3MA9H

Crystal structure of gp41 derived protein complexed with fab 8066
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
214
Chain Sequence
b'QLVQSGAEVKKPGSSVKVSCKASGGTFNSYAFSWVRQAPGQGLEWMGSIIPIFGTTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYFDTYNNYGFANWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transmembrane glycoprotein
publication title Structural Basis of HIV-1 Neutralization by Affinity Matured Fabs Directed against the Internal Trimeric Coiled-Coil of gp41.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 46
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ma9H01
4DOHE 2DYPA 5EBWB 2VJXA 2XTJC 3GSNA 2NY6C 3F7YA 2QADB 4Y2OA 1CGYA 3UPCA 4PV8A 2AEPL 1FIGL 1A1NA 4QEGA 4JHAH 5C0CE 4N0FA 4PJDB 4TVSa 1QSED 2OXHA 4I77H 5EDXA 1TJHH 4I0PC 1EVUA 3DSFL 3ETBF 5I74B 1V7NH 5E99H 5E95B 1NFDE 1RI8A 4OCWH 3P30H 1S5IL 4BYHA 2DKUA 3G5XA 1KJ3H 4N9GA 1B0GB 5CSZB 4EJ1C 4JO1H 3QIWA 4LDEB 5I1IH 5JOPD 1JGUH 1JN6B 4DN4H 3O3UN 3C09B 1CD1B 1X5AA 1WZMA 5I1CH 1YNLH 1QYGL 2C1PB 3QUZB 1P2CB 1FGNH 1WBYB 4G6AD 3T0EB 2CPCA 3IFLL 2VDLH 5F9WC 4APQC 1ND0A 5FXCH 4N8VG 1FIEA 2D3VA 4N0UB 1EO8L 3WHXA 2CRIA 5EC1A 4P4KB 2XT1B 3SO5A 2B7DT 1NCBL 4KJPD 4PJHB 5GGSY 1HH6B 1QQDB 4JO4H 4ZTOH 5K9KA 2BNQA 5BVJB 3HLAA 4LVHC 1HE7A 4HK0B 3QA3B 3UXFA 5EA0L 3QXAB 1QSFB 3WFEL 2DQGL 3V7MA 4IOSD 3BZ4A 4WU7B 3RNKA 2H6PB 2YRZA 2NY7L 4YPGA 2FHCA 1K8DB 3C5SA 2UZYB 2NY5L 4XNYH 4WV1C 1A0QL 1A1OB 5EBLA 2Z8VC 1KJ2B 1NBQA 2DWEB 3LKRB 5EO1A 1XMWA 2LAGB 3ARED 4QF1B 5GZND 3RZWA 4ODVH 3QUYB 1AQDA 2R39A 2DL2A 1ZS8A 1IE5A 3QPQC 3CFDA 3QDGA 3ZKSD 2XZCL 3SGJA 4S1RL 2VISB 1F58L 5DEGA 3GKZA 4XCNA 3WLWC 1XEDA 2QHLA 2AQ1A 2DQJH 4HG4J 2I9TB 3D0LB 2F54D 2R69H 2YZ1A 4MSWA 5JW3L 3ARDB 5F70A 4X6EA 4UILL 3GSVA 4WFFE 1BQHA 1VEMA 3FO0L 5DRWA 5JHLL 2FSEA 3JTSB 3L3JA 5HYQA 3FOLB 4EN3C 3P77B 4HQQL 3B4NA 5IROC 1KXVC 5JOEA 35C8L 4MAYC 4RRPA 1WK0A 3FB6A 2BNRD 4NSKB 2HLFC 4H25B 5L9DH 2GSGB 2VR9A 2PF6A 1FYHB 4ZFZA 1HIML 1OSZB 3HNVL 3MV8D 4Y1AB 1JZ4A 1IAIH 3IDMB 2EDJA 4PJAA 3TBTA 1DUYB 1VGEL 4GG8A 1J8HA 1U36A 1U93A 2CRMA 2GTWA 2UZXB 2ZOKB 4R2GC 1PD6A 3I50H 5I76B 2VXSH 5DTFB 3PV6A 2V9TA 4D9LH 5FO8A 1BWMA 4GAJH 4WJ5A 4X6DE 5D93B 4ZAKC 5IB3B 4YDLB 3SKUD 5DF0A 1JK8A 4PRHB 4LLYB 1NBVL 4NJAH 3CIQA 3OKKA 2ARWA 2VABB 3UBXB 1KNOA 3VXMD 3UJJL 3S5LB 4MB3A 4QXGH 2X9WA 3SE3C 2IALA 4L3ED 2XWBB 4OCLC 3IS1X 3BUYA 3PJSB 4B53A 1JJUA 3V7AE 1NAKH 3UTSB 1IM3B 4XP4L 2WZPD 4EUPG 1ES0A 5AG8A 2AV1A 1MIEH 4M6MH 5FA4A 2OJEA 5EIQA 3AS3A 1FVEA 4M93C 3ALXA 1NDGB 4S1SH 4FQHA 4PJ8A 1I1AB 3IDYC 5EUKA 2HTKC 1FZKA 4HJJL 2XZZA 4NQSB 1A6AB 1RUQH 3QG6B 2B0SH 4UNVA 5E2TL 5T5NG 1YY8B 3NA9L 1X44A 4PREB 3MUJA 1EAJA 3OAZH 4C83A 1T20A 3M45A 3T8XB 3IVKB 1NSNH 4E41B 1FPTL 2LTQB 5DC0A 4LPVA 1NGWA 4JPIA 3HG1B 4NRXA 3BT2L 3P4OA 1JUFB 2BVEA 2NY0B 4PYGA 5C7XL 4OD3H 4L8DB 3LN4A 2HFEB 1AO7D 5EU6E 2NY3B 2KDGA 4YFLI 5IBUG 5FYKD 3ZKNC 4YLQT 1X6NA 2EC8A 5F6HJ 3KR3H 3WIHL 3IXAB 5CD3A 2AEQH 1FAIH 3MLUL 4QT5B 4ZNCD 2BFVH 2VDQL 4HX1A 3QWOB 3CVIL 1AD9A 1UJ3C 5ICZA 5IMMB 1RHFA 1N26A 4O51B 3GMQB 1QUNA 5CEXA 5EOCL 3KGRA 3FFCB 1QO3B 3WE6A 3MGTB 4QHLB 4KHTL 1I4FB 5DK2B 2FO1A 3IDIB 4PJXF 4Y16B 3N0PB 1BF8A 2CJUL 3B2UD 1G9NL 3JWDH 4N90D 1QOKA 2R2HA 2R29H 1I1FB 4YXLH 2VXUL 1NCCH 5D7SL 4AT6B 1DEEA 5AWNH 4E42B 4HK3N 3WEXB 3EFFA 1S7SA 2JKXA 3GI8L 4JFFB 5DD0H 4HFUH 2X4SA 1C16A 2W92A 1YEJH 5L6YH 4Z95H 1OW0C 4N8CL 4RMSA 1R3LB 4OI7A 2R1YB 4OLVL 3NCBB 43CAA 3V6OC 2W0FA 2MQCA 3CLFL 2VR4A 3OJDA 3D39D 4G9FE 1EHNA 3D85A 1RMFL 5C71A 4WENB 1X5KA 4IJ3B 2H45A 3WYRA 4MA8H 3U0PB 4U1HB 1EFXA 1I7UB 1X7QA 1R6VA 2X4QA 2X1QA 3KPQA 3U9PL 3B3IA 3FN3A 3RNQA 4D3CL 1AFVH 1JHKH 5C6TL 4QXTB 3C09C 1I8KB 3RPIB 3O2WH 2AGJH 5HGDA 1IGIH 5I71B 3EIFA 3RWIB 5GZOD 2VZSA 3O6FB 4K2UH 5CHNA 2FIKB 3MUGB 4DZ8B 2NTFB 2ZZUT 3K46A 1XZ0B 3PWNA 4HH9A 3DUSA 1FP5A 4WFED 4IDJH 5JPMB 5FHBL 4PRPA 3MYZA 5D6CA 3GMPB 2F8XC 3ARWA 4NQUA 1FDLH 4WW1B 3L95A 3CFIC 1A2YA 2BMKA 3EYUH 3RKDD 5F7WC 4RNRB 1CU4H 1NGYA 4G43A 2EDNA 5TJWK 1AE6L 4U1SB 4OFIA 2PXYC 3EJYD 5DFWH 5ID1A 2OQJA 4IMLB 3FT3B 1A21A 1A7QH 5EPMA 5MI0B 4GMTL 4XVJH 1MFDL 4KY1H 3ZTJH 3CSGA 1C1EL 5B3NA 1CFNA 4ZOEA 3TZVD 1DDHA 4X9IA 3ZE0E 5HD8C 3G08B 1Z3GL 4YHML 3VRJA 4GW1B 3LB6C 4JFED 4YE4L 1CDHA 1T22B 1KLUA 4XCEB 4C56D 5IOPB 2PN5A 1KLFA 3EZJB 2XRAL 3ULVD 1IT9L 4F7CB 1P7KA 3QFJA 2HLAA 1YDPA 3ARDC 4L4VB 4EUPA 3OG6B 3TV3H 3WL9B 4KTDL 5SWZD 2AJYL 4P2RE 5C86A 2AJ3B 1TZIA 2YMXL 5JHDD 3IETA 2BJMH 1HNFA 1X4XA 1RUML 5F88B 5FGRA 1II4E 5K9JL 2DLFL 3MRRB 1J0ZA 4HIJA 5CZVL 3EYVB 1I1YB 1QR1A 5IB4A 2W1NA 1FN4B 1B90A 15C8H 1G84A 3WNKA 2ZUQC 1LO4H 5C9KA 1DQTA 3UO1H 2EH8H 5D7IF 4NRYA 4S1QH 1H8OA 1A64A 1TQCC 2B4CH 3T0VA 1QFWM 4L4TD 2IG2L 1GC1C 3CFEB 3RPKA 3KPOA 4LF3A 2FJFA 4OUUB 3FO2A 2F8OA 1AXTH 4DGVH 5TQ2H 5IHLB 4P0DA 1GGTA 2PYEE 2ED8A 5HHOE 3QI9B 5D2NC 2Q1EA 5KSBF 3HPJB 3QO1A 3RZCD 4FABL 4JFOB 4I2XE 4HEME 5IWLC 4PG9A 4IHOB 2QTEA 2HH0H 5TQ0H 4NZUL 1CXHA 2GKIA 5DJAA 3IDGA 5C9JB 5KJRL 3PQYE 2EIDA 5C0FA 1CLOH 4OLWH 4LLUB 2OR9L 4JZJB 2HAZA 4HXAH 3QQ3A 1Q1JH 1ZANL 3CVHA 4IIQB 5J4MA 2AJVH 