3MABA

Crystal structure of an uncharacterized protein from listeria monocytogenes, triclinic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
LANLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 32
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3mabA00
3C23A 1JXEA 3LDAA 4RT3A 4RPYA 4JUZA 3EYZA 4IQVA 4UQGA 2IBKA 5DB7A 4I2GA 2BKEA 4ED1A 2IMWP 4RQ8A 3GV8B 2XGPA 3RRGA 4O5KA 9ICKA 1ZQPA 9ICOA 1AROP 4YD2A 4J9QA 7ICQA 4UB2A 4F92B 3EWAA 3PVXA 4QW8A 2R8HA 1XC9A 2A1JB 2ATLA 5KG5A 3V6HA 1NK9A 3PW5A 5J0QA 3C5GA 3RB4A 3PW4A 2BHNA 4I2AA 4UAYA 4GLXA 4P4PA 4RQ1A 2PI5A 4PPXA 5KFDA 4B9SA 2JZBA 2ISOA 1NJWA 1TAUA 1N56A 5KFBA 3Q8LA 3C1ZA 4MEXA 4JV1A 4DSEA 1ZQYA 5J2KA 5KG0A 4MF8A 1RYRA 3Q8RB 3PR5B 5KFMA 4LZGA 3T3FA 1L3UA 1BPDA 5DQIA 4UB3A 4DL5A 9ICEA 3MGHA 1U48A 4KLHA 4E0DA 1COOA 5KT5A 4MFAA 4DL6A 3H8SA 1BPXA 2FMPA 1XU4A 4K4GA 4TQRA 5DB6A 4YVZA 4YR3A 4DFPA 3PMLA 3C1YA 2C22A 8ICSA 5HP4A 1TK0A 2PFQA 4DS5A 2AGPA 4KITB 4ED2A 2PFNA 4PHAA 2J6UA 1UT8A 1BPYA 3SZ2A 4EEYA 1KEJA 3TANA 4P2HA 1KFDA 4EBDA 4ELUA 4ED0A 4KLLA 4RZRA 3FDSA 5J0TA 5DBBA 2NRZA 4TUSA 1QSSA 5DLFA 1HUZA 1KTQA 2ZJ8A 5J2JA 4EZ6A 4I2CA 3MGIA 4YMMA 5HNKA 5J0YA 4DF8A 4YFKA 4YMOA 2JZBB 4UB1A 3PX0A 4KLEA 4DSFA 1KSPA 3PV8A 5KFQA 1UT5A 1ZQUA 3BQTA 2ZUCA 1S0VA 1SKRA 1QSLA 5J2BA 2F1JA 3C2LA 4YXJA 4NLNA 2MUTB 3PMNA 3RJFA 4R65A 3RH6A 2UVUA 4RNOA 9ICVA 2Y1JA 1T7PA 2Y1IA 2PFPA 5F9LA 2P6RA 4TQSA 5KFAA 4KTQA 1BPZA 5IIIA 4DOBA 2BCQA 2XGQA 4ECQA 4LZDA 5J0UA 4RQ3A 4Q44A 3B0XA 3T5HA 3PW7A 2BQUA 4DSJA 9ICJA 3K75D 1K1QA 5KFIA 4BDPA 8ICHA 4RPXA 3MFIA 3AU6A 3OHAA 3RR7A 2BCRA 1ZQGA 3V72A 5DGBA 5KFYA 4KLMA 7ICMA 5KFEA 1NKCA 2J6SA 4DSLA 5CJ7A 4ECXA 3UXNA 1QTMA 1NJYA 5L1KA 4QZHA 5KFXA 3TI0A 3OSPA 9ICNA 2PI4A 1HUOA 1QSYA 8ICRA 7ICRA 2BGWA 4PGXA 4DQSA 4DL4A 5KFVA 4Q8FA 4R64A 2XY5A 4I2IA 3GIKA 1NK7A 4IQWA 1IM4A 4KLSA 4DWIA 4O3QA 2JEJA 4ECRA 1KFSA 1NJZA 1C7YA 1KFTA 3JPTA 1MQ3A 1NK5A 4F2SA 5KFFA 4M9LA 4MFCA 4M2YA 4DF4A 1D8LA 3PR4A 2BCUA 2F1IA 4RPZA 3N4MB 4QWDA 1RZTA 3OGUA 4X5VA 5IILA 5DQHA 3G6YA 9ICSA 4IR9A 3RJGA 3MDAA 1DOQA 3H4DA 4O3OA 1KLNA 4KLJA 5IIJA 3KHGA 4KLTA 4I28A 1ZQRA 3UXOA 5KG1A 3SV4A 4I2FA 3MR5A 8ICCA 1ZQOA 4GXKA 8ICAA 2ZTDA 5KT4A 4JWMA 3RAXA 3ZDBA 5KFOA 1ZJNA 3V6JA 3UPQA 1S9FA 2PFOA 3SYZA 1B43A 2ZTEA 2FLPA 4M6WB 3RH5A 3RTVA 3RB6A 2NRWA 1ZQLA 4KLIA 3GQCA 2W9BB 1TK8A 9ICPA 1IXRA 5J2FA 3RRHA 2HVHA 3IHQB 5J0RA 1ZQNA 4Z6EA 2FMQA 2R8GA 4DOCA 2KZZA 1ZQMA 3C21A 3V7KA 4F5RA 9ICWA 4QZGA 9ICRA 3MBYA 4B9MA 2BQ3A 2DPJA 4KLGA 1ZQWA 3TARA 5J2GA 3BQ2A 1NK0A 4Z6FA 4YN4A 3OJUA 1XSPA 1V9PA 5KFNA 1NK4A 3EW9A 1SKSA 1PZNA 4YCXA 3JPSA 4KN7A 1XWLA 4IQTA 2V4RA 2RDJA 3ZDEA 1ZQDA 4NLZA 3V6KA 5EWGA 4DS4A 2KZMA 3TQ1A 4HYKA 2I9GA 9ICXA 3SI8A 4O3PA 4RQ5A 9ICBA 1HJPA 3UXPA 4F4WA 4ED3A 3JPNA 3ISCA 4J9RA 2BR0A 2P66A 1JN3A 3HT3A 4RNNA 5KFLA 4YR0A 1S97A 1CEZA 9ICQA 4BXOA 3RR8A 5L1LA 5J2AA 4C8OA 3TAQA 5CWRA 3PW2A 1L3VA 4ECZA 1ZQSA 4DQRA 4RQ2A 1X9MA 1L3SA 5CA7A 2HHXA 8ICJA 1D8YA 2W8KA 4KLFA 3ZDAA 9ICFA 2LYHA 2C28A 1ZQBA 3EPIA 4KLQA 5KFSA 2AGOA 1LB2B 1JX4A 4IRCA 3GV5B 4DL7A 3PX4A 3RJJA 9ICHA 4MF2A 3HW8A 2AQ0A 4UB5A 2Q0ZX 4QW9A 4KLDA 4B9LA 1ZQZA 3RJIA 2ZJ5A 2FMSA 2ASLA 2AGQA 8ICWA 2BPFA 4JK1A 4J9SA 4YR2A 4F8RA 4YQWA 1ZQXA 3GDXA 3KHLA 7ICSA 2M9NA 3MFHA 5DBCA 4QZ8A 4LVSA 4NLKA 5IIMA 2WTFA 3MDCA 3RB3A 4C8MA 4RQ6A 2W9CB 3T5JA 4NY8A 2ZUDA 3HP6A 5F9NA 4NM1A 4RT2A 1SZPA 3BQ0A 4QWEA 1T8EA 3G6XA 3THVA 1Z00B 4RU9A 1SL0A 5KFRA 1BGXT 4QZDA 1RPLA 4KN4A 4O9MA 4F4KA 4F91B 4UBBA 1S76D 3M9NB 4Q45A 4GXJA 4M9HA 2HHVA 5J2IA 5KTQA 1CUKA 2R8JA 8ICKA 4UBCA 3PO5A 1TVAA 4XQ8A 4QZBA 3V7JA 8ICNA 9ICGA 1MC8A 1TAQA 5KG3A 5D49A 4I2EA 1SL2A 4RQ7A 3QZ7A 1RXVA 2JEFA 4M9JA 5KFWA 3TFRA 2XY6A 4GC7A 3JPPA 2UVWA 4ECYA 9ICTA 1EXNA 5J0SA 3IM1A 2V4QA 5BPCA 4RQ0A 4DQPA 4ELTA 4DEZA 4FS2A 8ICVA 3UQ2A 5KFPA 3ZD9A 2ALZA 1BPBA 3C2KA 5L1IA 4B9TA 5KFUA 1NKEA 4ED6A 4FBTA 4Q43A 7ICIA 5CP2A 3PX6A 1U4BA 4FBUA 4TURA 1X2IA 4RQ4A 2FLNA 2ASJA 1ZQCA 2UVRA 3E2EA 2IHMA 2ZJAA 4GXIA 2BPCA 5KFCA 4BXOB 4DLGA 1XO1A 2PXIA 5DKWA 4C8LA 3ORYA 1RXWA 2HHUA 4J9LA 4KMUA 4DOAA 2HVIA 1ZQEA 9ICMA 5CR0A 5J2CA 1KDHA 4ED8A 1ZQKA 5EWEA 4F3OA 4NLGA 8ICGA 3MR2A 2BPGA 3OJSA 8ICFA 2R8KA 2ISPA 3M8RA 4XUSA 3KTQA 7ICNA 5DGAA 7ICHA 4IQUA 2GWSA 7ICJA 2XCPA 4UAWA 4O3NA 5BOLA 4PHDA 1WCLA 5KG7A 4RUCA 4DLEA 4RUAA 4DL2A 1TKDA 4M0AA 4KLOA 8ICOA 8ICIA 3ISDA 1NK8A 4FO6A 2H5XA 4O5EA 4RNMA 4DFMA 4IRKA 4Z6DA 3T5LA 3C2MA 3Q8QB 4DFKA 8ICMA 7ICVA 1Z3EB 5HHIA 4PHPA 5EOZA 1JXLA 5J2HA 3Q8PB 4EYHB 4M9GA 5KFJA 5C5JA 3BQ1A 3BJYA 5KFKA 5DLGA 2KN7A 4EBEA 2BDPA 3SV3A 4O3SA 2ASDA 1LV5A 1DGSA 4QWCA 5DB8A 4P4MA 1S77D 3OHBA 1ZQJA 5IIOA 8ICTA 3ISBA 4J9MA 7ICEA 5DQGA 5J0WA 4R8UB 1SKWA 1XSLA 4F2RA 4F93B 2HHWA 4YXMA 3GILA 2BCVA 3RJKA 5J0OA 2KZ3A 4F4XA 1TK5A 3ZDDA 1XSNA 9ICCA 4QZAA 1S0MA 2J6TA 2XY7A 4R8UA 4PHEA 2NRTA 3ZD8A 1NKBA 1WCNA 3QEAZ 3RBEA 2B21A 3GIJA 4JV2A 5KT6A 3JPRA 3M9MB 8ICYA 4MEYA 1A77A 4F4ZA 4FS1A 1ZQAA 3JPOA 4J9NA 2NRXA 4ECWA 2JEIA 4YG2A 4XRHA 5DB9A 4PGQA 4C8KA 4QZ9A 3K4GA 4BWMA 5KG4A 4QZEA 1BPEA 4YP3A 5KG6A 4R66A 3HWTA 1QLNA 2IHNA 2KFNA 4B9NA 2IA6A 3RB0A 8ICQA 2ZTCA 3H8WA 2W9CA 3MABA 5KT7A 2P6UA 4I2HA 4YMNA 4CCHA 5J2DA 1S0NA 4Z6CA 1D9DA 4M47A 2XCAA 2W9MA 4J9KA 2FPKA 3GIMA 3KHHA 5KG2A 1JIHA 3AU2A 5KFTA 2XC9A 1BVSA 3B0YA 5KT3A 5KT2A 3HPOA 2HHQA 4TUQA 4DQIA 4I2BA 4QWAA 2HHTA 2KFZA 7ICTA 1ZQHA 4EBCA 5DG8A 4F5OA 5DBAA 4YD1A 4ED7A 2MAXA 2BQRA 4G3IA 3C5FA 9ICIA 3QE9Y 8ICXA 4F5QA 2V9WA 1L5UA 7ICOA 3Q8SB 3H4BA 4DFJA 3QEBZ 3MR6A 5J0PA 4Q8EA 3V7LA 4IRDA 3Q8MA 7ICLA 4PGYA 5DDMA 3LK9A 4O5CA 2VA3A 2NRVA 1B22A 5D4BA 4ZH4A 1MQ2A 1ZQIA 4DSKA 5HMLA 2XO7A 2W9BA 1U47A 7ICFA 3NGDA 3UQ0A 1X9WA 4QWBA 3QZ8A 2BCSA 2FLLA 3H7IA 1A76A 1H38A 1XS9D 4DQQA 3LWLA 5D46A 2HHSA 3RJHA 5L1JA 9ICAA 2KTQA 2AQ4A 8ICEA 1N48A 4DL3A 2C2DA 2W8LA 3H40A 4GC6A 1U49A 2AU0A 5J29A 1S0OA 1NOMA 5DDYA 5HMMA 4EZ9A 7ICUA 7ICKA 1K1SA 5L9XA 4ECUA 2FPLA 1Y88A 9ICLA 2OWOA 1U45A 5IIKA 3RAQA 3BDPA 3MR3A 1ZQFA 1ZQTA 3RJEA 4F5NA 1S10A 1RYSA 1NJXA 1ZQQA 4MFFA 4J9PA 1UA0A 5TZVA 1Z00A 3AUOA 4TUPA 2DFLA 4I2DA 4JWNA 1SL1A 3GV7B 1X9SA 3M8SA 4M04A 2AJQA 1ZQVA 4M6WA 3T5KA 4ELVA 1MSWD 7ICPA 2ZUBA 5J2EA 4M9NA 1TV9A 4R63A 3EPGA 3PO4A 8ICZA 2RDIA 4ECTA 2VA2A 5BOMA 1ZETA 1KRPA 3PY8A 8ICUA 4UAZA 3TFSA 1JMSA 3FYHA 3NTUA 2F1HA 4BGDA 3M9OB 4J9OA 3LWMA 2VANA 3JPQA 3GIIA 1T3NA 4PH5A 5DG9A 1U9LA 3KHRA 1D9FA 4I27A 2VA8A 2R8IA 4JV0A 3PW0A 4O3RA 2FPMA 4K4IA 5JUMA 3G6VA 4DO9A 1L3TA 4KLUA 2C2EA 1T4GA 3TAPA 4BWJA 3OSNA 2W9AA 3PNCA 3RBDA 1ZYQA 3ZDCA 2C2RA 8ICPA 3ETLA 4I29A 5IINA 8ICBA 2JEGA 4DSIA 4IR1A 5DG7A 1UA1A 4QZIA 3GFKB 2A1JA 4F4YA 7ICGA 3N97B 9ICUA 3RH4A 2I1QA 5KFZA 5CB1A 2DPIA 4NM2A 2UVVA 4ECSA 1NK6A 5KFHA 8ICLA 4O0IA 5J0XA 2MUTA 4EYIB 5CHGA 3H8JA 4B9VA 3Q8KA 5HHHA 4QZCA 4B9UA 2HW3A 4ECVA 4P4OA 4K4HA 1TFRA 4C8NA 4I2JA 4XA5A 1ZJMA 5EWFA 4F50A 4UB4A 5KFGA 3EZ5A 3HX0A 4QZFA 4F5PA 4NXZA
chains in the Genus database with same CATH superfamily
