8PA 4ODTL 3A6CL 4XPTL 3GSOB 2MSPA 5C9JA 3QEGH 2AEIT 1MI5D 4Z8FL 1NFIB 3WHE1 1XH3A 4KROD 4G6FB 4JM4H 5DJDB 1A4KB 5GHWH 4JHWH 4DZ8A 3GNML 4LIQH 1KJ2L 2E8ZA 3TO4C 4NPYB 3TNNA 2WIMA 2VISA 3DVFA 1SBSH 5ALBH 3C6LB 2ARJA 1CLOL 1EFXB 4RFOH 4FQIL 1NUNB 4ZXBA 1T0NB 3S35X 2D7TH 3RIAF 1RIUL 4O4YL 3WJJC 5C0RH 5CCKL 5L0QB 2A73A 3FONA 1IMHC 5GSRB 4K9EC 1TETL 5CGMA 3WD5L 4QHLA 4F37F 2EDOA 1MY7A 5FGCE 4POUB 4KRPB 3MFFB 2Y25A 4N8VA 4FQIH 1MCLA 1F6AB 3KLDA 4Z0BH 3VFNA 3AVEA 4M7JH 3SOBH 4HWBH 3RWCB 1TJGL 1CXEA 3O6ML 4FXGA 4EIZC 2X4TB 4WHTA 1OLZA 4JQXA 4Q6IB 4GMSL 5AYUL 3O2WH 1YECL 3F7YB 3HC3L 1KYOK 4NO0A 1IEBA 3ZYJA 2EC9T 4F9PA 1FGVH 2XTJB 5FKPB 3HR5B 2ZP0T 3RA7L 1QUNA 2I5YL 2P5WD 4YHNB 5I66B 4JFDB 4I18B 3O8XC 4JM2A 1D7FA 1TQCC 5T5NF 3QB7C 2MCG1 4EZMA 3ZSSA 3ISWA 1FNGA 1JHLH 4KTEL 1DEEA 3ELAT 4R4ND 4LSQH 1MJJA 3H7BA 4Z7VE 4O58H 4PJCA 4KUCD 1EGJA 5L2KA 3MNZA 2V2TA 3FL7A 3NCEB 4PY8J 1OSZB 1S7UA 1UWXH 5IQ9A 3P4NB 3QXDA 2DBLL 1HSBA 3PXHA 4QOKD 3VE0A 4YBQD 4I77H 4U1NA 4GXUN 1X7QB 4CN1A 1JGLL 4KWUA 3O3AB 1SEQH 3ZT6A 5DQJB 4B0MM 5BRZA 1RZIA 4MVBC 4HMDA 4HS3A 4OZFB 1MCWM 4DVRL 3F7VB 4FZEH 5CMAB 3NAAH 1MJUL 4PB9L 5D7IB 3NPSB 4N0CC 1FNAA 3O6KH 1MIML 4JJ5A 4PJDF 5GRUH 3ILPA 4MS8C 4XPAL 5E2WL 5IF0B 2YS4A 2R0LL 4PRPB 5D7KE 3P4MB 3REVB 1J8HD 3LOWA 2VZ3A 4UTAL 3MJ8A 1X6LA 2ZG3A 1G6RL 4JO4L 5CWSB 1HWHB 1RJLA 2HN7B 3G6JA 3ZTNH 4PR5A 1FFNA 3MQIA 2UWEB 4UQ2A 3R1GL 2ZCKL 3ULVE 3U4EB 3IFLL 3D3VA 1A4KA 4L8SC 4NM4L 4P57A 4X4MA 4QWWD 3EOAB 4JPIB 3QEHA 4KK6D 2PCPA 2PXYA 5EU4B 2D7TL 1HZHH 4ONHB 1BAFL 3LHPL 2BVPB 4LLDB 4QHMA 4Z7OE 5IMMB 1R0AH 3DO3A 4Y19B 3ORJA 3U36B 4JZOA 2P7TB 2Y72A 2RB8A 3E8UL 4KKAC 1T66D 3PHOB 5JPMB 3U7AA 3NIFF 2QSQA 1JNJA 3TA3D 3AMLA 4IM8A 2A6DA 1RJZA 4M93B 4N0RA 2QKIB 1CDBA 3JWOC 2AXFB 