1ZEAL 1R3HB 1CGSH 1ROWA 2VLJB 4XCFH 1YZZA 3TYFB 4LRNL 1OAXL 4ESKA 4E0RB 4V1DA 3QCTH 3X14A 5AAMA 1J12A 3MLVH 4LLQB 5F1IA 5B38G 3EO1B 1S7QB 4CADA 3MODH 4JZNA 4U3HA 1GGCL 1JNHB 2OTPA 4K7PX 2AABL 5TF0A 4U1KA 1Z0MA 5D1XA 3KDMB 1JZ6A 1EEUA 1N5YL 4G8GD 2VDOH 3QDJD 1EVTC 3B43A 3SDDB 2YD7A 3IGAA 2Z31A 4XI5D 2XFXA 3ES6A 1BVLA 4XPAH 3QUMH 4BKLA 3F7YB 1OTTC 2VDKL 2FH6A 2FR4A 4JHBA 3GBNH 1A1NB 1L7TH 2ESVD 1AR1D 5TPWH 3RUGF 3Q2CA 4PB0L 1NCDL 1CE1H 3QQ9D 4PJ7B 3MXWH 1MUJA 2NY0C 2D9CA 3MPCA 4G42A 4H1LG 3BSZL 2NY3C 4MNQA 4EDWH 2DDQH 1RPQA 5F1KC 4P9MH 1CN4A 4NQXA 4ODSL 5JW4Q 3AM8A 4MXVF 1EXUB 2OYPA 4N9GB 3VGHA 2XZAH 1WEJH 4F8QA 4JM4H 2XN9A 32C2A 3W9EA 5JPNB 4GG6B 3DPBA 4X8JB 1NCAH 3VXRB 4M6OL 5JOFA 3A0OA 3JTTA 3DETC 2CXKA 4OLZL 3RL2B 4XPFL 3RIFF 5IVXF 5JORB 4YJZL 5DD5L 1DL7H 5KAQG 1T1YA 2GJ6A 4YO0A 4DEPC 5LQBH 4Q6YA 4TRPH 4KKLC 4RWHA 5KOMC 1NUFA 1CTOA 1SEQH 2B1HL 4OI8A 3VFSA 5I1DB 1WAAE 3DXAE 5EC1B 5DRZB 3RVTC 5L8LB 5TGBA 3WIIH 2CLRA 3SDYL 4NP4L 4LPCA 1A7OH 5D9SA 4TULL 4GRLD 1MFEL 3SQOH 3HLAB 4LVOC 3PXJA 2OL3A 2J4WH 1OQXA 5DDHA 4BJLA 2IBZX 2VLRE 4OCNC 5L0QB 3RNKB 2BHYA 5KVEH 4YPGB 5KZCB 3QULA 2Z35B 1MRDH 3C5SB 4MQSB 1UM6L 2ATPA 4KTEH 2IH1B 3VXNA 1LP9F 3ARXA 3LKPA 4M00A 1MPAH 5EO1B 4GBXC 5C0CA 5GISH 3AS0A 3G5VA 2ZCKH 4NKQB 4Z8FL 4XGZA 1AQDB 2BVPB 4NHCL 2YSSB 1FL3A 3RTQD 1J9CT 4EZMA 1LEGA 1NFDA 4JN1H 5DEGB 4XCNB 1XGQB 2QSCL 2CDGA 4Y19E 3Q1SL 4DW2L 2YWZA 1L6XA 2NYYD 5ICYA 4KI5D 3DWTA 2PW1B 1QSVA 3UTQA 2YRPA 4UIKL 2CLZA 1MHHB 1NGPL 2FSEB 3EO0A 3M8OL 3U0TA 4LVEA 1T2QL 1TTGA 5JOPE 3FB6B 2XNAA 3OR7B 4RX4A 2DQHH 3T0WA 1UCBL 1JZ7A 3JWOC 4TPRH 1RZJC 4I18C 3RGHA 1YMMA 1OAKL 2H1PL 3AAZA 3NIGF 3JV4B 4FQ2L 1YPZF 5K9OB 4XT1C 3W0WB 5EWIH 1HHKB 3QDMD 2GY5A 3FB7B 4XPHH 3TCLA 3OG4B 4PJAB 1IC5H 3CLEH 3TBTB 1KN4H 1YJDC 2JE8A 3F5WA 4LCIH 3AXLA 2IC2A 4H0HB 4NFDA 3VDBA 1KLGA 5GRJL 1RIHH 3LKSA 3QJHB 1A6UH 2FATH 2KUTA 4FQ1L 3RP1A 2AW2A 2XA3A 5BQ7B 1TJGL 3VJ6B 2CUIA 4PD4J 5IB5B 5IQ7H 3RVVD 5HVWA 4WJ5B 1HKFA 5GHWH 1RUKL 1VSCA 5EORL 1C8PA 5CGYC 1FCCA 3CDYA 2BVOA 3O0RH 1KNOB 3G6JF 4JHZA 4X4YA 2ZOLB 2X4OA 4HH8A 3JZ7A 3UJTL 1QKZL 4FTVE 4ZSOB 4WI5A 5EU7E 5A40E 4HLJA 2V17L 2P45B 2YHGA 3FO1B 1VEPA 1YY9C 2WWMC 5DJ0B 2AJSL 5TF1H 1LO0L 2C4FU 2PCPA 2OJEB 2Q7YA 2H8PA 4MLIA 4FQLH 5T33L 5IBTL 5EG6C 1YEFH 1XF5A 1MLBB 4FQHB 5B4MC 5EUKB 2R1XA 1FZKB 2IF7A 1SJEA 3AROA 4OCRH 4IM8A 3UAJC 5J6HB 3S8WA 5J56B 1SBSL 1CVSC 2UYLA 3PF2A 1QFWL 4MCYA 4XC1L 4HWZA 5GGSB 4C83B 4FXGB 2VITB 1I7TB 1BQUA 1YECL 2GAZB 1RK1A 4ZPVB 3ARFA 3MV8E 5INCA 4IRJD 2NW3A 1CXLA 1OAQH 3P4OB 1JPFB 4H1LA 4ENEC 4K9EC 4U6HA 4HIXL 4JO3L 2G2RA 3H7BA 1FFOB 4Y5XA 1QBLH 3LS4L 1B3JA 5IHBA 4MZ3A 2MPAH 3QXUA 4MAUL 2W60B 2H32A 4JFZL 4KDVA 4APQD 1INEL 2HT4D 4OQTA 4X6FB 2I9LA 1C08B 2IPUG 2O5ZH 4JZJC 5HHVH 1UEYA 3TYGH 1E6JH 4PLKD 3SKNA 4IIQC 1MCLA 2NY4C 3MRQA 1OY3B 4K71B 3QG7L 4PJBF 1ZSDA 3ZDYE 5H35B 5E03A 1J05B 1R0AL 1KACB 2YC1B 4F7EB 5ECJE 1JZ8A 1MCWW 3MRPB 1NMCB 3INUH 4MDJA 4POZC 1TJIL 1G6RL 4HF5L 3FRPG 4XC3H 4D0DA 4L3EE 4I9WD 1WSST 1NCWH 5DUML 4HFWB 1UM4L 5JXAH 2FL5A 5TE4H 4P57A 3WFDL 2LQRA 4F15C 5FECA 3NZHH 4MA7H 4WEUD 5C0AE 3CH8A 3ZZ1A 5IG7B 3MMEA 1XCQB 2B2XH 5D2LE 5CD5C 1QLFB 4FQQB 2Z91B 4NZJA 4LLVB 1H3VA 4YHIB 4H88L 3DROA 4M62H 2HJKA 2DMCA 3SO3B 2W0FB 4YWGH 4BQCA 1FO0B 3UP1A 1KIPA 4WHYG 2VDNL 4JY6B 1UKTA 4Y7MA 4HIEA 4QRTA 1OQOA 12E8H 3QHFH 4UT7L 3BPNC 4G7VL 3HMXL 3L3HA 1QRND 1OL0A 1C5CL 4X6CF 1PW3A 5IMOA 3MRGA 3BAEH 1Q38A 3QIWC 3QXTA 2GK0A 3B3IB 4EN3D 5E2WH 3S9DB 2X41A 3DLQR 1NUGA 3QYCA 3O2DA 4OM0H 3G04A 3SY0B 4YH6A 3BIKA 4KQ3L 2CKBH 3O6LL 1ERNA 5CHNB 4HS6A 1CL7L 4CL7A 3CPLA 3T0BA 1N2RB 3GIVB 3PWNB 3U1SL 1B9ZA 2BHZA 2ITCA 4P4RA 5E2UH 3TA3B 1LWRA 4X4ZA 5GGUB 5IBLC 2GHWB 3VFPB 5D6CB 1EEYB 2X4RB 5JA8B 3F7RA 5D7JA 1QPPA 1JGLH 3ZDXF 7CGTA 3WO4C 1AGDB 3TP4A 1HN1A 2DI8A 2EXYC 3QUKB 1EGJH 4OCSH 4U0QB 1NGYB 1JPST 1Q0XH 4HUWB 2J12B 4ZAKD 1TETH 2IJ0C 5ID1B 4EVNA 2OQJB 1ZLSL 4P5MB 4WUUE 3QIUD 4N90E 4XMKH 1M7IA 5EPMB 1N0XL 4U7KA 3MLWH 1YEEL 4QHUA 1GOHA 1H3PH 4ERSL 4KPHH 1QFUL 3GMOA 4MVBD 2DKMA 5HVHC 2OR8A 1DDHB 4JVPA 4G9FA 3NN8A 3P4NA 3SGJC 4ALAL 1EMTL 2UWEA 2GFBB 2IMNA 5A16A 3VRJB 1A7BA 1T7ZA 4G8EB 4K23H 2YPLA 3I6LD 5HY9A 1IQWH 2R4RL 3D39E 1S7WA 4ZFOB 4BQ9A 4Q6IA 5E0QA 3VFTA 1CVRA 3S35L 2MKWA 5BOPA 2HLAB 1A1MA 1Y18A 5E8OA 1EUUA 3QR2A 5EN2B 1ZMYA 2WUCH 5C2BL 1N8ZA 3DSNA 4AL8L 1TZIB 3IETB 5I1AA 3RI5F 2HVJA 3MREB 4ZYKA 6FABH 5E4EB 1ADQL 1P7QD 1HHJB 1X5XA 2PNDA 4HIJB 3WN5A 3VXSB 4L5FH 3PL6A 4DUVA 1QR1B 3ZYZA 5AG9A 1OPGL 3AY4A 1D6VL 3V8OA 1FH5H 1ZLWH 4M48H 4WUKH 1A5FH 4TUKL 5T1LB 4WFEE 3HC4L 1X5GA 4YZFF 5KSUB 1TENA 4Q2ZA 2FX9H 4UTBL 1JGDA 2BDNH 3NCFB 3L3KA 2EXWD 4S11A 1OGTA 2KQMA 2QSQA 4MJ2A 5C08E 1A7NL 3FFDA 5TDPB 4Q9QH 5IFAL 2IMMA 3NFNA 3U0WL 2WLZA 4NFCA 5KSVA 4J3SA 5IHUH 2GITA 5LXGL 3OAUL 2MHAA 5DJ6B 1CIUA 1V5JA 5DD6B 1B6UA 3HUJF 4Z7WB 4NQCB 2YRLA 5DJAB 3IFNH 2NXZC 3QNYB 2CIKB 3WD5H 1I9JH 5DT1L 3LQAH 4BQ6A 1KTLA 3RDTA 4YAQA 3DUHA 1QHPA 3NOIA 3CVHB 3O4LB 3R0NA 3C8DA 2RCSL 4JFEE 3QCUL 1GVIA 1A4KB 2HFFA 5J6GA 1WFUA 5BOZG 2D9QB 4X5XB 2WAHA 4P2RA 4PTUB 3FRPA 