3MABA

Crystal structure of an uncharacterized protein from listeria monocytogenes, triclinic form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
LANLSELPNIGKVLEQDLIKAGIKTPVELKDVGSKEAFLRIWENDSSVCMSELYALEGAVQGIRWHGLDEAKKIELKKFHQSLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 32
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3mabA00
2HHWA 2ZUDA 5J0RA 3OHBA 5KG6A 3RTVA 4ECZA 2F1HA 4BXOA 2F1IA 2NRXA 7ICPA 4M6WA 3KHRA 4ECVA 5J2EA 3GQCA 4RNMA 4O3OA 4K4HA 3RJGA 4DSIA 2ZTEA 4Q45A 3T3FA 2ASLA 3V6JA 1NJYA 4PHEA 1ZJMA 4QWBA 3H4BA 8ICLA 4X5VA 2BCRA 4BXOB 4ED1A 4I27A 3QE9Y 2PFOA 1S0OA 2ZTCA 4LZDA 4RQ4A 5HNKA 9ICGA 5BOMA 4NM1A 2BQUA 3KHHA 5J2GA 2HVIA 1ZQIA 4KLJA 5EWGA 9ICEA 1RPLA 2ZTDA 2I1QA 8ICTA 4GLXA 3SV3A 3T5HA 3MGIA 4FS2A 9ICIA 2Q0ZX 2HHVA 1KFTA 5J2DA 4QZDA 1DOQA 3M9OB 4J9QA 3G6XA 1L5UA 9ICAA 4RQ3A 3FYHA 4F4KA 3SV4A 5J0SA 4ED0A 4JK1A 1PZNA 1JXEA 3V7LA 4UBBA 4RQ1A 2XC9A 7ICLA 3H4DA 3MFIA 5KFZA 3LWLA 3C2KA 5KT2A 4HYKA 4LVSA 4KLHA 4Q8EA 5KG3A 3OJSA 4YD1A 4RT3A 4KITB 3V72A 5F9NA 4DQSA 1SL1A 2IBKA 9ICKA 4P4OA 1D9FA 1NK4A 4IRDA 3V6KA 5KG4A 3B0YA 4QZGA 5KT6A 3RB6A 1U48A 3GV7B 1QLNA 4DF4A 1NK8A 1S0MA 4RQ7A 3Q8LA 1MQ2A 2ISPA 3BQ0A 3PY8A 3C21A 4B9SA 4C8KA 8ICNA 5KFFA 2VA3A 4DOCA 2HHXA 3BQ2A 4MF2A 4KN4A 1RXVA 5D49A 5DLFA 4UB2A 1JIHA 4I2IA 4DF8A 5DGAA 5EWEA 5L1KA 4KLTA 4F50A 4DFJA 3RAXA 1TAUA 3Q8QB 3K4GA 1BGXT 3PW2A 4ED2A 1ZQNA 1ZQKA 1KSPA 4DSLA 7ICKA 4J9KA 4PHDA 1ZQGA 4KLDA 1ZQVA 2NRTA 1JX4A 8ICWA 2BCQA 1KRPA 1S97A 3JPQA 4DFPA 4UAYA 4DWIA 2R8HA 3QZ7A 4YXJA 4G3IA 8ICXA 4RQ8A 4ED6A 1SKSA 4ELVA 1RYRA 3K75D 2MUTA 1UT8A 2PXIA 5L1JA 5DG8A 2KZMA 5CWRA 3UPQA 3PW7A 1X9MA 2HVHA 3MR6A 4F5RA 3QEAZ 4FS1A 4NLZA 4O3QA 5J0YA 5KFXA 3ZDAA 4TUPA 3PMLA 1L3TA 2VANA 4B9UA 2C2RA 4O9MA 4DL6A 4YR2A 1N48A 4M9NA 3Q8RB 2W9BA 5CJ7A 4M04A 3B0XA 5KFQA 4EZ9A 4KMUA 4TQSA 4EBDA 3RJKA 4I28A 2F1JA 5KTQA 4DQPA 8ICJA 4UB5A 7ICVA 2PI4A 3RJFA 4K4IA 2NRZA 4C8LA 2KFZA 4DEZA 3ZDDA 3PX4A 1ZYQA 4BWJA 5J0XA 2XO7A 2A1JB 4QZBA 2ISOA 2P6RA 2Y1JA 2AQ4A 1WCNA 1X9WA 3RJHA 1MSWD 4FBUA 1ZQOA 1NKBA 4C8OA 8ICVA 3GFKB 3JPRA 3IM1A 4BWMA 4F4YA 2W8KA 4E0DA 4F91B 3V6HA 3GV8B 2BKEA 1ZQPA 1D8YA 5J29A 4QW9A 3Q8KA 4JV0A 4XRHA 4KTQA 1SZPA 2BPFA 3M9MB 5KT4A 1BPXA 4ECXA 4F3OA 4Z6EA 2RDJA 1ZQEA 3UQ2A 1ZQLA 2BR0A 2UVRA 3RJIA 4I29A 4MFAA 1NK6A 4KLSA 7ICHA 9ICCA 1U9LA 4Z6FA 4ECTA 7ICNA 7ICGA 2HHSA 4O0IA 3TAQA 4B9MA 4P4PA 3UXOA 3PMNA 4YQWA 1ZQQA 2IA6A 1KFDA 3AU2A 1XO1A 3ZDBA 5IIIA 1XWLA 3MABA 5IIKA 2W9CB 2FMQA 4DS5A 3TANA 2W9AA 2ASDA 5DQHA 4DOAA 5KFIA 4B9LA 2KN7A 3MR5A 8ICKA 3OSPA 5DB6A 5CB1A 5J2JA 1COOA 3PW5A 4GC7A 3PNCA 4F5OA 1ZQAA 5KT7A 3E2EA 2FPMA 2JEJA 2JZBA 1U4BA 1ZQMA 1JN3A 4EYHB 4JV2A 2AQ0A 1NKCA 5HHIA 1C7YA 4ELUA 4I2JA 1LV5A 1ZQFA 4YMMA 4Q43A 1UA1A 2NRVA 4PGQA 2ZJAA 3RB0A 2C22A 2FMPA 3RR7A 3RAQA 4QZCA 1S9FA 4KN7A 1SKWA 1JMSA 3BQTA 5KG7A 1N56A 1HUZA 1XC9A 3RR8A 3RBEA 4ECQA 4DS4A 4F2RA 4JWNA 4PPXA 4EBEA 4KLUA 4F4WA 4R63A 1RZTA 9ICQA 1X2IA 3LDAA 1ZETA 3PX6A 2AGQA 1L3VA 4KLEA 9ICNA 1ZQSA 3KTQA 4B9NA 1WCLA 2ZJ8A 5J0QA 3PR4A 4DLGA 1SKRA 4I2HA 8ICMA 8ICSA 4XA5A 5J0TA 4GXIA 1U45A 2H5XA 4IRCA 4M9HA 5BOLA 3IHQB 4XUSA 8ICEA 4J9RA 2Y1IA 4RNOA 1ZQWA 9ICOA 2AGOA 1MC8A 4QWDA 5KFTA 1NJXA 4M2YA 4MFCA 7ICRA 2P66A 4UB4A 9ICJA 4F4ZA 4R66A 2R8IA 2OWOA 4ECSA 1XSPA 2R8KA 3PO4A 1X9SA 4QW8A 3ZD9A 5L9XA 5EOZA 1DGSA 1ZQCA 2PFNA 3EZ5A 3MGHA 2VA2A 4UAZA 4R64A 4M9JA 4YD2A 1NK0A 1CUKA 1L3SA 2JEFA 5DQGA 1NJWA 4JV1A 4TURA 8ICRA 2MAXA 4RPZA 3GILA 2J6UA 3M9NB 2C28A 3HT3A 4XQ8A 8ICYA 5KFRA 5DGBA 4QZEA 3ISDA 3RH4A 4QZFA 1S0NA 1T8EA 2PI5A 4NLNA 4DQQA 4M0AA 4LZGA 3G6YA 4ECYA 4M9LA 2A1JA 4KLGA 1XSNA 1IM4A 1L3UA 5IILA 4NLKA 1NKEA 2UVWA 3OJUA 1QSYA 5KG2A 2FLNA 3MBYA 2KFNA 8ICPA 2ZJ5A 3T5LA 4RUAA 1H38A 3EPGA 3H8WA 4YP3A 3TI0A 9ICXA 2XGPA 5HMLA 5KFDA 2BQRA 3UXNA 4YN4A 2FPKA 5DG9A 5DB7A 1Z3EB 1ZQXA 4PHAA 4MFFA 9ICMA 3BQ1A 1TKDA 3Q8SB 4GC6A 2JEGA 4B9TA 5KFEA 1TK8A 4YXMA 4O3PA 5J2CA 1TK0A 2XY5A 2J6TA 4Q44A 4C8NA 4YMOA 4DL4A 4EEYA 1ZQDA 4C8MA 1XSLA 5J2BA 7ICMA 2P6UA 3N97B 1KLNA 5C5JA 1K1QA 4KLMA 4UB3A 1ZJNA 3H40A 4I2GA 8ICBA 4FO6A 4O5EA 2BPCA 5D46A 4J9MA 2BCUA 4O3RA 4M47A 4RT2A 4QWEA 4F5NA 9ICTA 4O3NA 3OSNA 5J2HA 2BCVA 5CP2A 4DLEA 2I9GA 3HX0A 4PGYA 3Q8PB 2R8JA 3KHLA 3LWMA 3EWAA 4KLLA 9ICUA 4R8UA 2XGQA 3GDXA 7ICQA 3RH5A 9ICLA 4DSJA 1MQ3A 4KLFA 5DQIA 5KFNA 3PO5A 8ICQA 3JPOA 7ICIA 1BVSA 1TK5A 4F93B 1AROP 4M9GA 5HMMA 4QZHA 2C2DA 4RQ2A 5DB9A 3Q8MA 4UAWA 1QSSA 3BDPA 4K4GA 3PW4A 5KFWA 4YCXA 1TVAA 2AU0A 3UQ0A 4IR1A 4YR3A 3ISBA 3H8SA 4PHPA 4RQ6A 3ZDEA 4P2HA 2XCPA 3EPIA 3JPSA 3GIKA 3ZD8A 3RB4A 3MDAA 3C2LA 3C2MA 4DFMA 5HP4A 4IRKA 3PW0A 1B43A 1XU4A 4M6WB 1QSLA 3RJEA 7ICUA 4IR9A 7ICSA 2HHQA 2W9MA 1UT5A 1ZQYA 1BPEA 5KG0A 4RPXA 5CA7A 2FMSA 5DB8A 4TUQA 5IINA 2KTQA 1T7PA 4DL3A 2V4QA 3ETLA 4DO9A 2XY6A 2GWSA 2IMWP 9ICFA 2PFPA 4R8UB 4YVZA 2FPLA 3GIMA 2RDIA 3RB3A 4J9OA 1IXRA 1UA0A 2R8GA 4RQ0A 1HJPA 3MR2A 5TZVA 3RRGA 3ZDCA 1BPDA 5KFPA 1KDHA 4YMNA 4UQGA 4RZRA 2IHNA 2MUTB 5DBCA 4ECRA 4ED7A 5DG7A 3RBDA 4FBTA 4I2EA 4F8RA 1TV9A 2NRWA 4NXZA 5J0WA 3PR5B 2V9WA 5KT5A 8ICUA 3EYZA 8ICIA 3H8JA 1ZQUA 3HWTA 5KFKA 7ICTA 2BGWA 5EWFA 5J2FA 5DLGA 1ZQTA 2FLLA 1NJZA 2HHTA 1BPYA 4O5KA 3THVA 5KFYA 4I2FA 4KLQA 4ECUA 3V7KA 4DL2A 2M9NA 3T5KA 2HW3A 5CR0A 5IIOA 5J2AA 1KTQA 4ED3A 1S10A 1RYSA 3JPTA 4RPYA 4Q8FA 1RXWA 5KFMA 3TAPA 1U47A 4O3SA 4IQUA 5BPCA 2HHUA 1NOMA 2WTFA 4O5CA 3C1YA 4CCHA 3EW9A 4I2BA 5IIMA 4QWCA 1S77D 2DPIA 5JUMA 4YFKA 4PH5A 1CEZA 9ICPA 8ICGA 3KHGA 4ELTA 1S76D 2ZUBA 1ZQZA 4UB1A 3C5GA 3GV5B 4BGDA 5J0UA 5J2IA 4F5QA 4MEYA 5J0OA 3MDCA 4DSEA 2ATLA 1BPZA 2FLPA 4QZ9A 3PX0A 1ZQBA 4J9PA 4I2AA 4KLIA 5L1IA 8ICCA 4RUCA 4ECWA 2J6SA 4NM2A 4J9SA 5KFJA 2W9CA 4F4XA 1KEJA 4F92B 3TQ1A 4QWAA 3LK9A 8ICOA 1V9PA 2AJQA 9ICHA 4DSFA 2VA8A 3AU6A 9ICVA 7ICOA 1T3NA 1ZQHA 4DL7A 3PV8A 3BJYA 5KG1A 2W9BB 3MFHA 4DOBA 3HPOA 4KLOA 4IQTA 3PVXA 1NK5A 4RU9A 1A77A 1Z00A 4R65A 3TFRA 5KFUA 3HP6A 9ICRA 3NTUA 2UVVA 2BPGA 4J9NA 8ICHA 5HHHA 4YR0A 2B21A 4F2SA 4JWMA 3RJJA 1Z00B 5J2KA 3FDSA 1Y88A 2JEIA 