3LDAA 4RPYA 2IBKA 5DB7A 1L8OA 2EZZA 3SR6A 3KBBA 1AROP 4F92B 3EWAA 2Y9UA 3OTQA 1NI3A 2WF6A 4P4PA 3C29A 3PSPA 2JZBA 1NJWA 1TAUA 4MEXA 3C1ZA 1RYRA 3PR5B 2W11A 1BPDA 2Y0SF 3S6JA 4UB3A 3TADA 3MGHA 3KD3A 1COOA 1ED1A 1BPXA 3H8SA 4ACOA 2VJ4A 3TACB 3C1YA 1L7OA 4DS5A 2AGPA 4UB6U 4KITB 5AKGA 3SZ2A 3F2CA 1A6SA 4ELUA 2JH7A 4C4TA 4ED0A 4RZRA 2YTUA 3FDSA 3VCBA 1QSSA 2NRZA 5DLFA 4EZ6A 1N2XA 4RQNA 5AM3A 2ESEA 5ALPA 4YFKA 3PX0A 2G5HB 1KSPA 1KBUA 2MU2A 1QQ7A 2F1JA 3C2LA 4NLNA 4R65A 4RNOA 4US8A 1T7PA 2HSZA 2NO5A 4ECQA 5J0UA 4RQ3A 2BQUA 3B0XA 3OPXA 5ALRA 3PW7A 1L7PA 5KFIA 3BS7A 4BDPA 3MFIA 3PZPA 3RR7A 5TISU 3SQIA 3V72A 1VJ5A 4ECXA 3UXNA 5B5EU 1SV4A 3BZCA 3OSPA 9ICNA 2IOFA 1HUOA 3I1YA 2AHOB 4PGXA 4DQSA 3QXGA 2K4IA 4I2IA 3GIKA 1D8BA 4FFDA 1NJZA 5ALDA 1NK5A 4F2SA 4M9LA 4DF4A 3F53A 1RZTA 4FZMA 4X5VA 5DQHA 3RJGA 1DOQA 2LBOA 4O3OA 1KLNA 4KLJA 5IIJA 4I28A 5KG1A 1T3QA 3MR5A 3F5AA 4GXKA 2EZYA 2LMRA 2BDUA 1ZJNA 4WJ3B 2JMGA 3UPQA 4CDGA 2E8NA 3R9KA 2FLPA 3RH5A 1ZRNA 3RTVA 3BZKA 3TKAA 2WFAA 2W9BB 9ICPA 1ZQNA 4F72A 4DOCA 4F5RA 3KZXA 2BQ3A 3BQ2A 1XSPA 3PSFA 1SKSA 1ZQDA 1XWLA 4IQTA 4P0QB 2W7PA 3TQ1A 2I9GA 2OH2A 5AKYA 1HJPA 4ED3A 2MA1A 2KJ9A 3WK5A 3ISCA 3IV6A 4J9RA 5ALIA 5KFLA 4YR0A 1CEZA 4BXOA 2KE7A 4C8OA 1L3VA 4RQ2A 1L3SA 1D8YA 4CNQA 3ZDAA 1ZQBA 2RQ5A 2Y0SC 2AGOA 1JX4A 5EE1A 1NNLA 4MF2A 4UASA 1Z4OA 4KLDA 4B9LA 1KL9A 4JK1A 1KN5A 4J9SA 4F8RA 7ICSA 2LPEA 3LVVA 3MFHA 4NLKA 3UMBA 2ZIVB 4FZNA 3T5JA 4GIBA 3HP6A 2OYYA 1T8EA 4RU9A 1SL0A 2MRLA 4Y2TA 5KFRA 2P35A 4F4KA 4UBBA 4Q45A 4GXJA 4M9HA 2LYBA 5J2IA 3PO5A 1TVAA 1MC8A 5D49A 1MA7A 4RQ7A 4M9JA 5KFWA 2IOHA 4GC7A 1ZOLA 9ICTA 3QUQA 4FZLA 4MHVA 5AIBA 1BPBA 5KFUA 1NKEA 4FBTA 2PMZC 4Q43A 1ZQCA 2EAMA 5KFCA 2PXIA 4EX7A 4C8LA 2ZIWA 4J9LA 4DOAA 9ICMA 5CR0A 2HBLA 4ED8A 2YMQA 5EWEA 1ZQKA 4F3OA 3I28A 3MR2A 2R8KA 2ISPA 5DGAA 3F2BA 2GWSA 2EAOA 4DL2A 4KLOA 8ICIA 2ZIWB 1SXDA 3ISDA 1TE2A 3LVWA 4O5EA 4RNMA 4DFMA 3VC8A 1IIPA 2G0AA 2G07A 1Z3EB 3Q8PB 4QNLA 5KFKA 5DLGA 4UAVA 2BDPA 3O0FA 4QWCA 1S77D 2HOQA 2KP7A 5JRTA 2BCVA 4F4XA 2EANA 3QUCA 1S0MA 1Z1VA 4ZOHC 4R8UA 2ES6A 2L5YA 2NRTA 1NKBA 1WCNA 1Z4NA 3GIJA 4JV2A 4MEYA 5A0LA 1A77A 4F4ZA 1ZQAA 4JMUA 2JXJA 2NRXA 2JEIA 3CP8A 1PVPA 5KG4A 1DK3A 3L4PA 4YP3A 1QLNA 2IHNA 2P6UA 3UMCA 1D9DA 1NZPA 3B0YA 2H3IA 5KT2A 2HHQA 4TUQA 2HHTA 7ICTA 5ALHA 2GH1A 5DG8A 4EBCA 3C5FA 4F5QA 1O03A 2DL0A 5J0PA 5EE3A 3Q8MA 2H3ZA 2KD1A 1YT3A 4DCCA 5AK3A 3ONNA 5HMLA 2XO7A 2W9BA 3NGDA 1X9WA 4QWBA 1L7NA 2KVSA 1H38A 4CF3A 2HHSA 1J2MA 2E8MA 3LYSA 4P0PB 5JU5A 1U49A 5AI0A 2ZXIA 1DGJA 9ICLA 3WKDA 2OWOA 2NO4A 1ZQTA 4F5NA 3WK6A 5ALUA 2LYAA 4JWNA 1SL1A 2W04A 3GV7B 4M04A 3QU4A 4OJPA 2VA2A 3PY8A 2YX8A 2DWQA 4HAIA 4PJ0U 2ZIUB 1D9FA 4I27A 4LJXA 4JV0A 2R8IA 2FPMA 3SAFA 3G6VA 2QB0A 3PNCA 5ALTA 3ETLA 8ICBA 4IR1A 4PL2A 3N97B 9ICUA 2I1QA 5CB1A 2UVVA 4ECSA 1N61A 4O0IA 5CHGA 3H8JA 1N60A 5ALOA 5KAFU 2ZIXA 4XA5A 1ZJMA 5EWFA 4UB4A 4DFDA 3PSTA 5KFGA 4PZNA 3HX0A 4F5PA 4UATA 2RHFA 2ZIXB 4IQVA 1S5LU 3NUQA 2D3DA 3NRWA 3RRGA 4O5KA 1ZQPA 9ICOA 3QX7A 4CE6A 4J9QA 3T79A 4QW8A 2ATLA 1NK9A 2R18A 3PW4A 2I6XA 4B9SA 5KFBA 3Q8LA 3HRDD 4DSEA 1ZQYA 5J2KA 4MF8A 1L3UA 2K8AA 4DL5A 4DL6A 5KT5A 4K4GA 4NJ8A 4TQRA 4DFPA 3PMLA 8ICSA 5HP4A 2KICA 2PFNA 4PHAA 2F44A 1KEJA 2AH5A 1DXSA 4P2HA 4EBDA 4TUSA 5DBBA 1CI4A 4YMMA 5J0YA 4UB1A 4KLEA 5AKJA 1Q3VA 1UT5A 4YXJA 3RJFA 2UVUA 2PFPA 2P6RA 4TQSA 5KFAA 4KTQA 2XGQA 9ICJA 3K75D 1K1QA 4RPXA 3AEVA 3WKEA 2CPRA 2OXOA 3AU6A 2XVTA 2J6SA 5G5GA 5CJ7A 2ZIUA 2XICA 1KQQA 5KFXA 2PI4A 8ICRA 2G09A 5AM0A 2BGWA 2YB4A 2H3FA 4R64A 1PK3A 4OJLA 3SENA 2XY5A 3B9JA 1NK7A 4DWIA 4O3QA 1KFSA 1ZD2P 1KFTA 3JPTA 4UARA 2BCUA 3PR4A 2F1IA 1BNPA 2DF4B 4OJOA 3DV9A 4IR9A 2VJ5A 3H4DA 2KVCA 4KLTA 3K1RB 2YMLA 8ICCA 2PKEA 4P0PA 3ZDBA 5KFOA 1S9FA 2ZTEA 3IN5A 2YY6A 2KJ8A 3QU5A 1O08A 3UM9A 3NVZA 1IXRA 4JB3A 1B4FA 2KHVA 3IHQB 1IV8A 1F0MA 1RQNA 2KZZA 3C21A 1QQ5A 4NLCA 2YMMA 4YN4A 3OJUA 2KOBA 1NK4A 2KZMA 4NL9A 3JPSA 3AM9A 2WF8A 2OHFA 3V6KA 9ICXA 3SI8A 3WU2U 9ICBA 3WKCA 4F4WA 1JN3A 4EENA 3WKAA 1UPHA 3RR8A 5J2AA 3TAQA 2HOIA 3PW2A 4ECZA 4DQRA 8ICJA 3DEEA 9ICFA 5KFSA 5ALNA 3DDHA 3GV5B 3QYPA 1OUQA 2DBYA 3RJJA 5AM1A 4UB5A 3BS5B 2FMSA 3AMZA 2AGQA 4YQWA 3KHLA 5IIMA 1ECWA 3RB3A 3MDCA 2RRDA 4C8MA 2W9CB 1FFVA 2ZUDA 4NM1A 3H8MA 4RT2A 1SB3C 3U26A 5HR6A 2AXTU 1BGXT 1RPLA 4F91B 2HHVA 5KTQA 2R8JA 8ICKA 4XQ8A 8ICNA 3QZ7A 2JEFA 2A19A 2OM6A 3JPPA 2UVWA 1EXNA 2V4QA 4RQ0A 4DQPA 4ELTA 3UQ2A 2NV3A 4ED6A 3NVWA 1U4BA 1X2IA 4RQ4A 2FLNA 2ASJA 4Y2VA 2IHMA 4GXIA 4BXOB 1XO1A 1V38A 3CW2C 1UQVA 3H0MB 4RQMA 2BPGA 1HEKA 1L8LA 1A0PA 1SZHA 3KTQA 1V97A 7ICHA 4CRXA 3I76A 2XCPA 4O3NA 4PHDA 5KG7A 1TKDA 4RUCA 8ICOA 2LI6A 4KX5A 1PUZA 4IRKA 4Z6DA 3T5LA 2EH9A 5HHIA 1JXLA 4M9GA 3A0BU 3BJYA 4GFJA 4KMOB 4O3SA 2ASDA 5ALVA 4P4MA 1ZQJA 4J9MA 5ALJA 5J0WA 1SKWA 4F2RA 2WF7A 5J0OA 2E8OA 1XSNA 4QZAA 5K4LA 3ETRA 3CNHA 3RBEA 2B21A 5KT6A 3JPRA 3M9MB 2JRZA 3JPOA 3E0FA 1SWWA 2WAQF 4PGQA 4C8KA 1BPEA 3FC4A 3HWTA 2IOFK 2KFNA 1JRPA 3J81j 2QARB 2ZTCA 3MABA 3F5EA 5KT7A 3IG8A 4CCHA 2ODGA 1JIHA 5KT3A 3HPOA 4DQIA 4I2BA 1ZQHA 1M6YA 4YD1A 4U7CA 5DBAA 2E1EA 4ED7A 4G3IA 1FIQA 3H4BA 7ICLA 4BX9C 2JR5A 3LK9A 2NRVA 1B22A 5D4BA 1ZQIA 1X6JA 1U47A 4OJ5A 3QZ8A 5J8YA 2BCSA 2FLLA 3KOOA 1XS9D 3LWLA 5AI9A 3RJHA 3WK4A 4DL3A 2W8LA 4GC6A 2AU0A 3L3FX 5J29A 1S0OA 2VIXA 5HMMA 4EZ9A 1HIWA 1K1SA 1U45A 5IIKA 3RAQA 3BDPA 1WYGA 1ZQQA 3ZI4A 4J9PA 1Z00A 3NVVA 4TUPA 3AN1A 7ICPA 2AJQA 1ZQVA 4ELVA 1MSWD 2ZUBA 1TV9A 8ICZA 4ECTA 8ICUA 5F3XB 2KNJA 3RAXA 1JMSA 2F1HA 5ALYA 4OCZA 3BS5A 2RLTA 5JUMA 4KLUA 1ZYQA 3NVYA 8ICPA 4I29A 4AP9A 1IG6A 2JEGA 4DSIA 2A1JA 7ICGA 1QCKA 3RH4A 5KFZA 4NM2A 5AKKA 3WK9A 5J8YC 4EEKA 1MN8A 5GTHU 3WK7A 5J0XA 4B9VA 3Q8KA 2HW3A 4UB8U 4ECVA 2HMXA 4P4OA 3EZ5A 1SXEA 5B66U 1PK1A 1ZXIA 1UHUA 3C23A 2KIVA 4JUZA 4UQGA 3N7SC 4I2GA 2BKEA 4EX6A 4NLBA 3D2QA 4PL1A 5CEHA 2IMWP 2KKVA 9ICKA 3PVXA 2R8HA 1XC9A 1FFUA 5KG5A 3V6HA 3PW5A 1NZBA 3IDWA 5J0QA 3RF9A 4I2AA 2W54A 4RQ1A 2PI5A 4PPXA 5KFDA 3HILA 2ISOA 2K4PA 1JI7A 5KFMA 3N28A 3T3FA 5DQIA 4MFAA 4Y2SA 1XU4A 1SIJA 5DB6A 2C22A 2HCFA 2PFQA 5AIAA 4ED2A 4EELA 1UT8A 1BPYA 2EQYA 3TANA 4OJ6A 4KLLA 3QUTA 4NV0A 1HUZA 1KTQA 3HKZC 3MGIA 2HI0A 2K4HA 4YMOA 4DSFA 5ALXA 3PV8A 5KFQA 1F44A 1ZQUA 2ZUCA 1S0VA 1QSLA 5J2BA 3KKAA 2MUTB 3PMNA 3RH6A 2Y1JA 1B0XA 3C28A 4Y2UA 2G08A 1BPZA 5IIIA 2BCQA 3AQFA 5ALKA 4Q44A 1AQ6A 1Q8KA 8ICHA 3OHAA 2W43A 2BCRA 1Z19A 1ZQGA 2QB0B 7ICMA 2WHEA 2KMDA 2MSNA 4DSLA 2LM4A 1QTMA 3IG5A 5L1KA 4QZHA 3TI0A 5EE9A 5AKZA 4IQWA 4KLSA 4IL6U 2WF9A 3WKBA 3SAHA 1LKYA 3M1YA 1MQ3A 3N4MB 4QWDA 3G6YA 2OEHA 4ICAA 3D2SA 2OCEA 3KHGA 3UXOA 3SV4A 4I2FA 1BNOA 3AQEA 1ZQOA 2ZTDA 5KT4A 4JWMA 4Y2QA 3IRUA 3V6JA 2B0CA 5CRXA 1B43A 1TAMA 3RB6A 2NRWA 1ZQLA 5J2FA 4IC9A 2HVHA 5J0RA 2W3RA 4Z6EA 2FMQA 2R8GA 3GZFA 2BZFA 9ICWA 9ICRA 5HR7A 3MBYA 4KLGA 4Z6FA 5E79U 2CRXA 2RDJA 2KSOA 3ZDEA 4NLZA 5EWGA 1ZD5A 3SD7A 4RQ5A 2Q4TA 4OD0A 3KFUF 3JPNA 2BR0A 2P66A 3UMGA 3HT3A 1S97A 4RNNA 5L1LA 5CWRA 1ZQSA 1X9MA 5CA7A 2W8KA 5ALLA 4KLFA 2C28A 4KLQA 3EPIA 3F2DA 3H0LB 2H3QA 4IRCA 2GO7A 3HW8A 1FO4A 2AQ0A 2Q0ZX 4QW9A 1ZQZA 1X6IA 3RJIA 2ZJ5A 8ICWA 2ASLA 2BPFA 1Q3UA 2M9NA 4QZ8A 4LVSA 2WTFA 2JV3A 4RQ6A 4NY8A 2QARA 3WK8A 4QWEA 2JH1A 4QZDA 4O9MA 4KN4A 1SWVA 1S76D 3M9NB 1X40A 2I5HA 4UW9A 3V7JA 4QZBA 5KG3A 4I2EA 1SL2A 5G5HA 1RXVA 3TFRA 3NS1A 2E8PA 4ECYA 3IM1A 5BPCA 1SGGA 8ICVA 3ZD9A 2ALZA 2KEYA 1GO3F 5CP2A 1XNSA 5AKHA 4G9BA 4KX3A 2FDRA 2G5IB 5T14A 1ZD4A 3ORYA 1RXWA 1OW5A 4KMUA 2HVIA 3H0RB 1KDHA 5EE0A 2GLEA 5AHXA 4P0QA 3OJSA 8ICFA 5KL8B 4XUSA 3M8RA 7ICNA 1X66A 7ICJA 4UAWA 4M0AA 1WCLA 4DLEA 3CYMA 1JUDA 1NK8A 2H5XA 4NWIA 3Q8QB 4DFKA 4PHPA 5EOZA 4EYHB 3D6JA 5KFJA 2HBJA 3BQ1A 3SV3A 4AYBF 2G06A 1LV5A 1DGSA 1J97A 3OHBA 7ICEA 5DQGA 4F93B 4YXMA 2KZ3A 1TK5A 3IP4B 1UCVA 9ICCA 1RQLA 5ALZA 3HKZF 3ZD8A 3QEAZ 4CGZA 4FS1A 1XO0A 4XRHA 4QZ9A 3K4GA 1SV0A 3QUBA 1JALA 5KG6A 5JTIA 1PVRA 4B9NA 2IA6A 2W7OA 8ICQA 2KK0A 2W9CA 4I2HA 3SMVA 5J2DA 1S0NA 2XCAA 5AK4A 5ALSA 3KHHA 5KG2A 5KFTA 1BVSA 4QWAA 4F5OA 9ICIA 2MAXA 2BQRA 3QE9Y 2V9WA 3QEBZ 2FE9A 3MR6A 5DDMA 4O5CA 2GOLA 5AKXA 3UQ0A 3H7IA 4DQQA 1DK2A 1KW4A 2K4EA 5L1JA 2XI9A 9ICAA 2KTQA 1N48A 2C2DA 7ICUA 5L9XA 2RP5A 3MR3A 1ZQFA 3RJEA 1S10A 4MFFA 1RYSA 1NJXA 2WF5A 5TZVA 3AUOA 2VKQA 3MGVA 4I2DA 1X9SA 3M8SA 2NYVA 5J2EA 2ZIVA 3PO4A 1ZETA 5FP0A 3M9OB 2CXYA 3JPQA 2F8KA 4PH5A 1Q46A 5DG9A 3KHRA 4O3RA 2E1FA 3PW0A 1L3TA 1T4GA 4BWJA 3OSNA 4USAA 2W9AA 3ZDCA 5ALGA 2C2RA 5ALEA 4QZIA 1X9XA 3GFKB 4F4YA 2YB1A 1N5WA 2WAQC 2PMZF 5KFHA 4EYIB 2MUTA 2DUYA 5HHHA 4C7ZA 4QZCA 2F3NA 2QLTA 3ED5A 4B9UA 5AK6A 1TFRA 4C8NA 4I2JA 4F50A 