2B20A 2FEEI 3DX6A 2QADD 4FNLL 5A2FA 1HINH 4RA3A 5DD3H 2ZCHL 2AJXL 1FORH 5I19H 4PJ8C 1YEDA 5M94B 5F1IB 4R7NB 4JR9H 1JPGA 3ALWA 2ZG3A 3VFRA 4WFGD 4RISH 2GK2A 1INDH 4JZNB 4WI4A 5SWZE 1MJUH 4K3EH 5GGTL 4PJCF 1D5IL 1O5DT 5D1XB 1OP5H 4KJQD 1CS6A 2Z31B 3ROLB 4G5ZH 3BP4B 3PP3H 4WU5A 2GW5A 5HI4D 2PYEA 1G7PA 1YEHL 1BVKA 1DCLA 4XWGH 3QUZD 1H3GA 4YHKL 5T1KB 4KJWD 2VLLA 2X5PA 5F1SA 5GRXG 3T0ED 1KELH 1SYSB 4YQXH 3KPSB 32C2B 5MENA 2Y72A 4P4KD 5IW3A 4HHAA 5HYSB 4POYA 2YN5A 3PQYA 4PGEB 3KLAA 2G60L 2HTLD 4U05A 1CGXA 3JXAA 1HZHH 2C5DC 5IJKA 1QSFD 5E5RB 3JVGA 4M8QA 3VFSB 5FYJU 3P0YH 4JAMA 5TGBB 4AENB 1CICB 3A67L 2CLRB 1JI1A 4LDOB 3CFKA 5I1KH 3QUYD 4JFXA 1ACYH 1KJ2L 1JYWA 1Z2KA 3IB4A 1CFVL 3X3GL 2XKUA 4GLRI 1WQVT 1MLCA 4YHOH 3REVA 4O5LL 1FFNA 3HI6H 5D5MF 1KCSH 3FJTA 3RJQB 3SO3C 4GMSL 4MXQC 1AKJA 4H5SB 4XBEL 1TXKA 3VXNB 3TIDA 1Z9SA 3AGVA 1YMHA 3A6CL 3GSOA 3G5VB 1QBBA 1KPRB 3ARDD 4K94H 4AEHH 3REWA 1FE8H 3B8YA 1NH6A 4X6BA 1FL3B 2C4FT 1T6WA 2JIXA 4TUJA 2UY6A 4NUGL 1NFDB 3U30C 4OFKA 3G6AA 4QY8A 5CMAA 3OPZL 1NBYA 3V52H 2YXFA 4JGJA 4OV6F 4XXCA 5ICYB 4BH7A 1F6FB 3FQUB 4H8WL 3AUVA 2DQUL 4L9DA 4Y1AD 4AEFA 1MJ8H 3NCJL 4LHJB 4UV4L 1OCWH 3FN9A 4ZXBB 3GSUB 2BHUA 5BV7H 2EDYA 4PR5A 1CGWA 4XX1G 1GOFA 5HYJE 1N5AB 4U6XB 1WAAA 4HMCA 2CIIB 3DXAA 3KNBA 1X4ZA 3ULUC 2KQNA 2FJHB 5J13B 3SE8H 4Q0XH 4CRPA 1IM9B 4NIKB 3CC5A 1GIGH 3IFPB 3W39A 3LEXB 4PRHD 2IPKB 4W68A 2P43B 1BM3L 3FTGA 4HCRL 3ARGA 2VLRA 1ACZA 1C5DA 1CBVH 1ZGLB 4HZLA 1KLGB 4CW1A 4ZS6C 2P49B 4EOWL 4IOFC 1SM3L 4NKIH 3BE1L 1W72H 1WBZA 5FYJH 2FD6L 1RJZA 3O9WB 3UTSD 2FB4L 4NWTH 3P40A 1DFBH 2D7PA 2R2BB 2E6QA 3SEPA 3IU4L 3I02A 1A3RL 3BQUB 4X7SH 3HNTH 4UDTA 4NJ9H 5D70L 1XGYH 2X05A 5D8JL 3S4SB 2NZIA 3QQNA 1I1AD 4Y19A 3T0DA 4Z7VF 3WS3A 3GJFA 3MXVL 4U1JA 4U7SA 3QUMB 1S9XA 4ZUTA 4F7TB 1I9RH 1JV5B 3AVEA 4DVRH 4K3JL 2P44B 4JO2L 4M3JA 3ILQD 2PW2B 5IHZA 2FWOA 1J0JA 1IC4H 2PCPB 5E24E 3G5YB 4JRWA 3U46A 4E41D 4YHLL 1F4XH 4KI5E 4HT1H 4CVXA 2J5LC 4AY0A 4J6RH 2E27L 3HG1D 1JHLH 1NLBL 2NY0D 4OLYH 4WCYL 3VA2C 4U31A 4IS6B 4K3HA 2NY3D 1YYML 4MCYB 4HWZB 3V5HA 1C5BH 1C12B 3PE9A 2DQFA 4O9HL 1J11A 2GSIA 3TVMB 2MCPH 5HGAA 3MLRL 3QDME 5DRXA 3DARA 3VFNA 5I15L 2Q7NA 3QZWA 1NEZB 1WITA 3GK8H 4X6DB 1FAKT 1T04A 3FFCD 4GW4A 3BISA 2CLVB 4KKLD 4QOKE 3O6KL 5TH2A 2O5YH 4Y16D 2CO7B 2ED7A 2H32B 4OF6A 3TEUA 2I9LB 1RZKC 1MWAH 3HCVB 1U6AH 3AREA 5CEZH 1NC2A 2HT3C 1FNEA 5E70A 4U33A 4R4FL 4WW2B 4MNHB 5I17B 2P8PB 3PDOA 5T5FL 1JCKA 2FHFA 3GZKA 5DC4B 4JFFD 1NJ9A 3WCYA 2DJ4A 2DLHA 1P4IL 4Z76B 1RK0A 5C0JA 3RFZC 3PWUB 1TFHA 1FG9C 3I6KA 4X4ME 2DQIL 2F54A 2IEPA 4IOIB 1AHWA 2HG5B 1UXWB 3RWHA 2EYRA 3DX9A 3GBML 4DUXA 5I1HL 1KIUA 1PG7H 5D1XC 2FJGA 4ZD3L 1IEBB 5CBAB 2Y23A 3FO9A 3VRLE 4PRBA 2Z31C 4WGWB 4W4NA 1KC5H 4X5WA 1G0XA 4JJ5A 4X9HA 1SJHB 1VFAB 3VW3L 4LEXL 3RWDA 1NFIB 2HJKB 1OSPL 4YR6A 5BW7A 3QNZA 1HKLL 3L3GB 1KB5H 4NQDB 3MV8A 4YNYB 2WP3O 4NM4L 3O6FD 1URLA 1UGNA 3V6FA 3AS2A 3AM8C 1HSBA 25C8H 4O2EA 2O5XH 3BP6A 4P48A 5MEOA 2BERA 5DI8B 1KXTB 2MQ0A 5DMJB 5EU6B 5BRZE 4OM1L 4HXBL 4GRWE 1KN2L 4JY5H 4WEMB 5CSBA 4ZOBA 5CBEB 5E8NA 2FH8A 5TE7H 3GDBA 1ZA6A 1T0MB 3MX0A 5KVFL 1XH3B 4KVCH 5KS9A 1FGVH 4OF5A 3BIKB 2HKHH 2R0ZL 1KXQE 5DJ2B 2DMKA 3V5KA 5IW6B 5CJQL 4XHQA 5F9OL 5I75B 1Q94A 2EDOA 3H9HA 4P4RB 2VDRH 1U2HA 4LCYB 3VXMA 4JPWH 1TQBC 3JV6B 4XVUC 1H3TA 5EC2A 4YDJB 3ZTNL 4L3EA 2FX7L 1OHQA 1PY9A 2W65A 1R3KA 5EU3A 1CXFA 3MOAH 3MLXL 3RHWF 4BUGA 1GXEA 4I9WE 3U4BL 5E7BA 5C0AA 4HUXA 5FYLH 4J3XA 5CGYD 2X6MA 5D2LA 2HJFB 1K4CA 1BHGA 2C3HA 4Z0BH 3SKMB 3MLTA 1R5IB 4XAKD 1D9KB 4KFZC 2F8VA 3QRGH 4L4VD 1ZHBB 3MQIA 1DBBH 3DV4A 1BZ9A 5SX5H 4CAGA 4G9FB 1JWMA 3VI4F 3KPPA 4PGBA 4UNTA 5A16B 3SOBL 1J1XH 1BAFL 1GGIL 1PYWB 2J7LA 2WWMD 3ARZA 4JPVL 3HR5A 2EDWA 2X09A 3F6LA 3QWRD 1QRNE 4LMQI 5E2VL 4DVBB 1WFOA 2R23B 5D1QB 1Y18B 5E8OB 3BX7C 4XP9H 4LSTL 2Q6WA 2CQVA 2JCCF 3O3BB 4KMTL 3WIHA 5T3XD 4KRPB 4ZYKB 4KKCD 1T4KB 2BVQA 4FFZH 3BDXA 2L0DA 3PGCB 5T3XL 5IB1A 5EZLB 3WN5B 4GLRH 1S5HA 4MJ6B 4NNPH 2EDQA 1CQKA 3MNVA 3QI9D 5HI5D 4CVZB 5J3HD 4GSDL 4NGHL 2FHBA 1ZT4B 1FZJB 3UYRL 4U6TA 4ENED 3C9NA 2OL3H 1UA6L 1HSAA 4WI7A 3Q5YA 4HIHB 1G6VK 3IDNB 2HKFH 5B3JF 3MOBL 3WKML 4F33A 1V05A 3L3KB 3QH3B 3QPXL 2WIIA 1OTUC 3OKNA 2F19L 4LGRB 4WUUA 4NUJA 3ZSSA 2DQEL 2D0HA 5DGRA 2FECL 5JDJA 1GPOL 1K3IA 2V5YA 1XCTA 2F5AL 2R0WL 4AM0B 5FV1L 1MHEA 1E27B 4P3CL 4A6YA 2VLJD 4JVWA 1F90H 4RFNC 4EIZC 2VWEE 1BFVL 3BPCA 3F8UB 4PLJC 1KCVL 5JR1H 3GRWL 1BD2E 4N5UA 5ISZB 1E6OH 4HV8B 1TITA 3BRGC 1CQYA 4ZUVA 2UVEA 3D39A 2BSTB 3BKYL 3RDTB 1G9MH 2AXGA 4N0CC 2ADGB 3RA7H 5IEKB 3O6ML 4HWNA 5IESH 2VXQL 4U7MA 1IGCL 2JB5L 4FQIH 4P2RB 3SDDD 3RU8H 5DWUH 4ZDHA 3SKOA 4XP1L 1SYVB 3TFKC 3MFFA 5I1EH 3ZKMC 3S3JA 4AIXA 1UVQB 3OKEA 3QWQB 5C07E 3OKMA 4XVSH 5GRVL 4GRMA 5I2IA 5ANME 2DD8L 4UOW1 3VCLA 4NT6A 1UM5H 2IQ9L 5H37G 1TIUA 3BUTA 3DIFA 4PJIB 1L7IL 3L3IB 2ADFH 2IH3B 5FO9B 4NZRL 2G9HB 4ONHA 5JQ6L 1P4LA 3VXRD 3ARFC 4WU5B 5FGCE 3G6DL 2ARJB 1GOGA 2PYEB 4NN7B 1T5WA 1IAIM 3GSWA 5I8EA 4NQTA 2C7UA 4MQ7A 1G7PB 5HHOB 1KCUH 4DAGH 4Y5XC 3C6SB 5C0BB 3X11A 3S37L 1DANT 4D8PB 2VLLB 1EO5A 4LSQH 4I2XB 