3TFSA 1D9DA 1QTMA 4DQRA 3C1ZA 2UVUA 9ICSA 2W8LA 2ASJA 3ORYA 4NLGA 3UXPA 2LYHA 2JZBB 4RNNA 3SYZA 3SI8A 5F9LA 5CHGA 4ED8A 1NK7A 3HW8A 1BPBA 4I2DA 1ZQJA 3OHAA 1NK9A 5KFBA 4B9VA 8ICFA 1K1SA 2BHNA 3JPPA 1TFRA 4YG2A 1JXLA 1SL0A 4BDPA 2BDPA 5J0PA 3M8RA 2ZUCA 3QZ8A 7ICJA 4QZAA 3GIJA 4P4MA 4EYIB 4DFKA 4QZ8A 5KFVA 3RRHA 5KG5A 4Z6DA 3JPNA 4PGXA 4MEXA 4EBCA 3AUOA 2DPJA 1B22A 5D4BA 5KFGA 2ALZA 1EXNA 1TAQA 3V7JA 4UBCA 1A76A 1D8LA 1T4GA 4IQWA 3ISCA 4Z6CA 2BQ3A 8ICAA 4I2CA 5KFHA 1LB2B 4EZ6A 5KFLA 4RQ5A 4MF8A 2XY7A 1S0VA 3N4MB 7ICEA 3G6VA 2KZ3A 1U49A 4JUZA 9ICBA 2PFQA 3H7IA 3QEBZ 3OGUA 4GXJA 7ICFA 5KFSA 5KT3A 4ZH4A 2KZZA 5DBAA 4QZIA 2BCSA 3TARA 4DSKA 2IHMA 5DBBA 1KFSA 3GIIA 3T5JA 2C2EA 2DFLA 4J9LA 4IQVA 4GXKA 5KFAA 2AGPA 4TUSA 2V4RA 2XCAA 1HUOA 3RH6A 4NY8A 1ZQRA 1XS9D 4F5PA 4DL5A 5DKWA 9ICWA 5L1LA 5KFCA 3C5FA 8ICZA 3NGDA 3MR3A 5DDYA 4DQIA 4TQRA 3SZ2A 5IIJA 3C23A 5KFOA 1SL2A 3M8SA 5DDMA
chains in the Genus database with same CATH superfamily
4Y2QA 1JI7A 3RTVA 3KHRA 2E8NA 4K4HA 4DSIA 3VC8A 2ASLA 4PHEA 3H4BA 1ZD2P 2BCRA 3E0FA 3QE9Y 4NM1A 1F5SA 3KHHA 2HVIA 3KOOA 1ZQIA 4KLJA 2LM4A 5ALXA 1HIWA 4KX5A 3QUBA 1X6JA 5ALKA 4C0ZA 5AM2A 4B6JA 5J2DA 4QZDA 1XO0A 3FYHA 1Z19A 4ED0A 1PZNA 2I6XA 2YMLA 4RQ1A 1FEZA 7ICLA 1SIJA 3MFIA 4EENA 5KFZA 3C2KA 5B66U 1LKYB 9ICKA 1SL1A 1D9FA 3TADA 1U48A 4C7ZA 1V38A 3BQ0A 8ICNA 5KFFA 2EQYA 4NJ8A 2HHXA 4MF2A 5DGAA 4KLTA 1BNPA 3T79A 3K4GA 1BGXT 4ED2A 1KSPA 1ZQGA 1JX4A 4UAYA 4G3IA 4RQ8A 1SKSA 2MUTA 3WKAA 5AKEA 1UT8A 2PXIA 2KZMA 4O3MA 2E1FA 3WK9A 4Y2XA 1PK3A 2PMZC 3MR6A 3SD7A 2Y0SF 3ETRA 2DWQA 4FS1A 1Z1VA 4CGZA 1V97A 4YR2A 1N48A 3Q8RB 1L7NA 3B0XA 4CF3A 2EAMA 5ALVA 8ICJA 3F2BA 2QB0B 4IRKA 4QZBA 1X9WA 2G5IB 1NKBA 3GFKB 3LVWA 4BWMA 3KFUF 2W8KA 4E0DA 3V6HA 2BKEA 2Y0SC 5J29A 3Q8KA 2CN1A 2HI0A 2MA1A 4JV0A 3CNHA 1SZPA 4EX7A 2EDUA 4ECXA 4Z6EA 2RDJA 2BR0A 9ICCA 4Z6FA 4ECTA 3I28A 4B9MA 4P4PA 1ZD4A 4YQWA 1KFDA 1PUZA 3MABA 2FMQA 4DS5A 2KIWA 4B9LA 3OSPA 3AMZA 1COOA 3PW5A 1SXDA 2JEJA 1GO3F 2JZBA 1S5LU 1ZQMA 1IG6A 4JV2A 2AQ0A 1NKCA 2WB1C 4I2JA 1LV5A 4FFDA 4Q43A 3RAQA 4KN7A 3MC1A 3BQTA 1XC9A 4PPXA 4ECQA 2MSNA 4EBEA 3WU2U 2K89A 3PX6A 2YB4A 3KTQA 4DLGA 2E1EA 5J0TA 2H5XA 4IRCA 4M9HA 5BOLA 4XUSA 3KKAC 4MFCA 7ICRA 2R8IA 1XSPA 1RQNA 2VA2A 4UAZA 4YD2A 1L3SA 4JV1A 8ICRA 3GILA 3O0FA 1L7PA 4XQ8A 4QZEA 4NLNA 1KQQA 3G6YA 2WAQC 4NWIA 1T94A 4PZNA 4UW9A 3M7DA 3MBYA 2ZIWB 1UCVA 3T5LA 4RUAA 1H38A 3EPGA 1KBUA 3TI0A 5KFDA 3WKBA 3UXNA 5DG9A 3SEIA 3I1YA 4MFFA 1VDVA 1ZOLA 1N5WA 4GC6A 2JEGA 4O3PA 1TK0A 2KEYA 3CP8A 1QQ5A 3SAHA 1L8LA 1KLNA 4KLMA 1ZJNA 4RQNA 2F77X 4O5EA 3TADC 4J9MA 4O3RA 4JB3A 4O3NA 2YQEA 5J2HA 4GIBA 4DLEA 3AN1A 2I9GA 3Q8PB 9ICUA 3RH5A 4DSJA 8ICQA 4F93B 1AROP 5DB9A 5AKIA 1FIQA 5AIAA 5KFWA 4YCXA 3PW4A 3NUQA 1PK1B 3H8SA 4P2HA 3ZDEA 3GIKA 4DFMA 3PW0A 3RJEA 4OO1J 5JRTA 2HDOA 2FMSA 4DL3A 3R9KA 2PFPA 2VJ4A 2WHEA 2FPLA 2JGAA 2R8GA 4RQ0A 3SAGA 3ZDCA 1BPDA 5KFPA 1KDHA 4YMNA 4UQGA 2F44A 4ED7A 4I2EA 2NRWA 5J0WA 4J03A 3EYZA 5AHXA 2BGWA 5J8YC 1FFVA 5AKKA 4I2FA 2WB1F 4DL2A 1NZPA 1PVPA 5CR0A 5J2AA 2H3VA 4ED3A 1S10A 1RYSA 3CW2C 2A19A 3JPTA 1RXWA 2H3ZA 4O3SA 2EH9A 2WTFA 3C1YA 4NL9A 4CCHA 4C7YA 2OH2A 4YFKA 1CEZA 9ICPA 2HOQA 2WF7A 3TACB 2LKYA 1S76D 2ZUBA 3C5GA 2LM1A 3GV5B 5J2IA 5J0OA 4QZ9A 1ZQBA 1AQ6A 2W9CA 1KEJA 4F92B 2BDUA 3AU6A 7ICOA 1T3NA 5KG1A 2W9BB 2VJ5A 1Z1BA 3HPOA 4KLOA 1NK5A 4RU9A 2KVSA 4R65A 9ICRA 3NTUA 4YR0A 5AM0A 2G08A 4PL1A 1NI3A 2JEIA 3C1ZA 9ICSA 2W8LA 3IV6A 5A0LA 2JZBB 3SYZA 3SI8A 4ED8A 1NK7A 1ZQ1C 2K4EA 3HW8A 1ZQJA 3JPPA 5KNIA 1SL0A 3QU7A 4UAVA 2BDPA 3M8RA 7ICJA 5AI4A 3RRHA 2F76X 4Z6DA 3SAFA 4F72A 5D4BA 1TAQA 3V7JA 1D8LA 4Z6CA 8ICAA 3NRWA 5EE0A 4I2CA 1QH9A 7ICEA 4LJXA 3G6VA 1U49A 2OYYA 3QEBZ 5DBAA 2IHMA 4J9LA 1DRGA 3UMGA 2HBKA 2XCAA 1MA7A 3RH6A 1ZQRA 4DL5A 5DKWA 5L1LA 3A0BU 8ICZA 2QB1A 3J81j 4UB8U 1ZQOA 3M8SA 2HHWA 5ALWA 1L6NA 3OHBA 3D2NA 2K60A 2DBYA 2F1HA 5JU5A 7ICPA 3GQCA 2W54A 2O6KA 3RJGA 3V6JA 2RLTA 1ZJMA 4QWBA 5ALLA 8ICLA 4X5VA 4BXOB 4ED1A 2ZTCA 9ICGA 5EE3A 2BQUA 2QB0A 5EWGA 2ZTDA 1DK3A 3KD3A 3M6ZA 3MGIA 4FS2A 2Q0ZX 5ALGA 2JHDA 4RQ3A 4F4KA 3QU9A 1QQ7A 3V7LA 4UBBA 2OHFA 3FC4A 5ALZA 3QYPA 2OXOA 3LWLA 4HYKA 4Q8EA 4KLHA 3QU5A 1IIPA 4YD1A 3V72A 4DQSA 2B6GA 2OM6A 1A6SA 5KT6A 3GV7B 3LVVA 1S0MA 1TAMA 2F3NA 4C8KA 2VA3A 5D49A 2W7PA 1JIHA 4I2IA 5EWEA 4DFJA 4C80A 3Q8QB 3PW2A 4DSLA 4J9KA 4KLDA 1ZQVA 2KSOB 2BCQA 1KRPA 3JPQA 4DWIA 1MN8A 2L5YA 2Z7JA 1RYRA 1DK2A 2DKZA 2G5HB 1KW4A 3PW7A 3BZKA 4O3QA 4TUPA 2VANA 4O9MA 4M9NA 2K4HA 5KAIU 1NNLA 5CJ7A 4KMUA 4TQSA 3RJKA 5KTQA 2GH1A 4OJ6A 5AICA 2NRZA 4C8LA 1ZYQA 5J0XA 2Y1JA 3RJHA 1MSWD 2W7OA 4F91B 1ZQPA 4QW9A 3RF9A 1ZRMA 4XRHA 1BNOA 1N2XA 3M9MB 4QIWF 4F3OA 4OJOA 4KLSA 4MFAA 4OJPA 1U9LA 3L4PA 7ICNA 7ICGA 2HHSA 2DKXA 3TAQA 3PMNA 1ZQQA 2IA6A 5IIIA 4US9A 5IIKA 4BUGA 3TANA 2W9AA 2ASDA 3K1ZA 5KFIA 4GC7A 4UASA 5KT7A 3E2EA 2FE9A 4CF5A 1C7YA 4ELUA 1ZQFA 1UA1A 4PGQA 2JV3A 3QXGA 1LVHA 4JWNA 3RBEA 2KJ9A 5AK6A 5JTIA 4R63A 1RZTA 9ICQA 1X2IA 3LDAA 2DGZA 2ZJ8A 5J0QA 1SKRA 3IG8A 8ICMA 5ALYA 2Y1IA 4RNOA 1YZ6A 2JRZA 1UPHA 2K8CB 4QWDA 2AGOA 1NJXA 2OEHA 4IC9A 4Y2UA 3PZPA 2HCFA 2OWOA 2R8KA 1X9SA 5H2FU 3EZ5A 2PFNA 3MGHA 1CUKA 1NJWA 2J6UA 4NL9C 3AQEA 3IDWA 1S0NA 1T8EA 4DQQA 3F5AA 2A1JA 1L3UA 4NLKA 4KMOB 5ALRA 2UVWA 8ICPA 2KOBA 5AI9A 4YP3A 9ICXA 5HMLA 2FPKA 1ZQXA 1J97A 3Q8SB 4B9TA 4C8NA 1ZQDA 2JH1A 1XSLA 5J2BA 2P6UA 4JMUA 1K1QA 3NRZA 4GFJA 4USAA 5ALUA 1LKYA 2BPCA 2BCUA 4M47A 9ICTA 5AM1A 2BCVA 1O03A 4C4RA 4PGYA 2R8JA 2HBJA 3LWMA 3EWAA 2XGQA 2HMXA 9ICLA 1BVSA 2NO4A 4RQ2A 2KNJA 3Q8MA 2I5HA 1X66A 1ZXIA 3A0HU 3EPIA 2DUYA 2KE7A 3HRDD 5ALFA 3ZD8A 3MDAA 3RB4A 3C2MA 5HP4A 3B9JA 1B43A 1O08A 2HBLA 2EAPA 3IN5A 1ZQYA 4RPXA 5CA7A 2KTQA 5IINA 1T7PA 2JR5A 2V4QA 3ETLA 3OPXA 5EE1A 2K8BB 2A3VA 4R8UB 4YVZA 2QKQA 4P0PA 2QLTA 4J9OA 5EE9A 4U7CA 1UA0A 5TZVA 1WG8A 5ALHA 2ZIUA 3H0RB 3RBDA 5DG7A 4ECRA 4FBTA 2LI6A 5AKXA 1ZQUA 1WWUA 3UMBA 5KFKA 7ICTA 5EWFA 5J2FA 5DLGA 1Q3VA 1NJZA 2W3RA 4OJLA 1X42A 4Q8FA 2KHQA 1U47A 4IQUA 2KG5A 1NOMA 5JUMA 2FDRA 8ICGA 4ELTA 2DQNB 4UB1A 