1PK1B 1WWUA 4QZFA 3N7RC 2EDUA 1JXEA 5AI5A 4RT3A 3EYZA 4ED1A 2K8BB 2M0NA 4RQ8A 3GV8B 2XGPA 1YZ7A 2Y9TA 4YD2A 2WB1F 4UB2A 7ICQA 1RG6A 2A1JB 3C5GA 3RB4A 2BHNA 4UAYA 1WUDA 4GLXA 3K1ZA 2A3VA 3GU3A 1N56A 4JV1A 5KG0A 2A1AA 3Q8RB 4LZGA 4F71A 3E58A 2D6FC 5AM4A 9ICEA 1U48A 4KLHA 4E0DA 3FAHA 2FJ6A 2FMPA 2O6KA 4YVZA 4YR3A 1TK0A 5AICA 5AI6A 2J6UA 4EEYA 1KFDA 1L7MA 5J0TA 2YN4A 5J2JA 2ZJ8A 4I2CA 3CRXA 5HNKA 2KG5A 4DF8A 5AKIA 1N5XA 2JZBB 3BQTA 5GTIU 2KJ5A 1SKRA 3BQ7A 3FM9A 2K8CB 9ICVA 2Y1IA 5F9LA 1YZ6A 4DOBA 2WB1C 4LZDA 3T5HA 4DSJA 4QIWF 1KKXA 5DGBA 5KFYA 4KLMA 5KFEA 1NKCA 2EZXA 2K60A 1NJYA 5L1MA 1QSYA 7ICRA 4DL4A 5KFVA 4Q8FA 1P7DA 4IS7A 1IM4A 2JEJA 4ECRA 1C7YA 1PVQA 2YQEA 1VDVA 2F8LA 5KFFA 4M2YA 4MFCA 1VLBA 2F2AB 1D8LA 4RPZA 1SV0C 3OGUA 2K89A 5IILA 9ICSA 2LKYA 3MDAA 2KHQA 1ZQRA 2HBMA 8ICAA 3TADC 1URJA 4PZOA 5KAIU 2PFOA 3SYZA 4M6WB 1T94A 4KLIA 3GQCA 2JGAA 2DKZA 2W3SA 1TK8A 3RRHA 3ICXA 2DGZA 1ZQMA 3V7KA 4QZGA 4B9MA 2DPJA 1RM6C 1ZQWA 3TARA 5J2GA 1NK0A 2KKPA 1V9PA 5KFNA 3EW9A 1PZNA 4YCXA 3QNMA 1F5SA 4KN7A 2V4RA 2KIWA 4DS4A 4HYKA 4O3PA 3UXPA 3M7DA 1WG8A 2H3VA 5AI8A 9ICQA 4QJFB 4C7YA 2HHXA 2LYHA 5ALMA 1LB2B 4DL7A 3PX4A 5ALWA 9ICHA 5ALQA 2D8CA 3PSIA 3KKAC 4YR2A 2W55A 5H2FU 1ZQXA 3GDXA 5DBCA 4BJQA 2ZXHA 2QB1A 5ALFA 2KV2A 1JROA 5F9NA 1SZPA 3BQ0A 3G6XA 3THVA 1Z00B 1RDFA 3A0HU 4Y2JA 2HDOA 1CUKA 3SEIA 2LHTA 4UBCA 9ICGA 1TAQA 4Y2RA 2F77X 3M6ZA 4Y2XA 3MC1A 2XY6A 5J0SA 4O3MA 4DEZA 4FS2A 5KFPA 4B9TA 3C2KA 5L1IA 4B6JA 7ICIA 2Z7JA 1DRGA 3HJEA 3PX6A 4FBUA 4TURA 2CN1A 2UVRA 3E2EA 2ZJAA 2BPCA 4DLGA 5C0YA 4OO1J 2LM1A 5DKWA 2HHUA 1ZQEA 3NRZA 5J2CA 4NLGA 8ICGA 3KZIU 4U6PA 4IQUA 5BOLA 1K5OA 4RUAA 4NL9C 1N62A 1FEZA 4FO6A 2JHDA 3C2MA 8ICMA 1ZD3A 7ICVA 4J03A 5J2HA 1Z1BA 1S8OA 5C5JA 4EBEA 2KN7A 1ZQ1C 1J2NA 4Y2YA 5DB8A 2YMPA 3D2NA 5IIOA 8ICTA 3ISBA 4C4SA 4R8UB 1X42A 1XSLA 2HHWA 3GILA 3RJKA 2E5SA 3ZDDA 1LVHA 3QU9A 3SAGA 2J6TA 5KNIA 2XY7A 4PHEA 3AL0B 8ICYA 4C0ZA 4QIWC 4J9NA 4ECWA 4YG2A 5DB9A 4BWMA 4QZEA 4R66A 3RB0A 3H8WA 3ALRA 4YMNA 1QQ6A 4US9A 3RFAA 4M47A 4Z6CA 2W9MA 4J9KA 2FPKA 3GIMA 3AU2A 2XC9A 2KFZA 2KSOB 1WWVA 8ICXA 3N7PD 1L5UA 3Q8SB 7ICOA 4DFJA 1ZRMA 4Q8EA 3V7LA 4IRDA 4Y2PA 4PGYA 1RYUA 2VA3A 4ZH4A 1MQ2A 4DSKA 7ICFA 2DQNB 1QH9A 4FE3A 1A76A 4A8EA 2QKQA 5D46A 2AQ4A 8ICEA 3L5KA 3H40A 1NOMA 5DDYA 4AYBC 7ICKA 4ECUA 2FPLA 1Y88A 2F76X 4CF5A 3M6KA 1OXJA 4C4RA 1UA0A 1COKA 1LKYB 2DFLA 4C80A 2DKXA 3T5KA 4M6WA 2W03A 4M9NA 5AKEA 4R63A 3EPGA 4BUGA 2RDIA 5BOMA 1KRPA 4UAZA 3TFSA 3FYHA 3NTUA 1C20A 4J9OA 4BGDA 3LWMA 2VANA 3GIIA 1N63A 3NASA 5KL1B 1T3NA 1U9LA 3QU2A 2VA8A 5AM2A 4K4IA 2ZG6A 4DO9A 5AI4A 2C2EA 3TAPA 3RBDA 5IINA 5AK5A 5DG7A 1UA1A 1CRXA 2FI1A 2DPIA 2EAPA 4CF4A 3EUB2 1NK6A 2HOFA 8ICLA 1L6NA 3QU7A 5AKLA 1V85A 2XIDA 2B6GA 4UAUA 4K4HA 2E3TA 5AM5A 2N1RA 2HBKA 4NXZA
chains in the Genus database with same CATH topology
3C23A 1JXEA 3LDAA 4RT3A 4RPYA 4JUZA 3EYZA 4IQVA 4UQGA 2IBKA 5DB7A 4I2GA 2BKEA 4ED1A 2IMWP 4RQ8A 3GV8B 2XGPA 3RRGA 4O5KA 9ICKA 1ZQPA 9ICOA 1AROP 4YD2A 4J9QA 7ICQA 4UB2A 4F92B 3EWAA 3PVXA 4QW8A 2R8HA 1XC9A 2A1JB 2ATLA 5KG5A 3V6HA 1NK9A 3PW5A 5J0QA 3C5GA 3RB4A 3PW4A 2BHNA 4I2AA 4UAYA 4GLXA 4P4PA 4RQ1A 2PI5A 4PPXA 5KFDA 4B9SA 2JZBA 2ISOA 1NJWA 1TAUA 1N56A 5KFBA 3Q8LA 3C1ZA 4MEXA 4JV1A 4DSEA 1ZQYA 5J2KA 5KG0A 4MF8A 1RYRA 3Q8RB 3PR5B 5KFMA 4LZGA 3T3FA 1L3UA 1BPDA 5DQIA 4UB3A 4DL5A 9ICEA 3MGHA 1U48A 4KLHA 4E0DA 1COOA 5KT5A 4MFAA 4DL6A 3H8SA 1BPXA 2FMPA 1XU4A 4K4GA 4TQRA 5DB6A 4YVZA 4YR3A 4DFPA 3PMLA 3C1YA 2C22A 8ICSA 5HP4A 1TK0A 2PFQA 4DS5A 2AGPA 4KITB 4ED2A 2PFNA 4PHAA 2J6UA 1UT8A 1BPYA 3SZ2A 4EEYA 1KEJA 3TANA 4P2HA 1KFDA 4EBDA 4ELUA 4ED0A 4KLLA 4RZRA 3FDSA 5J0TA 5DBBA 2NRZA 4TUSA 1QSSA 5DLFA 1HUZA 1KTQA 2ZJ8A 5J2JA 4EZ6A 4I2CA 3MGIA 4YMMA 5HNKA 5J0YA 4DF8A 4YFKA 4YMOA 2JZBB 4UB1A 3PX0A 4KLEA 4DSFA 1KSPA 3PV8A 5KFQA 1UT5A 1ZQUA 3BQTA 2ZUCA 1S0VA 1SKRA 1QSLA 5J2BA 2F1JA 3C2LA 4YXJA 4NLNA 2MUTB 3PMNA 3RJFA 4R65A 3RH6A 2UVUA 4RNOA 9ICVA 2Y1JA 1T7PA 2Y1IA 2PFPA 5F9LA 2P6RA 4TQSA 5KFAA 4KTQA 1BPZA 5IIIA 4DOBA 2BCQA 2XGQA 4ECQA 4LZDA 5J0UA 4RQ3A 4Q44A 3B0XA 3T5HA 3PW7A 2BQUA 4DSJA 9ICJA 3K75D 1K1QA 5KFIA 4BDPA 8ICHA 4RPXA 3MFIA 3AU6A 3OHAA 3RR7A 2BCRA 1ZQGA 3V72A 5DGBA 5KFYA 4KLMA 7ICMA 5KFEA 1NKCA 2J6SA 4DSLA 5CJ7A 4ECXA 3UXNA 1QTMA 1NJYA 5L1KA 4QZHA 5KFXA 3TI0A 3OSPA 9ICNA 2PI4A 1HUOA 1QSYA 8ICRA 7ICRA 2BGWA 4PGXA 4DQSA 4DL4A 5KFVA 4Q8FA 4R64A 2XY5A 4I2IA 3GIKA 1NK7A 4IQWA 1IM4A 4KLSA 4DWIA 4O3QA 2JEJA 4ECRA 1KFSA 1NJZA 1C7YA 1KFTA 3JPTA 1MQ3A 1NK5A 4F2SA 5KFFA 4M9LA 4MFCA 4M2YA 4DF4A 1D8LA 3PR4A 2BCUA 2F1IA 4RPZA 3N4MB 4QWDA 1RZTA 3OGUA 4X5VA 5IILA 5DQHA 3G6YA 9ICSA 4IR9A 3RJGA 3MDAA 1DOQA 3H4DA 4O3OA 1KLNA 4KLJA 5IIJA 3KHGA 4KLTA 4I28A 1ZQRA 3UXOA 5KG1A 3SV4A 4I2FA 3MR5A 8ICCA 1ZQOA 4GXKA 8ICAA 2ZTDA 5KT4A 4JWMA 3RAXA 3ZDBA 5KFOA 1ZJNA 3V6JA 3UPQA 1S9FA 2PFOA 3SYZA 1B43A 2ZTEA 2FLPA 4M6WB 3RH5A 3RTVA 3RB6A 2NRWA 1ZQLA 4KLIA 3GQCA 2W9BB 1TK8A 9ICPA 1IXRA 5J2FA 3RRHA 2HVHA 3IHQB 5J0RA 1ZQNA 4Z6EA 2FMQA 2R8GA 4DOCA 2KZZA 1ZQMA 3C21A 3V7KA 4F5RA 9ICWA 4QZGA 9ICRA 3MBYA 4B9MA 2BQ3A 2DPJA 4KLGA 1ZQWA 3TARA 5J2GA 3BQ2A 1NK0A 4Z6FA 4YN4A 3OJUA 1XSPA 1V9PA 5KFNA 1NK4A 3EW9A 1SKSA 1PZNA 4YCXA 3JPSA 4KN7A 1XWLA 4IQTA 2V4RA 2RDJA 3ZDEA 1ZQDA 4NLZA 3V6KA 5EWGA 4DS4A 2KZMA 3TQ1A 4HYKA 2I9GA 9ICXA 3SI8A 4O3PA 4RQ5A 9ICBA 1HJPA 3UXPA 4F4WA 4ED3A 3JPNA 3ISCA 4J9RA 2BR0A 2P66A 1JN3A 3HT3A 4RNNA 5KFLA 4YR0A 1S97A 1CEZA 9ICQA 4BXOA 3RR8A 5L1LA 5J2AA 4C8OA 3TAQA 5CWRA 3PW2A 1L3VA 4ECZA 1ZQSA 4DQRA 4RQ2A 1X9MA 1L3SA 5CA7A 2HHXA 8ICJA 1D8YA 2W8KA 4KLFA 3ZDAA 9ICFA 2LYHA 2C28A 1ZQBA 3EPIA 4KLQA 5KFSA 2AGOA 1LB2B 1JX4A 4IRCA 3GV5B 4DL7A 3PX4A 3RJJA 9ICHA 4MF2A 3HW8A 2AQ0A 4UB5A 2Q0ZX 4QW9A 4KLDA 4B9LA 1ZQZA 3RJIA 2ZJ5A 2FMSA 2ASLA 2AGQA 8ICWA 2BPFA 4JK1A 4J9SA 4YR2A 4F8RA 4YQWA 1ZQXA 3GDXA 3KHLA 7ICSA 2M9NA 3MFHA 5DBCA 4QZ8A 4LVSA 4NLKA 5IIMA 2WTFA 3MDCA 3RB3A 4C8MA 4RQ6A 2W9CB 3T5JA 4NY8A 2ZUDA 3HP6A 5F9NA 4NM1A 4RT2A 1SZPA 3BQ0A 4QWEA 1T8EA 3G6XA 3THVA 1Z00B 4RU9A 1SL0A 5KFRA 1BGXT 4QZDA 1RPLA 4KN4A 4O9MA 4F4KA 4F91B 4UBBA 1S76D 3M9NB 4Q45A 4GXJA 4M9HA 2HHVA 5J2IA 5KTQA 1CUKA 2R8JA 8ICKA 4UBCA 3PO5A 1TVAA 4XQ8A 4QZBA 3V7JA 8ICNA 9ICGA 1MC8A 1TAQA 5KG3A 5D49A 4I2EA 1SL2A 4RQ7A 3QZ7A 1RXVA 2JEFA 4M9JA 5KFWA 3TFRA 2XY6A 4GC7A 3JPPA 2UVWA 4ECYA 9ICTA 1EXNA 5J0SA 3IM1A 2V4QA 5BPCA 4RQ0A 4DQPA 4ELTA 4DEZA 4FS2A 8ICVA 3UQ2A 5KFPA 3ZD9A 2ALZA 1BPBA 3C2KA 5L1IA 4B9TA 5KFUA 1NKEA 4ED6A 4FBTA 4Q43A 7ICIA 5CP2A 3PX6A 1U4BA 4FBUA 4TURA 1X2IA 4RQ4A 2FLNA 2ASJA 1ZQCA 2UVRA 3E2EA 2IHMA 2ZJAA 4GXIA 2BPCA 5KFCA 4BXOB 4DLGA 1XO1A 2PXIA 5DKWA 4C8LA 3ORYA 1RXWA 2HHUA 4J9LA 4KMUA 4DOAA 2HVIA 1ZQEA 9ICMA 5CR0A 5J2CA 1KDHA 4ED8A 1ZQKA 5EWEA 4F3OA 4NLGA 8ICGA 3MR2A 2BPGA 3OJSA 8ICFA 2R8KA 2ISPA 3M8RA 4XUSA 3KTQA 7ICNA 5DGAA 7ICHA 4IQUA 2GWSA 7ICJA 2XCPA 4UAWA 4O3NA 5BOLA 4PHDA 1WCLA 5KG7A 4RUCA 4DLEA 4RUAA 4DL2A 1TKDA 4M0AA 4KLOA 8ICOA 8ICIA 3ISDA 1NK8A 4FO6A 2H5XA 4O5EA 4RNMA 4DFMA 4IRKA 4Z6DA 3T5LA 3C2MA 3Q8QB 4DFKA 8ICMA 7ICVA 1Z3EB 5HHIA 4PHPA 5EOZA 1JXLA 5J2HA 3Q8PB 4EYHB 4M9GA 5KFJA 5C5JA 3BQ1A 3BJYA 5KFKA 5DLGA 2KN7A 4EBEA 2BDPA 3SV3A 4O3SA 2ASDA 1LV5A 1DGSA 4QWCA 5DB8A 4P4MA 1S77D 3OHBA 1ZQJA 5IIOA 8ICTA 3ISBA 4J9MA 7ICEA 5DQGA 5J0WA 4R8UB 1SKWA 1XSLA 4F2RA 4F93B 2HHWA 4YXMA 3GILA 2BCVA 3RJKA 5J0OA 2KZ3A 4F4XA 1TK5A 3ZDDA 1XSNA 9ICCA 4QZAA 1S0MA 2J6TA 2XY7A 4R8UA 4PHEA 2NRTA 3ZD8A 1NKBA 1WCNA 3QEAZ 3RBEA 2B21A 3GIJA 4JV2A 5KT6A 3JPRA 3M9MB 8ICYA 4MEYA 1A77A 4F4ZA 4FS1A 1ZQAA 3JPOA 4J9NA 2NRXA 4ECWA 2JEIA 4YG2A 4XRHA 5DB9A 4PGQA 4C8KA 4QZ9A 3K4GA 4BWMA 5KG4A 4QZEA 1BPEA 4YP3A 5KG6A 4R66A 3HWTA 1QLNA 2IHNA 2KFNA 4B9NA 2IA6A 3RB0A 8ICQA 2ZTCA 3H8WA 2W9CA 3MABA 5KT7A 2P6UA 4I2HA 4YMNA 4CCHA 5J2DA 