1V3JA 2JLLA 5DUML 2J1KA 4HCRA 3BAEH 3V79C 1GIGH 1H3XA 1A7OH 1Q0YH 4G8IA 3FQNB 3HI6H 1G7QA 3SJVB 5L0QC 4JRWA 1SJEB 4PLKC 2YA0A 5KANI 5EO0B 4ZS6C 4ISVA 5F7NC 5CIPA 4LSUH 3K0WA 1T22A 5DK3A 4CNIA 2P49B 2YC1B 5DI8B 1KEML 4X6DF 4I0PC 2WLZA 3FFDB 5FKAA 4MQXC 1H5BB 4NO5A 4HXAL 1G9MH 3H9HB 3P0VL 4ZUWB 2HA1A 5A40E 1DUYB 2BNQD 3QRFM 4U1SA 5HYQB 2FEDD 2VDQH 1N5AB 3RWFB 3W81A 1K9TA 4PJDA 5LGHL 3MV9A 4Z76B 4QLRA 5HHME 1SEBA 5I1IL 2MPAH 4M43L 3AFLA 1W72B 1QFHA 3RFZC 4L4VA 2CXKA 3V4PH 4FTVD 1KCKA 5F96L 5FIEA 2FATH 4PJ9B 1MELA 1DBMH 2DF3A 3QRGL 3KNBA 3DUUA 2YZ8A 1KJ3H 3GRWA 5DA0B 1BD2E 5FA4A 3EJZD 5FYKH 5IM7B 1AXTH 1DBKL 1CK0L 1MF2L 3O9WC 5CSBA 3BEVA 3X14A 2HJLB 4TSAL 3WFDL 2WQ8A 4MXVE 1QLRB 1R5VA 1FO0L 2A1WH 2KUTA 4G6MH 2DKSA 4Y4HC 1KIPB 1PG7H 3LKPB 3U9UA 1DLFH 1IT9H 3PL6A 1DL7L 4OI9A 3BH8A 3MJ6A 2B1AH 1ZVHA 3QPXL 1OP3H 2MHAB 3KPLB 4MMZC 5DEGB 3SDYL 3GJFK 4Z78B 5IVXA 5H2BA 2CKBL 1HINH 1XF5B 4PJBA 4UTBL 3WXVL 1CR9H 4IDJL 1KPUA 5ESAA 3TN0A 1D5IL 3NH7L 4JKKA 1Y0LA 5E1HB 4CGTA 4H5SB 2PYEE 4G8GA 1IC4H 2Z91A 1LVEA 1FH5L 1IAIH 5F88B 3TA3B 3GUTB 4RQQA 4PJHA 4M6OH 4DKDC 5DVMA 8CGTA 3QJFB 2RR3A 3D85D 1C08B 1EIBA 2VDNH 3FQWA 4M1DH 1GGCL 2W9EL 4EN3D 4PUBL 4JKPL 5ADPL 1QP1A 3BXNB 3DV6A 5B4MD 3TBYA 4UB0L 4BQ9A 2FBJH 4OBSA 2AJ3A 3QXUA 2ID5A 1ONQB 4CU7A 4XBEH 4ZFGL 4RWYL 3BW9B 5EIQA 1IM9B 2ED7A 1C8PA 1DBBL 3MV9B 4Z76A 3EYUH 1IVLA 3HMXH 3GGWA 5L8LB 5E2JA 2YOCA 4JKLA 3OPZL 3DUHA 5DFVC 5J0BA 2E7LC 1A2YA 1JRHL 1H3PL 2N1KA 3EDKA 1AGDA 1SY6L 1OL0A 4MXQC 3C08L 5FV1L 1RVFH 2JCCF 4XNXH 4YGVB 4BSVA 2EZ0C 4K3GA 3OMZA 3QIWB 5KVDL 3A6CH 1F4HA 1JI2A 3PUCA 5B3NA 4XMPL 4APQA 4JPKL 1P5UA 4KZDL 1WZ1L 3HZKA 2IGFH 3BIBX 4QCIA 2ADJA 3WKML 4HXAH 2X40A 1KB5H 5MHSD 5IOPB 2FX8H 3BP4A 4PP1C 2O5ZH 2DQTH 2YZ1A 3MXVL 