5ALDA 4BGDA 4DSEA 3MDCA 1BPZA 2Y9UA 4I2AA 4J9PA 4KLIA 8ICCA 3S6JA 5AKLA 3HKZF 4P0QB 8ICOA 3BS5B 5HR6A 2VA8A 3D2QA 3MFHA 1A77A 3HP6A 2DL0A 2BPGA 3NVYA 5HHHA 8ICHA 4F2SA 1VJ5A 4JWMA 1Z00B 1Y88A 3TFSA 1QTMA 2UVUA 2ASJA 2YY6A 3ORYA 3UXPA 1Q8KA 1DGJA 4I2DA 4FZNA 4G9BA 4YG2A 1RM6C 2YN4A 3QZ8A 3GIJA 4Y2RA 4DFKA 3NVVA 5KFVA 1WWVA 4KX3A 5KG5A 3JPNA 2DPJA 1B22A 2W04A 2ALZA 1FO4A 4UBCA 4IQWA 2KKVA 5KFHA 1LB2B 3N4MB 3WK6A 3OGUA 4GXJA 4P0QA 5KFSA 4ZH4A 5AI0A 4AYBC 2EAOA 1KFSA 3D6JA 3T5JA 4GXKA 2F8KA 1WUDA 5KL1B 5AK4A 2V4RA 2ZIUB 2RRDA 2WF5A 3CRXA 5KFCA 3NGDA 1K5OA 3MR3A 3SZ2A 5IIJA 5KFOA 2A1AA 2DF4B 5J0RA 2KK0A 2QARA 5AKHA 5KG6A 1SV0C 3PSTA 2F1IA 2WF8A 4M6WA 2JMGA 4PZOA 4RNMA 5AI6A 2ZTEA 4Q45A 1NJYA 2Q4TA 1S0OA 1Z4NA 4LZDA 4RQ4A 1ECWA 5AI5A 9ICEA 1URJA 2KKPA 2ZIXA 2KHVA 8ICTA 3DEEA 4GLXA 2G09A 9ICIA 2HHVA 5GTHU 2XVTA 3M9OB 4J9QA 4P0PB 3G6XA 2R18A 3SV4A 4US8A 4ZOHC 3QNMA 1Q46A 5GTIU 3H4DA 2ZXIA 3L5KA 4LVSA 1JUDA 4RT3A 2IBKA 5F9NA 3V6KA 3B0YA 3GZFA 1MQ2A 3Q8LA 2ISPA 3C21A 2LBOA 3BQ2A 1RXVA 1FFUA 4CDGA 4UB2A 4DF8A 5L1KA 3AEVA 3RAXA 1TAUA 3ALRA 1ZQKA 1ZQNA 1PVQA 1S97A 2R8HA 3QZ7A 4YXJA 2LYAA 4ED6A 4ELVA 3K75D 3DV9A 5DG8A 5CWRA 3RFAA 2W03A 1B4FA 2HVHA 3AL0B 3WKDA 3QEAZ 2Y9TA 3BQ7A 4BJQA 4NLZA 2BZFA 2PKEA 1UHUA 5J0YA 4U6PA 3PMLA 1L3TA 2C2RA 2ODGA 4EEKA 1SXEA 4EZ9A 4I28A 4EBDA 2F1JA 4DQPA 7ICVA 3U26A 2PI4A 2KFZA 4DEZA 2P6RA 2A1JB 2ISOA 2AQ4A 4FBUA 2KJ8A 3QUTA 5J8YA 3JPRA 4F4YA 5CRXA 4UATA 3NVZA 3F2CA 2BPFA 5KT4A 1BPXA 4Y2PA 1V85A 3UQ2A 1ZQLA 3RJIA 4I29A 7ICHA 3F5EA 2EANA 5E79U 5FP0A 4ACOA 3AU2A 5AI8A 3ZDBA 2NYVA 2D8CA 5DQHA 4DOAA 3WKCA 2KN7A 3MR5A 5DB6A 2RP5A 5ALJA 1J2NA 2ZXHA 3PNCA 3QU2A 1SB3C 2FPMA 3C29A 1U4BA 1JN3A 4EYHB 4YMMA 3RB0A 1YZ7A 2ZJAA 2FMPA 5ALEA 2HOIA 1SKWA 2WFAA 1HUZA 3HILA 4DS4A 1HEKA 1L8OA 2ZIXB 4F4WA 2ZIWA 1ZETA 2AGQA 9ICNA 8ICFA 1ZQSA 4NV0A 2E8PA 4B9NA 3BS7A 1WCLA 3PR4A 8ICSA 4GXIA 3ONNA 1COKA 4J9RA 3SR6A 1NZBA 4M2YA 2P66A 4UB4A 2IOHA 4F4ZA 4R66A 2G07A 3ZD9A 5L9XA 1ZQCA 3AQFA 1SV4A 1NK0A 2GO7A 1OXJA 5DQGA 1JRPA 4TURA 3KZXA 4HAIA 2KICA 4M0AA 4KLGA 1IM4A 5IILA 1CRXA 2ZIVB 3H8MA 1NKEA 2RQ5A 3OJUA 5KG2A 2KFNA 2ZJ5A 2VKQA 3H8WA 2CRXA 2XGPA 5AIBA 3F53A 2BQRA 2H3IA 4YN4A 5DB7A 1Z3EB 4CRXA 2XI9A 9ICMA 1TKDA 5KFEA 1TK8A 4YXMA 5J2CA 2XY5A 4Q44A 4DL4A 7ICMA 4C8MA 5C5JA 4UB3A 3H40A 8ICBA 4FO6A 2CXYA 2LYBA 1OUQA 3OSNA 3HX0A 3NASA 4KLLA 3GDXA 4UARA 1SZHA 4Y2SA 3JPOA 3D2SA 4M9GA 2C2DA 1KL9A 4UAWA 3BDPA 3QUCA 4CF4A 2AU0A 1TVAA 4YR3A 1ED1A 4PHPA 4RQ6A 1SV0A 2B0CA 1YT3A 7ICUA 7ICSA 2NV3A 2E5SA 1BPEA 5DB8A 4TUQA 2LMRA 4Y2YA 5L1MA 2GWSA 2H3FA 9ICFA 2KVCA 3RB3A 2KD1A 3C28A 1HJPA 3MR2A 3RRGA 4RZRA 1ZD5A 1RDFA 2MUTB 4FE3A 4NXZA 3PR5B 8ICUA 3H8JA 3HWTA 1P7DA 1ZQTA 2HHTA 1B0XA 4KLQA 3THVA 4ECUA 3T5KA 2P35A 2HW3A 5IIOA 2K8AA 2HHUA 5BPCA 4O5CA 3EW9A 5IIMA 3F2DA 2DPIA 4PH5A 5ALIA 5G5GA 3KHGA 4F5QA 2ZIVA 5J0UA 3PX0A 4RUCA 2J6SA 4J9SA 4F4XA 3TQ1A 3LK9A 1V9PA 2AJQA 3N7SC 2XIDA 4DL7A 3BJYA 3GU3A 5ALTA 3N28A 4Y2TA 4IQTA 1D8BA 2VIXA 4FZLA 2UVVA 2B21A 3RJJA 3N7RC 5AM3A 3BZCA 2ES6A 1A0PA 1D9DA 4DQRA 1PVRA 2FI1A 4NLGA 5F9LA 5CHGA 2H3QA 3OHAA 4B9VA 4AYBF 5AKZA 1JXLA 4BDPA 4QZAA 2QARB 4P4MA 4EYIB 3QU4A 2KSOA 4PGXA 4EBCA 3AUOA 5KFGA 3M1YA 1EXNA 3SQIA 4OJ5A 1T4GA 4PJ0U 2BQ3A 2AHOB 2ZG6A 4EZ6A 4RQ5A 2XY7A 2KZ3A 4JUZA 1J2MA 9ICBA 2PFQA 3H7IA 1KN5A 2K4IA 2KZZA 3TKAA 2BCSA 2EZYA 3GIIA 2C2EA 2DFLA 3FAHA 4AP9A 1XNSA 5ALOA 5KFAA 2N1RA 2MU2A 5F3XB 1XS9D 4F5PA 9ICWA 3UM9A 5TISU 3C5FA 5K4LA 1RG6A 4DQIA 3C23A 1T3QA 5DDMA 4RQMA 2ZUDA 3ICXA 4ECZA 4BXOA 4IL6U 2NRXA 3ZI4A 4ECVA 5J2EA 4O3OA 2YX8A 3T3FA 5AK5A 1N61A 2EZXA 4I27A 2PFOA 3KBBA 5HNKA 5BOMA 5J2GA 1RPLA 2HBMA 3IRUA 5ALMA 2I1QA 3SV3A 3T5HA 1KFTA 1DOQA 3KKAA 1X6IA 1L5UA 9ICAA 2YMQA 3PSFA 5J0SA 4JK1A 1JXEA 2W55A 2XC9A 2KJ5A 2LPEA 3K1RB 3WKEA 3BS5A 5KT2A 5KG3A 3OJSA 2GLEA 4KITB 3KZIU 5AKYA 4P4OA 1PK1A 1NK4A 4IRDA 5KG4A 4QZGA 1QLNA 3RB6A 4DF4A 3NS1A 3L3FX 1NK8A 4RQ7A 3PY8A 4B9SA 1RQLA 3QUQA 4DOCA 1ZRNA 2PMZF 4KN4A 2GOLA 5DLFA 1M6YA 2NO5A 2M0NA 4F50A 7ICKA 4PHDA 5C0YA 2NRTA 8ICWA 4DFPA 3FM9A 8ICXA 1C20A 2YMPA 5ALPA 1F44A 5L1JA 3PSPA 5T14A 3UPQA 2HOFA 1X9MA 4F5RA 4QJFB 5KAFU 2YTUA 1UQVA 4EX6A 5KFXA 3ZDAA 3HJEA 4B9UA 2WF6A 4DL6A 2W9BA 4M04A 5KFQA 1CI4A 1ZD3A 4UB5A 4K4IA 3RJFA 2XICA 3ZDDA 3PX4A 4BWJA 2XO7A 4Y2JA 1WCNA 3I76A 4C8OA 8ICVA 5AKJA 3IM1A 3GV8B 1D8YA 2JXJA 4KTQA 1ZQEA 3LYSA 2UVRA 1NK6A 1N60A 4O0IA 3H0MB 3UXOA 5CEHA 2KIVA 1JALA 1X9XA 1XO1A 4C4TA 1XWLA 2W9CB 2F2AB 4DFDA 4A8EA 8ICKA 1SWWA 5CB1A 5J2JA 4F5OA 1ZQAA 3M6KA 1IV8A 3VCBA 2W11A 2IOFK 5HHIA 2WAQF 2E8OA 2EZZA 4OCZA 2NRVA 3RR7A 2C22A 1S8OA 4QZCA 2FJ6A 1S9FA 1JMSA 1N56A 5KG7A 3RR8A 4F2RA 1N62A 4OD0A 4KLUA 1OW5A 1L3VA 2E8MA 4KLEA 1L7MA 5AKGA 4I2HA 5AK3A 4XA5A 1U45A 2YB1A 4ICAA 3IHQB 4DCCA 8ICEA 1ZQWA 3IP4B 9ICOA 1MC8A 5KFTA 3MGVA 3EUB2 9ICJA 1DXSA 2AXTU 4ECSA 3PO4A 4QW8A 5EOZA 1DGSA 4R64A 4M9JA 2JEFA 2MAXA 4RPZA 1WYGA 3M9NB 2C28A 3HT3A 3OTQA 8ICYA 5KFRA 5DGBA 4UB6U 3ISDA 3RH4A 4QZFA 2OCEA 3WK8A 2PI5A 4LZGA 4ECYA 4M9LA 4CNQA 3PSIA 1XSNA 2W43A 2MRLA 1QSYA 4NLCA 2FLNA 1L7OA 5HR7A 1VLBA 4PHAA 3ED5A 1N63A 3BQ1A 3NVWA 3CYMA 2J6TA 4YMOA 4EEYA 3N97B 3WK7A 2JH7A 4I2GA 5D46A 4RT2A 4QWEA 4F5NA 5CP2A 5ALNA 4QIWC 4UAUA 3KHLA 4R8UA 7ICQA 2YMMA 5ALQA 1MQ3A 4KLFA 5DQIA 5KFNA 3PO5A 3QX7A 4C4SA 7ICIA 1TK5A 4PL2A 3HKZC 5HMMA 4QZHA 3WK5A 1QSSA 4K4GA 3UQ0A 1JROA 4IR1A 3ISBA 2XCPA 2F8LA 3JPSA 3C2LA 4NLBA 1XU4A 4M6WB 1QSLA 4MHVA 4IR9A 2D6FC 2HHQA 2W9MA 1UT5A 2KV2A 5KG0A 3SMVA 2KP7A 4DO9A 2XY6A 2RHFA 2IMWP 3GIMA 2RDIA 1IXRA 1QCKA 4BX9C 2IHNA 5DBCA 2WF9A 4F8RA 1TV9A 2V9WA 5KT5A 8ICIA 2K4PA 2FLLA 1BPYA 4O5KA 5KFYA 1KKXA 3V7KA 2HSZA 2M9NA 3N7PD 1KTQA 4RPYA 3SENA 5KFMA 3TAPA 4I2BA 4QWCA 1S77D 5ALSA 4Y2VA 1N5XA 1ZQZA 4MEYA 2ATLA 2FLPA 5L1IA 4ECWA 4NM2A 5KFJA 9ICHA 4QWAA 9ICVA 4DSFA 3IG5A 1ZQHA 3PV8A 2W3SA 5KL8B 4DOBA 2LHTA 3PVXA 1Z00A 3TFRA 5KFUA 4J9NA 5G5HA 5J2KA 5B5EU 3FDSA 4QNLA 3H0LB 4FZMA 3E58A 2LYHA 4EELA 4RNNA 4CE6A 1X40A 1BPBA 4WJ3B 1NK9A 3AM9A 5KFBA 2ESEA 2D3DA 1F0MA 1K1SA 1RYUA 1Z4OA 1TFRA 2BHNA 2KMDA 2E3TA 4F71A 5J0PA 2ZUCA 1SGGA 1Q3UA 4QZ8A 4MEXA 1A76A 2IOFA 2CPRA 3WK4A 3ISCA 1QQ6A 5KFLA 1S0VA 4MF8A 7ICFA 5KT3A 3UMCA 4QZIA 4DSKA 3TARA 5DBBA 5AM5A 3DDHA 4IQVA 2AGPA 2G0AA 4TUSA 1HUOA 4NY8A 4IS7A 5AM4A 1SWVA 5DDYA 4TQRA 2G06A 2AH5A 1SL2A 1TE2A