1S0NA 4Z6CA 1D9DA 4M47A 2XCAA 2W9MA 4J9KA 2FPKA 3GIMA 3KHHA 5KG2A 1JIHA 3AU2A 5KFTA 2XC9A 1BVSA 3B0YA 5KT3A 5KT2A 3HPOA 2HHQA 4TUQA 4DQIA 4I2BA 4QWAA 2HHTA 2KFZA 7ICTA 1ZQHA 4EBCA 5DG8A 4F5OA 5DBAA 4YD1A 4ED7A 2MAXA 2BQRA 4G3IA 3C5FA 9ICIA 3QE9Y 8ICXA 4F5QA 2V9WA 1L5UA 7ICOA 3Q8SB 3H4BA 4DFJA 3QEBZ 3MR6A 5J0PA 4Q8EA 3V7LA 4IRDA 3Q8MA 7ICLA 4PGYA 5DDMA 3LK9A 4O5CA 2VA3A 2NRVA 1B22A 5D4BA 4ZH4A 1MQ2A 1ZQIA 4DSKA 5HMLA 2XO7A 2W9BA 1U47A 7ICFA 3NGDA 3UQ0A 1X9WA 4QWBA 3QZ8A 2BCSA 2FLLA 3H7IA 1A76A 1H38A 1XS9D 4DQQA 3LWLA 5D46A 2HHSA 3RJHA 5L1JA 9ICAA 2KTQA 2AQ4A 8ICEA 1N48A 4DL3A 2C2DA 2W8LA 3H40A 4GC6A 1U49A 2AU0A 5J29A 1S0OA 1NOMA 5DDYA 5HMMA 4EZ9A 7ICUA 7ICKA 1K1SA 5L9XA 4ECUA 2FPLA 1Y88A 9ICLA 2OWOA 1U45A 5IIKA 3RAQA 3BDPA 3MR3A 1ZQFA 1ZQTA 3RJEA 4F5NA 1S10A 1RYSA 1NJXA 1ZQQA 4MFFA 4J9PA 1UA0A 5TZVA 1Z00A 3AUOA 4TUPA 2DFLA 4I2DA 4JWNA 1SL1A 3GV7B 1X9SA 3M8SA 4M04A 2AJQA 1ZQVA 4M6WA 3T5KA 4ELVA 1MSWD 7ICPA 2ZUBA 5J2EA 4M9NA 1TV9A 4R63A 3EPGA 3PO4A 8ICZA 2RDIA 4ECTA 2VA2A 5BOMA 1ZETA 1KRPA 3PY8A 8ICUA 4UAZA 3TFSA 1JMSA 3FYHA 3NTUA 2F1HA 4BGDA 3M9OB 4J9OA 3LWMA 2VANA 3JPQA 3GIIA 1T3NA 4PH5A 5DG9A 1U9LA 3KHRA 1D9FA 4I27A 2VA8A 2R8IA 4JV0A 3PW0A 4O3RA 2FPMA 4K4IA 5JUMA 3G6VA 4DO9A 1L3TA 4KLUA 2C2EA 1T4GA 3TAPA 4BWJA 3OSNA 2W9AA 3PNCA 3RBDA 1ZYQA 3ZDCA 2C2RA 8ICPA 3ETLA 4I29A 5IINA 8ICBA 2JEGA 4DSIA 4IR1A 5DG7A 1UA1A 4QZIA 3GFKB 2A1JA 4F4YA 7ICGA 3N97B 9ICUA 3RH4A 2I1QA 5KFZA 5CB1A 2DPIA 4NM2A 2UVVA 4ECSA 1NK6A 5KFHA 8ICLA 4O0IA 5J0XA 2MUTA 4EYIB 5CHGA 3H8JA 4B9VA 3Q8KA 5HHHA 4QZCA 4B9UA 2HW3A 4ECVA 4P4OA 4K4HA 1TFRA 4C8NA 4I2JA 4XA5A 1ZJMA 5EWFA 4F50A 4UB4A 5KFGA 3EZ5A 3HX0A 4QZFA 4F5PA 4NXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C23 A;  1JXE A;  3LDA A;  4RT3 A;  4RPY A;  4JUZ A;  3EYZ A;  4IQV A;  4UQG A;  2IBK A;  5DB7 A;  4I2G A;  2BKE A;  4ED1 A;  2IMW P;  4RQ8 A;  3GV8 B;  2XGP A;  3RRG A;  4O5K A;  9ICK A;  1ZQP A;  9ICO A;  1ARO P;  4YD2 A;  4J9Q A;  7ICQ A;  4UB2 A;  4F92 B;  3EWA A;  3PVX A;  4QW8 A;  2R8H A;  1XC9 A;  2A1J B;  2ATL A;  5KG5 A;  3V6H A;  1NK9 A;  3PW5 A;  5J0Q A;  3C5G A;  3RB4 A;  3PW4 A;  2BHN A;  4I2A A;  4UAY A;  4GLX A;  4P4P A;  4RQ1 A;  2PI5 A;  4PPX A;  5KFD A;  4B9S A;  2JZB A;  2ISO A;  1NJW A;  1TAU A;  1N56 A;  5KFB A;  3Q8L A;  3C1Z A;  4MEX A;  4JV1 A;  4DSE A;  1ZQY A;  5J2K A;  5KG0 A;  4MF8 A;  1RYR A;  3Q8R B;  3PR5 B;  5KFM A;  4LZG A;  3T3F A;  1L3U A;  1BPD A;  5DQI A;  4UB3 A;  4DL5 A;  9ICE A;  3MGH A;  1U48 A;  4KLH A;  4E0D A;  1COO A;  5KT5 A;  4MFA A;  4DL6 A;  3H8S A;  1BPX A;  2FMP A;  1XU4 A;  4K4G A;  4TQR A;  5DB6 A;  4YVZ A;  4YR3 A;  4DFP A;  3PML A;  3C1Y A;  2C22 A;  8ICS A;  5HP4 A;  1TK0 A;  2PFQ A;  4DS5 A;  2AGP A;  4KIT B;  4ED2 A;  2PFN A;  4PHA A;  2J6U A;  1UT8 A;  1BPY A;  3SZ2 A;  4EEY A;  1KEJ A;  3TAN A;  4P2H A;  1KFD A;  4EBD A;  4ELU A;  4ED0 A;  4KLL A;  4RZR A;  3FDS A;  5J0T A;  5DBB A;  2NRZ A;  4TUS A;  1QSS A;  5DLF A;  1HUZ A;  1KTQ A;  2ZJ8 A;  5J2J A;  4EZ6 A;  4I2C A;  3MGI A;  4YMM A;  5HNK A;  5J0Y A;  4DF8 A;  4YFK A;  4YMO A;  2JZB B;  4UB1 A;  3PX0 A;  4KLE A;  4DSF A;  1KSP A;  3PV8 A;  5KFQ A;  1UT5 A;  1ZQU A;  3BQT A;  2ZUC A;  1S0V A;  1SKR A;  1QSL A;  5J2B A;  2F1J A;  3C2L A;  4YXJ A;  4NLN A;  2MUT B;  3PMN A;  3RJF A;  4R65 A;  3RH6 A;  2UVU A;  4RNO A;  9ICV A;  2Y1J A;  1T7P A;  2Y1I A;  2PFP A;  5F9L A;  2P6R A;  4TQS A;  5KFA A;  4KTQ A;  1BPZ A;  5III A;  4DOB A;  2BCQ A;  2XGQ A;  4ECQ A;  4LZD A;  5J0U A;  4RQ3 A;  4Q44 A;  3B0X A;  3T5H A;  3PW7 A;  2BQU A;  4DSJ A;  9ICJ A;  3K75 D;  1K1Q A;  5KFI A;  4BDP A;  8ICH A;  4RPX A;  3MFI A;  3AU6 A;  3OHA A;  3RR7 A;  2BCR A;  1ZQG A;  3V72 A;  5DGB A;  5KFY A;  4KLM A;  7ICM A;  5KFE A;  1NKC A;  2J6S A;  4DSL A;  5CJ7 A;  4ECX A;  3UXN A;  1QTM A;  1NJY A;  5L1K A;  4QZH A;  5KFX A;  3TI0 A;  3OSP A;  9ICN A;  2PI4 A;  1HUO A;  1QSY A;  8ICR A;  7ICR A;  2BGW A;  4PGX A;  4DQS A;  4DL4 A;  5KFV A;  4Q8F A;  4R64 A;  2XY5 A;  4I2I A;  3GIK A;  1NK7 A;  4IQW A;  1IM4 A;  4KLS A;  4DWI A;  4O3Q A;  2JEJ A;  4ECR A;  1KFS A;  1NJZ A;  1C7Y A;  1KFT A;  3JPT A;  1MQ3 A;  1NK5 A;  4F2S A;  5KFF A;  4M9L A;  4MFC A;  4M2Y A;  4DF4 A;  1D8L A;  3PR4 A;  2BCU A;  2F1I A;  4RPZ A;  3N4M B;  4QWD A;  1RZT A;  3OGU A;  4X5V A;  5IIL A;  5DQH A;  3G6Y A;  9ICS A;  4IR9 A;  3RJG A;  3MDA A;  1DOQ A;  3H4D A;  4O3O A;  1KLN A;  4KLJ A;  5IIJ A;  3KHG A;  4KLT A;  4I28 A;  1ZQR A;  3UXO A;  5KG1 A;  3SV4 A;  4I2F A;  3MR5 A;  8ICC A;  1ZQO A;  4GXK A;  8ICA A;  2ZTD A;  5KT4 A;  4JWM A;  3RAX A;  3ZDB A;  5KFO A;  1ZJN A;  3V6J A;  3UPQ A;  1S9F A;  2PFO A;  3SYZ A;  1B43 A;  2ZTE A;  2FLP A;  4M6W B;  3RH5 A;  3RTV A;  3RB6 A;  2NRW A;  1ZQL A;  4KLI A;  3GQC A;  2W9B B;  1TK8 A;  9ICP A;  1IXR A;  5J2F A;  3RRH A;  2HVH A;  3IHQ B;  5J0R A;  1ZQN A;  4Z6E A;  2FMQ A;  2R8G A;  4DOC A;  2KZZ A;  1ZQM A;  3C21 A;  3V7K A;  4F5R A;  9ICW A;  4QZG A;  9ICR A;  3MBY A;  4B9M A;  2BQ3 A;  2DPJ A;  4KLG A;  1ZQW A;  3TAR A;  5J2G A;  3BQ2 A;  1NK0 A;  4Z6F A;  4YN4 A;  3OJU A;  1XSP A;  1V9P A;  5KFN A;  1NK4 A;  3EW9 A;  1SKS A;  1PZN A;  4YCX A;  3JPS A;  4KN7 A;  1XWL A;  4IQT A;  2V4R A;  2RDJ A;  3ZDE A;  1ZQD A;  4NLZ A;  3V6K A;  5EWG A;  4DS4 A;  2KZM A;  3TQ1 A;  4HYK A;  2I9G A;  9ICX A;  3SI8 A;  4O3P A;  4RQ5 A;  9ICB A;  1HJP A;  3UXP A;  4F4W A;  4ED3 A;  3JPN A;  3ISC A;  4J9R A;  2BR0 A;  2P66 A;  1JN3 A;  3HT3 A;  4RNN A;  5KFL A;  4YR0 A;  1S97 A;  1CEZ A;  9ICQ A;  4BXO A;  3RR8 A;  5L1L A;  5J2A A;  4C8O A;  3TAQ A;  5CWR A;  3PW2 A;  1L3V A;  4ECZ A;  1ZQS A;  4DQR A;  4RQ2 A;  1X9M A;  1L3S A;  5CA7 A;  2HHX A;  8ICJ A;  1D8Y A;  2W8K A;  4KLF A;  3ZDA A;  9ICF A;  2LYH A;  2C28 A;  1ZQB A;  3EPI A;  4KLQ A;  5KFS A;  2AGO A;  1LB2 B;  1JX4 A;  4IRC A;  3GV5 B;  4DL7 A;  3PX4 A;  3RJJ A;  9ICH A;  4MF2 A;  3HW8 A;  2AQ0 A;  4UB5 A;  2Q0Z X;  4QW9 A;  4KLD A;  4B9L A;  1ZQZ A;  3RJI A;  2ZJ5 A;  2FMS A;  2ASL A;  2AGQ A;  8ICW A;  2BPF A;  4JK1 A;  4J9S A;  4YR2 A;  4F8R A;  4YQW A;  1ZQX A;  3GDX A;  3KHL A;  7ICS A;  2M9N A;  3MFH A;  5DBC A;  4QZ8 A;  4LVS A;  4NLK A;  5IIM A;  2WTF A;  3MDC A;  3RB3 A;  4C8M A;  4RQ6 A;  2W9C B;  3T5J A;  4NY8 A;  2ZUD A;  3HP6 A;  5F9N A;  4NM1 A;  4RT2 A;  1SZP A;  3BQ0 A;  4QWE A;  1T8E A;  3G6X A;  3THV A;  1Z00 B;  4RU9 A;  1SL0 A;  5KFR A;  1BGX T;  4QZD A;  1RPL A;  4KN4 A;  4O9M A;  4F4K A;  4F91 B;  4UBB A;  1S76 D;  3M9N B;  4Q45 A;  4GXJ A;  4M9H A;  2HHV A;  5J2I A;  5KTQ A;  1CUK A;  2R8J A;  8ICK A;  4UBC A;  3PO5 A;  1TVA A;  4XQ8 A;  4QZB A;  3V7J A;  8ICN A;  9ICG A;  1MC8 A;  1TAQ A;  5KG3 A;  5D49 A;  4I2E A;  1SL2 A;  4RQ7 A;  3QZ7 A;  1RXV A;  2JEF A;  4M9J A;  5KFW A;  3TFR A;  2XY6 A;  4GC7 A;  3JPP A;  2UVW A;  4ECY A;  9ICT A;  1EXN A;  5J0S A;  3IM1 A;  2V4Q A;  5BPC A;  4RQ0 A;  4DQP A;  4ELT A;  4DEZ A;  4FS2 A;  8ICV A;  3UQ2 A;  5KFP A;  3ZD9 A;  2ALZ A;  1BPB A;  3C2K A;  5L1I A;  4B9T A;  5KFU A;  1NKE A;  4ED6 A;  4FBT A;  4Q43 A;  7ICI A;  5CP2 A;  3PX6 A;  1U4B A;  4FBU A;  4TUR A;  1X2I A;  4RQ4 A;  2FLN A;  2ASJ A;  1ZQC A;  2UVR A;  3E2E A;  2IHM A;  2ZJA A;  4GXI A;  2BPC A;  5KFC A;  4BXO B;  4DLG A;  1XO1 A;  2PXI A;  5DKW A;  4C8L A;  3ORY A;  1RXW A;  2HHU A;  4J9L A;  4KMU A;  4DOA A;  2HVI A;  1ZQE A;  9ICM A;  5CR0 A;  5J2C A;  1KDH A;  4ED8 A;  1ZQK A;  5EWE A;  4F3O A;  4NLG A;  8ICG A;  3MR2 A;  2BPG A;  3OJS A;  8ICF A;  2R8K A;  2ISP A;  3M8R A;  4XUS A;  3KTQ A;  7ICN A;  5DGA A;  7ICH A;  4IQU A;  2GWS A;  7ICJ A;  2XCP A;  4UAW A;  4O3N A;  5BOL A;  4PHD