4PS4H 2FEEL 5I2IA 2FHBA 2XQBL 3QRGH 2WWMD 2ICWA 3O11B 1F90H 2W60B 1NAMB 2CUMA 4IOSD 5D6CB 4XP1H 4LCWA 4J4PA 3BPCA 4P2OC 3ROLA 1NCAL 1U36A 3JV4A 1YEHH 3S8WA 2HH0H 2IANA 5E94B 1O7VA 4WFED 3NA9H 1CGSH 2R23B 3GMQA 1HILA 5F72S 4JE4B 3G5ZA 3NPSC 1T1YA 3RVUD 4JFQB 2BMKB 1DLHA 4HGMA 4ONHA 3PWLB 4MD4A 4PGBB 1PYWB 4ELKA 1UYWH 1BZ7B 2W59A 4HFWB 3QHFL 1CGTA 4GSDL 1S9WB 4Z7UA 4JFDD 4P3DA 4LSRH 5CFHA 2LE9A 3DX7A 4WO4C 3BPOB 1FAIL 2PYFA 4DW2H 4C58B 4U3XA 3LH2L 2AJUH 3KHQA 1NSNL 1HHIA 3LHPH 1X4ZA 1EFQA 2P5EA 1MCIA 4GSDH 2E9WA 2BNUA 4ZAKB 3ZKNC 3DYPA 3DGCR 1ZANH 3KPRB 3QA3A 4CMMB 1KPRA 3VFOA 1HEZA 2OSLA 1Q38A 5FHBH 2CKBH 3LS4H 2NR6D 3PDDA 1HWGB 2QSVA 4NQSA 3HPJA 4PJHB 3FQUB 2APTA 1KENH 4JFED 5F88A 1CD1A 3D39B 4OQTH 3T1WA 3V8OA 1S5HA 1BGXH 4GJTB 3V6OE 1G7MA 1UWXK 4M1CD 4A6YA 4ZUTA 4HFUH 4JFPB 4PFEA 5TQ2H 5HGHB 5EH1A 3VWJC 1BQLH 2VLRE 4NQDB 4D9LL 3KPMA 4CADA 2OQJA 5BO1H 1JNNL 1SJVA 2NLJB 4EIGB 4MA7H 4OZIA 3H9HA 3S36X 3ECBB 4Y4FD 5IROC 3FOMA 2JELL 4XVTH 3LAFA 1RAMA 4GS7C 2J3SA 5A3ID 3BAEL 5F7KC 1KJ3L 1NC2D 3PL6B 4NHUA 4W68A 4WGVB 3TPUA 3SGKC 4P5MB 3Q3GA 2D2OA 3C6SA 3L5IA 1YJDH 3K4ZA 4EBQL 1FGNL 4HIXL 5FO8B 5JZ7D 1MRCL 5IKCA 5C0BE 1ZOXA 3BESR 5ESAB 1YNTA 3N0PB 1GC1C 3VXMB 3PHQB 2HYMA 5HGHA 3O8XA 4JM2C 1QFWH 1MQ8A 1WK0A 5CEYB 3MLUL 1EDQA 1R5IB 1ZGLB 2NY4C 3BZDA 4S1DD 4CJ0A 3D9AH 4P2QB 1NUFA 5J4MA 3MV8B 1HYSC 1Q72L 3RUGA 1CGXA 3FT4A 2VLLB 2F8OA 4OFYD 5SWQA 1A5FH 3PNWB 2Z4QA 3G5YA 4NO3A 2FGWH 1F6AA 1MCHA 2DN7A 3LB6D 4M43H 1CU4L 3WFZA 4OZIE 1OAZH 4W70A 4UTAH 4IS6B 4ZNEA 2P5EB 3TO4B 4TVSa 2J2ZA 4BH8B 4YEEA 1MAML 2OL3L 3ZDYE 5GGTL 4WUUD 3PV6B 3WIHA 3DETC 4QHUA 4FFWD 2B4CL 5KW9L 4X98B 1ZTXL 5T3ZD 1S78C 2BSTA 4KRNA 3D69A 2QHRH 4GAGL 4JFQA 3VGFA 5CEZL 1PEWA 2A6KA 3BH9A 3QQ9D 3RWGA 5CHNA 