chains in the Genus database with same CATH topology
2HHWA 2ZUDA 5J0RA 3OHBA 5KG6A 3RTVA 4ECZA 2F1HA 4BXOA 2F1IA 2NRXA 7ICPA 4M6WA 3KHRA 4ECVA 5J2EA 3GQCA 4RNMA 4O3OA 4K4HA 3RJGA 4DSIA 2ZTEA 4Q45A 3T3FA 2ASLA 3V6JA 1NJYA 4PHEA 1ZJMA 4QWBA 3H4BA 8ICLA 4X5VA 2BCRA 4BXOB 4ED1A 4I27A 3QE9Y 2PFOA 1S0OA 2ZTCA 4LZDA 4RQ4A 5HNKA 9ICGA 5BOMA 4NM1A 2BQUA 3KHHA 5J2GA 2HVIA 1ZQIA 4KLJA 5EWGA 9ICEA 1RPLA 2ZTDA 2I1QA 8ICTA 4GLXA 3SV3A 3T5HA 3MGIA 4FS2A 9ICIA 2Q0ZX 2HHVA 1KFTA 5J2DA 4QZDA 1DOQA 3M9OB 4J9QA 3G6XA 1L5UA 9ICAA 4RQ3A 3FYHA 4F4KA 3SV4A 5J0SA 4ED0A 4JK1A 1PZNA 1JXEA 3V7LA 4UBBA 4RQ1A 2XC9A 7ICLA 3H4DA 3MFIA 5KFZA 3LWLA 3C2KA 5KT2A 4HYKA 4LVSA 4KLHA 4Q8EA 5KG3A 3OJSA 4YD1A 4RT3A 4KITB 3V72A 5F9NA 4DQSA 1SL1A 2IBKA 9ICKA 4P4OA 1D9FA 1NK4A 4IRDA 3V6KA 5KG4A 3B0YA 4QZGA 5KT6A 3RB6A 1U48A 3GV7B 1QLNA 4DF4A 1NK8A 1S0MA 4RQ7A 3Q8LA 1MQ2A 2ISPA 3BQ0A 3PY8A 3C21A 4B9SA 4C8KA 8ICNA 5KFFA 2VA3A 4DOCA 2HHXA 3BQ2A 4MF2A 4KN4A 1RXVA 5D49A 5DLFA 4UB2A 1JIHA 4I2IA 4DF8A 5DGAA 5EWEA 5L1KA 4KLTA 4F50A 4DFJA 3RAXA 1TAUA 3Q8QB 3K4GA 1BGXT 3PW2A 4ED2A 1ZQNA 1ZQKA 1KSPA 4DSLA 7ICKA 4J9KA 4PHDA 1ZQGA 4KLDA 1ZQVA 2NRTA 1JX4A 8ICWA 2BCQA 1KRPA 1S97A 3JPQA 4DFPA 4UAYA 4DWIA 2R8HA 3QZ7A 4YXJA 4G3IA 8ICXA 4RQ8A 4ED6A 1SKSA 4ELVA 1RYRA 3K75D 2MUTA 1UT8A 2PXIA 5L1JA 5DG8A 2KZMA 5CWRA 3UPQA 3PW7A 1X9MA 2HVHA 3MR6A 4F5RA 3QEAZ 4FS1A 4NLZA 4O3QA 5J0YA 5KFXA 3ZDAA 4TUPA 3PMLA 1L3TA 2VANA 4B9UA 2C2RA 4O9MA 4DL6A 4YR2A 1N48A 4M9NA 3Q8RB 2W9BA 5CJ7A 4M04A 3B0XA 5KFQA 4EZ9A 4KMUA 4TQSA 4EBDA 3RJKA 4I28A 2F1JA 5KTQA 4DQPA 8ICJA 4UB5A 7ICVA 2PI4A 3RJFA 4K4IA 2NRZA 4C8LA 2KFZA 4DEZA 3ZDDA 3PX4A 1ZYQA 4BWJA 5J0XA 2XO7A 2A1JB 4QZBA 2ISOA 2P6RA 2Y1JA 2AQ4A 1WCNA 1X9WA 3RJHA 1MSWD 4FBUA 1ZQOA 1NKBA 4C8OA 8ICVA 3GFKB 3JPRA 3IM1A 4BWMA 4F4YA 2W8KA 4E0DA 4F91B 3V6HA 3GV8B 2BKEA 1ZQPA 1D8YA 5J29A 4QW9A 3Q8KA 4JV0A 4XRHA 4KTQA 1SZPA 2BPFA 3M9MB 5KT4A 1BPXA 4ECXA 4F3OA 4Z6EA 2RDJA 1ZQEA 3UQ2A 1ZQLA 2BR0A 2UVRA 3RJIA 4I29A 4MFAA 1NK6A 4KLSA 7ICHA 9ICCA 1U9LA 4Z6FA 4ECTA 7ICNA 7ICGA 2HHSA 4O0IA 3TAQA 4B9MA 4P4PA 3UXOA 3PMNA 4YQWA 1ZQQA 2IA6A 1KFDA 3AU2A 1XO1A 3ZDBA 5IIIA 1XWLA 3MABA 5IIKA 2W9CB 2FMQA 4DS5A 3TANA 2W9AA 2ASDA 5DQHA 4DOAA 5KFIA 4B9LA 2KN7A 3MR5A 8ICKA 3OSPA 5DB6A 5CB1A 5J2JA 1COOA 3PW5A 4GC7A 3PNCA 4F5OA 1ZQAA 5KT7A 3E2EA 2FPMA 2JEJA 2JZBA 1U4BA 1ZQMA 1JN3A 4EYHB 4JV2A 2AQ0A 1NKCA 5HHIA 1C7YA 4ELUA 4I2JA 1LV5A 1ZQFA 4YMMA 4Q43A 1UA1A 2NRVA 4PGQA 2ZJAA 3RB0A 2C22A 2FMPA 3RR7A 3RAQA 4QZCA 1S9FA 4KN7A 1SKWA 1JMSA 3BQTA 5KG7A 1N56A 1HUZA 1XC9A 3RR8A 3RBEA 4ECQA 4DS4A 4F2RA 4JWNA 4PPXA 4EBEA 4KLUA 4F4WA 4R63A 1RZTA 9ICQA 1X2IA 3LDAA 1ZETA 3PX6A 2AGQA 1L3VA 4KLEA 9ICNA 1ZQSA 3KTQA 4B9NA 1WCLA 2ZJ8A 5J0QA 3PR4A 4DLGA 1SKRA 4I2HA 8ICMA 8ICSA 4XA5A 5J0TA 4GXIA 1U45A 2H5XA 4IRCA 4M9HA 5BOLA 3IHQB 4XUSA 8ICEA 4J9RA 2Y1IA 4RNOA 1ZQWA 9ICOA 2AGOA 1MC8A 4QWDA 5KFTA 1NJXA 4M2YA 4MFCA 7ICRA 2P66A 4UB4A 9ICJA 4F4ZA 4R66A 2R8IA 2OWOA 4ECSA 1XSPA 2R8KA 3PO4A 1X9SA 4QW8A 3ZD9A 5L9XA 5EOZA 1DGSA 1ZQCA 2PFNA 3EZ5A 3MGHA 2VA2A 4UAZA 4R64A 4M9JA 4YD2A 1NK0A 1CUKA 1L3SA 2JEFA 5DQGA 1NJWA 4JV1A 4TURA 8ICRA 2MAXA 4RPZA 3GILA 2J6UA 3M9NB 2C28A 3HT3A 4XQ8A 8ICYA 5KFRA 5DGBA 4QZEA 3ISDA 3RH4A 4QZFA 1S0NA 1T8EA 2PI5A 4NLNA 4DQQA 4M0AA 4LZGA 3G6YA 4ECYA 4M9LA 2A1JA 4KLGA 1XSNA 1IM4A 1L3UA 5IILA 4NLKA 1NKEA 2UVWA 3OJUA 1QSYA 5KG2A 2FLNA 3MBYA 2KFNA 8ICPA 2ZJ5A 3T5LA 4RUAA 1H38A 3EPGA 3H8WA 4YP3A 3TI0A 9ICXA 2XGPA 5HMLA 5KFDA 2BQRA 3UXNA 4YN4A 2FPKA 5DG9A 5DB7A 1Z3EB 1ZQXA 4PHAA 4MFFA 9ICMA 3BQ1A 1TKDA 3Q8SB 4GC6A 2JEGA 4B9TA 5KFEA 1TK8A 4YXMA 4O3PA 5J2CA 1TK0A 2XY5A 2J6TA 4Q44A 4C8NA 4YMOA 4DL4A 4EEYA 1ZQDA 4C8MA 1XSLA 5J2BA 7ICMA 2P6UA 3N97B 1KLNA 5C5JA 1K1QA 4KLMA 4UB3A 1ZJNA 3H40A 4I2GA 8ICBA 4FO6A 4O5EA 2BPCA 5D46A 4J9MA 2BCUA 4O3RA 4M47A 4RT2A 4QWEA 4F5NA 9ICTA 4O3NA 3OSNA 5J2HA 2BCVA 5CP2A 4DLEA 2I9GA 3HX0A 4PGYA 3Q8PB 2R8JA 3KHLA 3LWMA 3EWAA 4KLLA 9ICUA 4R8UA 2XGQA 3GDXA 7ICQA 3RH5A 9ICLA 4DSJA 1MQ3A 4KLFA 5DQIA 5KFNA 3PO5A 8ICQA 3JPOA 7ICIA 1BVSA 1TK5A 4F93B 1AROP 4M9GA 5HMMA 4QZHA 2C2DA 4RQ2A 5DB9A 3Q8MA 4UAWA 1QSSA 3BDPA 4K4GA 3PW4A 5KFWA 4YCXA 1TVAA 2AU0A 3UQ0A 4IR1A 4YR3A 3ISBA 3H8SA 4PHPA 4RQ6A 3ZDEA 4P2HA 2XCPA 3EPIA 3JPSA 3GIKA 3ZD8A 3RB4A 3MDAA 3C2LA 3C2MA 4DFMA 5HP4A 4IRKA 3PW0A 1B43A 1XU4A 4M6WB 1QSLA 3RJEA 7ICUA 4IR9A 7ICSA 2HHQA 2W9MA 1UT5A 1ZQYA 1BPEA 5KG0A 4RPXA 5CA7A 2FMSA 5DB8A 4TUQA 5IINA 2KTQA 1T7PA 4DL3A 2V4QA 3ETLA 4DO9A 2XY6A 2GWSA 2IMWP 9ICFA 2PFPA 4R8UB 4YVZA 2FPLA 3GIMA 2RDIA 3RB3A 4J9OA 1IXRA 1UA0A 2R8GA 4RQ0A 1HJPA 3MR2A 5TZVA 3RRGA 3ZDCA 1BPDA 5KFPA 1KDHA 4YMNA 4UQGA 4RZRA 2IHNA 2MUTB 5DBCA 4ECRA 4ED7A 5DG7A 3RBDA 4FBTA 4I2EA 4F8RA 1TV9A 2NRWA 4NXZA 5J0WA 3PR5B 2V9WA 5KT5A 8ICUA 3EYZA 8ICIA 3H8JA 1ZQUA 3HWTA 5KFKA 7ICTA 2BGWA 5EWFA 5J2FA 5DLGA 1ZQTA 2FLLA 1NJZA 2HHTA 1BPYA 4O5KA 3THVA 5KFYA 4I2FA 4KLQA 4ECUA 3V7KA 4DL2A 2M9NA 3T5KA 2HW3A 5CR0A 5IIOA 5J2AA 1KTQA 4ED3A 1S10A 1RYSA 3JPTA 4RPYA 4Q8FA 1RXWA 5KFMA 3TAPA 1U47A 4O3SA 4IQUA 5BPCA 2HHUA 1NOMA 2WTFA 4O5CA 3C1YA 4CCHA 3EW9A 4I2BA 5IIMA 4QWCA 1S77D 2DPIA 5JUMA 4YFKA 4PH5A 1CEZA 9ICPA 8ICGA 3KHGA 4ELTA 1S76D 2ZUBA 1ZQZA 4UB1A 3C5GA 3GV5B 4BGDA 5J0UA 5J2IA 4F5QA 4MEYA 5J0OA 3MDCA 4DSEA 2ATLA 1BPZA 2FLPA 4QZ9A 3PX0A 1ZQBA 4J9PA 4I2AA 4KLIA 5L1IA 8ICCA 4RUCA 4ECWA 2J6SA 4NM2A 4J9SA 5KFJA 2W9CA 4F4XA 1KEJA 4F92B 3TQ1A 4QWAA 3LK9A 8ICOA 1V9PA 2AJQA 9ICHA 4DSFA 2VA8A 3AU6A 9ICVA 7ICOA 1T3NA 1ZQHA 4DL7A 3PV8A 3BJYA 5KG1A 2W9BB 3MFHA 4DOBA 3HPOA 4KLOA 4IQTA 3PVXA 1NK5A 4RU9A 1A77A 1Z00A 4R65A 3TFRA 5KFUA 3HP6A 9ICRA 3NTUA 2UVVA 2BPGA 4J9NA 8ICHA 5HHHA 4YR0A 2B21A 4F2SA 4JWMA 3RJJA 1Z00B 5J2KA 3FDSA 1Y88A 2JEIA 3TFSA 1D9DA 1QTMA 4DQRA 3C1ZA 