A;  1WCL A;  5KG7 A;  4RUC A;  4DLE A;  4RUA A;  4DL2 A;  1TKD A;  4M0A A;  4KLO A;  8ICO A;  8ICI A;  3ISD A;  1NK8 A;  4FO6 A;  2H5X A;  4O5E A;  4RNM A;  4DFM A;  4IRK A;  4Z6D A;  3T5L A;  3C2M A;  3Q8Q B;  4DFK A;  8ICM A;  7ICV A;  1Z3E B;  5HHI A;  4PHP A;  5EOZ A;  1JXL A;  5J2H A;  3Q8P B;  4EYH B;  4M9G A;  5KFJ A;  5C5J A;  3BQ1 A;  3BJY A;  5KFK A;  5DLG A;  2KN7 A;  4EBE A;  2BDP A;  3SV3 A;  4O3S A;  2ASD A;  1LV5 A;  1DGS A;  4QWC A;  5DB8 A;  4P4M A;  1S77 D;  3OHB A;  1ZQJ A;  5IIO A;  8ICT A;  3ISB A;  4J9M A;  7ICE A;  5DQG A;  5J0W A;  4R8U B;  1SKW A;  1XSL A;  4F2R A;  4F93 B;  2HHW A;  4YXM A;  3GIL A;  2BCV A;  3RJK A;  5J0O A;  2KZ3 A;  4F4X A;  1TK5 A;  3ZDD A;  1XSN A;  9ICC A;  4QZA A;  1S0M A;  2J6T A;  2XY7 A;  4R8U A;  4PHE A;  2NRT A;  3ZD8 A;  1NKB A;  1WCN A;  3QEA Z;  3RBE A;  2B21 A;  3GIJ A;  4JV2 A;  5KT6 A;  3JPR A;  3M9M B;  8ICY A;  4MEY A;  1A77 A;  4F4Z A;  4FS1 A;  1ZQA A;  3JPO A;  4J9N A;  2NRX A;  4ECW A;  2JEI A;  4YG2 A;  4XRH A;  5DB9 A;  4PGQ A;  4C8K A;  4QZ9 A;  3K4G A;  4BWM A;  5KG4 A;  4QZE A;  1BPE A;  4YP3 A;  5KG6 A;  4R66 A;  3HWT A;  1QLN A;  2IHN A;  2KFN A;  4B9N A;  2IA6 A;  3RB0 A;  8ICQ A;  2ZTC A;  3H8W A;  2W9C A;  3MAB A;  5KT7 A;  2P6U A;  4I2H A;  4YMN A;  4CCH A;  5J2D A;  1S0N A;  4Z6C A;  1D9D A;  4M47 A;  2XCA A;  2W9M A;  4J9K A;  2FPK A;  3GIM A;  3KHH A;  5KG2 A;  1JIH A;  3AU2 A;  5KFT A;  2XC9 A;  1BVS A;  3B0Y A;  5KT3 A;  5KT2 A;  3HPO A;  2HHQ A;  4TUQ A;  4DQI A;  4I2B A;  4QWA A;  2HHT A;  2KFZ A;  7ICT A;  1ZQH A;  4EBC A;  5DG8 A;  4F5O A;  5DBA A;  4YD1 A;  4ED7 A;  2MAX A;  2BQR A;  4G3I A;  3C5F A;  9ICI A;  3QE9 Y;  8ICX A;  4F5Q A;  2V9W A;  1L5U A;  7ICO A;  3Q8S B;  3H4B A;  4DFJ A;  3QEB Z;  3MR6 A;  5J0P A;  4Q8E A;  3V7L A;  4IRD A;  3Q8M A;  7ICL A;  4PGY A;  5DDM A;  3LK9 A;  4O5C A;  2VA3 A;  2NRV A;  1B22 A;  5D4B A;  4ZH4 A;  1MQ2 A;  1ZQI A;  4DSK A;  5HML A;  2XO7 A;  2W9B A;  1U47 A;  7ICF A;  3NGD A;  3UQ0 A;  1X9W A;  4QWB A;  3QZ8 A;  2BCS A;  2FLL A;  3H7I A;  1A76 A;  1H38 A;  1XS9 D;  4DQQ A;  3LWL A;  5D46 A;  2HHS A;  3RJH A;  5L1J A;  9ICA A;  2KTQ A;  2AQ4 A;  8ICE A;  1N48 A;  4DL3 A;  2C2D A;  2W8L A;  3H40 A;  4GC6 A;  1U49 A;  2AU0 A;  5J29 A;  1S0O A;  1NOM A;  5DDY A;  5HMM A;  4EZ9 A;  7ICU A;  7ICK A;  1K1S A;  5L9X A;  4ECU A;  2FPL A;  1Y88 A;  9ICL A;  2OWO A;  1U45 A;  5IIK A;  3RAQ A;  3BDP A;  3MR3 A;  1ZQF A;  1ZQT A;  3RJE A;  4F5N A;  1S10 A;  1RYS A;  1NJX A;  1ZQQ A;  4MFF A;  4J9P A;  1UA0 A;  5TZV A;  1Z00 A;  3AUO A;  4TUP A;  2DFL A;  4I2D A;  4JWN A;  1SL1 A;  3GV7 B;  1X9S A;  3M8S A;  4M04 A;  2AJQ A;  1ZQV A;  4M6W A;  3T5K A;  4ELV A;  1MSW D;  7ICP A;  2ZUB A;  5J2E A;  4M9N A;  1TV9 A;  4R63 A;  3EPG A;  3PO4 A;  8ICZ A;  2RDI A;  4ECT A;  2VA2 A;  5BOM A;  1ZET A;  1KRP A;  3PY8 A;  8ICU A;  4UAZ A;  3TFS A;  1JMS A;  3FYH A;  3NTU A;  2F1H A;  4BGD A;  3M9O B;  4J9O A;  3LWM A;  2VAN A;  3JPQ A;  3GII A;  1T3N A;  4PH5 A;  5DG9 A;  1U9L A;  3KHR A;  1D9F A;  4I27 A;  2VA8 A;  2R8I A;  4JV0 A;  3PW0 A;  4O3R A;  2FPM A;  4K4I A;  5JUM A;  3G6V A;  4DO9 A;  1L3T A;  4KLU A;  2C2E A;  1T4G A;  3TAP A;  4BWJ A;  3OSN A;  2W9A A;  3PNC A;  3RBD A;  1ZYQ A;  3ZDC A;  2C2R A;  8ICP A;  3ETL A;  4I29 A;  5IIN A;  8ICB A;  2JEG A;  4DSI A;  4IR1 A;  5DG7 A;  1UA1 A;  4QZI A;  3GFK B;  2A1J A;  4F4Y A;  7ICG A;  3N97 B;  9ICU A;  3RH4 A;  2I1Q A;  5KFZ A;  5CB1 A;  2DPI A;  4NM2 A;  2UVV A;  4ECS A;  1NK6 A;  5KFH A;  8ICL A;  4O0I A;  5J0X A;  2MUT A;  4EYI B;  5CHG A;  3H8J A;  4B9V A;  3Q8K A;  5HHH A;  4QZC A;  4B9U A;  2HW3 A;  4ECV A;  4P4O A;  4K4H A;  1TFR A;  4C8N A;  4I2J A;  4XA5 A;  1ZJM A;  5EWF A;  4F50 A;  4UB4 A;  5KFG A;  3EZ5 A;  3HX0 A;  4QZF A;  4F5P A;  4NXZ A; 
#chains in the Genus database with same CATH topology
 3LDA A;  4RPY A;  2IBK A;  5DB7 A;  1L8O A;  2EZZ A;  3SR6 A;  3KBB A;  1ARO P;  4F92 B;  3EWA A;  2Y9U A;  3OTQ A;  1NI3 A;  2WF6 A;  4P4P A;  3C29 A;  3PSP A;  2JZB A;  1NJW A;  1TAU A;  4MEX A;  3C1Z A;  1RYR A;  3PR5 B;  2W11 A;  1BPD A;  2Y0S F;  3S6J A;  4UB3 A;  3TAD A;  3MGH A;  3KD3 A;  1COO A;  1ED1 A;  1BPX A;  3H8S A;  4ACO A;  2VJ4 A;  3TAC B;  3C1Y A;  1L7O A;  4DS5 A;  2AGP A;  4UB6 U;  4KIT B;  5AKG A;  3SZ2 A;  3F2C A;  1A6S A;  4ELU A;  2JH7 A;  4C4T A;  4ED0 A;  4RZR A;  2YTU A;  3FDS A;  3VCB A;  1QSS A;  2NRZ A;  5DLF A;  4EZ6 A;  1N2X A;  4RQN A;  5AM3 A;  2ESE A;  5ALP A;  4YFK A;  3PX0 A;  2G5H B;  1KSP A;  1KBU A;  2MU2 A;  1QQ7 A;  2F1J A;  3C2L A;  4NLN A;  4R65 A;  4RNO A;  4US8 A;  1T7P A;  2HSZ A;  2NO5 A;  4ECQ A;  5J0U A;  4RQ3 A;  2BQU A;  3B0X A;  3OPX A;  5ALR A;  3PW7 A;  1L7P A;  5KFI A;  3BS7 A;  4BDP A;  3MFI A;  3PZP A;  3RR7 A;  5TIS U;  3SQI A;  3V72 A;  1VJ5 A;  4ECX A;  3UXN A;  5B5E U;  1SV4 A;  3BZC A;  3OSP A;  9ICN A;  2IOF A;  1HUO A;  3I1Y A;  2AHO B;  4PGX A;  4DQS A;  3QXG A;  2K4I A;  4I2I A;  3GIK A;  1D8B A;  4FFD A;  1NJZ A;  5ALD A;  1NK5 A;  4F2S A;  4M9L A;  4DF4 A;  3F53 A;  1RZT A;  4FZM A;  4X5V A;  5DQH A;  3RJG A;  1DOQ A;  2LBO A;  4O3O A;  1KLN A;  4KLJ A;  5IIJ A;  4I28 A;  5KG1 A;  1T3Q A;  3MR5 A;  3F5A A;  4GXK A;  2EZY A;  2LMR A;  2BDU A;  1ZJN A;  4WJ3 B;  2JMG A;  3UPQ A;  4CDG A;  2E8N A;  3R9K A;  2FLP A;  3RH5 A;  1ZRN A;  3RTV A;  3BZK A;  3TKA A;  2WFA A;  2W9B B;  9ICP A;  1ZQN A;  4F72 A;  4DOC A;  4F5R A;  3KZX A;  2BQ3 A;  3BQ2 A;  1XSP A;  3PSF A;  1SKS A;  1ZQD A;  1XWL A;  4IQT A;  4P0Q B;  2W7P A;  3TQ1 A;  2I9G A;  2OH2 A;  5AKY A;  1HJP A;  4ED3 A;  2MA1 A;  2KJ9 A;  3WK5 A;  3ISC A;  3IV6 A;  4J9R A;  5ALI A;  5KFL A;  4YR0 A;  1CEZ A;  4BXO A;  2KE7 A;  4C8O A;  1L3V A;  4RQ2 A;  1L3S A;  1D8Y A;  4CNQ A;  3ZDA A;  1ZQB A;  2RQ5 A;  2Y0S C;  2AGO A;  1JX4 A;  5EE1 A;  1NNL A;  4MF2 A;  4UAS A;  1Z4O A;  4KLD A;  4B9L A;  1KL9 A;  4JK1 A;  1KN5 A;  4J9S A;  4F8R A;  7ICS A;  2LPE A;  3LVV A;  3MFH A;  4NLK A;  3UMB A;  2ZIV B;  4FZN A;  3T5J A;  4GIB A;  3HP6 A;  2OYY A;  1T8E A;  4RU9 A;  1SL0 A;  2MRL A;  4Y2T A;  5KFR A;  2P35 A;  4F4K A;  4UBB A;  4Q45 A;  4GXJ A;  4M9H A;  2LYB A;  5J2I A;  3PO5 A;  1TVA A;  1MC8 A;  5D49 A;  1MA7 A;  4RQ7 A;  4M9J A;  5KFW A;  2IOH A;  4GC7 A;  1ZOL A;  9ICT A;  3QUQ A;  4FZL A;  4MHV A;  5AIB A;  1BPB A;  5KFU A;  1NKE A;  4FBT A;  2PMZ C;  4Q43 A;  1ZQC A;  2EAM A;  5KFC A;  2PXI A;  4EX7 A;  4C8L A;  2ZIW A;  4J9L A;  4DOA A;  9ICM A;  5CR0 A;  2HBL A;  4ED8 A;  2YMQ A;  5EWE A;  1ZQK A;  4F3O A;  3I28 A;  3MR2 A;  2R8K A;  2ISP A;  5DGA A;  3F2B A;  2GWS A;  2EAO A;  4DL2 A;  4KLO A;  8ICI A;  2ZIW B;  1SXD A;  3ISD A;  1TE2 A;  3LVW A;  4O5E A;  4RNM A;  4DFM A;  3VC8 A;  1IIP A;  2G0A A;  2G07 A;  1Z3E B;  3Q8P B;  4QNL A;  5KFK A;  5DLG A;  4UAV A;  2BDP A;  3O0F A;  4QWC A;  1S77 D;  2HOQ A;  2KP7 A;  5JRT A;  2BCV A;  4F4X A;  2EAN A;  3QUC A;  1S0M A;  1Z1V A;  4ZOH C;  4R8U A;  2ES6 A;  2L5Y A;  2NRT A;  1NKB A;  1WCN A;  1Z4N A;  3GIJ A;  4JV2 A;  4MEY A;  5A0L A;  1A77 A;  4F4Z A;  1ZQA A;  4JMU A;  2JXJ A;  2NRX A;  2JEI A;  3CP8 A;  1PVP A;  5KG4 A;  1DK3 A;  3L4P A;  4YP3 A;  1QLN A;  2IHN A;  2P6U A;  3UMC A;  1D9D A;  1NZP A;  3B0Y A;  2H3I A;  5KT2 A;  2HHQ A;  4TUQ A;  2HHT A;  7ICT A;  5ALH A;  2GH1 A;  5DG8 A;  4EBC A;  3C5F A;  4F5Q A;  1O03 A;  2DL0 A;  5J0P A;  5EE3 A;  3Q8M A;  2H3Z A;  2KD1 A;  1YT3 A;  4DCC A;  5AK3 A;  3ONN A;  5HML A;  2XO7 A;  2W9B A;  3NGD A;  1X9W A;  4QWB A;  1L7N A;  2KVS A;  1H38 A;  4CF3 A;  2HHS A;  1J2M A;  2E8M A;  3LYS A;  4P0P B;  5JU5 A;  1U49 A;  