5BJTA 1JUFB 2I07A 2X4NA 1YNKL 3LKOB 4NKMB 1U8NB 3HE6A 5DUBB 5DR5H 4TPRL 2LU7A 1DQLL 1F4YL 5SWSB 5C2BL 4NO2A 3PJSB 3JVGA 2GSIB 5FUOL 1A6VH 4CKVX 2YEZB 4I0CC 4ZG1A 4O2CA 1XAUA 3OJMB 1ZXQA 5GGUA 1JF6A 4XPFL 5CZVH 4U33A 5CIPB 5I8KL 4JR9H 5B8CC 1LO5B 4P4RB 3SCMC 5HBBA 4LKCB 1WFNA 3X3GH 4OM1H 5C6TH 4KKCC 3D85B 3GSNA 1BVLB 4DQOH 4E42A 3QDGE 4JFPA 4IDLA 4ZUTB 5D7LB 2CR6A 5KSBA 4OCRH 4YR6B 5DO2C 2PF6A 5IMKA 4XPGL 2JKXA 3RDTB 4EUPB 4FFVC 5CGYD 1LP9B 2AJVH 3KPSB 5CBAA 1I3GH 2C3XA 4O2EA 5CD3A 1U8NA 1RURL 2ERJB 3HE6B 5F1OB 3HNSL 4AL8L 8FABA 3T0EE 3IJSB 1RUAL 4LDOB 2BCKA 3P0VH 1MRCH 2DLGA 2NW2B 3QDJD 4YIQA 4UOW0 1KB5B 4OF5A 5JIHA 5CEZD 1CTOA 4HIHB 5HPOA 1E4XI 2BSRA 4CBPA 5I15L 4MMXC 3ULVL 1EZVY 3PP3K 3SY0B 1ITCA 4Y5XB 4P9MH 3ARED 2Z35B 3L3OB 3V7AG 2NY4B 3H0TA 4O9HH 5EBLA 5BMFH 1CE1H 3K46A 3MZGB 5I8OL 1I7UA 1YJDC 1R5IA 1ZGLA 4WW2F 3B2VH 3MLRH 1JWUA 1KYOJ 5CEYA 5KVFH 3SO3B 3RGHA 4RQQB 4LAQL 5DVLA 1I1CA 1OT2A 4LASL 5E6ID 4FQXB 1NAKH 5L2KE 2AVGA 2JB5L 3HI5H 4HX1A 2HMIC 5B8CA 4HW6A 5EBWB 4K7PY 3VE0B 1KPUB 1PJ9A 1NCDH 1U3HD 3QUMA 5HVFB 5TFSL 1T5XA 1OSZA 2NTFB 1PGRB 5F44A 4YBLC 1HKFA 1QKZL 3THML 1F4XH 1PQZB 1OARL 2FHCA 4NZUH 2CLVA 4WIQA 5IB2B 1X5XA 5I1GH 3QNZB 1AHWA 1EXUB 3VD4A 3QIUC 1Y6NR 4MWFB 4NCC1 1BEYH 3W2DL 5AUMA 4PJIE 1VADA 3L95A 3IXTA 4U1NB 3OF6D 3QDME 3UJTL 2P46B 1G0DA 3DECA 2VWEE 5GRJH 5C0RL 5BV7C 1A6PA 1CLZH 1F2QA 1WWWX 5CUSL 2BVOB 1P7KA 4LHQB 4EDWL 1MNUL 1RZKL 3H9SE 2E8YA 3NFNA 3FOMB 5DXWA 3UX9B 2GTZA 1K4CB 4K7FB 5DMIL 1J1OL 1HNFA 1SBBA 3OKDB 4AT6B 5D9SA 5DTFB 5E7BA 2XG4A 4PJXE 3VXSA 4PYHA 1YYLH 1WBXA 3N1PC 4OM1L 5C6TL 1FJ1A 5I1AB 3DXAE 3BT2H 3FQTA 2R0KH 1PD6A 4E41B 2JF1A 3V5HB 3WFBH 2VAAB 1Q9WA 2A74B 3LV3B 3FN0L 1KT2A 1JWSB 3AAZA 3QAZC 4Y8AA 4I77L 4JPKH 4CVUA 4YHPA 