2UVUA 9ICSA 2W8LA 2ASJA 3ORYA 4NLGA 3UXPA 2LYHA 2JZBB 4RNNA 3SYZA 3SI8A 5F9LA 5CHGA 4ED8A 1NK7A 3HW8A 1BPBA 4I2DA 1ZQJA 3OHAA 1NK9A 5KFBA 4B9VA 8ICFA 1K1SA 2BHNA 3JPPA 1TFRA 4YG2A 1JXLA 1SL0A 4BDPA 2BDPA 5J0PA 3M8RA 2ZUCA 3QZ8A 7ICJA 4QZAA 3GIJA 4P4MA 4EYIB 4DFKA 4QZ8A 5KFVA 3RRHA 5KG5A 4Z6DA 3JPNA 4PGXA 4MEXA 4EBCA 3AUOA 2DPJA 1B22A 5D4BA 5KFGA 2ALZA 1EXNA 1TAQA 3V7JA 4UBCA 1A76A 1D8LA 1T4GA 4IQWA 3ISCA 4Z6CA 2BQ3A 8ICAA 4I2CA 5KFHA 1LB2B 4EZ6A 5KFLA 4RQ5A 4MF8A 2XY7A 1S0VA 3N4MB 7ICEA 3G6VA 2KZ3A 1U49A 4JUZA 9ICBA 2PFQA 3H7IA 3QEBZ 3OGUA 4GXJA 7ICFA 5KFSA 5KT3A 4ZH4A 2KZZA 5DBAA 4QZIA 2BCSA 3TARA 4DSKA 2IHMA 5DBBA 1KFSA 3GIIA 3T5JA 2C2EA 2DFLA 4J9LA 4IQVA 4GXKA 5KFAA 2AGPA 4TUSA 2V4RA 2XCAA 1HUOA 3RH6A 4NY8A 1ZQRA 1XS9D 4F5PA 4DL5A 5DKWA 9ICWA 5L1LA 5KFCA 3C5FA 8ICZA 3NGDA 3MR3A 5DDYA 4DQIA 4TQRA 3SZ2A 5IIJA 3C23A 5KFOA 1SL2A 3M8SA 5DDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHW A;  2ZUD A;  5J0R A;  3OHB A;  5KG6 A;  3RTV A;  4ECZ A;  2F1H A;  4BXO A;  2F1I A;  2NRX A;  7ICP A;  4M6W A;  3KHR A;  4ECV A;  5J2E A;  3GQC A;  4RNM A;  4O3O A;  4K4H A;  3RJG A;  4DSI A;  2ZTE A;  4Q45 A;  3T3F A;  2ASL A;  3V6J A;  1NJY A;  4PHE A;  1ZJM A;  4QWB A;  3H4B A;  8ICL A;  4X5V A;  2BCR A;  4BXO B;  4ED1 A;  4I27 A;  3QE9 Y;  2PFO A;  1S0O A;  2ZTC A;  4LZD A;  4RQ4 A;  5HNK A;  9ICG A;  5BOM A;  4NM1 A;  2BQU A;  3KHH A;  5J2G A;  2HVI A;  1ZQI A;  4KLJ A;  5EWG A;  9ICE A;  1RPL A;  2ZTD A;  2I1Q A;  8ICT A;  4GLX A;  3SV3 A;  3T5H A;  3MGI A;  4FS2 A;  9ICI A;  2Q0Z X;  2HHV A;  1KFT A;  5J2D A;  4QZD A;  1DOQ A;  3M9O B;  4J9Q A;  3G6X A;  1L5U A;  9ICA A;  4RQ3 A;  3FYH A;  4F4K A;  3SV4 A;  5J0S A;  4ED0 A;  4JK1 A;  1PZN A;  1JXE A;  3V7L A;  4UBB A;  4RQ1 A;  2XC9 A;  7ICL A;  3H4D A;  3MFI A;  5KFZ A;  3LWL A;  3C2K A;  5KT2 A;  4HYK A;  4LVS A;  4KLH A;  4Q8E A;  5KG3 A;  3OJS A;  4YD1 A;  4RT3 A;  4KIT B;  3V72 A;  5F9N A;  4DQS A;  1SL1 A;  2IBK A;  9ICK A;  4P4O A;  1D9F A;  1NK4 A;  4IRD A;  3V6K A;  5KG4 A;  3B0Y A;  4QZG A;  5KT6 A;  3RB6 A;  1U48 A;  3GV7 B;  1QLN A;  4DF4 A;  1NK8 A;  1S0M A;  4RQ7 A;  3Q8L A;  1MQ2 A;  2ISP A;  3BQ0 A;  3PY8 A;  3C21 A;  4B9S A;  4C8K A;  8ICN A;  5KFF A;  2VA3 A;  4DOC A;  2HHX A;  3BQ2 A;  4MF2 A;  4KN4 A;  1RXV A;  5D49 A;  5DLF A;  4UB2 A;  1JIH A;  4I2I A;  4DF8 A;  5DGA A;  5EWE A;  5L1K A;  4KLT A;  4F50 A;  4DFJ A;  3RAX A;  1TAU A;  3Q8Q B;  3K4G A;  1BGX T;  3PW2 A;  4ED2 A;  1ZQN A;  1ZQK A;  1KSP A;  4DSL A;  7ICK A;  4J9K A;  4PHD A;  1ZQG A;  4KLD A;  1ZQV A;  2NRT A;  1JX4 A;  8ICW A;  2BCQ A;  1KRP A;  1S97 A;  3JPQ A;  4DFP A;  4UAY A;  4DWI A;  2R8H A;  3QZ7 A;  4YXJ A;  4G3I A;  8ICX A;  4RQ8 A;  4ED6 A;  1SKS A;  4ELV A;  1RYR A;  3K75 D;  2MUT A;  1UT8 A;  2PXI A;  5L1J A;  5DG8 A;  2KZM A;  5CWR A;  3UPQ A;  3PW7 A;  1X9M A;  2HVH A;  3MR6 A;  4F5R A;  3QEA Z;  4FS1 A;  4NLZ A;  4O3Q A;  5J0Y A;  5KFX A;  3ZDA A;  4TUP A;  3PML A;  1L3T A;  2VAN A;  4B9U A;  2C2R A;  4O9M A;  4DL6 A;  4YR2 A;  1N48 A;  4M9N A;  3Q8R B;  2W9B A;  5CJ7 A;  4M04 A;  3B0X A;  5KFQ A;  4EZ9 A;  4KMU A;  4TQS A;  4EBD A;  3RJK A;  4I28 A;  2F1J A;  5KTQ A;  4DQP A;  8ICJ A;  4UB5 A;  7ICV A;  2PI4 A;  3RJF A;  4K4I A;  2NRZ A;  4C8L A;  2KFZ A;  4DEZ A;  3ZDD A;  3PX4 A;  1ZYQ A;  4BWJ A;  5J0X A;  2XO7 A;  2A1J B;  4QZB A;  2ISO A;  2P6R A;  2Y1J A;  2AQ4 A;  1WCN A;  1X9W A;  3RJH A;  1MSW D;  4FBU A;  1ZQO A;  1NKB A;  4C8O A;  8ICV A;  3GFK B;  3JPR A;  3IM1 A;  4BWM A;  4F4Y A;  2W8K A;  4E0D A;  4F91 B;  3V6H A;  3GV8 B;  2BKE A;  1ZQP A;  1D8Y A;  5J29 A;  4QW9 A;  3Q8K A;  4JV0 A;  4XRH A;  4KTQ A;  1SZP A;  2BPF A;  3M9M B;  5KT4 A;  1BPX A;  4ECX A;  4F3O A;  4Z6E A;  2RDJ A;  1ZQE A;  3UQ2 A;  1ZQL A;  2BR0 A;  2UVR A;  3RJI A;  4I29 A;  4MFA A;  1NK6 A;  4KLS A;  7ICH A;  9ICC A;  1U9L A;  4Z6F A;  4ECT A;  7ICN A;  7ICG A;  2HHS A;  4O0I A;  3TAQ A;  4B9M A;  4P4P A;  3UXO A;  3PMN A;  4YQW A;  1ZQQ A;  2IA6 A;  1KFD A;  3AU2 A;  1XO1 A;  3ZDB A;  5III A;  1XWL A;  3MAB A;  5IIK A;  2W9C B;  2FMQ A;  4DS5 A;  3TAN A;  2W9A A;  2ASD A;  5DQH A;  4DOA A;  5KFI A;  4B9L A;  2KN7 A;  3MR5 A;  8ICK A;  3OSP A;  5DB6 A;  5CB1 A;  5J2J A;  1COO A;  3PW5 A;  4GC7 A;  3PNC A;  4F5O A;  1ZQA A;  5KT7 A;  3E2E A;  2FPM A;  2JEJ A;  2JZB A;  1U4B A;  1ZQM A;  1JN3 A;  4EYH B;  4JV2 A;  2AQ0 A;  1NKC A;  5HHI A;  1C7Y A;  4ELU A;  4I2J A;  1LV5 A;  1ZQF A;  4YMM A;  4Q43 A;  1UA1 A;  2NRV A;  4PGQ A;  2ZJA A;  3RB0 A;  2C22 A;  2FMP A;  3RR7 A;  3RAQ A;  4QZC A;  1S9F A;  4KN7 A;  1SKW A;  1JMS A;  3BQT A;  5KG7 A;  1N56 A;  1HUZ A;  1XC9 A;  3RR8 A;  3RBE A;  4ECQ A;  4DS4 A;  4F2R A;  4JWN A;  4PPX A;  4EBE A;  4KLU A;  4F4W A;  4R63 A;  1RZT A;  9ICQ A;  1X2I A;  3LDA A;  1ZET A;  3PX6 A;  2AGQ A;  1L3V A;  4KLE A;  9ICN A;  1ZQS A;  3KTQ A;  4B9N A;  1WCL A;  2ZJ8 A;  5J0Q A;  3PR4 A;  4DLG A;  1SKR A;  4I2H A;  8ICM A;  8ICS A;  4XA5 A;  5J0T A;  4GXI A;  1U45 A;  2H5X A;  4IRC A;  4M9H A;  5BOL A;  3IHQ B;  4XUS A;  8ICE A;  4J9R A;  2Y1I A;  4RNO A;  1ZQW A;  9ICO A;  2AGO A;  1MC8 A;  4QWD A;  5KFT A;  1NJX A;  4M2Y A;  4MFC A;  7ICR A;  2P66 A;  4UB4 A;  9ICJ A;  4F4Z A;  4R66 A;  2R8I A;  2OWO A;  4ECS A;  1XSP A;  2R8K A;  3PO4 A;  1X9S A;  4QW8 A;  3ZD9 A;  5L9X A;  5EOZ A;  1DGS A;  1ZQC A;  2PFN A;  3EZ5 A;  3MGH A;  2VA2 A;  4UAZ A;  4R64 A;  4M9J A;  4YD2 A;  1NK0 A;  1CUK A;  1L3S A;  2JEF A;  5DQG A;  1NJW A;  4JV1 A;  4TUR A;  8ICR A;  2MAX A;  4RPZ A;  3GIL A;  2J6U A;  3M9N B;  2C28 A;  3HT3 A;  4XQ8 A;  8ICY A;  5KFR A;  5DGB A;  4QZE A;  3ISD A;  3RH4 A;  4QZF A;  1S0N A;  1T8E A;  2PI5 A;  4NLN A;  4DQQ A;  4M0A A;  4LZG A;  3G6Y A;  4ECY A;  4M9L A;  2A1J A;  4KLG A;  1XSN A;  1IM4 A;  1L3U A;  5IIL A;  4NLK A;  1NKE A;  2UVW A;  3OJU A;  1QSY A;  5KG2 A;  2FLN A;  3MBY A;  2KFN A;  8ICP A;  2ZJ5 A;  3T5L A;  4RUA A;  1H38 A;  3EPG