1FC2D 3D18B 5IV2B 5FM5M 1YQ2A 1K3ZA 4ORGA 4NO5B 5LBSH 3LS5H 5IBLD 4R96A 1IZJA 3BGMA 2VDPL 1J0IA 1EHAA 1UQSA 2UVFA 3PQYB 3KLAB 3KYKL 3TPUB 4GXUN 3FB8B 1PLGH 2K9UA 4YFLF 3HI5L 3IYLW 5I8CA 4P9HL 5DJDA 2WBJB 4OIIL 5IF0B 4JFEA 2WLYA 4YK4C 3IU3A 1Q9LA 5GS0L 4C56A 4M8QB 2HA1A 5KZCD 4WGVB 2FYYB 3EO9H 5C0ND 3I9GL 2GYSA 4JAMB 4PJXE 4NNYA 1MRCH 1IBGH 3EJJX 1JGVH 1A47A 3SJVE 5GGVL 1I9IH 5DURB 5SWZA 2ZUSA 5JHDA 2E7MA 4X7TA 3VI3E 3F58H 3R8BB 4JANB 3O3AA 1KF9B 1SY6L 5DEZA 2XICA 3NTCL 5IKCB 4P5TB 1MLCB 4OGAD 1W8NA 5AZEL 1EJOL 3REVB 5J1SC 2QQKL 4NBYB 1NGZB 4HGMA 2HWZL 3BWUC 4M61A 3VD5A 2UV3A 4L4JA 4M1DH 3BZDA 4EI6B 3WFHA 1DQQB 3I2CH 3TIDB 3MGAA 5J89A 4YBHA 3TJHC 1HQRB 2EKSA 3TJEL 3MCLL 5FM8A 4EQ3A 3REWB 3P2TA 1AXIB 3LN5A 5CJXA 4UBDC 5DVOA 4PTTA 4L8BA 3TBVA 4QY8B 1I7RB 1XGUB 3N85L 4ELMF 1NBYB 1T7YA 4JKPH 3S7GA 1T03L 1LO3H 3RZCA 4BH7B 4PJ9B 4X9GA 3SDXF 4XBGB 3W0WD 4PRDA 4N0UE 3E6FA 4LSDA 5F7HA 1I85A 1YC8A 1U8QA 1EEZA 2N7AA 2F53E 1G7QB 1KT2A 4X0KB 4PJHE 1A3LH 3ZE1F 4NPYB 1U3JA 5D7JC 5DSCB 3DXAB 3OXRB 3KNBB 2V5MA 2X2YA 2YD2A 3DBXA 5HGGS 2GJJA 1NMAL 3LMJL 4UI2A 1LO2L 5JW5B 1WBXA 3FQNA 1CDYA 4BQ8A 4CKVX 3S36L 3EGSA 1RUAL 3PP4L 4W6WB 1HCFX 4TSBL 1MCHA 2ICWA 2NMSA 1EHXA 2EEDA 3BWAB 2VLRB 3DTXA 1NBZA 2P8LB 3DOSA 2ILLA 5GRUL 3TH3T 1VDGA 4AEIH 3NFSH 1WF5A 5I0ZA 3U9UA 2CK0L 4RAVA 2DM3A 3MUY1 5DVNA 4LLDA 1FV1A 2ATKA 4IEFB 1NC4B 5AYQA 1IQDA 4ETQA 4RFEA 3C5JA 3K0WA 1H0DB 4JZOB 4X7CC 3TT1H 1S9KC 1UXSA 4Q6IC 2ESVA 2O61A 2DTMH 4Y19B 4GQPH 4I77L 3CU7A 3PWPB 1TJHL 1CT8B 1V7NL 3GJFB 4U1JB 1MCFA 4U2YA 3CFBA 2X89D 5E99L 1B4JH 2I27N 5AUMA 5EB9A 3FZUC 1FQ9C 2HFTA 4JFHD 1S9XB 4OCWL 3P30L 2D03H 5EUOF 1S7UA 1TLKA 1KJ3L 2EE2A 3HE6B 1HXYA 4LEOA 3VGAB 3WN5C 4JO1L 3P73A 2DLIA 3PL6C 4NCC1 2A6DA 3U46B 4LARL 2QEJA 5I1IL 1ORSB 3AY4C 3HNSH 4QTIH 5MP6H 4NYLA 2X4UA 1R24A 5EBMA 5HHPA 2HP4A 4DN4L 5GRWA 3O81A 4N0RA 4TNWK 3BH9B 5I1CL 1YNLL 1U8PA 1FGNL 4NFBA 1P5UA 4HLZG 1BOYA 5I16A 4LVNC 3QUXB 1S9YA 3V5HB 4BH8B 2R1WB 4CJ0A 1EHLH 2DQFB 1P7HL 4JO4L 4ZTOL 5HBBA 1ZHKB 4KKAC 3LQZA 5KSBE 4NKDB 4HKZB 4XNMA 4Y5YA 4F37K 1CK0H 4C58B 4LFHD 1T04B 4WDIA 2APBA 3IFOB 2Q8BH 3QNXA 5TH2B 3MGOB 3R4DA 4XNYL 4HWEH 4FN0A 5J9PB 4LDLB 3UZVB 5DS8B 2IANE 5IIEA 3RDTC 3UTSE 4C4KO 2VL5B 1QFPA 1YEGH 3FRUA 4N68A 3VFVB 4GXUM 1OB1B 4ODVL 4U1LB 1NC2B 2XWJA 3DHJA 4NC1C 5AD0A 2AK4B 2VR5A 3RTQA 3CH1B 4P2QB 1W0WB 4P99A 2HRPH 4FTVB 4BZ2H 2ZPKH 1MFCH 3OKOA 4F58H 2DQJL 4X99B 2YPVH 2YUWA 4OZ4B 3SKJH 3I6KB 4MDIA 4M4PA 4JLRA 2R69L 3TNNA 4OT1H 4KUCD 1S3KH 1FRGH 1OP3H 5M95B 1FO0L 1MVFA 1MSPA 3T2NL 3E2HC 4XHJC 1P53A 4E41E 5K59F 3SGKA 5J06A 1N59A 3QXDB 3U36A 3K8MA 1EO7A 4WRLA 3MO1B 1MAMH 3VDAA 4JG1H 1D6EA 3TBSB 2LV4A 3UC0H 3RUGE 1IAIL 2PYFA 5FKPA 3QDMA 5BV7B 2ZUYA 4RGNE 2JK5A 1GGBH 3GSQB 4LAQH 1MAJA 3SDAA 3TA3D 2HN7B 3QJFA 5ITFA 3RWEA 1WTLA 5CJ5A 3OKYA 4YUEH 5L2JB 3I50L 2VXSL 5EZOH 3WXWH 3GMRA 1WISA 4D9LL 5ITBH 4HIIB 4GAJL 5JNYB 4M1CD 5IJKC 5IVXE 1EX0A 3QHTC 3JVGC 4MNGA 1A4JA 4NJAL 5TDOA 2YKLH 2OXGA 4CU6A 3MRMA 1Q94B 4LQFH 1G7MA 3D3VB 5GRZA 1A7PH 3IJSA 4QXGL 4Q97A 3K80A 5EC2B 1N3NB 1UWGH 1ZGLM 1XF2A 1BIIB 4X4MA 3CFCH 4MWFA 1QLRA 5EU3B 2YD8A 4XXDA 1NGXA 1JTTA 1Z9MA 1MIEL 1NL0H 1QEWA 3H0TA 4M6ML 5C0AB 1FL6A 1UCTA 1KFAH 2DBJA 1UB5A 4K8RH 1WJ3A 5KW9H 3P0GB 5I1JL 5J1AA 4S1SL 3OZ9H 2Y9RT 4PJGF 3NCCB 4WHYH 1KB9K 4KK8C 3BZFB 3HZYA 2VQUA 1RUQL 2B0SL 4ZFOL 1LP9E 3CCHB 4BFIA 3VXTB 1BZ9B 2V7NA 1RFDH 3GMMA 4HKBA 1T1WA 1UWEH 5HPMA 3CZFA 1OP9A 1JWMB 2P47B 4KK5C 2EEAA 5F7NC 2AXFA 1NSNL 2Q87A 3B6SA 2DL9A 1GHFH 3LKOA 5BRZA 5I9QC 3VXSD 4IRJA 2EE6A 1BBJB 4L8SA 4XXCC 3K2UH 2JB6A 2QJDA 5T3ZH 3KPMB 5T1LD 4OD3L 1BEYL 3PNWA 1PG7W 4Z78A 1WUNT 4YHYB 3BPLC 3N1GC 3MJ9H 3VWKB 3MV7B 1J86A 1U8OA 3O3DA 3PIQA 5HGBB 2M2DA 3KR3L 5GSRA 1OWRM 3LIZH 3D9AH 4LCCB 1FAIL 4PB9L 1KCKA 1MCOH 1R5VA 2BFVL 4MD0B 5HI3C 5SWSE 2YK1L 2AK1H 3SDCA 3MNVB 1TVDA 1XIWB 4G9DB 1G6RA 5JIKA 3BJLA 4YGVA 3W9DB 2DQCL 2OP4H 1YPZE 1HSAB 3CFJB 5DUBB 4R0LB 4MD4B 3ARGC 4NQCD 4K7FB 1MWAB 3WFZA 4MJ5A 3JWDL 4HC1L 3TO4B 4KRLB 1CDUA 4QHMA 3LD8B 4UOW0 4WUUB 2PUQT 2YBRA 1K5NB 3W2DH 2R29L 5J11C 4YXLL 1NCCL 1RJLA 2IQAB 5AWNL 5F7YC 4D9QE 3O4LD 1TZHA 2HT3D 3NVQA 3VXOB 1MHCB 3ARTA 4WHTB 5DD0L 1A9EA 3HAEG 4HFUL 2I07A 4IMKA 4RBPK 3BOVA 1OD7A 2XOTA 1YEJL 5L6YL 1VFMA 4Z95L 1HILA 1JZ2A 3PWJA 2GT9B 3BPCB 4PJAF 2UUDH 2H9GA 1FJ1B 4XAKE 4ODWB 5EOQH 1CE6A 3HMXA 1LNUB 3OBAA 5IQ9A 1ZT7A 1OAYH 2AXGB 4M7LH 5EU5A 5C8JB 1QRNA 4PY7A 3ET9F 2XQBH 5D1XD 3AMKA 3Q3GB 4MA8L 2YA2A 1Y6NR 4PRNA 4R9HA 2DWDB 3VGAC 3QEGH 5L2KE 2Z31D 1ZLVH 1CGTA 5HYIA 1KB5B 1LEKA 1AFVL 3KYMA 1JHKL 2QLVB 1D5ZB 4XRCA 2A9ML 2X4TA 4I0KA 3O2WL 3ZKXB 1X5JA 3GJEA 1IGIL 4NN6B 4K2UL 4RMQA 2PETA 3BN9D 5T3XE 4G6AC 5KVDL 1PG7X 5B8CB 2XACC 5T1KD 3OKLB 5CKAA 4IDJL 4MLSA 4O2CB 2VLKE 2QBWA 4KJPC 3KPSD 1E4WH 1X5LA 2ADJA 3QEHB 4WI2A 1FDLL 1C7SA 1RJYB 1DN2A 5C08B 3RJDA 2WWKO 1FLRL 3EYUL 2AJUH 4ZFFA 4QYOA 5I8EB 1CU4L 2NY5C 4LRIA 2EDLA 2IADA 4GAFB 3N50A 4LCWE 3VXQB 2AEPH 3QIUA 1A7QL 4GKNB 4PGDB 4XVJL 3OAYK 1RSFA 5CWSA 2VIRB 1S7VA 5F7FA 4KY1L 2AV7A 3AREC 4QTHA 2H3NA 3MRJB 4UT9H 1CICD 1BD2A 