4NN7C 3U4BL 2OMBA 1LK2B 2VZTA 4G8GB 5BO1L 4Z7WA 4G6KL 3OGOE 5B3JE 3BJLA 3TLRA 2IPUK 4KKCD 1DFBL 1XF2B 3S5LG 4MDIA 5E2VL 5KSUB 1NKRA 3D0LA 1V05A 4K3DL 2HFGL 4I1NB 1MRFL 4XNMB 5DEGA 4GG8A 1CDIA 1KTRL 3BEWA 2BHZA 2R2EB 1KB9K 1F3RB 1IM3B 3PGFH 3HCVB 3PWPA 4NYLB 2ITCA 1SBSL 5ALBL 1IAOB 1A6TB 3MBEA 3P0GB 3NACL 5C92A 4KMTL 5IEHB 5ADOL 4NC2B 3RTQC 3S7GA 3B6SA 4P5TC 1KTLA 3MA7B 2OBGA 4FNLL 2P5EE 1F58H 4CVWA 2A0LD 3FQXB 2EDRA 5DDHA 3QEGL 4BKLB 4F7EA 4PRID 1A5FL 1AI1L 1NGQH 1CI5A 1UYWL 3RPKA 3LS5H 5DUPL 3VFSB 4GW1A 1G7HB 5FF6A 3HZKB 4W4NA 1KB9J 3LEVL 1FRGL 2BXZA 3MRDB 2BHUA 3Q48A 4K3JH 4L4VB 5A2FA 4P2QE 3HE7A 4GS7B 4X5XB 1CQKA 4WRLA 3OKMB 5C07D 4LHUG 1GSMA 1MFCL 2VDLH 1J8HE 3C87A 4YFEA 4I3GA 4I4WA 3QCVH 1K5NB 1UXSA 5JHLL 4YUEL 1PYWA 4Q2ZB 3T0WA 1MFEH 1OGAD 5GJSL 5FHBL 3EZJB 3SKNB 1EEYB 2XI9A 1ZV5A 2DQHL 1YEIH 3QIWC 3T8XB 1DN0A 4XGZB 1RUQL 5D4QA 5IVXB 1H15B 1J0IA 1MCKA 5CILH 4Z7VA 4HFUL 1MFEL 3G6JE 4PJ7F 4Z0XB 2MHAA 1HE7A 1HSBB 3UYPA 1S7UB 5IQ9B 1FJ1B 3MNVB 5BQ7B 2IMMA 3L5WB 1MCQA 2NY0D 2DQTL 5IW1B 1HXYA 3VXMA 3BKJL 1N8ZA 4TQEH 1A1MA 4WI4A 5HVHC 3Q5OA 5FYKE 3KPQA 4F7CB 1QRKA 3DLQR 3C5SA 3RAJH 5FO8A 1MLCA 3QPQC 3NN8B 3SCMA 4OUUA 5T3XL 3VXQB 5EN2A 9CGTA 1FHGA 1ZT1A 3PWUA 2BRRL 3MUHL 5IW6A 4YHPB 3VWJD 2WUCH 4LHJB 3EJYD 1VPOH 2GITB 3VXME 3WDIA 3ZTNL 5IBLC 1YEKH 2NYYD 1CGWA 3QFJB 5BCAA 2D0HA 1JYVA 4UBDC 1KPVA 5SX5H 3HTLX 4ODUB 1KIPA 3LKPA 5ACMA 3STBA 1JNLL 1Z0MA 2OXGA 2NW3B 2YMXH 5B4MC 3GJEB 4LLMB 4R96A 2DYPA 5BZWA 1KELL 4CU6A 5ILTH 5GS2H 1LHZA 1QFPA 5IVNA 1OM3L 3GJFA 1I9IL 3VU2A 3BDYL 2PETA 5EBMA 3WNPA 5F9JA 2OSLB 1IGCH 3QIUD 1D9KB 2RCSH 5TDNB 4M8QA 3EO9L 1LO0L 2J8UF 3ARGD 4Z9KB 2IF7A 2ATKB 3LZFL 1FNSL 3U0TB 3WUZA 4EI5C 3B9EA 15C8L 2FJHA 4M6ML 1WCQA 2VXVL 1INDL 4R26L 3FRPG 