5AI0 A;  2ZXI A;  1DGJ A;  9ICL A;  3WKD A;  2OWO A;  2NO4 A;  1ZQT A;  4F5N A;  3WK6 A;  5ALU A;  2LYA A;  4JWN A;  1SL1 A;  2W04 A;  3GV7 B;  4M04 A;  3QU4 A;  4OJP A;  2VA2 A;  3PY8 A;  2YX8 A;  2DWQ A;  4HAI A;  4PJ0 U;  2ZIU B;  1D9F A;  4I27 A;  4LJX A;  4JV0 A;  2R8I A;  2FPM A;  3SAF A;  3G6V A;  2QB0 A;  3PNC A;  5ALT A;  3ETL A;  8ICB A;  4IR1 A;  4PL2 A;  3N97 B;  9ICU A;  2I1Q A;  5CB1 A;  2UVV A;  4ECS A;  1N61 A;  4O0I A;  5CHG A;  3H8J A;  1N60 A;  5ALO A;  5KAF U;  2ZIX A;  4XA5 A;  1ZJM A;  5EWF A;  4UB4 A;  4DFD A;  3PST A;  5KFG A;  4PZN A;  3HX0 A;  4F5P A;  4UAT A;  2RHF A;  2ZIX B;  4IQV A;  1S5L U;  3NUQ A;  2D3D A;  3NRW A;  3RRG A;  4O5K A;  1ZQP A;  9ICO A;  3QX7 A;  4CE6 A;  4J9Q A;  3T79 A;  4QW8 A;  2ATL A;  1NK9 A;  2R18 A;  3PW4 A;  2I6X A;  4B9S A;  5KFB A;  3Q8L A;  3HRD D;  4DSE A;  1ZQY A;  5J2K A;  4MF8 A;  1L3U A;  2K8A A;  4DL5 A;  4DL6 A;  5KT5 A;  4K4G A;  4NJ8 A;  4TQR A;  4DFP A;  3PML A;  8ICS A;  5HP4 A;  2KIC A;  2PFN A;  4PHA A;  2F44 A;  1KEJ A;  2AH5 A;  1DXS A;  4P2H A;  4EBD A;  4TUS A;  5DBB A;  1CI4 A;  4YMM A;  5J0Y A;  4UB1 A;  4KLE A;  5AKJ A;  1Q3V A;  1UT5 A;  4YXJ A;  3RJF A;  2UVU A;  2PFP A;  2P6R A;  4TQS A;  5KFA A;  4KTQ A;  2XGQ A;  9ICJ A;  3K75 D;  1K1Q A;  4RPX A;  3AEV A;  3WKE A;  2CPR A;  2OXO A;  3AU6 A;  2XVT A;  2J6S A;  5G5G A;  5CJ7 A;  2ZIU A;  2XIC A;  1KQQ A;  5KFX A;  2PI4 A;  8ICR A;  2G09 A;  5AM0 A;  2BGW A;  2YB4 A;  2H3F A;  4R64 A;  1PK3 A;  4OJL A;  3SEN A;  2XY5 A;  3B9J A;  1NK7 A;  4DWI A;  4O3Q A;  1KFS A;  1ZD2 P;  1KFT A;  3JPT A;  4UAR A;  2BCU A;  3PR4 A;  2F1I A;  1BNP A;  2DF4 B;  4OJO A;  3DV9 A;  4IR9 A;  2VJ5 A;  3H4D A;  2KVC A;  4KLT A;  3K1R B;  2YML A;  8ICC A;  2PKE A;  4P0P A;  3ZDB A;  5KFO A;  1S9F A;  2ZTE A;  3IN5 A;  2YY6 A;  2KJ8 A;  3QU5 A;  1O08 A;  3UM9 A;  3NVZ A;  1IXR A;  4JB3 A;  1B4F A;  2KHV A;  3IHQ B;  1IV8 A;  1F0M A;  1RQN A;  2KZZ A;  3C21 A;  1QQ5 A;  4NLC A;  2YMM A;  4YN4 A;  3OJU A;  2KOB A;  1NK4 A;  2KZM A;  4NL9 A;  3JPS A;  3AM9 A;  2WF8 A;  2OHF A;  3V6K A;  9ICX A;  3SI8 A;  3WU2 U;  9ICB A;  3WKC A;  4F4W A;  1JN3 A;  4EEN A;  3WKA A;  1UPH A;  3RR8 A;  5J2A A;  3TAQ A;  2HOI A;  3PW2 A;  4ECZ A;  4DQR A;  8ICJ A;  3DEE A;  9ICF A;  5KFS A;  5ALN A;  3DDH A;  3GV5 B;  3QYP A;  1OUQ A;  2DBY A;  3RJJ A;  5AM1 A;  4UB5 A;  3BS5 B;  2FMS A;  3AMZ A;  2AGQ A;  4YQW A;  3KHL A;  5IIM A;  1ECW A;  3RB3 A;  3MDC A;  2RRD A;  4C8M A;  2W9C B;  1FFV A;  2ZUD A;  4NM1 A;  3H8M A;  4RT2 A;  1SB3 C;  3U26 A;  5HR6 A;  2AXT U;  1BGX T;  1RPL A;  4F91 B;  2HHV A;  5KTQ A;  2R8J A;  8ICK A;  4XQ8 A;  8ICN A;  3QZ7 A;  2JEF A;  2A19 A;  2OM6 A;  3JPP A;  2UVW A;  1EXN A;  2V4Q A;  4RQ0 A;  4DQP A;  4ELT A;  3UQ2 A;  2NV3 A;  4ED6 A;  3NVW A;  1U4B A;  1X2I A;  4RQ4 A;  2FLN A;  2ASJ A;  4Y2V A;  2IHM A;  4GXI A;  4BXO B;  1XO1 A;  1V38 A;  3CW2 C;  1UQV A;  3H0M B;  4RQM A;  2BPG A;  1HEK A;  1L8L A;  1A0P A;  1SZH A;  3KTQ A;  1V97 A;  7ICH A;  4CRX A;  3I76 A;  2XCP A;  4O3N A;  4PHD A;  5KG7 A;  1TKD A;  4RUC A;  8ICO A;  2LI6 A;  4KX5 A;  1PUZ A;  4IRK A;  4Z6D A;  3T5L A;  2EH9 A;  5HHI A;  1JXL A;  4M9G A;  3A0B U;  3BJY A;  4GFJ A;  4KMO B;  4O3S A;  2ASD A;  5ALV A;  4P4M A;  1ZQJ A;  4J9M A;  5ALJ A;  5J0W A;  1SKW A;  4F2R A;  2WF7 A;  5J0O A;  2E8O A;  1XSN A;  4QZA A;  5K4L A;  3ETR A;  3CNH A;  3RBE A;  2B21 A;  5KT6 A;  3JPR A;  3M9M B;  2JRZ A;  3JPO A;  3E0F A;  1SWW A;  2WAQ F;  4PGQ A;  4C8K A;  1BPE A;  3FC4 A;  3HWT A;  2IOF K;  2KFN A;  1JRP A;  3J81 j;  2QAR B;  2ZTC A;  3MAB A;  3F5E A;  5KT7 A;  3IG8 A;  4CCH A;  2ODG A;  1JIH A;  5KT3 A;  3HPO A;  4DQI A;  4I2B A;  1ZQH A;  1M6Y A;  4YD1 A;  4U7C A;  5DBA A;  2E1E A;  4ED7 A;  4G3I A;  1FIQ A;  3H4B A;  7ICL A;  4BX9 C;  2JR5 A;  3LK9 A;  2NRV A;  1B22 A;  5D4B A;  1ZQI A;  1X6J A;  1U47 A;  4OJ5 A;  3QZ8 A;  5J8Y A;  2BCS A;  2FLL A;  3KOO A;  1XS9 D;  3LWL A;  5AI9 A;  3RJH A;  3WK4 A;  4DL3 A;  2W8L A;  4GC6 A;  2AU0 A;  3L3F X;  5J29 A;  1S0O A;  2VIX A;  5HMM A;  4EZ9 A;  1HIW A;  1K1S A;  1U45 A;  5IIK A;  3RAQ A;  3BDP A;  1WYG A;  1ZQQ A;  3ZI4 A;  4J9P A;  1Z00 A;  3NVV A;  4TUP A;  3AN1 A;  7ICP A;  2AJQ A;  1ZQV A;  4ELV A;  1MSW D;  2ZUB A;  1TV9 A;  8ICZ A;  4ECT A;  8ICU A;  5F3X B;  2KNJ A;  3RAX A;  1JMS A;  2F1H A;  5ALY A;  4OCZ A;  3BS5 A;  2RLT A;  5JUM A;  4KLU A;  1ZYQ A;  3NVY A;  8ICP A;  4I29 A;  4AP9 A;  1IG6 A;  2JEG A;  4DSI A;  2A1J A;  7ICG A;  1QCK A;  3RH4 A;  5KFZ A;  4NM2 A;  5AKK A;  3WK9 A;  5J8Y C;  4EEK A;  1MN8 A;  5GTH U;  3WK7 A;  5J0X A;  4B9V A;  3Q8K A;  2HW3 A;  4UB8 U;  4ECV A;  2HMX A;  4P4O A;  3EZ5 A;  1SXE A;  5B66 U;  1PK1 A;  1ZXI A;  1UHU A;  3C23 A;  2KIV A;  4JUZ A;  4UQG A;  3N7S C;  4I2G A;  2BKE A;  4EX6 A;  4NLB A;  3D2Q A;  4PL1 A;  5CEH A;  2IMW P;  2KKV A;  9ICK A;  3PVX A;  2R8H A;  1XC9 A;  1FFU A;  5KG5 A;  3V6H A;  3PW5 A;  1NZB A;  3IDW A;  5J0Q A;  3RF9 A;  4I2A A;  2W54 A;  4RQ1 A;  2PI5 A;  4PPX A;  5KFD A;  3HIL A;  2ISO A;  2K4P A;  1JI7 A;  5KFM A;  3N28 A;  3T3F A;  5DQI A;  4MFA A;  4Y2S A;  1XU4 A;  1SIJ A;  5DB6 A;  2C22 A;  2HCF A;  2PFQ A;  5AIA A;  4ED2 A;  4EEL A;  1UT8 A;  1BPY A;  2EQY A;  3TAN A;  4OJ6 A;  4KLL A;  3QUT A;  4NV0 A;  1HUZ A;  1KTQ A;  3HKZ C;  3MGI A;  2HI0 A;  2K4H A;  4YMO A;  4DSF A;  5ALX A;  3PV8 A;  5KFQ A;  1F44 A;  1ZQU A;  2ZUC A;  1S0V A;  1QSL A;  5J2B A;  3KKA A;  2MUT B;  3PMN A;  3RH6 A;  2Y1J A;  1B0X A;  3C28 A;  4Y2U A;  2G08 A;  1BPZ A;  5III A;  2BCQ A;  3AQF A;  5ALK A;  4Q44 A;  1AQ6 A;  1Q8K A;  8ICH A;  3OHA A;  2W43 A;  2BCR A;  1Z19 A;  1ZQG A;  2QB0 B;  7ICM A;  2WHE A;  2KMD A;  2MSN A;  4DSL A;  2LM4 A;  1QTM A;  3IG5 A;  5L1K A;  4QZH A;  3TI0 A;  5EE9 A;  5AKZ A;  4IQW A;  4KLS A;  4IL6 U;  2WF9 A;  3WKB A;  3SAH A;  1LKY A;  3M1Y A;  1MQ3 A;  3N4M B;  4QWD A;  3G6Y A;  2OEH A;  4ICA A;  3D2S A;  2OCE A;  3KHG A;  3UXO A;  3SV4 A;  4I2F A;  1BNO A;  3AQE A;  1ZQO A;  2ZTD A;  5KT4 A;  4JWM A;  4Y2Q A;  3IRU A;  3V6J A;  2B0C A;  5CRX A;  1B43 A;  1TAM A;  3RB6 A;  2NRW A;  1ZQL A;  5J2F A;  4IC9 A;  2HVH A;  5J0R A;  2W3R A;  4Z6E A;  2FMQ A;  2R8G A;  3GZF A;  2BZF A;  9ICW A;  9ICR A;  5HR7 A;  3MBY A;  4KLG A;  4Z6F A;  5E79 U;  2CRX A;  2RDJ A;  2KSO A;  3ZDE A;  4NLZ A;  5EWG A;  1ZD5 A;  3SD7 A;  4RQ5 A;  2Q4T A;  4OD0 A;  3KFU F;  3JPN A;  2BR0 A;  2P66 A;  3UMG A;  3HT3 A;  1S97 A;  4RNN A;  5L1L A;  5CWR A;  1ZQS A;  1X9M A;  5CA7 A;  2W8K A;  5ALL A;  4KLF A;  2C28 A;  4KLQ A;  3EPI A;  3F2D A;  3H0L B;  2H3Q A;  4IRC A;  2GO7 A;  3HW8 A;  1FO4 A;  2AQ0 A;  2Q0Z X;  4QW9 A;  1ZQZ A;  1X6I A;  3RJI A;  2ZJ5 A;  8ICW A;  2ASL A;  2BPF A;  1Q3U A;  2M9N A;  4QZ8 A;  4LVS A;  2WTF A;  2JV3 A;  4RQ6 A;  4NY8 A;  2QAR A;  3WK8 A;  4QWE A;  2JH1 A;  4QZD A;  4O9M A;  4KN4 A;  1SWV A;  1S76 D;  3M9N B;  1X40 A;  2I5H A;  4UW9 A;  3V7J A;  4QZB A;  5KG3 A;  4I2E A;  1SL2 A;  5G5H A;  1RXV A;  3TFR A;  3NS1 A;  2E8P A;  4ECY A;  3IM1 A;  5BPC A;  1SGG A;  8ICV A;  3ZD9 A;  2ALZ A;  2KEY A;  1GO3 F;  5CP2 A;  1XNS A;  5AKH A;  4G9B A;  4KX3 A;  2FDR A;  2G5I B;  5T14 A;  1ZD4 A;  3ORY A;  1RXW A;  1OW5 A;  4KMU A;  2HVI A;  3H0R B;  1KDH A;  5EE0 A;  2GLE A;  5AHX A;  4P0Q A;  3OJS A;  8ICF A;  5KL8 B;  4XUS A;  3M8R A;  7ICN A;  1X66 A;  7ICJ A;  4UAW A;  4M0A A;  1WCL A;  4DLE A;  3CYM A;  1JUD A;  1NK8 A;  2H5X A;  4NWI A;  3Q8Q B;  4DFK A;  4PHP A;  5EOZ A;  4EYH B;  3D6J A;  5KFJ A;  2HBJ A;  3BQ1 A;  3SV3 A;  4AYB F;  2G06 A;  1LV5 A;  1DGS A;  1J97 A;  3OHB A;  7ICE A;  5DQG A;  