5GZNC 3BGMB 1EAPA 4PRAB 5CP3A 4NNXA 4OFYD 2VLJE 4U6VH 3GMLB 5DJDB 1K85A 5EU7C 1OLZA 1IAKB 1MI5E 1RIVH 1DLFH 2AP2A 4YBLB 1A14H 3NH7H 3AC0A 1XF3A 1RZFH 4OB5H 5FDWB 1AHWC 4UOJA 2GUOB 1F2XK 3MLZH 4NNYB 4PLNC 4NO3A 5GIRB 4G8FA 3TH2T 4H0GA 5JO5A 3TV3L 5IUSA 4JQVA 4LKXB 4Y2DB 5KOVC 2YWYA 4I5BB 3QQ4A 1ADQA 2BJML 5ANMA 4UIMA 3KXFE 3HRZA 4Z5RA 1TCRB 3W82A 1P7QA 3VH8B 3KLDA 4BM7A 4RAUB 5BW7C 4PJ7E 2APVA 4GAYA 2VRAA 1RU9H 4Z7UA 3IT8D 4WNQA 3RWGA 3UO1L 2EH8L 2W0PA 5C0GA 4S1QL 4HZAA 2EKSB 1K4DB 3NIFF 3PV7A 4B7LA 2B4CL 2H26A 4ZXBD 5I1LA 4GG6E 1M7XA 3EOYG 3L5JA 1F11B 1AXTL 4DGVL 5TQ2L 1QP1A 2H2PD 1HHHB 4I4WB 3S5LG 4RX4D 4IRZH 1W0YT 5EULV 1JWSA 3MRDA 2ZUTA 3SGDH 5TDNB 3EHBC 4M9PA 4FQXB 1IM9D 8FABA 1P1ZB 2E7HA 3F7VA 3FQTA 2HH0L 3ZMRA 5TQ0L 2A6IB 4XNXL 2R4SH 4GJTB 2C3VA 4I3SL 5C09E 1WZLA 1FVCA 3IAPA 1DP0A 1AXSA 1CLOL 1I3UA 2N4IA 4AMKH 4OLWL 5E5MB 4CU8A 2VC2H 5DVLA 4LSUH 4HXAL 1F8TH 1Q1JL 3MRCB 3DBXB 1RHHA 4PJXA 5IMKB 1O0VA 1U8LA 3OXSB 2AJVL 3O9WD 4J3OC 1VFUA 3S34H 2DB8A 1CGSL 1DUZB 3ZDXE 1FBIH 3DO7A 3DRQB 4XCFL 5EBWA 3EGSB 1LE9B 5DR5H 1QNZL 3BQUD 4H26B 2ICWB 3QCTL 3TC9A 3MLVL 5GGTA 4KK9D 5I8KH 1NBZB 4PJDA 3MODL 5F96H 3HNVH 1FYTE 1MFNA 1CZ8H 4L8CB 3O41B 5F1NA 5DO2D 1FV1B 3GUTB 1QSZA 1PVHA 1UADC 5FYKU 2VDOL 3ZO0A 3ULUF 1ORQB 4ONOA 3GHEH 3UTOA 3FHAA 4XPAL 3DVGB 3QUML 5CSZA 4WFFD 2QQQA 1EK3A 1L7TL 3J7HA 2W9DH 2O61B 4ZODA 1TVHA 1CE1L 3MC0A 3V8CA 3TFKD 1JN6A 3BYTA 3MXWL 2E5EA 4EDWL 2DDQL 3QUZA 4P9ML 1P2CA 1WBYA 4YHYC 2FNBA 2N56A 2ERJB 4MX7A 4XVTH 3T0EA 1Z6JT 1T1XB 4KMLB 1I3GH 2XZAL 1WEJL 2YN3A 4N0UA 3BXNB 3RBSA 1HXYB 3WNMA 4L29B 1X9QA 4P4KA 4AK1A 3MLYH 1NCAL 3P73B 1UWXK 2F53A 1ULVA 2YUXA 1OT2A 4PJHA 4XP4H 3DYMA 1QQDA 3TVMD 4C57C 1CFTB 5HYJB 2NXYB 3I3EA 5HDLA 1DL7L 3S98A 5BVJA 5LQBL 1L0QA 4G6JH 4HK0A 5IP4A 4P46B 4O4YL 4UQ3A 1JVKA 4OAWA 4TRPL 3QXAA 1QSFA 1U8PB 5TE6H 1G9NC 4WU7A 5JW4R 3D5OF 3QIBA 1SEQL 5KVGH 1K8DA 4MZ2A 4CNIA 3B2UC 2AVGA 1A1OA 3WIIL 2YD5A 2GQHA 5EIVA 1KJ2A 2DWEA 1FZMB 3LKRA 1A7OL 1FFRA 1EZVY 4QF1A 3MCKB 4AG4H 3SQOL 3QUYA 4LPTA 5JXEA 3L6FA 2CGRH 2QQNH 2J4WL 3MFGB 2IWGA 4LSRH 4XNMB 4EDXB 5B38B 3DV6B 5KVEL 4HKXB 1MRDL 4XPGH 4ZO8A 4KTEL 3HUJE 3MBEB 5FHAH 3D0LA 3BT2H 2EDFA 2P8MB 4YEEA 4PPTA 1TTFA 1MPAL 4R97B 2ZCKL 3TBWB 3GBLA 3LOWA 4S1DD 1DTUA 3IAQA 2NZ9D 3UPRB 4F3FB 3MRLB 4RWYL 1LD9B 5E8PB 5KVMC 1V8HA 3JTSA 4JN1L 3K74B 5I18H 5FYKH 5F7EH 2XWTB 3MA7B 5C0IB 5DC9B 2DJSA 3NIDF 2L7JA 4NSKA 4XP6H 4H25A 5EOTA 4JLRB 2GSGA 3FOMA 1VERA 2R15A 5GZOC 4NQDD 1OSZA 1A6ZA 3TCXA 4Y1AA 4ISVA 1J87A 2XXCB 3IDMA 4OLEA 4XTRC 2XIDA 3KJ6H 1FG2B 1T0PB 1DUYA 1QPXA 3QAZB 5EU6D 1L9MA 4MCZB 3NPSB 4N5ED 2ZOKA 4L9LB 4J8RB 2BVTA 3V0WL 1DN0A 3RKDC 4K55A 3GFUA 2Z4QA 3WV0A 2FGWH 5CILH 2D31B 5IB3A 3NBNA 3MRKA 5EWIL 4HCRA 5FKPB 4XPHL 1IC5L 2YUVA 43C9B 4N8PA 3CLEL 4LLYA 5DFVD 4YEFA 2VDMH 1KN4L 4A6YH 3SDAB 4LCIL 3HE7B 5LGKA 3UBXA 2EECA 3B9EA 1RIHL 1A6UL 4QOKB 2FATL 3S5LA 2XWBA 5D7LE 3PJSA 5C70A 2Y25A 4OI9A 3UTSA 1IM3A 3KJ4B 5GHWL 4JDTH 3RX5A 1J0KA 1NANI 3EOTH 1A4JB 1FVDB 1DBAH 2VAAB 3QEQB 5FKAA 4TOYH 3O0RL 5C0EB 3ULVC 3H6JA 1I1AA 1MCBA 1H3WM 2BOBB 4NQSA 5F9AC 5ADOH 3H9SB 1D9KD 1A6AA 2P24B 1EV2E 3QG6A 4ODBD 3P9WB 1NGXB 4BSWB 4G9FD 4FQCH 4G8IB 3C60B 5MEPA 3T8XA 1WFNA 4KGLA 4W6XB 3IVKA 4QRQA 1X5YA 5CAYB 4E41A 4DGYH 1YEFL 4U1MA 3HG1A 4OCRL 2E3VA 4C55A 1JUFA 1JNJA 5D1QD 1WC7B 5DRNB 1T2XA 4L8DA 2V7NB 2HFEA 5CJXC 1MF2H 4HKBB 5HPMB 1H15B 4GMTH 2EH7H 2MQ3A 1DQLL 4UUJA 5FO7A 4KRPD 2A83B 2EIEA 5BCAA 1KTDA 4HWBH 3FT2B 3IXAA 3LKOB 5BRZB 1BREA 2ZG1A 3RZCC 5DJYB 4CMHB 5F7KC 1EUTA 1KENH 1OAQL 4XCYB 1Z3GH 1EH9A 1U8IB 1F4AA 3D48R 1UH2A 3GMQA 3R06B 1I85C 3FFCA 1QBLL 1QO3A 3MGTA 4QHLA 1I4FA 5CJBA 2MPAL 4M4RA 5DK2A 4Y16A 3O3DB 2OI9B 2RHEA 1IT9H 1IC1A 3PIQB 3BO8B 5HHVL 1ZXQA 3TYGL 1E6JL 1R5VB 3LV3B 3ULVH 3X13A 4O2FB 4WTZG 4K7PH 5E9DB 3SDCB 3DNKA 4KZEH 4AT6A 4UT6L 2VH5H 4BZ1H 5F6IC 1AGEB 2WBKA 3INUL 1GYAA 4XC3L 1ZLUK 3UYOD 1NCWL 1R3LA 4PLOB 2R1YA 4WHCA 3MROB 4QXUH 3QXVA 4MJ5B 5JXAL 5ISZD 1XR9B 1GJIA 5E56A 5D1ZB 2APWA 2CUMA 2YBRB 4PYHA 4WY7L 5TE4L 2B5IB 4NZTH 4I3GA 3PGDB 3RDTD 4MA7L 3X3FH 1TZHB 4X98B 4XI5C 1BOGA 2B2XL 3U0PA 1LP9A 4U1HA 3LEVH 1AY1H 1I7UA 3KPLA 4P2RD 3MZGB 3ZYOA 3PWJB 1AR1C 1VFOA 4M62L 5SV4A 2H9GB 1T83A 4OSUH 2EC9T 4YWGL 2DOCA 4QXTA 3QQ9C 3RVWC 3NACH 5F8QC 4ZQKB 4NQVA 4W4OA 1QLEL 4Y4FB 4JFDB 12E8L 3QHFL 4UU9A 3O6FA 3NGBB 3BP5A 3MUGA 3MRBB 4Z7VE 4DZ8A 1XZ0A 2P5EE 4OKVB 4PP1C 4NWUH 1MFAH 3V2AR 3BAEL 4XHJD 5JPMA 3C6LB 2YZ8A 1ZHLB 1LEKB 5E2WL 2C3WA 4JKWA 1PY4A 3GMPA 3VFGH 1I8MB 5DMKA 2I26N 4WW1A 1F3DJ 2NXYC 4XRCB 4OM0L 1ZEAH 5J7CC 2O93L 2PYED 1U8KB 2W0LA 1UACH 2CKBL 4JGUA 1ED3B 5E8EA 1VHPA 5HHOD 5GGRA 4U1SA 5C0BD 1D3CA 5HHMB 2IAMB 5E2UL 1XT5A 2G75A 1CL7I 2AERT 4PBWD 3ARPA 3NCMA 5CZXD 1JGLL 3PQYD 1T89A 5INDB 1N5YH 2D4DA 4HJ0C 4MXWL 3V6ZA 4DKFH 3MV9E 1EGJL 4Y5YC 3PHOA 1QA9B 4JN2A 1Q0XL 4Z7WE 3G08A 3DHMA 2C26A 4ZS7H 1TETL 2WBJD 2IADB 1NGQH 2JJWA 5ADPH 4JREB 2BY2A 4XMKL 5I66B 3MLWL 1H3PL 2CKNA 2YOCA 4UAOB 4KPHL 5IVNA 3O4LE 1MCKA 2R2CA 1BD2B 4OZHF 4F7CA 3BSZH 1EAPB 3WJLA 1DQDH 4L4VA 4LCUB 1MY7A 4UDUB 3WL9A 