1U3HC 3EO9H 4M4RA 5SWZE 3X3FH 3RVUC 3L9RB 1DVFD 3T4YA 1PZ5A 1PY9A 3RX5A 2ZG2A 5JW4Q 2YXFA 2VLMD 3DVGA 4OZGA 1UWGL 2X1PA 2EH8L 3LMJH 3AY4A 5TDPB 4QXGH 4HF5L 2IAMD 1JV5A 1NCUA 4R2GB 3RBSA 1ZA3B 3FO2A 2DDQL 4DK6A 3O9WD 1DSFH 1ND0B 3LDBB 2PTVA 2XWJA 4YUEH 3IB4A 1ZLSH 2CH8A 5D72H 2JIXA 3HN3A 3SKJL 1FVEB 4LSPH 4PRNB 4U6YA 4MJ5B 4XH2A 4BA8A 2VDLL 4LCWB 1VEPA 4MA8H 1NJ9A 4UAOC 3KYOA 1A7RH 4GRMB 3SPVB 4OCYH 2ZSVB 2V17L 4QRRA 2VLKA 4U1IA 5HGBB 1MH5B 1WSST 3I6GA 2BJML 1X4YA 1OSPL 5GJSH 1QPXA 4OQ1A 5FGRA 5JZ7C 5F96H 4LSUL 1KLUA 2DQCH 4UQ2B 1YPZA 4JO4H 3SDDD 4RFNC 1LE9B 4O2FB 3MMEA 2DAVA 3MRJA 1VKXB 4XCNB 5IVOA 4BZ2L 1A9BB 1QG3A 4RGNB 3T1FA 3LEYH 4LIQL 2DLIA 4OKVA 2R29H 4MSWB 1AGDB 4TUJA 1FNEA 3ARXA 4A6YL 2IG2H 4U2ZA 3TPKA 4JJ5B 4YHOH 4BH7A 1FIGH 3HI1A 1HHHB 4LCWE 5HHVH 3O0RL 2JB5H 3CMGA 3NCFB 4NC1C 1B3JA 4NPYA 1E0OB 4M3KB 4X0KA 5GS2D 4OLYL 4LP4A 5HYFA 3O45B 4MD5A 3H8NA 5AD0B 3O4LA 3TO2B 3O3DB 3PHSA 3WFDH 1SJEA 3QWRA 4KC3B 1S7XA 4G6ML 1VACB 2FWOA 1WZMA 2BC4B 5A2JH 1E6OH 1QO3A 5D70L 5GGUB 3O6MH 4MSWA 4HGWB 3KYNB 5SWZD 5D2LF 5EZJB 4UDUA 2APXA 3ULSB 2YHGA 4WW1A 4WO4D 5D7SH 5I19H 3F6LA 4TNVF 3D18A 1GYAA 1D9KD 4JLRB 3S37H 2JIXB 2XZCL 4DK3A 2AEPH 2PO6B 3RUGB 4MCYB 3WJJA 2VR9A 1KJMB 1MFAL 4LPYA 3LB6C 3KXFA 3TVMA 3P4NA 4XWGH 5AG8A 4P2OB 4OLZL 4QT5A 3BD5A 4U1IB 4GG6E 1F45A 1J11A 5F8RC 3WEXA 5JW4N 1I8MB 5LVEA 3PDOA 4Y4KA 3G6JF 4PLJC 1AGCA 5F71A 1AC0A 2CUHA 4YC2C 4P5MA 1HXYB 1U8LB 5IFAH 1N26A 4GO6B 4Y5YB 4NO3B 1RZ7L 3MNVA 4Q9RH 1DBAL 2EICA 2CK0L 3UDWA 1DP0A 3I6LE 4PJGF 3HG1E 4LSPL 4FABL 2UUDK 4GW4A 4LCCC 4LLWA 5E8PA 4I2XB 5KSAD 1KCVL 5D2NE 5MENB 4RAVB 2LFGA 1BD2B 3WLWD 3U1SH 3OXRA 1MHCA 4PGZA 1JGDB 2NW3A 5L8JB 4C55A 3RZCD 1IKFH 1PLGH 4Z5RA 1AY1H 5E6YA 3HI5L 1V7NL 1IGIH 4WWID 5LCVL 