4F93 B;  4YXM A;  2KZ3 A;  1TK5 A;  3IP4 B;  1UCV A;  9ICC A;  1RQL A;  5ALZ A;  3HKZ F;  3ZD8 A;  3QEA Z;  4CGZ A;  4FS1 A;  1XO0 A;  4XRH A;  4QZ9 A;  3K4G A;  1SV0 A;  3QUB A;  1JAL A;  5KG6 A;  5JTI A;  1PVR A;  4B9N A;  2IA6 A;  2W7O A;  8ICQ A;  2KK0 A;  2W9C A;  4I2H A;  3SMV A;  5J2D A;  1S0N A;  2XCA A;  5AK4 A;  5ALS A;  3KHH A;  5KG2 A;  5KFT A;  1BVS A;  4QWA A;  4F5O A;  9ICI A;  2MAX A;  2BQR A;  3QE9 Y;  2V9W A;  3QEB Z;  2FE9 A;  3MR6 A;  5DDM A;  4O5C A;  2GOL A;  5AKX A;  3UQ0 A;  3H7I A;  4DQQ A;  1DK2 A;  1KW4 A;  2K4E A;  5L1J A;  2XI9 A;  9ICA A;  2KTQ A;  1N48 A;  2C2D A;  7ICU A;  5L9X A;  2RP5 A;  3MR3 A;  1ZQF A;  3RJE A;  1S10 A;  4MFF A;  1RYS A;  1NJX A;  2WF5 A;  5TZV A;  3AUO A;  2VKQ A;  3MGV A;  4I2D A;  1X9S A;  3M8S A;  2NYV A;  5J2E A;  2ZIV A;  3PO4 A;  1ZET A;  5FP0 A;  3M9O B;  2CXY A;  3JPQ A;  2F8K A;  4PH5 A;  1Q46 A;  5DG9 A;  3KHR A;  4O3R A;  2E1F A;  3PW0 A;  1L3T A;  1T4G A;  4BWJ A;  3OSN A;  4USA A;  2W9A A;  3ZDC A;  5ALG A;  2C2R A;  5ALE A;  4QZI A;  1X9X A;  3GFK B;  4F4Y A;  2YB1 A;  1N5W A;  2WAQ C;  2PMZ F;  5KFH A;  4EYI B;  2MUT A;  2DUY A;  5HHH A;  4C7Z A;  4QZC A;  2F3N A;  2QLT A;  3ED5 A;  4B9U A;  5AK6 A;  1TFR A;  4C8N A;  4I2J A;  4F50 A;  1PK1 B;  1WWU A;  4QZF A;  3N7R C;  2EDU A;  1JXE A;  5AI5 A;  4RT3 A;  3EYZ A;  4ED1 A;  2K8B B;  2M0N A;  4RQ8 A;  3GV8 B;  2XGP A;  1YZ7 A;  2Y9T A;  4YD2 A;  2WB1 F;  4UB2 A;  7ICQ A;  1RG6 A;  2A1J B;  3C5G A;  3RB4 A;  2BHN A;  4UAY A;  1WUD A;  4GLX A;  3K1Z A;  2A3V A;  3GU3 A;  1N56 A;  4JV1 A;  5KG0 A;  2A1A A;  3Q8R B;  4LZG A;  4F71 A;  3E58 A;  2D6F C;  5AM4 A;  9ICE A;  1U48 A;  4KLH A;  4E0D A;  3FAH A;  2FJ6 A;  2FMP A;  2O6K A;  4YVZ A;  4YR3 A;  1TK0 A;  5AIC A;  5AI6 A;  2J6U A;  4EEY A;  1KFD A;  1L7M A;  5J0T A;  2YN4 A;  5J2J A;  2ZJ8 A;  4I2C A;  3CRX A;  5HNK A;  2KG5 A;  4DF8 A;  5AKI A;  1N5X A;  2JZB B;  3BQT A;  5GTI U;  2KJ5 A;  1SKR A;  3BQ7 A;  3FM9 A;  2K8C B;  9ICV A;  2Y1I A;  5F9L A;  1YZ6 A;  4DOB A;  2WB1 C;  4LZD A;  3T5H A;  4DSJ A;  4QIW F;  1KKX A;  5DGB A;  5KFY A;  4KLM A;  5KFE A;  1NKC A;  2EZX A;  2K60 A;  1NJY A;  5L1M A;  1QSY A;  7ICR A;  4DL4 A;  5KFV A;  4Q8F A;  1P7D A;  4IS7 A;  1IM4 A;  2JEJ A;  4ECR A;  1C7Y A;  1PVQ A;  2YQE A;  1VDV A;  2F8L A;  5KFF A;  4M2Y A;  4MFC A;  1VLB A;  2F2A B;  1D8L A;  4RPZ A;  1SV0 C;  3OGU A;  2K89 A;  5IIL A;  9ICS A;  2LKY A;  3MDA A;  2KHQ A;  1ZQR A;  2HBM A;  8ICA A;  3TAD C;  1URJ A;  4PZO A;  5KAI U;  2PFO A;  3SYZ A;  4M6W B;  1T94 A;  4KLI A;  3GQC A;  2JGA A;  2DKZ A;  2W3S A;  1TK8 A;  3RRH A;  3ICX A;  2DGZ A;  1ZQM A;  3V7K A;  4QZG A;  4B9M A;  2DPJ A;  1RM6 C;  1ZQW A;  3TAR A;  5J2G A;  1NK0 A;  2KKP A;  1V9P A;  5KFN A;  3EW9 A;  1PZN A;  4YCX A;  3QNM A;  1F5S A;  4KN7 A;  2V4R A;  2KIW A;  4DS4 A;  4HYK A;  4O3P A;  3UXP A;  3M7D A;  1WG8 A;  2H3V A;  5AI8 A;  9ICQ A;  4QJF B;  4C7Y A;  2HHX A;  2LYH A;  5ALM A;  1LB2 B;  4DL7 A;  3PX4 A;  5ALW A;  9ICH A;  5ALQ A;  2D8C A;  3PSI A;  3KKA C;  4YR2 A;  2W55 A;  5H2F U;  1ZQX A;  3GDX A;  5DBC A;  4BJQ A;  2ZXH A;  2QB1 A;  5ALF A;  2KV2 A;  1JRO A;  5F9N A;  1SZP A;  3BQ0 A;  3G6X A;  3THV A;  1Z00 B;  1RDF A;  3A0H U;  4Y2J A;  2HDO A;  1CUK A;  3SEI A;  2LHT A;  4UBC A;  9ICG A;  1TAQ A;  4Y2R A;  2F77 X;  3M6Z A;  4Y2X A;  3MC1 A;  2XY6 A;  5J0S A;  4O3M A;  4DEZ A;  4FS2 A;  5KFP A;  4B9T A;  3C2K A;  5L1I A;  4B6J A;  7ICI A;  2Z7J A;  1DRG A;  3HJE A;  3PX6 A;  4FBU A;  4TUR A;  2CN1 A;  2UVR A;  3E2E A;  2ZJA A;  2BPC A;  4DLG A;  5C0Y A;  4OO1 J;  2LM1 A;  5DKW A;  2HHU A;  1ZQE A;  3NRZ A;  5J2C A;  4NLG A;  8ICG A;  3KZI U;  4U6P A;  4IQU A;  5BOL A;  1K5O A;  4RUA A;  4NL9 C;  1N62 A;  1FEZ A;  4FO6 A;  2JHD A;  3C2M A;  8ICM A;  1ZD3 A;  7ICV A;  4J03 A;  5J2H A;  1Z1B A;  1S8O A;  5C5J A;  4EBE A;  2KN7 A;  1ZQ1 C;  1J2N A;  4Y2Y A;  5DB8 A;  2YMP A;  3D2N A;  5IIO A;  8ICT A;  3ISB A;  4C4S A;  4R8U B;  1X42 A;  1XSL A;  2HHW A;  3GIL A;  3RJK A;  2E5S A;  3ZDD A;  1LVH A;  3QU9 A;  3SAG A;  2J6T A;  5KNI A;  2XY7 A;  4PHE A;  3AL0 B;  8ICY A;  4C0Z A;  4QIW C;  4J9N A;  4ECW A;  4YG2 A;  5DB9 A;  4BWM A;  4QZE A;  4R66 A;  3RB0 A;  3H8W A;  3ALR A;  4YMN A;  1QQ6 A;  4US9 A;  3RFA A;  4M47 A;  4Z6C A;  2W9M A;  4J9K A;  2FPK A;  3GIM A;  3AU2 A;  2XC9 A;  2KFZ A;  2KSO B;  1WWV A;  8ICX A;  3N7P D;  1L5U A;  3Q8S B;  7ICO A;  4DFJ A;  1ZRM A;  4Q8E A;  3V7L A;  4IRD A;  4Y2P A;  4PGY A;  1RYU A;  2VA3 A;  4ZH4 A;  1MQ2 A;  4DSK A;  7ICF A;  2DQN B;  1QH9 A;  4FE3 A;  1A76 A;  4A8E A;  2QKQ A;  5D46 A;  2AQ4 A;  8ICE A;  3L5K A;  3H40 A;  1NOM A;  5DDY A;  4AYB C;  7ICK A;  4ECU A;  2FPL A;  1Y88 A;  2F76 X;  4CF5 A;  3M6K A;  1OXJ A;  4C4R A;  1UA0 A;  1COK A;  1LKY B;  2DFL A;  4C80 A;  2DKX A;  3T5K A;  4M6W A;  2W03 A;  4M9N A;  5AKE A;  4R63 A;  3EPG A;  4BUG A;  2RDI A;  5BOM A;  1KRP A;  4UAZ A;  3TFS A;  3FYH A;  3NTU A;  1C20 A;  4J9O A;  4BGD A;  3LWM A;  2VAN A;  3GII A;  1N63 A;  3NAS A;  5KL1 B;  1T3N A;  1U9L A;  3QU2 A;  2VA8 A;  5AM2 A;  4K4I A;  2ZG6 A;  4DO9 A;  5AI4 A;  2C2E A;  3TAP A;  3RBD A;  5IIN A;  5AK5 A;  5DG7 A;  1UA1 A;  1CRX A;  2FI1 A;  2DPI A;  2EAP A;  4CF4 A;  3EUB 2;  1NK6 A;  2HOF A;  8ICL A;  1L6N A;  3QU7 A;  5AKL A;  1V85 A;  2XID A;  2B6G A;  4UAU A;  4K4H A;  2E3T A;  5AM5 A;  2N1R A;  2HBK A;  4NXZ A; 
#chains in the Genus database with same CATH homology
 3C23 A;  1JXE A;  3LDA A;  4RT3 A;  4RPY A;  4JUZ A;  3EYZ A;  4IQV A;  4UQG A;  2IBK A;  5DB7 A;  4I2G A;  2BKE A;  4ED1 A;  2IMW P;  4RQ8 A;  3GV8 B;  2XGP A;  3RRG A;  4O5K A;  9ICK A;  1ZQP A;  9ICO A;  1ARO P;  4YD2 A;  4J9Q A;  7ICQ A;  4UB2 A;  4F92 B;  3EWA A;  3PVX A;  4QW8 A;  2R8H A;  1XC9 A;  2A1J B;  2ATL A;  5KG5 A;  3V6H A;  1NK9 A;  3PW5 A;  5J0Q A;  3C5G A;  3RB4 A;  3PW4 A;  2BHN A;  4I2A A;  4UAY A;  4GLX A;  4P4P A;  4RQ1 A;  2PI5 A;  4PPX A;  5KFD A;  4B9S A;  2JZB A;  2ISO A;  1NJW A;  1TAU A;  1N56 A;  5KFB A;  3Q8L A;  3C1Z A;  4MEX A;  4JV1 A;  4DSE A;  1ZQY A;  5J2K A;  5KG0 A;  4MF8 A;  1RYR A;  3Q8R B;  3PR5 B;  5KFM A;  4LZG A;  3T3F A;  1L3U A;  1BPD A;  5DQI A;  4UB3 A;  4DL5 A;  9ICE A;  3MGH A;  1U48 A;  4KLH A;  4E0D A;  1COO A;  5KT5 A;  4MFA A;  4DL6 A;  3H8S A;  1BPX A;  2FMP A;  1XU4 A;  4K4G A;  4TQR A;  5DB6 A;  4YVZ A;  4YR3 A;  4DFP A;  3PML A;  3C1Y A;  2C22 A;  8ICS A;  5HP4 A;  1TK0 A;  2PFQ A;  4DS5 A;  2AGP A;  4KIT B;  4ED2 A;  2PFN A;  4PHA A;  2J6U A;  1UT8 A;  1BPY A;  3SZ2 A;  4EEY A;  1KEJ A;  3TAN A;  4P2H A;  1KFD A;  4EBD A;  4ELU A;  4ED0 A;  4KLL A;  4RZR A;  3FDS A;  5J0T A;  5DBB A;  2NRZ A;  4TUS A;  1QSS A;  5DLF A;  1HUZ A;  1KTQ A;  2ZJ8 A;  5J2J A;  4EZ6 A;  4I2C A;  3MGI A;  4YMM A;  5HNK A;  5J0Y A;  4DF8 A;  4YFK A;  4YMO A;  2JZB B;  4UB1 A;  3PX0 A;  4KLE A;  4DSF A;  1KSP A;  3PV8 A;  5KFQ A;  1UT5 A;  1ZQU A;  3BQT A;  2ZUC A;  1S0V A;  1SKR A;  1QSL A;  5J2B A;  2F1J A;  3C2L A;  4YXJ A;  4NLN A;  2MUT B;  3PMN A;  3RJF A;  4R65 A;  3RH6 A;  2UVU A;  4RNO A;  9ICV A;  2Y1J A;  1T7P A;  2Y1I A;  2PFP A;  5F9L A;  2P6R A;  4TQS A;  5KFA A;  4KTQ A;  1BPZ A;  5III A;  4DOB A;  2BCQ A;  2XGQ A;  4ECQ A;  4LZD A;  5J0U A;  4RQ3 A;  4Q44 A;  3B0X A;  3T5H A;  3PW7 A;  2BQU A;  4DSJ A;  9ICJ A;  3K75 D;  1K1Q A;  5KFI A;  4BDP A;  8ICH A;  4RPX A;  3MFI A;  3AU6 A;  3OHA A;  3RR7 A;  2BCR A;  1ZQG A;  3V72 A;  5DGB A;  5KFY A;  4KLM A;  7ICM A;  5KFE A;  1NKC A;  2J6S A;  4DSL A;  5CJ7 A;  4ECX A;  3UXN A;  1QTM A;  1NJY A;  5L1K A;  4QZH A;  5KFX A;  3TI0 A;  3OSP A;  9ICN