A;  3H8W A;  4YP3 A;  3TI0 A;  9ICX A;  2XGP A;  5HML A;  5KFD A;  2BQR A;  3UXN A;  4YN4 A;  2FPK A;  5DG9 A;  5DB7 A;  1Z3E B;  1ZQX A;  4PHA A;  4MFF A;  9ICM A;  3BQ1 A;  1TKD A;  3Q8S B;  4GC6 A;  2JEG A;  4B9T A;  5KFE A;  1TK8 A;  4YXM A;  4O3P A;  5J2C A;  1TK0 A;  2XY5 A;  2J6T A;  4Q44 A;  4C8N A;  4YMO A;  4DL4 A;  4EEY A;  1ZQD A;  4C8M A;  1XSL A;  5J2B A;  7ICM A;  2P6U A;  3N97 B;  1KLN A;  5C5J A;  1K1Q A;  4KLM A;  4UB3 A;  1ZJN A;  3H40 A;  4I2G A;  8ICB A;  4FO6 A;  4O5E A;  2BPC A;  5D46 A;  4J9M A;  2BCU A;  4O3R A;  4M47 A;  4RT2 A;  4QWE A;  4F5N A;  9ICT A;  4O3N A;  3OSN A;  5J2H A;  2BCV A;  5CP2 A;  4DLE A;  2I9G A;  3HX0 A;  4PGY A;  3Q8P B;  2R8J A;  3KHL A;  3LWM A;  3EWA A;  4KLL A;  9ICU A;  4R8U A;  2XGQ A;  3GDX A;  7ICQ A;  3RH5 A;  9ICL A;  4DSJ A;  1MQ3 A;  4KLF A;  5DQI A;  5KFN A;  3PO5 A;  8ICQ A;  3JPO A;  7ICI A;  1BVS A;  1TK5 A;  4F93 B;  1ARO P;  4M9G A;  5HMM A;  4QZH A;  2C2D A;  4RQ2 A;  5DB9 A;  3Q8M A;  4UAW A;  1QSS A;  3BDP A;  4K4G A;  3PW4 A;  5KFW A;  4YCX A;  1TVA A;  2AU0 A;  3UQ0 A;  4IR1 A;  4YR3 A;  3ISB A;  3H8S A;  4PHP A;  4RQ6 A;  3ZDE A;  4P2H A;  2XCP A;  3EPI A;  3JPS A;  3GIK A;  3ZD8 A;  3RB4 A;  3MDA A;  3C2L A;  3C2M A;  4DFM A;  5HP4 A;  4IRK A;  3PW0 A;  1B43 A;  1XU4 A;  4M6W B;  1QSL A;  3RJE A;  7ICU A;  4IR9 A;  7ICS A;  2HHQ A;  2W9M A;  1UT5 A;  1ZQY A;  1BPE A;  5KG0 A;  4RPX A;  5CA7 A;  2FMS A;  5DB8 A;  4TUQ A;  5IIN A;  2KTQ A;  1T7P A;  4DL3 A;  2V4Q A;  3ETL A;  4DO9 A;  2XY6 A;  2GWS A;  2IMW P;  9ICF A;  2PFP A;  4R8U B;  4YVZ A;  2FPL A;  3GIM A;  2RDI A;  3RB3 A;  4J9O A;  1IXR A;  1UA0 A;  2R8G A;  4RQ0 A;  1HJP A;  3MR2 A;  5TZV A;  3RRG A;  3ZDC A;  1BPD A;  5KFP A;  1KDH A;  4YMN A;  4UQG A;  4RZR A;  2IHN A;  2MUT B;  5DBC A;  4ECR A;  4ED7 A;  5DG7 A;  3RBD A;  4FBT A;  4I2E A;  4F8R A;  1TV9 A;  2NRW A;  4NXZ A;  5J0W A;  3PR5 B;  2V9W A;  5KT5 A;  8ICU A;  3EYZ A;  8ICI A;  3H8J A;  1ZQU A;  3HWT A;  5KFK A;  7ICT A;  2BGW A;  5EWF A;  5J2F A;  5DLG A;  1ZQT A;  2FLL A;  1NJZ A;  2HHT A;  1BPY A;  4O5K A;  3THV A;  5KFY A;  4I2F A;  4KLQ A;  4ECU A;  3V7K A;  4DL2 A;  2M9N A;  3T5K A;  2HW3 A;  5CR0 A;  5IIO A;  5J2A A;  1KTQ A;  4ED3 A;  1S10 A;  1RYS A;  3JPT A;  4RPY A;  4Q8F A;  1RXW A;  5KFM A;  3TAP A;  1U47 A;  4O3S A;  4IQU A;  5BPC A;  2HHU A;  1NOM A;  2WTF A;  4O5C A;  3C1Y A;  4CCH A;  3EW9 A;  4I2B A;  5IIM A;  4QWC A;  1S77 D;  2DPI A;  5JUM A;  4YFK A;  4PH5 A;  1CEZ A;  9ICP A;  8ICG A;  3KHG A;  4ELT A;  1S76 D;  2ZUB A;  1ZQZ A;  4UB1 A;  3C5G A;  3GV5 B;  4BGD A;  5J0U A;  5J2I A;  4F5Q A;  4MEY A;  5J0O A;  3MDC A;  4DSE A;  2ATL A;  1BPZ A;  2FLP A;  4QZ9 A;  3PX0 A;  1ZQB A;  4J9P A;  4I2A A;  4KLI A;  5L1I A;  8ICC A;  4RUC A;  4ECW A;  2J6S A;  4NM2 A;  4J9S A;  5KFJ A;  2W9C A;  4F4X A;  1KEJ A;  4F92 B;  3TQ1 A;  4QWA A;  3LK9 A;  8ICO A;  1V9P A;  2AJQ A;  9ICH A;  4DSF A;  2VA8 A;  3AU6 A;  9ICV A;  7ICO A;  1T3N A;  1ZQH A;  4DL7 A;  3PV8 A;  3BJY A;  5KG1 A;  2W9B B;  3MFH A;  4DOB A;  3HPO A;  4KLO A;  4IQT A;  3PVX A;  1NK5 A;  4RU9 A;  1A77 A;  1Z00 A;  4R65 A;  3TFR A;  5KFU A;  3HP6 A;  9ICR A;  3NTU A;  2UVV A;  2BPG A;  4J9N A;  8ICH A;  5HHH A;  4YR0 A;  2B21 A;  4F2S A;  4JWM A;  3RJJ A;  1Z00 B;  5J2K A;  3FDS A;  1Y88 A;  2JEI A;  3TFS A;  1D9D A;  1QTM A;  4DQR A;  3C1Z A;  2UVU A;  9ICS A;  2W8L A;  2ASJ A;  3ORY A;  4NLG A;  3UXP A;  2LYH A;  2JZB B;  4RNN A;  3SYZ A;  3SI8 A;  5F9L A;  5CHG A;  4ED8 A;  1NK7 A;  3HW8 A;  1BPB A;  4I2D A;  1ZQJ A;  3OHA A;  1NK9 A;  5KFB A;  4B9V A;  8ICF A;  1K1S A;  2BHN A;  3JPP A;  1TFR A;  4YG2 A;  1JXL A;  1SL0 A;  4BDP A;  2BDP A;  5J0P A;  3M8R A;  2ZUC A;  3QZ8 A;  7ICJ A;  4QZA A;  3GIJ A;  4P4M A;  4EYI B;  4DFK A;  4QZ8 A;  5KFV A;  3RRH A;  5KG5 A;  4Z6D A;  3JPN A;  4PGX A;  4MEX A;  4EBC A;  3AUO A;  2DPJ A;  1B22 A;  5D4B A;  5KFG A;  2ALZ A;  1EXN A;  1TAQ A;  3V7J A;  4UBC A;  1A76 A;  1D8L A;  1T4G A;  4IQW A;  3ISC A;  4Z6C A;  2BQ3 A;  8ICA A;  4I2C A;  5KFH A;  1LB2 B;  4EZ6 A;  5KFL A;  4RQ5 A;  4MF8 A;  2XY7 A;  1S0V A;  3N4M B;  7ICE A;  3G6V A;  2KZ3 A;  1U49 A;  4JUZ A;  9ICB A;  2PFQ A;  3H7I A;  3QEB Z;  3OGU A;  4GXJ A;  7ICF A;  5KFS A;  5KT3 A;  4ZH4 A;  2KZZ A;  5DBA A;  4QZI A;  2BCS A;  3TAR A;  4DSK A;  2IHM A;  5DBB A;  1KFS A;  3GII A;  3T5J A;  2C2E A;  2DFL A;  4J9L A;  4IQV A;  4GXK A;  5KFA A;  2AGP A;  4TUS A;  2V4R A;  2XCA A;  1HUO A;  3RH6 A;  4NY8 A;  1ZQR A;  1XS9 D;  4F5P A;  4DL5 A;  5DKW A;  9ICW A;  5L1L A;  5KFC A;  3C5F A;  8ICZ A;  3NGD A;  3MR3 A;  5DDY A;  4DQI A;  4TQR A;  3SZ2 A;  5IIJ A;  3C23 A;  5KFO A;  1SL2 A;  3M8S A;  5DDM A; 
#chains in the Genus database with same CATH topology
 4Y2Q A;  1JI7 A;  3RTV A;  3KHR A;  2E8N A;  4K4H A;  4DSI A;  3VC8 A;  2ASL A;  4PHE A;  3H4B A;  1ZD2 P;  2BCR A;  3E0F A;  3QE9 Y;  4NM1 A;  1F5S A;  3KHH A;  2HVI A;  3KOO A;  1ZQI A;  4KLJ A;  2LM4 A;  5ALX A;  1HIW A;  4KX5 A;  3QUB A;  1X6J A;  5ALK A;  4C0Z A;  5AM2 A;  4B6J A;  5J2D A;  4QZD A;  1XO0 A;  3FYH A;  1Z19 A;  4ED0 A;  1PZN A;  2I6X A;  2YML A;  4RQ1 A;  1FEZ A;  7ICL A;  1SIJ A;  3MFI A;  4EEN A;  5KFZ A;  3C2K A;  5B66 U;  1LKY B;  9ICK A;  1SL1 A;  1D9F A;  3TAD A;  1U48 A;  4C7Z A;  1V38 A;  3BQ0 A;  8ICN A;  5KFF A;  2EQY A;  4NJ8 A;  2HHX A;  4MF2 A;  5DGA A;  4KLT A;  1BNP A;  3T79 A;  3K4G A;  1BGX T;  4ED2 A;  1KSP A;  1ZQG A;  1JX4 A;  4UAY A;  4G3I A;  4RQ8 A;  1SKS A;  2MUT A;  3WKA A;  5AKE A;  1UT8 A;  2PXI A;  2KZM A;  4O3M A;  2E1F A;  3WK9 A;  4Y2X A;  1PK3 A;  2PMZ C;  3MR6 A;  3SD7 A;  2Y0S F;  3ETR A;  2DWQ A;  4FS1 A;  1Z1V A;  4CGZ A;  1V97 A;  4YR2 A;  1N48 A;  3Q8R B;  1L7N A;  3B0X A;  4CF3 A;  2EAM A;  5ALV A;  8ICJ A;  3F2B A;  2QB0 B;  4IRK A;  4QZB A;  1X9W A;  2G5I B;  1NKB A;  3GFK B;  3LVW A;  4BWM A;  3KFU F;  2W8K A;  4E0D A;  3V6H A;  2BKE