3JTSB 1A9BA 2ZUXA 1CDCA 3C5ZA 3HE7B 4H1LA 5DMGC 1QKZH 1J0KA 3S36L 1YEJH 5CJOH 4ZO6A 3GMPA 1QQDB 4E41D 4P4KD 2OR7A 1NL0H 3FB5B 4JRXA 4PJ9D 4BSWA 3TA3C 3KWWB 3N9GH 1OD9A 2YA1A 3CC5B 2V5TA 2CQVA 1TCMA 2LAGB 4BKLA 4LEOB 1KPVB 3BVNB 1IM9D 3QUXB 3E2HB 1T3FA 3PV7A 4P5KA 5DSCA 3U30B 2R0ZL 1ACYH 4K9EH 4F8QA 4U1KB 4HDIB 1G1CA 2FO4A 4PREA 3V0WH 2GFBA 3TH2T 4U0QB 1KLUB 3H9YA 5F8QC 1INQB 1ZGLP 3JSSA 3BQUD 3IETB 3RL1B 3DX9A 1PBYA 4FFYL 4UDUB 3EYSH 1UT9A 5IW1A 1AO7B 1UZ8A 3HC0A 2Y7QA 3KAAA 1UM5H 4XXDB 5B38B 3VWKC 2W0FA 1NLBH 4PGCB 1RZFH 1H5BC 3IJHB 4EJ1C 5HD8D 1U93B 2V9RA 5IT2L 4TTGA 1QLEH 2UYLA 3HS0A 4R8WH 5SX4I 4KI5F 1JN6A 3EYFB 4LRNH 2DQFA 5D8JL 4EI5B 1DLHB 1F4YH 1RUPL 2B20A 2DJUA 4XHJC 1U2HA 1AD0A 1A6VL 1QFUL 2VDOH 1LDSA 1JHKL 1WJ3A 2QLVB 1FFPA 5EIVA 1X44A 2R0WH 1UB6B 1KLGA 4AZ8A 43C9A 4EXPX 4J1UB 1QSFD 4TNWK 2J8HA 4OCLC 3J7HA 3KLAA 3TBTA 1UM4H 5ICXA 2ICWB 3O11A 3JWOL 4L8DA 2NCMA 4OJFL 4Y16D 1HXMA 1K8IA 4U1LB 2WLYA 3DGGA 5KSBF 1BOGA 4YGAB 4NQED 4AQ1B 4KVNH 3HAEH 4P59L 5FGBA 5HJ3B 1FORL 4F15C 1U8KA 5EOCL 3HNTL 2R56L 3AROA 4MB3A 1J0HA 5EA0L 3MUY1 2QQLL 2L7UA 5GHWL 4MHHI 2HT4D 3MNZB 1X5IA 1GRWA 5IB5B 5GZNC 3ULVF 3IVKB 3VFMB 5GRYA 2MWCA 1T7WA 3QUXA 3WS6C 2ITDB 4EN3C 1NEZA 4OLWH 5ICYB 3TBVB 4X7FC 5I74B 25C8H 4NQEE 3I84A 4NQCE 3FOLB 2F53A 1IGTB 5T3XE 4JANB 1CD8A 2E6QA 2JCCA 2JJSC 5F70A 2XQYG 3H9SD 4QRTA 2ESVE 4X5WA 4TSCL 4M62L 1MPAH 3KPLA 4WTZA 2WSKA 4P0DA 1XZ0A 3JUZA 3JV0A 3QHZL 2CRMA 4KKAD 3MOAL 1WZKA 4P2RB 4LL9A 1MSPA 3QDMD 1FNHA 4OM0H 4C56A 1PEZA 4I48B 4UT7H 3CPLB 5ANMA 2OCFD 3Q1SL 5I1DA 5E00A 4UNTA 3LN4A 2FJHB 4GRLD 4IRJA 5F7DB 5E03A 2JJTC 3HRZB 5AG9A 5JIPA 3IS1X 1RQ5A 3J8F7 3BISA 3QULA 4QWWC 3MRIA 4WJ5B 15C8H 3QI9A 1LP9E 3NBNA 1OAQL 4J3UA 3TJHD 4NJAH 1INDH 4N68A 1XR9B 3H6JA 