5DURD 3RTQC 2AJ3A 1V3MA 2FX8H 3VMPA 4K23L 2NNAB 4NOBA 1JNNH 4P5TD 5F88A 4XPFH 3EYVA 3KWWB 3QWRA 2NYYC 4S2SB 3BJ91 4KI5C 1M05B 1EPFA 1FN4A 3H42H 3RQ3A 2C4XA 2F74B 3TO2B 2WUCL 1IGJB 4Z6AT 5C07B 3QQ4B 5KAQF 1K6QH 5H37H 4FFWD 4LHQB 3CFEA 4NQEB 3SGKC 3HRZB 6FABL 4LNRB 5A2IH 4OD1L 1N4XH 3O4OB 4KK5D 1MCNA 4BFBD 5IJVA 4L5FL 3RY6A 4U49A 3STBA 4GAYB 1MCIA 3QI9A 1FH5L 3HPJA 3NMEA 5FGCB 5ICXB 4WUKL 1A5FL 4O00A 4PJ9D 5DYOB 4HBQA 3C87A 5C0GB 3P9LB 2D2OA 2MSPA 4OZIE 4IHOA 3SDAC 2FX9L 1MCQA 4JPKH 3KPSE 1J5OH 3OR6A 2FBJH 2BDNL 1JIBA 4QNPE 5C9JA 4LCWA 3P4LA 5DXWA 1MY5A 3VWJB 1A8JH 5DHVH 3F12B 1PKQE 5FCUH 1P4BH 4LLUA 1VFBA 1YUHA 4GOSA 4QRUB 3DXAD 3RVVC 5IHUL 3WUWB 1CCZA 3MRDB 2Q76B 2B8OT 2DIAA 1R3HA 2XI9A 3PABA 2IFGA 2M26A 4FHBD 5FB8A 5I30H 2VLJA 3GRWA 1A6TB 3TYFA 1KIRB 3IFNL 2E9WA 4QRRE 4E0RA 2C3XA 4WIQA 3WD5L 2VLRD 1I9JL 4LLQA 3K1DA 1UB6B 3LQAL 3CJJA 5J8OA 3HB3C 1S7QA 4WTZA 1EBPA 2BC4A 1FZOA 1JNHA 2AS5M 3BGFB 3I3DA 3E1F1 4PJXB 1I3RB 2YA0A 5DVKA 3KDMA 2EDRA 3M8OH 3SJVB 4OZFH 1NC4D 1U3YA 2WM0A 3SDDA 3U79A 1P84K 3FONB 2VTFA 1HINL 5DD3L 5I19L 1VA9A 5DZOA 5FCSH 4J4PD 4RISL 1INDL 4Y19D 1MCRA 1MJUL 3HA0A 4K3EL 3PWPD 4PJ7A 1RZIB 3RWCA 5F1NB 5D4QA 4RA0C 1D5XB 4GW5B 1IILE 4P2OB 4Y4HB 3DGGB 3NCYS 1KOAA 1LK2B 1B0RB 5GRJH 1EXUA 3HE6D 1QG3A 4G5ZL 1PJ9A 4FZEH 5JPNA 4GG6A 2X40A 4X8JA 5CINL 1NANH 1TJGH 2KZ1B 3VXRA 4IRJC 4L8SC 4MA3B 5FA3A 4CMHC 3RL2A 2ITDA 1T6VN 1AGFA 1TVHB 2A6KB 5JORA 3WLBB 5KTEH 3T2OA 5HGHA 2J8OA 3M17A 4XWGL 5FAAA 1HQ4A 1TNMA 2PTTA 4MX7B 4IRSA 1KELL 4LFHG 2GIYA 2XV6B 4R8WH 5GS2H 2JCCE 2HT4C 4YQXL 2UWEF 3QUXD 3ZT5A 5I1DA 4OF8A 3RKPA 3GKWH 4NO0B 5DRZA 4PLKC 4LIQH 2F53B 3MOQA 3LPFA 1INQB 1G7LB 5ENWA 3MLSH 3HC3H 3HI1B 3OJMB 1HZHL 3U7YH 4UQ3B 4OAWB 2AJZA 1BZQK 4MA1C 3QIBB 5T33H 1U9KA 2IPTH 2W0KA 4CNIB 2Z35A 7FABH 3X12B 3U4EB 3P0YL 3CUPB 2IH1A 3L3OB 2AXHA 2I25N 3S6CA 3MJ8B 5I1KL 1NC2D 3WDJA 1T7WA 2BVPA 1ACYL 1KUMA 1SY6A 2YSSA 4QRPE 5E6ZA 3L6FB 1VGKB 4IMKC 3TBYA 2AK4D 4JRXE 3VMOA 2DTSA 4P2QD 4G7YH 1RURH 4FTVD 5GRVK 4YHOL 5FK9B 1YNTB 5EZIH 3BMWA 3HI6L 1XGQA 1KCSL 5DD1H 5IFHL 4HUVB 1H9VA 4BK4A 1NEUA 3E6HB 1OVZA 2DI9A 4LU5H 4JG0H 5EO0B 1G7JB 2FZ3B 3E3QC 2PW1A 4HD9A 5C0RH 3MNWA 4PJEF 4K94L 4AEHL 1FE8L 5E00B 2B39A 3T08A 1MHHA 3U6RB 3B5HA 4JVUA 3RWJA 5D2NE 5I73C 2CDEA 4M5YH 5KN5A 5A2JH 3OR7A 4XCCH 2J6EH 4HSQA 5EOTB 5E94B 1F2QA 3FOMB 2QL1A 3CZJA 4KZDL 1T66C 3JV4A 1NAMH 1A6ZB 5K9OA 1MJ8L 4ISVB 2OJZH 4HF5H 3W0WA 2Y1VA 1HHKA 2WINB 3KYOA 1OCWL 3FB7A 1DBML 1F4YH 4RMVA 4P49A 1ZVSA 3NPZB 1AR2A 5BV7L 3I75B 4YHPB 5ETUA 4R26H 3EDJA 5D7IB 2ADIB 3FHQA 3WFDH 3QJHA 4WEBH 2FEDD 4HPYH 5BQ7A 3VJ6A 1DN0B 5IB5A 3SE8L 2Z4QB 4Q0XL 4Y5VB 4AQ1B 4LRIC 5LWYH 1GIGL 3EHBD 3MRKB 1S8DB 5ESQB 5A3ID 4BQBA 3QIUC 1BVZA 5KSBB 4YXKL 3IJHB 5C0DB 1CBVL 2VDNH 1FFPB 1WWBX 3D3VD 5FYJD 4NKIL 4MVBC 1W72L 4G7VH 5FYJL 2ZOLA 2IANB 1DFBL 3L7EB 4ZSOA 3UTPD 5IFJB 4X9BA 2A9NH 4MB5A 3FO1A 3C08H 3MA9H 5C0AD 4X7SL 3HNTL 5DJ0A 4NJ9L 5F3HB 1XGYL 5FKAB 3WBDA 2A1WL 4PY8I 4Q9CA 4R3SB 4DJMA 5CIPH 1MLBA 4XNUH 3EYSH 4GKSA 1LDPH 4JQVC 1CL7H 5J6HA 3DI2B 2YD9A 2X89A 2D4FA 3U1SH 2Q20A 4GXVH 4JJHA 1I9RL 2YD4A 4RQQB 5GGSA 3EZ8A 5MEPB 2VQTA 1Z5LA 4FXGA 3N06B 2N7BA 2VITA 1I7TA 4RFOH 4U1IA 1IC4L 4QRQB 2GAZA 4R4ND 4NQDE 5HDQH 4ZPVA 1S9VA 5CSGA 4U1MB 4J6RL 3GB7B 1JHLL 3VFOB 3CMGA 1JPFA 3C5ZB 4XAWH 4OLYL 1HHIB 1ZLSH 3RUGB 1FFOA 4M7JH 2EXWC 1YEEH 5FFLA 3U7AA 3AMLA 3VD7A 4RGNB 4UUJB 5FO7B 1C5BL 2W60A 3MV7D 3VWKD 1KTDB 4X6FA 2E7CA 1C08A 2X4NB 1ZGLP 2MCPL 2O26U 3ROOB 1LVEA 5H35A 4ELME 1J05A 2YC1A 1XIWD 4F7EA 5HHXH 5FUCC 1X5HA 3MRHB 3MRPA 3VRIB 1X3DA 4LSPH 3T3PF 3GK8L 2KH2B 1T1ZB 5IVXB 2O5YL 4HS8H 1CF8H 5FOBB 5CEZD 4Z7NE 2ZJSH 4HFWA 3S35H 2NPLX 4WUUD 3ZE1E 1MWAL 3BGFC 1U6AL 5CEZL 1JWUB 3X13B 2ZSVB 4NN5B 3B9DA 1EZVX 1MIMH 2BP3A 3PWLB 2EZ0D 4ODXB 5IG7A 5DK0B 1XCQA 1AJ7H 2MFNA 2QADC 1QLFA 4FQQA 2Z91A 3ZL4H 2RFXB 3V0VB 4LLVA 3TIEB 4YHIA 2R0LH 5LG1A 2Y36H 2QQLH 3HKFA 2V2XB 1FO0A 4HJGA 1FSKB 5D72H 4JY6A 1RY7B 5I74C 3HC4H 1PG7L 1AI1H 1WAAF 4KJQC 1UKSA 3O3EA 4UTBH 1BOGB 1KC5L 1LP9B 3O45B 3QCVL 5EOCJ 2P5WB 2HRLA 3RVXD 3KPLB 1MQKH 3EKCA 4KK6D 4QCIA 1AC6A 3QISA 5HI4C 1KB5L 1VACB 3BH8B 3SY0A 3MRIB 4NQVB 1AC0A 4HUMB 3QUZC 4UU9B 5SWQB 4ZNEE 4M7ZB 3BP5B 1HH9A 4D9RD 4KJWC 3T0EC 5AAWA 1N2RA 3BMVA 3GIVA 25C8L 2Y6SD 2O5XL 4XTRD 1BJ1J 1LK3H 3TA3A 4P4KC 2OS7A 3ZTJG 5GGUA 5J12B 4JY5L 3WDHA 3BI9X 3VFPA 4C54A 4FFYH 5DMKB 2HTLC 3LDBB 1EEYA 2DKSA 2FEEL 2X4RA 5F7DB 5TE7L 5C08D 3UCRA 1MJJB 3EYQD 2RCSH 4KVCL 1FGVL 1AGDA 4I13B 2HKHL 1FFQA 4YC2B 5SWSB 3QUKA 4PJ5E 2EKJA 4HUWA 5E8EB 4N1EA 5GGRB 3QIBC 2ZKHH 4Y4KB 3IJYB 3RVUD 4J12A 1KJVA 4P5MA 4LGSB 2G75B 1EBAA 2VDRL 2P4AB 5EZJB 1YPZB 1BQLH 4GUPB 4JPWL 1P69B 3N1MC 4M43H 4JFPB 3QUYC 5JXEC 4GS7B 3MOAL 2E7LA 2UZIL 1ZVHA 2MOVA 3V6ZB 2PKDA 1RD6A 4DWHA 3PHOB 5FEBA 4JN2B 3UYPA 2CMRH 5IM7B 2GFBA 3HAEH 3ZHLA 3KYNB 2Y5TA 4G8EA 5FYLL 2BSSB 4MAYA 5ISZE 2XKNA 3VXUB 4ZFOA 4TTDD 1U8HA 5BZDB 4N1CA 3CSYB 5A2KH 4R4BA 3QRGL 3MNZB 3NFPB 1ZK9A 2HFGH 4I0CC 3HS0A 5EN2A 1DBBL 3TWCH 3G6JB 4Y2DD 5D96B 1H8SA 1A02N 1J1XL 3KS0J 3MREA 1I8IB 1KBGH 2RGSA 