A;  2Y0S C;  5J29 A;  3Q8K A;  2CN1 A;  2HI0 A;  2MA1 A;  4JV0 A;  3CNH A;  1SZP A;  4EX7 A;  2EDU A;  4ECX A;  4Z6E A;  2RDJ A;  2BR0 A;  9ICC A;  4Z6F A;  4ECT A;  3I28 A;  4B9M A;  4P4P A;  1ZD4 A;  4YQW A;  1KFD A;  1PUZ A;  3MAB A;  2FMQ A;  4DS5 A;  2KIW A;  4B9L A;  3OSP A;  3AMZ A;  1COO A;  3PW5 A;  1SXD A;  2JEJ A;  1GO3 F;  2JZB A;  1S5L U;  1ZQM A;  1IG6 A;  4JV2 A;  2AQ0 A;  1NKC A;  2WB1 C;  4I2J A;  1LV5 A;  4FFD A;  4Q43 A;  3RAQ A;  4KN7 A;  3MC1 A;  3BQT A;  1XC9 A;  4PPX A;  4ECQ A;  2MSN A;  4EBE A;  3WU2 U;  2K89 A;  3PX6 A;  2YB4 A;  3KTQ A;  4DLG A;  2E1E A;  5J0T A;  2H5X A;  4IRC A;  4M9H A;  5BOL A;  4XUS A;  3KKA C;  4MFC A;  7ICR A;  2R8I A;  1XSP A;  1RQN A;  2VA2 A;  4UAZ A;  4YD2 A;  1L3S A;  4JV1 A;  8ICR A;  3GIL A;  3O0F A;  1L7P A;  4XQ8 A;  4QZE A;  4NLN A;  1KQQ A;  3G6Y A;  2WAQ C;  4NWI A;  1T94 A;  4PZN A;  4UW9 A;  3M7D A;  3MBY A;  2ZIW B;  1UCV A;  3T5L A;  4RUA A;  1H38 A;  3EPG A;  1KBU A;  3TI0 A;  5KFD A;  3WKB A;  3UXN A;  5DG9 A;  3SEI A;  3I1Y A;  4MFF A;  1VDV A;  1ZOL A;  1N5W A;  4GC6 A;  2JEG A;  4O3P A;  1TK0 A;  2KEY A;  3CP8 A;  1QQ5 A;  3SAH A;  1L8L A;  1KLN A;  4KLM A;  1ZJN A;  4RQN A;  2F77 X;  4O5E A;  3TAD C;  4J9M A;  4O3R A;  4JB3 A;  4O3N A;  2YQE A;  5J2H A;  4GIB A;  4DLE A;  3AN1 A;  2I9G A;  3Q8P B;  9ICU A;  3RH5 A;  4DSJ A;  8ICQ A;  4F93 B;  1ARO P;  5DB9 A;  5AKI A;  1FIQ A;  5AIA A;  5KFW A;  4YCX A;  3PW4 A;  3NUQ A;  1PK1 B;  3H8S A;  4P2H A;  3ZDE A;  3GIK A;  4DFM A;  3PW0 A;  3RJE A;  4OO1 J;  5JRT A;  2HDO A;  2FMS A;  4DL3 A;  3R9K A;  2PFP A;  2VJ4 A;  2WHE A;  2FPL A;  2JGA A;  2R8G A;  4RQ0 A;  3SAG A;  3ZDC A;  1BPD A;  5KFP A;  1KDH A;  4YMN A;  4UQG A;  2F44 A;  4ED7 A;  4I2E A;  2NRW A;  5J0W A;  4J03 A;  3EYZ A;  5AHX A;  2BGW A;  5J8Y C;  1FFV A;  5AKK A;  4I2F A;  2WB1 F;  4DL2 A;  1NZP A;  1PVP A;  5CR0 A;  5J2A A;  2H3V A;  4ED3 A;  1S10 A;  1RYS A;  3CW2 C;  2A19 A;  3JPT A;  1RXW A;  2H3Z A;  4O3S A;  2EH9 A;  2WTF A;  3C1Y A;  4NL9 A;  4CCH A;  4C7Y A;  2OH2 A;  4YFK A;  1CEZ A;  9ICP A;  2HOQ A;  2WF7 A;  3TAC B;  2LKY A;  1S76 D;  2ZUB A;  3C5G A;  2LM1 A;  3GV5 B;  5J2I A;  5J0O A;  4QZ9 A;  1ZQB A;  1AQ6 A;  2W9C A;  1KEJ A;  4F92 B;  2BDU A;  3AU6 A;  7ICO A;  1T3N A;  5KG1 A;  2W9B B;  2VJ5 A;  1Z1B A;  3HPO A;  4KLO A;  1NK5 A;  4RU9 A;  2KVS A;  4R65 A;  9ICR A;  3NTU A;  4YR0 A;  5AM0 A;  2G08 A;  4PL1 A;  1NI3 A;  2JEI A;  3C1Z A;  9ICS A;  2W8L A;  3IV6 A;  5A0L A;  2JZB B;  3SYZ A;  3SI8 A;  4ED8 A;  1NK7 A;  1ZQ1 C;  2K4E A;  3HW8 A;  1ZQJ A;  3JPP A;  5KNI A;  1SL0 A;  3QU7 A;  4UAV A;  2BDP A;  3M8R A;  7ICJ A;  5AI4 A;  3RRH A;  2F76 X;  4Z6D A;  3SAF A;  4F72 A;  5D4B A;  1TAQ A;  3V7J A;  1D8L A;  4Z6C A;  8ICA A;  3NRW A;  5EE0 A;  4I2C A;  1QH9 A;  7ICE A;  4LJX A;  3G6V A;  1U49 A;  2OYY A;  3QEB Z;  5DBA A;  2IHM A;  4J9L A;  1DRG A;  3UMG A;  2HBK A;  2XCA A;  1MA7 A;  3RH6 A;  1ZQR A;  4DL5 A;  5DKW A;  5L1L A;  3A0B U;  8ICZ A;  2QB1 A;  3J81 j;  4UB8 U;  1ZQO A;  3M8S A;  2HHW A;  5ALW A;  1L6N A;  3OHB A;  3D2N A;  2K60 A;  2DBY A;  2F1H A;  5JU5 A;  7ICP A;  3GQC A;  2W54 A;  2O6K A;  3RJG A;  3V6J A;  2RLT A;  1ZJM A;  4QWB A;  5ALL A;  8ICL A;  4X5V A;  4BXO B;  4ED1 A;  2ZTC A;  9ICG A;  5EE3 A;  2BQU A;  2QB0 A;  5EWG A;  2ZTD A;  1DK3 A;  3KD3 A;  3M6Z A;  3MGI A;  4FS2 A;  2Q0Z X;  5ALG A;  2JHD A;  4RQ3 A;  4F4K A;  3QU9 A;  1QQ7 A;  3V7L A;  4UBB A;  2OHF A;  3FC4 A;  5ALZ A;  3QYP A;  2OXO A;  3LWL A;  4HYK A;  4Q8E A;  4KLH A;  3QU5 A;  1IIP A;  4YD1 A;  3V72 A;  4DQS A;  2B6G A;  2OM6 A;  1A6S A;  5KT6 A;  3GV7 B;  3LVV A;  1S0M A;  1TAM A;  2F3N A;  4C8K A;  2VA3 A;  5D49 A;  2W7P A;  1JIH A;  4I2I A;  5EWE A;  4DFJ A;  4C80 A;  3Q8Q B;  3PW2 A;  4DSL A;  4J9K A;  4KLD A;  1ZQV A;  2KSO B;  2BCQ A;  1KRP A;  3JPQ A;  4DWI A;  1MN8 A;  2L5Y A;  2Z7J A;  1RYR A;  1DK2 A;  2DKZ A;  2G5H B;  1KW4 A;  3PW7 A;  3BZK A;  4O3Q A;  4TUP A;  2VAN A;  4O9M A;  4M9N A;  2K4H A;  5KAI U;  1NNL A;  5CJ7 A;  4KMU A;  4TQS A;  3RJK A;  5KTQ A;  2GH1 A;  4OJ6 A;  5AIC A;  2NRZ A;  4C8L A;  1ZYQ A;  5J0X A;  2Y1J A;  3RJH A;  1MSW D;  2W7O A;  4F91 B;  1ZQP A;  4QW9 A;  3RF9 A;  1ZRM A;  4XRH A;  1BNO A;  1N2X A;  3M9M B;  4QIW F;  4F3O A;  4OJO A;  4KLS A;  4MFA A;  4OJP A;  1U9L A;  3L4P A;  7ICN A;  7ICG A;  2HHS A;  2DKX A;  3TAQ A;  3PMN A;  1ZQQ A;  2IA6 A;  5III A;  4US9 A;  5IIK A;  4BUG A;  3TAN A;  2W9A A;  2ASD A;  3K1Z A;  5KFI A;  4GC7 A;  4UAS A;  5KT7 A;  3E2E A;  2FE9 A;  4CF5 A;  1C7Y A;  4ELU A;  1ZQF A;  1UA1 A;  4PGQ A;  2JV3 A;  3QXG A;  1LVH A;  4JWN A;  3RBE A;  2KJ9 A;  5AK6 A;  5JTI A;  4R63 A;  1RZT A;  9ICQ A;  1X2I A;  3LDA A;  2DGZ A;  2ZJ8 A;  5J0Q A;  1SKR A;  3IG8 A;  8ICM A;  5ALY A;  2Y1I A;  4RNO A;  1YZ6 A;  2JRZ A;  1UPH A;  2K8C B;  4QWD A;  2AGO A;  1NJX A;  2OEH A;  4IC9 A;  4Y2U A;  3PZP A;  2HCF A;  2OWO A;  2R8K A;  1X9S A;  5H2F U;  3EZ5 A;  2PFN A;  3MGH A;  1CUK A;  1NJW A;  2J6U A;  4NL9 C;  3AQE A;  3IDW A;  1S0N A;  1T8E A;  4DQQ A;  3F5A A;  2A1J A;  1L3U A;  4NLK A;  4KMO B;  5ALR A;  2UVW A;  8ICP A;  2KOB A;  5AI9 A;  4YP3 A;  9ICX A;  5HML A;  2FPK A;  1ZQX A;  1J97 A;  3Q8S B;  4B9T A;  4C8N A;  1ZQD A;  2JH1 A;  1XSL A;  5J2B A;  2P6U A;  4JMU A;  1K1Q A;  3NRZ A;  4GFJ A;  4USA A;  5ALU A;  1LKY A;  2BPC A;  2BCU A;  4M47 A;  9ICT A;  5AM1 A;  2BCV A;  1O03 A;  4C4R A;  4PGY A;  2R8J A;  2HBJ A;  3LWM A;  3EWA A;  2XGQ A;  2HMX A;  9ICL A;  1BVS A;  2NO4 A;  4RQ2 A;  2KNJ A;  3Q8M A;  2I5H A;  1X66 A;  1ZXI A;  3A0H U;  3EPI A;  2DUY A;  2KE7 A;  3HRD D;  5ALF A;  3ZD8 A;  3MDA A;  3RB4 A;  3C2M A;  5HP4 A;  3B9J A;  1B43 A;  1O08 A;  2HBL A;  2EAP A;  3IN5 A;  1ZQY A;  4RPX A;  5CA7 A;  2KTQ A;  5IIN A;  1T7P A;  2JR5 A;  2V4Q A;  3ETL A;  3OPX A;  5EE1 A;  2K8B B;  2A3V A;  4R8U B;  4YVZ A;  2QKQ A;  4P0P A;  2QLT A;  4J9O A;  5EE9 A;  