4Z78A 2BNUB 3U79A 1HHKA 3BOVA 1BVZA 3H3BC 2P8LB 3LPFA 4MJ6A 3BH8B 1KIUA 3DROA 4OD3H 2WIIA 1S7SA 4NRYB 2DYPB 5D7JD 3IRZA 4TULH 4NKIL 4ZFZA 2D9QB 1LE5B 1OAUL 2I26N 3ROOB 4OAWA 2VN7A 4XCYA 1ORSB 2R2HB 3KPPB 1WAAA 3SE9L 1QLFB 4JFXA 4WWKD 2KZWA 1MEXL 4LVOB 3LQAH 2IBBA 4ELKB 3RDTA 1FZKA 5EZOH 2H1PL 3GK8H 1GAFL 3WIFB 2VRAA 3X13A 3E6FA 3D6GA 4ZDHB 4DN3H 2IANB 1ZHBB 2VL5A 1MEXH 3UPAA 3ZL4H 4P2QD 2YN5A 2Z0BA 5HHPA 3SDAC 4ODHL 2Q76A 3C6LD 5EORL 4LCYA 3ZDXF 4L9DA 2H32B 4G43A 1BIIA 1K8DB 2EIBA 3QG7L 5DC0A 3HRPA 3NZHL 2AXFA 4C4KO 1U8MB 2H9GB 2HJFB 4R7NA 5CZXD 3ZKSD 3ARPA 3KPNA 3QI9C 3PGCA 4ZUWA 3VD9A 3QR2A 3B8YA 1CXLA 2FB4L 4MGXA 3G6DL 2BC4A 1WCBB 1CG9B 3STZA 3VI4E 1FYTB 4KHXL 4PJGA 3TP4A 4UNVA 3IJSA 3OHXA 3MGOB 5EOQL 3THMH 2IPUG 4DAGH 3S88H 4P46B 1FLRH 4GAYB 4L3EB 5JR1L 3IDYC 1HHJB 5I75B 4B50A 5BS0A 4YDIH 4QO1A 3P9LA 4PJ8B 1QSEE 3A67H 3OB0K 3P9LB 4ODXB 4F2MB 5DD1L 4Y5XA 1JZ4A 2J12B 3ULUF 3PL6C 4GQ9L 1DEDA 4X5XA 4LCIH 1IQWL 4Z7UF 4OSUH 5DWUL 3OAUH 1KTKE 2A38A 3BN9C 1HSAB 2OTWB 3RL1A 3VDBA 5E4EC 2QADD 5KG9A 4HXBL 3DTXB 4OGAD 1LO5A 4WFFE 5GIRB 1QFWM 2W0LA 4QHNB 2IQAB 5D1QD 5T1MA 2ZUVA 3PXJA 2OI9C 1IFHH 3TO4D 3F5WB 3GSVB 2W91A 4Z7NF 5T1KA 1AGBA 3P30L 1D3CA 4U3CA 4NO2B 3CFEB 3MA9L 4ONFH 1FFOA 4OZHB 5E70A 1AFVH 5DMKA 3ZZ1A 4K55A 3OJDB 4HBCH 1F8TL 1UWEH 3GIVA 3SKOB 5HHOD 2DM3A 5F1NA 5JW4M 4U3HA 3QJHA 4ZPTB 2DD8L 5KZCB 1TPXB 5GRUL 1ADQH 5I18H 1LP9F 1G1YA 1RUKH 1XGQA 3ZE2E 3D2UA 1PLGL 4NUGH 5D1ZA 3NGBC 5GRZA 2Y07L 2DQHH 4JAMA 4XB7A 3U83A 4M7LT 3M45A 3GO1L 4WI5A 5F7HA 1YY9C 4OF0A 5C8JB 4LOUC 5HVHB 2C4FU 3GSRB 3QO1B 1RVFL 1X5JA 4FP8H 3V6OC 3EOBB 5KJRL 3TVMB 5KS9E 4HBQA 1CIDA 1FORH 1EBPA 5GRWA 4HIJA 3OB0H 3I3EA 4W6YB 1DQJA 1QRNE 5H8DA 4RMUA 2CMRH 5HDOA 3QIWD 3RWIB 1I9EA 4TYUA 2HLFC