1HHJA 5B39B 4KQ4H 4H8WC 2DAVA 5L2KB 1HHGB 3VXSA 2OTUB 3JBG7 5BMFL 5T1LA 4XP9L 4HPOH 3BZEB 4PJIE 4CN6A 5KSUA 4GQ9H 4QWWC 4PGZA 3FKUS 3CMOH 4RDQF 4FFZL 1GGUA 3A67H 5TDPA 1HK6A 5IJVB 2VLKB 3TZVB 4NNPL 5C2UB 1JI2A 4QHNA 3L3DB 2ZUUA 5D93C 5DJ6A 5C0BE 3FQRB 4YDLC 4B41A 4FQXD 5DD6A 3FAWA 3T0XA 4UB0H 1Q9KB 4LKCA 3MV9A 5F1OB 4U6YB 3RGVB 3T4YA 4HC1A 2HKFL 4Z7WA 1ZT1B 4NQCA 3OR6B 5FGSA 4G6MH 3GIZH 3QNYA 2CIKA 4LCWB 4UINH 3S4SG 2EDEA 1B4RA 3OB8A 3EOAB 1VFBB 1YUHB 4F9PA 3O4LA 4CU7A 1KYOK 3Q6GH 1A4KA 3PABB 4X5XA 5FB8B 4PTUA 1XGPB 1F90L 3BW9B 4PJBB 4R90H 2LVCA 1E6OL 1I1AC 1MI5B 5ACLA 4ONFH 4R7NA 3OAZK 5KBNC 4WO4B 2BC4B 1G9ML 1FZOB 1FLTX 5FUOH 3RA7L 4X80H 3FN0H 5IESL 2X7LB 1FNGB 3CXHK 3LY6A 4OZGF 5KS9F 3ILQC 3AU1B 4JHWH 4FQIL 1N64L 5GQBA 5LGHH 5DWUL 3ROLA 3ZDYF 3BP4A 3DI3B 3KXFB 2LTQC 1D7FA 1GC1H 2VO5A 3ARBB 5CUSH 2A73B 2CK2A 1HYSD 5I1EL 1KJMB 3RWCB 4XVSL 3Q6FA 3GO1H 3RVWD 1K8IB 1YEKH 4PJGE 1RULH 2A0LC 1NEZG 1UM5L 4GAGH 2VZVA 5MHSE 5T1KA 4EBQH 5IEHB 1RZ8B 2XQYG 4ZO9A 4F9LA 1CYGA 2ADFL 4PP1D 4OZIA 1SYSA 4G3YH 4EI5A 3KPSA 4U1GB 3T4AB 5HYSA 1IKNA 2ORBH 5FA3B 5D2LF 4PGEA 2ITDB 1AGFB 5HYJD 2NXYD 3FAXA 1R5WB 1RIUH 5HGHB 1KCUL 4P46D 1T7VA 1A3RH 1JFQH 2EDTA 4DAGL 3M17B 1DVFA 1HQ4B 4AYFA 3X17A 3V7AG 2PTTB 4IRSB 4LSQL 4Y16C 1OAUH 2VMFA 1U58B 3SPVA 1U92B 5LBSL 5DJXB 3LS5L 4AENA 4E5XA 3QDGE 1CICA 5C09B 1H3UA 1IC7H 1OF2B 2E6JA 3BRFA 1Q72H 1TZGH 5ENWB 1PLGL 4OFYA 3GSRB 2J88H 1Z0NA 1BECA 1BPVA 2MNUA 3PGFH 5DMIH 1J10A 1S78D 2OTWA 3MRFB 4GKZB 4HJ0D 1FL5B 2AJZB 5JTWA 1HEZB 1ZVYA 2W91A 4LASH 3GEWB 1IL1B 3EO9L 3MBED 5DQJB 4HBCH 5CZKA 4H5SA 1IBGL 3AB0B 1JGVL 4LPWA 1NLBH 5JLZB 2PTVA 1I9IL 1JP5A 4IJ3C 1KPRA 1FYTB 5FM5O 1ONQB 3TBYB 3GHBL 5IT2H 3F58L 2XPGB 1QVOA 4OGYH 3BFOA 1T83C 4GKOA 1D5BB 3D69B 3PWPE 4M1DL 3ILPB 5I6XB 3I2CL 4W4OC 1W8OA 5I71C 4R6UA 3O6FC 3PG2A 1J8HE 4M7ZC 3FQUA 5MEQB 2OZ4H 3MRNB 3MNWB 5DQDH 4ZXBA 3GSUA 4F2MB 1WV7T 3RWJB 4F7PB 1G7IB 2CDEB 4KH2A 5KN5B 1N5AA 4U6XA 1IEAA 5AYUH 3BKCH 2CIIA 4JKPL 4R4FH 3GMNB 3F62A 1LO3L 2VOTA 2FJHA 4WTWA 1IM9A 1PFCA 3STLB 4NM8H 4NBXB 3IFPA 5E1AB 3KYOB 3LEXA 2IPKA 5MI0C 1Q0YH 2V5RA 3SDAD 1ZVSB 3HE7D 1A3LL 2BRQA 5ETUB 3L1OH 1ZGLA 4NKMB 1U3HB 5L7XH 3LEYH 4QOKD 2Q86B 4ZD3H 2VSCA 1T89C 3MCG1 3WIFB 3OKDB 2DM7A 5DQ9B 3O9WA 3EDKA 4LOUC 4HDIB 5HTSA 2R2BA 3ZE2F 5I8OH 3V4VH 4QRPA 3HZVA 1PZ5A 2FGZA 1KB9J 3BQUA 3QEQD 4JRXA 3DRTB 4HMEA 1FNHA 3S4SA 4O58H 2DIJA 3NFSL 5GS1B 1F6LL 1YYLH 3HUJB 4YDIH 3WJLC 5IR1A 3HB3D 4OZFB 2AK4E 1B0WA 3H2WA 3H9SD 4P2QE 4CMMA 1U3ZA 3QUMA 1KPUB 4W81A 4F7TA 1JV5A 1ZOXA 3B83A 5GJTH 4BELD 3C60D 2BY0A 2PW2A 3TT1L 2NW2B 1WICA 1DQJB 5DJ8B 2RQ8A 3G5YA 5CJ8A 1KCRH 2YEZA 1ZTXH 2DTML 3B9VA 3DECA 3LQMA 3FQXA 1OOAA 4GKSB 2JTDA 4TTGA 1T21B 3A6BH 3JWNC 3JWOH 4GH7B 1OAZH 1RZJH 1B4JL 4GFTB 4LSSH 3EJZD 4IS6A 4KKCC 4P23B 4PJCB 1Z5LB 4U1IB 2ICEA 4BFGA 1C12A 4XMPH 1YJDH 3RY6C 4U1NB 1LQSR 1JGEB 3HNSL 3DX8B 3QI9C 4QTIL 5J3HC 5BRZD 5HI5C 3TVMA 1S9VB 2BNUB 3OF6A 2VXVH 2VKXA 3ULVF 1NEZA 2WBWB 1RV6X 2W9LA 1GL4B 8CGTA 4X6DA 3VD3A 4EXKA 2CLVA 3NIFE 5F21B 4JEGB 3OJ2C 2JF1A 2D7MA 3L7FB 3SCMB 5ERWA 1EHLL 1HNGA 5JMOC 2VN4A 4Z0XA 1H5BA 2RIKA 3HCVA 1G0DA 3B9KB 4TSAL 5E9DD 3SDCD 4KROB 5D7LB 4WW2A 4XNZB 4MNHA 5I17A 1DBKH 2P8PA 4Z7OE 4S0SD 3BIBX 3L9RB 2XTJB 2NY6B 1CK0L 4QGTA 2Q8BL 3D3VE 5FYJE 1W2KT 4Z76A 4HWEL 4UV7H 4KXZI 3PWUA 4LGPB 4RGOH 5E2VH 2NLJA 4JDVA 4IOIA 4I0PB 5D1ZD 1U8MA 1YEGL 1UXWA 2HG5A 3UTPE 2YPKB 4DUWA 4ZO7A 1WCBB 1A7RH 2EICA 1A9BB 1IEBA 4OF3A 5CBAA 4LBEB 5GJSH 3SDDC 2OM5A 1C7TA 2HRPL 1MH5A 1ZHNB 2ZPKL 4BZ2L 4UTAH 5ID0B 1MFCL 4F58L 1SJHA 1VFAA 4FQJH 4BK5A 2YPVL 4TNWF 4K07A 3D2UA 2H2SD 1NFIA 3SKJL 4YGAB 3QRFM 3RY4A 4OT1L 1S3KL 4GSDH 4HJGB 1FRGL 3L3GA 3S96B 4NQDA 2JJUA 1AIFB 3UYRH 4Y4FD 2G5BB 4JFDD 4YNYA 4LQ1A 4PRPE 3P4MB 4AEEA 3O3EB 5MERB 1U8JB 4K9EH 5F9WB 5DI8A 2F19H 5EU6A 3ULUE 3C6LD 5DJCA 5CBEA 1GH7A 1MAML 4QCIB 1KEGH 4JG1L 3PWVA 1OTSD 4F37F 1JHTB 2V6HA 1QFOA 1T0MA 4LVHB 3UC0L 1XH3A 1GZPB 4ZUUB 2XQYK 2BSED 5DJ2A 1T66D 5IW6A 4HK3J 1HH9B 4ELMA 4IRSC 4XMLL 3GNMH 2K7QA 3MV7E 1GGBL 4ZPTA 4LAQL 5HHMD 2IAMD 1A6VH 4ELKB 1FNAA 4WV1B 1IAII 4J3TA 3BHBB 4LCYA 1JPTH 2BZDA 3JV6A 1BLNA 4P9HC 4YDJA 5E6IA 5LCVH 4YUEL 5EZOL 4YFEA 1YA5A 3WXWL 4P3DB 4ZTPH 3O6MH 4X4XB 5ITBL 4ODHH 5BS0B 4K3DH 4KVNH 5GS0C 1IGCH 4EEEA 5L0QC 1JYVA 5BVPH 5CEZE 1JE6A 2YKLL 2Z92B 5L8KB 4LQFL 1KJVB 3GSNH 1KG0B 4PJFF 5C0NC 2HJFA 3UZQA 1A7PL 5ALCH 1UWGL 4OGXH 3S97C 5FF6B 4ZUWB 1IGMH 3QHZH 3VG0H 3SKMA 1BD2D 1R5IA 3CFCL 4DZBB 1D9KA 4JB9H 5BXFA 4DKEH 1ZHBA 3HZKB 3U4AA 2CSPA 4K8RD 2CDFB 3MLPA 1NL0L 4A2LA 4OGAC 1KFAL 3BDBA 1BZ7B 2Y5TB 4K8RL 5KW9L 5CIPB 1GAFH 4MAYB 4FS0A 2Y4SA 3BD5A 2XKNB 3N9GH 1PYWA 1KPVB 3OZ9L 3VDCA 2BSRA 3RBGA 4YBQD 4YHZH 1WVZA 1U8HB 4DVBA 4PRIE 3RY5A 4R4BB 2DBLH 2R23A 5D1QA 1U0QA 2V9QA 4CUCA 3HS0B 1CLZH 2FIRT 1RFDL 1UWEL 5C07D 3O3BA 2HVKA 2JELL 4NQED 4Z7VB 2VZ3A 2FLRT 2ED9A 1T4KA 1PDKA 2P5EB 3U7WH 3WFCH 4R2GB 1GHFL 3PGCA 3VGBA 5EZLA 3WXVH 2VE6A 4MJ6A 4FG6D 4YXHH 4D9RE 3NIDE 4CVZA 4JKMA 5T3ZL 3LSOA 4XP5H 1HI6B 3G5ZB 5DEFB 1ZT4A 1S9WB 1FZJA 4M7KH 4OFVA 1F6AB 5DLMH 5BJTB 