A;  2PI4 A;  1HUO A;  1QSY A;  8ICR A;  7ICR A;  2BGW A;  4PGX A;  4DQS A;  4DL4 A;  5KFV A;  4Q8F A;  4R64 A;  2XY5 A;  4I2I A;  3GIK A;  1NK7 A;  4IQW A;  1IM4 A;  4KLS A;  4DWI A;  4O3Q A;  2JEJ A;  4ECR A;  1KFS A;  1NJZ A;  1C7Y A;  1KFT A;  3JPT A;  1MQ3 A;  1NK5 A;  4F2S A;  5KFF A;  4M9L A;  4MFC A;  4M2Y A;  4DF4 A;  1D8L A;  3PR4 A;  2BCU A;  2F1I A;  4RPZ A;  3N4M B;  4QWD A;  1RZT A;  3OGU A;  4X5V A;  5IIL A;  5DQH A;  3G6Y A;  9ICS A;  4IR9 A;  3RJG A;  3MDA A;  1DOQ A;  3H4D A;  4O3O A;  1KLN A;  4KLJ A;  5IIJ A;  3KHG A;  4KLT A;  4I28 A;  1ZQR A;  3UXO A;  5KG1 A;  3SV4 A;  4I2F A;  3MR5 A;  8ICC A;  1ZQO A;  4GXK A;  8ICA A;  2ZTD A;  5KT4 A;  4JWM A;  3RAX A;  3ZDB A;  5KFO A;  1ZJN A;  3V6J A;  3UPQ A;  1S9F A;  2PFO A;  3SYZ A;  1B43 A;  2ZTE A;  2FLP A;  4M6W B;  3RH5 A;  3RTV A;  3RB6 A;  2NRW A;  1ZQL A;  4KLI A;  3GQC A;  2W9B B;  1TK8 A;  9ICP A;  1IXR A;  5J2F A;  3RRH A;  2HVH A;  3IHQ B;  5J0R A;  1ZQN A;  4Z6E A;  2FMQ A;  2R8G A;  4DOC A;  2KZZ A;  1ZQM A;  3C21 A;  3V7K A;  4F5R A;  9ICW A;  4QZG A;  9ICR A;  3MBY A;  4B9M A;  2BQ3 A;  2DPJ A;  4KLG A;  1ZQW A;  3TAR A;  5J2G A;  3BQ2 A;  1NK0 A;  4Z6F A;  4YN4 A;  3OJU A;  1XSP A;  1V9P A;  5KFN A;  1NK4 A;  3EW9 A;  1SKS A;  1PZN A;  4YCX A;  3JPS A;  4KN7 A;  1XWL A;  4IQT A;  2V4R A;  2RDJ A;  3ZDE A;  1ZQD A;  4NLZ A;  3V6K A;  5EWG A;  4DS4 A;  2KZM A;  3TQ1 A;  4HYK A;  2I9G A;  9ICX A;  3SI8 A;  4O3P A;  4RQ5 A;  9ICB A;  1HJP A;  3UXP A;  4F4W A;  4ED3 A;  3JPN A;  3ISC A;  4J9R A;  2BR0 A;  2P66 A;  1JN3 A;  3HT3 A;  4RNN A;  5KFL A;  4YR0 A;  1S97 A;  1CEZ A;  9ICQ A;  4BXO A;  3RR8 A;  5L1L A;  5J2A A;  4C8O A;  3TAQ A;  5CWR A;  3PW2 A;  1L3V A;  4ECZ A;  1ZQS A;  4DQR A;  4RQ2 A;  1X9M A;  1L3S A;  5CA7 A;  2HHX A;  8ICJ A;  1D8Y A;  2W8K A;  4KLF A;  3ZDA A;  9ICF A;  2LYH A;  2C28 A;  1ZQB A;  3EPI A;  4KLQ A;  5KFS A;  2AGO A;  1LB2 B;  1JX4 A;  4IRC A;  3GV5 B;  4DL7 A;  3PX4 A;  3RJJ A;  9ICH A;  4MF2 A;  3HW8 A;  2AQ0 A;  4UB5 A;  2Q0Z X;  4QW9 A;  4KLD A;  4B9L A;  1ZQZ A;  3RJI A;  2ZJ5 A;  2FMS A;  2ASL A;  2AGQ A;  8ICW A;  2BPF A;  4JK1 A;  4J9S A;  4YR2 A;  4F8R A;  4YQW A;  1ZQX A;  3GDX A;  3KHL A;  7ICS A;  2M9N A;  3MFH A;  5DBC A;  4QZ8 A;  4LVS A;  4NLK A;  5IIM A;  2WTF A;  3MDC A;  3RB3 A;  4C8M A;  4RQ6 A;  2W9C B;  3T5J A;  4NY8 A;  2ZUD A;  3HP6 A;  5F9N A;  4NM1 A;  4RT2 A;  1SZP A;  3BQ0 A;  4QWE A;  1T8E A;  3G6X A;  3THV A;  1Z00 B;  4RU9 A;  1SL0 A;  5KFR A;  1BGX T;  4QZD A;  1RPL A;  4KN4 A;  4O9M A;  4F4K A;  4F91 B;  4UBB A;  1S76 D;  3M9N B;  4Q45 A;  4GXJ A;  4M9H A;  2HHV A;  5J2I A;  5KTQ A;  1CUK A;  2R8J A;  8ICK A;  4UBC A;  3PO5 A;  1TVA A;  4XQ8 A;  4QZB A;  3V7J A;  8ICN A;  9ICG A;  1MC8 A;  1TAQ A;  5KG3 A;  5D49 A;  4I2E A;  1SL2 A;  4RQ7 A;  3QZ7 A;  1RXV A;  2JEF A;  4M9J A;  5KFW A;  3TFR A;  2XY6 A;  4GC7 A;  3JPP A;  2UVW A;  4ECY A;  9ICT A;  1EXN A;  5J0S A;  3IM1 A;  2V4Q A;  5BPC A;  4RQ0 A;  4DQP A;  4ELT A;  4DEZ A;  4FS2 A;  8ICV A;  3UQ2 A;  5KFP A;  3ZD9 A;  2ALZ A;  1BPB A;  3C2K A;  5L1I A;  4B9T A;  5KFU A;  1NKE A;  4ED6 A;  4FBT A;  4Q43 A;  7ICI A;  5CP2 A;  3PX6 A;  1U4B A;  4FBU A;  4TUR A;  1X2I A;  4RQ4 A;  2FLN A;  2ASJ A;  1ZQC A;  2UVR A;  3E2E A;  2IHM A;  2ZJA A;  4GXI A;  2BPC A;  5KFC A;  4BXO B;  4DLG A;  1XO1 A;  2PXI A;  5DKW A;  4C8L A;  3ORY A;  1RXW A;  2HHU A;  4J9L A;  4KMU A;  4DOA A;  2HVI A;  1ZQE A;  9ICM A;  5CR0 A;  5J2C A;  1KDH A;  4ED8 A;  1ZQK A;  5EWE A;  4F3O A;  4NLG A;  8ICG A;  3MR2 A;  2BPG A;  3OJS A;  8ICF A;  2R8K A;  2ISP A;  3M8R A;  4XUS A;  3KTQ A;  7ICN A;  5DGA A;  7ICH A;  4IQU A;  2GWS A;  7ICJ A;  2XCP A;  4UAW A;  4O3N A;  5BOL A;  4PHD A;  1WCL A;  5KG7 A;  4RUC A;  4DLE A;  4RUA A;  4DL2 A;  1TKD A;  4M0A A;  4KLO A;  8ICO A;  8ICI A;  3ISD A;  1NK8 A;  4FO6 A;  2H5X A;  4O5E A;  4RNM A;  4DFM A;  4IRK A;  4Z6D A;  3T5L A;  3C2M A;  3Q8Q B;  4DFK A;  8ICM A;  7ICV A;  1Z3E B;  5HHI A;  4PHP A;  5EOZ A;  1JXL A;  5J2H A;  3Q8P B;  4EYH B;  4M9G A;  5KFJ A;  5C5J A;  3BQ1 A;  3BJY A;  5KFK A;  5DLG A;  2KN7 A;  4EBE A;  2BDP A;  3SV3 A;  4O3S A;  2ASD A;  1LV5 A;  1DGS A;  4QWC A;  5DB8 A;  4P4M A;  1S77 D;  3OHB A;  1ZQJ A;  5IIO A;  8ICT A;  3ISB A;  4J9M A;  7ICE A;  5DQG A;  5J0W A;  4R8U B;  1SKW A;  1XSL A;  4F2R A;  4F93 B;  2HHW A;  4YXM A;  3GIL A;  2BCV A;  3RJK A;  5J0O A;  2KZ3 A;  4F4X A;  1TK5 A;  3ZDD A;  1XSN A;  9ICC A;  4QZA A;  1S0M A;  2J6T A;  2XY7 A;  4R8U A;  4PHE A;  2NRT A;  3ZD8 A;  1NKB A;  1WCN A;  3QEA Z;  3RBE A;  2B21 A;  3GIJ A;  4JV2 A;  5KT6 A;  3JPR A;  3M9M B;  8ICY A;  4MEY A;  1A77 A;  4F4Z A;  4FS1 A;  1ZQA A;  3JPO A;  4J9N A;  2NRX A;  4ECW A;  2JEI A;  4YG2 A;  4XRH A;  5DB9 A;  4PGQ A;  4C8K A;  4QZ9 A;  3K4G A;  4BWM A;  5KG4 A;  4QZE A;  1BPE A;  4YP3 A;  5KG6 A;  4R66 A;  3HWT A;  1QLN A;  2IHN A;  2KFN A;  4B9N A;  2IA6 A;  3RB0 A;  8ICQ A;  2ZTC A;  3H8W A;  2W9C A;  3MAB A;  5KT7 A;  2P6U A;  4I2H A;  4YMN A;  4CCH A;  5J2D A;  1S0N A;  4Z6C A;  1D9D A;  4M47 A;  2XCA A;  2W9M A;  4J9K A;  2FPK A;  3GIM A;  3KHH A;  5KG2 A;  1JIH A;  3AU2 A;  5KFT A;  2XC9 A;  1BVS A;  3B0Y A;  5KT3 A;  5KT2 A;  3HPO A;  2HHQ A;  4TUQ A;  4DQI A;  4I2B A;  4QWA A;  2HHT A;  2KFZ A;  7ICT A;  1ZQH A;  4EBC A;  5DG8 A;  4F5O A;  5DBA A;  4YD1 A;  4ED7 A;  2MAX A;  2BQR A;  4G3I A;  3C5F A;  9ICI A;  3QE9 Y;  8ICX A;  4F5Q A;  2V9W A;  1L5U A;  7ICO A;  3Q8S B;  3H4B A;  4DFJ A;  3QEB Z;  3MR6 A;  5J0P A;  4Q8E A;  3V7L A;  4IRD A;  3Q8M A;  7ICL A;  4PGY A;  5DDM A;  3LK9 A;  4O5C A;  2VA3 A;  2NRV A;  1B22 A;  5D4B A;  4ZH4 A;  1MQ2 A;  1ZQI A;  4DSK A;  5HML A;  2XO7 A;  2W9B A;  1U47 A;  7ICF A;  3NGD A;  3UQ0 A;  1X9W A;  4QWB A;  3QZ8 A;  2BCS A;  2FLL A;  3H7I A;  1A76 A;  1H38 A;  1XS9 D;  4DQQ A;  3LWL A;  5D46 A;  2HHS A;  3RJH A;  5L1J A;  9ICA A;  2KTQ A;  2AQ4 A;  8ICE A;  1N48 A;  4DL3 A;  2C2D A;  2W8L A;  3H40 A;  4GC6 A;  1U49 A;  2AU0 A;  5J29 A;  1S0O A;  1NOM A;  5DDY A;  5HMM A;  4EZ9 A;  7ICU A;  7ICK A;  1K1S A;  5L9X A;  4ECU A;  2FPL A;  1Y88 A;  9ICL A;  2OWO A;  1U45 A;  5IIK A;  3RAQ A;  3BDP A;  3MR3 A;  1ZQF A;  1ZQT A;  3RJE A;  4F5N A;  1S10 A;  1RYS A;  1NJX A;  1ZQQ A;  4MFF A;  4J9P A;  1UA0 A;  5TZV A;  1Z00 A;  3AUO A;  4TUP A;  2DFL A;  4I2D A;  4JWN A;  1SL1 A;  3GV7 B;  1X9S A;  3M8S A;  4M04 A;  2AJQ A;  1ZQV A;  4M6W A;  3T5K A;  4ELV A;  1MSW D;  7ICP A;  2ZUB A;  5J2E A;  4M9N A;  1TV9 A;  4R63 A;  3EPG A;  3PO4 A;  8ICZ A;  2RDI A;  4ECT A;  2VA2 A;  5BOM A;  1ZET A;  1KRP A;  3PY8 A;  8ICU A;  4UAZ A;  3TFS A;  1JMS A;  3FYH A;  3NTU A;  2F1H A;  4BGD A;  3M9O B;  4J9O A;  3LWM A;  2VAN A;  3JPQ A;  3GII A;  1T3N A;  4PH5 A;  5DG9 A;  1U9L A;  3KHR A;  1D9F A;  4I27 A;  2VA8 A;  2R8I A;  4JV0 A;  3PW0 A;  4O3R A;  2FPM A;  4K4I A;  5JUM A;  3G6V A;  4DO9 A;  1L3T A;  4KLU A;  2C2E A;  1T4G A;  3TAP A;  4BWJ A;  3OSN A;  2W9A A;  3PNC A;  3RBD A;  1ZYQ A;  3ZDC A;  2C2R A;  8ICP A;  3ETL A;  4I29 A;  5IIN A;  8ICB A;  2JEG A;  4DSI A;  4IR1 A;  5DG7 A;  1UA1 A;  4QZI A;  3GFK B;  2A1J A;  4F4Y A;  7ICG A;  3N97 B;  9ICU A;  3RH4 A;  2I1Q A;  5KFZ A;  5CB1 A;  2DPI A;  4NM2 A;  2UVV A;  4ECS A;  1NK6 A;  5KFH A;  8ICL A;  4O0I A;  5J0X A;  2MUT A;  4EYI B;  5CHG A;  3H8J A;  4B9V A;  3Q8K A;  5HHH A;  4QZC A;  4B9U A;  2HW3 A;  4ECV A;  4P4O A;  4K4H A;  1TFR A;  4C8N A;  4I2J A;  4XA5 A;  1ZJM A;  5EWF A;  4F50 A;  4UB4 A;  5KFG A;  3EZ5 A;  3HX0 A;  4QZF A;  4F5P A;  4NXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...