1Y0LA 1MCEA 4WI9A 4HIHA 3HRPA 3CXDH 3IDNA 4G80B 1KTRL 4X7EC 3MJ9L 3MTRA 3QH3A 5E2JA 4QGYA 3VWJD 3LIZL 4Y88A 3D9AL 5CGTA 1NLDH 1MCOL 1VKXB 2PR4H 1P6FA 2YA1A 2V2WB 2AK1L 2X4PB 4YDVB 4LSVH 1X5IA 4QHNB 4TVPH 4TN9A 2NX5E 3VE0B 4AM0A 2OP4L 4KI5F 1E27A 5AZEH 4LKCB 3H3PH 3MV9B 4WFHD 3T4YB 5KG9A 3Q0HA 4M93B 4AH2B 1HOCA 1NUDA 3IDYB 5ISZA 2OK0H 4HV8A 2NR6D 1H8NA 4HUUB 2CRZA 5FYLE 2BSTA 3BEVB 1E4XI 2AEWA 5DHYB 2ADGA 5IEKA 5JDSA 2D7NA 5HJ3B 1E28A 3SJVD 3OMZA 2F9BT 3HMWH 4YX2H 1SYVA 3V95A 4MNQE 5TFSH 4G6KH 2J8HA 5EOQL 3S35X 1UVQA 3LZFH 4XPTH 1OAYL 2GTZB 4M7LL 1HXMB 1ITBB 3FB5B 2XQBL 1IKFL 4FXKA 4P2OD 3VXPB 4Y4HD 4PJIA 1CDGA 3QEGL 3L3IA 3ME0A 2D7TH 4D0BB 1GGYA 1MREH 2IH3A 4I8DA 5FO9A 2GJ6E 2G9HA 2I60H 1W0VB 1F3JB 2CKBA 2ARJA 1GZQA 5F89B 1LO2H 2PTUA 4WTXA 3Q6FB 3NAAL 3RIAK 1ODAA 5HHOA 3QZWG 3UZEA 1M71B 5C0BA 2VZTA 3C6SA 3ARQA 1J1OH 3CU1A 4P59H 3S88H 4Q9RH 4D8PA 4I2XA 5FOJA 3D18A 5IV2A 1HWHB 1HDMB 4OZIB 3WSQH 4Q9BA 1EFQA 1E4WL 3TT3H 4EI5B 4NO0D 4NO5A 2CK0H 1NKRA 1M7DB 2CH8A 2F58H 2F53D 1EGJA 2ZNXA 3F65A 4K71C 2AJUL 1BFSA 4KROC 4XNZC 1PKQB 3TPUA 3FB8A 1J0YA 1WZ1H 1RZGB 1NMCC 2WBJA 1NMBH 1DVFB 5IF0A 4RDQG 4TYUA 3UTZB 1IZKA 3QIBD 2R56H 2FYYA 3SPVB 4QRRB 4E5XB 4UT9L 3U2SB 5CCKL 3HAEB 5JMRA 5JXED 4GRWF 4U6VL 2V2TB 5CP7B 2OTWB 1UENA 2XY2A 3OV6A 2A6JB 2J8UF 4PP2A 4JANA 1RIVL 5IKCA 1DLFL 3DX7A 4P5TA 1A14L 4LARH 1F5WA 3V4PH 3UPAA 3NH7L 1NGZA 4OB5L 1RZFL 4I3RH 1U8NB 1AD0B 4NO2B 3OHXB 4EI6A 3MLZL 1DQQA 1PZUB 3BGAA 3I6GB 5DJZB 1AP2B 3DVNA 3PHQA 1IGYB 1HQRA 2Q8AH 1NPUA 4O02H 4PJGA 3LH2L 4DN3H 2BCKB 1J88A 1QVOB 3SE4A 1YMME 1I7RA 1XGUA 1T3FB 3OJVC 3EOBB 3UMTA 4WI6A 2BXZA 1RU9L 1WCQA 2EDHA 4R7DB 2LU7A 5DMYA 4ODTH 2YS4A 4MJIE 4KXZH 1ITCA 1S7TB 4PJ9A 1U41A 4FRWA 4M3KB 2PXYB 4XBGA 4OF7A 3CDGA 3TA3C 2CD0A 1BIHA 2DI7A 3JSSA 5H94A 1G7QA 5DUPH 4X0KA 3VMNA 4QWWD 4NPYA 5ACZB 2JCCB 5DSCA 4IRZL 1IEAB 2Q3ZA 4M1CC 3OXRA 4Q58C 5HPOA 2YUZA 3HFMH 1UG9A 4MQXD 5JW5A 2E9JA 1LGVA 2R4SL 3UTTB 5F71A 5AZ2H 3ZYJA 4NRZA 5HDOA 4ZFGH 1PEWA 3BWAA 1F97A 4OV5B 2P8LA 4AMKL 5FDYA 2ZUVA 2VC2L 1FO0H 4L1DA 4LSUL 1A3QA 2E7LC 1F8TL 3T2NH 4ZG1A 3W5MA 2IAND 3FQWB 3S34L 1I1RA 1FBIL 3MBXH 3HTLX 1FNLA 1NC4A 2QKIB 1H0DA 4QRPB 4ETYA 1VB9A 2GJZA 3HZVB 5DR5L 1PZ5B 4JZOA 2J1KA 4JRXB 1WWWX 1UH4A 5I8KL 4J4PA 5F96L 3IXTB 3PWPA 2ZUQB 1CZ8L 4M02A 3OQ3B 5IR1B 4J7RA 1CT8A 2EIZB 4CMMB 1TQCB 4OZHE 5FV2A 2VQ1B 4X9FA 4YIQB 2E6PA 3GHEL 5E4EC 1ZLWK 3HE6A 4N9OB 3V4UL 1YQVL 3O2VH 3H7LA 4OCXH 4L3CA 2W9DL 1MFBH 2HT2D 2WMPA 1ORSA 1EIBA 2YEZB 5D2NB 3FQXB 3BKJL 1MEXH 2ENSA 2G5RA 1CXIA 3BH9A 3ULUH 3C5ZD 1LEIB 4BSJA 4PY8J 4XVTL 2A0LD 1I3GL 4RGND 3QUXA 5T1DH 2ICEB 4HW6A 3MLYL 4BH8A 2R1WA 2FCBA 2F5BH 1SBBA 3PDDA 4LK4A 3ZDZF 3KLHC 4LPYA 3QO0A 2CUHA 2R0KH 4G6JL 2P1YA 1ZHKA 5EFIB 3L5WB 1AQKH 4NKDA 4HKZA 5TE6L 1JF1B 3JWDC 5I1JH 1U91A 3F7PC 3IFOA 3ESUF 4P2YA 5KVGL 3ELAT 3MGOA 4ODUA 5J9PA 5ERWB 3LN9A 5DS8A 3UJIH 5KSAA 2VL5A 4Z0XB 1H5BB 4F9PC 3VFVA 4AG4L 1OB1A 4U1LA 5E08H 2IFFH 1ETZA 2CGRL 2QQNL 4EUPH 3IAGC 2AK4A 3QEQE 4Z7UF 4LSRL 3CH1A 4P2QA 1W0WA 4FTVA 1OGAB 4M1GH 5BO1H 1MJ7H 4XPGL 5C92A 4CDHA 4F7MA 4X99A 1OP5K 5FHAL 1OT1A 3L5XH 4OZ4A 3H9SE 4M6NH 3LKQB 2NLJB 3GJFK 4JDVB 1CTNA 3NABH 3VFWB 1U8MB 4XNQB 1BEYH 3PP3K 3QEUB 1X4YA 3EYFB 3EW3B 5HVFB 2ZSWB 1KCLA 2P5WD 4GO6B 5I18L 4KKNA 1MH5B 5FYKL 5F7EL 4PB9H 1X5FA 3QXDA 2YK1H 3M1BB 3MO1A 4JRYB 4XP6L 3D2UB 2R8SH 3GGWB 2X1PA 4UNUA 1OM3H 3TBSA 4BSVA 2XA8H 4DEPB 3WFBH 2DQCH 2Y5EA 3BN9C 3BDYH 1N6QH 2VL4A 4AZ8A 2P7TB 3RAJH 1DEDA 1VPOH 4N8VA 4RZCB 3KJ6L 4V2CB 1KGCD 4F9LC 1E4XH 3GSQA 4HC1H 4EI5C 2HN7A 1IGTB 3FT4B 3ZLQC 1IKNC 3F7QA 4LLWB 5DJCB 1SVZA 3MYJA 3DVFA 5L2JA 1RUPH 1BGXH 2HJLB 3VI3F 3PWVB 2EYSB 2FGWL 4HIIA 5JNYA 5CILL 4PG2A 1RZKH 4LVOB 4PJDF 4XZUB 3BP7B 5SWSD 3CVHH 1DVFC 2BRRH 5LKNA 1IRAY 2AKRA 4DGIH 4ELMB 3MR9B 2VDML 4Y4KD 4A6YL 1F00I 4ZPTB 1I75A 1MAKA 1W72A 1JMXA 3D3VA 4RMTA 1CICC 3HR6A 1BLNB 5E9DE 3SDXB 4LLMA 5E6IB 1N3NA 4LMQE 2UWEE 4GBXB 1BIIA 3HC0A 4DCQB 2DQDH 2Y07L 2YPLE 4ZO6A 3ULSB 4JDTL 3WUZA 4LOUD 3T1FB 3EOTL 2X70B 3P9MB 4D9QD 1DBAL 1XF4B 4MS8C 4TOYL 4OIAA 4NHUB 1NCUA 3VH8G 4FOMA 2A9MH 4LHUB 3VXUD 3W81A 3G9VA 1ZAGA 4QHKI 2ICES 1SHMA 3BZFA 5F3BB 5ADOL 3ZT7A 5BXFB 5KVDH 2EDKA 4PJHF 3CCHA 2ARJQ 1YC7A 3VXTA 5A1AA 4FQCL 5C3TA 3DURB 1T0NB 1LE5B 5I1GH 4DGYL 1FLRH 1S7XB 1UKQA 3BKMH 5L2KD 2XZQH 2BSRB 4I18B 4JFDE 2B4CC 1PAMA 4JFQB 1BBJA 4XPBH 5HHNA 3THMH 3KPMA 4DK3A 1PSKH 4ZXBC 4Z7QF 4FZ8H 1MF2L 2VXTH 2EH7L 4F8TA 4PJEE 2HVKB 4P5KB 4JQIH 3P0VH 3VWKA 2H2PC 3MV7A 4HWBL 4Z9KB 5HGBA 4J1UB 4LCCA 4MD0A 2VE6B 2VLKD 5EUOB 3QDHA 5J13C 1XGTB 1KENL 3GSXA 4RIRB 1YEIH 2I5YH 1YN6B 3LSOB 2BOCA 1XIWA 4G9DA 2OSLB 3HPLB 5HHME 4JM2A 1E0OB 3W9DA 3HZMB 1F4WH 1Y0LB 4POUB 3RGVD 3CFJA 5DUBA 4R0LA 4MD4A 4PJ5B 1QBMH 2DQTH 1MWAA 4K7FA 4LCWD 3TO4A 2HMID 1K5NA 4NC1E 3ULVL 4K7PL 3I3BA 3O9WC 1P84J 2OX5A 4KZEL 2IQAA 2VH5L 4BZ1L 1AGCB 3T2QA 3VXOA 2V5SA 1MHCA 4KDWA 4WHTA 1S7RB 3BQUC 3MUZ1 4KV5F 1CLYH 3RWFB 1PQZB 3KPNB 3ORJA 1B2WH 5KG9B 5ALBH 2AI0H 1HOCB 2GT9A 4KK9C 4QXUL 3IDXH 3B2VH 4HUKB 4NKOA 1FJ1A 1MI5D 1O7SA 4ODWA 5IVZB 4KHXH 4WO4D