4U7C A;  1UA0 A;  5TZV A;  1WG8 A;  5ALH A;  2ZIU A;  3H0R B;  3RBD A;  5DG7 A;  4ECR A;  4FBT A;  2LI6 A;  5AKX A;  1ZQU A;  1WWU A;  3UMB A;  5KFK A;  7ICT A;  5EWF A;  5J2F A;  5DLG A;  1Q3V A;  1NJZ A;  2W3R A;  4OJL A;  1X42 A;  4Q8F A;  2KHQ A;  1U47 A;  4IQU A;  2KG5 A;  1NOM A;  5JUM A;  2FDR A;  8ICG A;  4ELT A;  2DQN B;  4UB1 A;  5ALD A;  4BGD A;  4DSE A;  3MDC A;  1BPZ A;  2Y9U A;  4I2A A;  4J9P A;  4KLI A;  8ICC A;  3S6J A;  5AKL A;  3HKZ F;  4P0Q B;  8ICO A;  3BS5 B;  5HR6 A;  2VA8 A;  3D2Q A;  3MFH A;  1A77 A;  3HP6 A;  2DL0 A;  2BPG A;  3NVY A;  5HHH A;  8ICH A;  4F2S A;  1VJ5 A;  4JWM A;  1Z00 B;  1Y88 A;  3TFS A;  1QTM A;  2UVU A;  2ASJ A;  2YY6 A;  3ORY A;  3UXP A;  1Q8K A;  1DGJ A;  4I2D A;  4FZN A;  4G9B A;  4YG2 A;  1RM6 C;  2YN4 A;  3QZ8 A;  3GIJ A;  4Y2R A;  4DFK A;  3NVV A;  5KFV A;  1WWV A;  4KX3 A;  5KG5 A;  3JPN A;  2DPJ A;  1B22 A;  2W04 A;  2ALZ A;  1FO4 A;  4UBC A;  4IQW A;  2KKV A;  5KFH A;  1LB2 B;  3N4M B;  3WK6 A;  3OGU A;  4GXJ A;  4P0Q A;  5KFS A;  4ZH4 A;  5AI0 A;  4AYB C;  2EAO A;  1KFS A;  3D6J A;  3T5J A;  4GXK A;  2F8K A;  1WUD A;  5KL1 B;  5AK4 A;  2V4R A;  2ZIU B;  2RRD A;  2WF5 A;  3CRX A;  5KFC A;  3NGD A;  1K5O A;  3MR3 A;  3SZ2 A;  5IIJ A;  5KFO A;  2A1A A;  2DF4 B;  5J0R A;  2KK0 A;  2QAR A;  5AKH A;  5KG6 A;  1SV0 C;  3PST A;  2F1I A;  2WF8 A;  4M6W A;  2JMG A;  4PZO A;  4RNM A;  5AI6 A;  2ZTE A;  4Q45 A;  1NJY A;  2Q4T A;  1S0O A;  1Z4N A;  4LZD A;  4RQ4 A;  1ECW A;  5AI5 A;  9ICE A;  1URJ A;  2KKP A;  2ZIX A;  2KHV A;  8ICT A;  3DEE A;  4GLX A;  2G09 A;  9ICI A;  2HHV A;  5GTH U;  2XVT A;  3M9O B;  4J9Q A;  4P0P B;  3G6X A;  2R18 A;  3SV4 A;  4US8 A;  4ZOH C;  3QNM A;  1Q46 A;  5GTI U;  3H4D A;  2ZXI A;  3L5K A;  4LVS A;  1JUD A;  4RT3 A;  2IBK A;  5F9N A;  3V6K A;  3B0Y A;  3GZF A;  1MQ2 A;  3Q8L A;  2ISP A;  3C21 A;  2LBO A;  3BQ2 A;  1RXV A;  1FFU A;  4CDG A;  4UB2 A;  4DF8 A;  5L1K A;  3AEV A;  3RAX A;  1TAU A;  3ALR A;  1ZQK A;  1ZQN A;  1PVQ A;  1S97 A;  2R8H A;  3QZ7 A;  4YXJ A;  2LYA A;  4ED6 A;  4ELV A;  3K75 D;  3DV9 A;  5DG8 A;  5CWR A;  3RFA A;  2W03 A;  1B4F A;  2HVH A;  3AL0 B;  3WKD A;  3QEA Z;  2Y9T A;  3BQ7 A;  4BJQ A;  4NLZ A;  2BZF A;  2PKE A;  1UHU A;  5J0Y A;  4U6P A;  3PML A;  1L3T A;  2C2R A;  2ODG A;  4EEK A;  1SXE A;  4EZ9 A;  4I28 A;  4EBD A;  2F1J A;  4DQP A;  7ICV A;  3U26 A;  2PI4 A;  2KFZ A;  4DEZ A;  2P6R A;  2A1J B;  2ISO A;  2AQ4 A;  4FBU A;  2KJ8 A;  3QUT A;  5J8Y A;  3JPR A;  4F4Y A;  5CRX A;  4UAT A;  3NVZ A;  3F2C A;  2BPF A;  5KT4 A;  1BPX A;  4Y2P A;  1V85 A;  3UQ2 A;  1ZQL A;  3RJI A;  4I29 A;  7ICH A;  3F5E A;  2EAN A;  5E79 U;  5FP0 A;  4ACO A;  3AU2 A;  5AI8 A;  3ZDB A;  2NYV A;  2D8C A;  5DQH A;  4DOA A;  3WKC A;  2KN7 A;  3MR5 A;  5DB6 A;  2RP5 A;  5ALJ A;  1J2N A;  2ZXH A;  3PNC A;  3QU2 A;  1SB3 C;  2FPM A;  3C29 A;  1U4B A;  1JN3 A;  4EYH B;  4YMM A;  3RB0 A;  1YZ7 A;  2ZJA A;  2FMP A;  5ALE A;  2HOI A;  1SKW A;  2WFA A;  1HUZ A;  3HIL A;  4DS4 A;  1HEK A;  1L8O A;  2ZIX B;  4F4W A;  2ZIW A;  1ZET A;  2AGQ A;  9ICN A;  8ICF A;  1ZQS A;  4NV0 A;  2E8P A;  4B9N A;  3BS7 A;  1WCL A;  3PR4 A;  8ICS A;  4GXI A;  3ONN A;  1COK A;  4J9R A;  3SR6 A;  1NZB A;  4M2Y A;  2P66 A;  4UB4 A;  2IOH A;  4F4Z A;  4R66 A;  2G07 A;  3ZD9 A;  5L9X A;  1ZQC A;  3AQF A;  1SV4 A;  1NK0 A;  2GO7 A;  1OXJ A;  5DQG A;  1JRP A;  4TUR A;  3KZX A;  4HAI A;  2KIC A;  4M0A A;  4KLG A;  1IM4 A;  5IIL A;  1CRX A;  2ZIV B;  3H8M A;  1NKE A;  2RQ5 A;  3OJU A;  5KG2 A;  2KFN A;  2ZJ5 A;  2VKQ A;  3H8W A;  2CRX A;  2XGP A;  5AIB A;  3F53 A;  2BQR A;  2H3I A;  4YN4 A;  5DB7 A;  1Z3E B;  4CRX A;  2XI9 A;  9ICM A;  1TKD A;  5KFE A;  1TK8 A;  4YXM A;  5J2C A;  2XY5 A;  4Q44 A;  4DL4 A;  7ICM A;  4C8M A;  5C5J A;  4UB3 A;  3H40 A;  8ICB A;  4FO6 A;  2CXY A;  2LYB A;  1OUQ A;  3OSN A;  3HX0 A;  3NAS A;  4KLL A;  3GDX A;  4UAR A;  1SZH A;  4Y2S A;  3JPO A;  3D2S A;  4M9G A;  2C2D A;  1KL9 A;  4UAW A;  3BDP A;  3QUC A;  4CF4 A;  2AU0 A;  1TVA A;  4YR3 A;  1ED1 A;  4PHP A;  4RQ6 A;  1SV0 A;  2B0C A;  1YT3 A;  7ICU A;  7ICS A;  2NV3 A;  2E5S A;  1BPE A;  5DB8 A;  4TUQ A;  2LMR A;  4Y2Y A;  5L1M A;  2GWS A;  2H3F A;  9ICF A;  2KVC A;  3RB3 A;  2KD1 A;  3C28 A;  1HJP A;  3MR2 A;  3RRG A;  4RZR A;  1ZD5 A;  1RDF A;  2MUT B;  4FE3 A;  4NXZ A;  3PR5 B;  8ICU A;  3H8J A;  3HWT A;  1P7D A;  1ZQT A;  2HHT A;  1B0X A;  4KLQ A;  3THV A;  4ECU A;  3T5K A;  2P35 A;  2HW3 A;  5IIO A;  2K8A A;  2HHU A;  5BPC A;  4O5C A;  3EW9 A;  5IIM A;  3F2D A;  2DPI A;  4PH5 A;  5ALI A;  5G5G A;  3KHG A;  4F5Q A;  2ZIV A;  5J0U A;  3PX0 A;  4RUC A;  2J6S A;  4J9S A;  4F4X A;  3TQ1 A;  3LK9 A;  1V9P A;  2AJQ A;  3N7S C;  2XID A;  4DL7 A;  3BJY A;  3GU3 A;  5ALT A;  3N28 A;  4Y2T A;  4IQT A;  1D8B A;  2VIX A;  4FZL A;  2UVV A;  2B21 A;  3RJJ A;  3N7R C;  5AM3 A;  3BZC A;  2ES6 A;  1A0P A;  1D9D A;  4DQR A;  1PVR A;  2FI1 A;  4NLG A;  5F9L A;  5CHG A;  2H3Q A;  3OHA A;  4B9V A;  4AYB F;  5AKZ A;  1JXL A;  4BDP A;  4QZA A;  2QAR B;  4P4M A;  4EYI B;  3QU4 A;  2KSO A;  4PGX A;  4EBC A;  3AUO A;  5KFG A;  3M1Y A;  1EXN A;  3SQI A;  4OJ5 A;  1T4G A;  4PJ0 U;  2BQ3 A;  2AHO B;  2ZG6 A;  4EZ6 A;  4RQ5 A;  2XY7 A;  2KZ3 A;  4JUZ A;  1J2M A;  9ICB A;  2PFQ A;  3H7I A;  1KN5 A;  2K4I A;  2KZZ A;  3TKA A;  2BCS A;  2EZY A;  3GII A;  2C2E A;  2DFL A;  3FAH A;  4AP9 A;  1XNS A;  5ALO A;  5KFA A;  2N1R A;  2MU2 A;  5F3X B;  1XS9 D;  4F5P A;  9ICW A;  3UM9 A;  5TIS U;  3C5F A;  5K4L A;  1RG6 A;  4DQI A;  3C23 A;  1T3Q A;  5DDM A;  4RQM A;  2ZUD A;  3ICX A;  4ECZ A;  4BXO A;  4IL6 U;  2NRX A;  3ZI4 A;  4ECV A;  5J2E A;  4O3O A;  2YX8 A;  3T3F A;  5AK5 A;  1N61 A;  2EZX A;  4I27 A;  2PFO A;  3KBB A;  5HNK A;  5BOM A;  5J2G A;  1RPL A;  2HBM A;  3IRU A;  5ALM A;  2I1Q A;  3SV3 A;  3T5H A;  1KFT A;  1DOQ A;  3KKA A;  1X6I A;  1L5U A;  9ICA A;  2YMQ A;  3PSF A;  5J0S A;  4JK1 A;  1JXE A;  2W55 A;  2XC9 A;  2KJ5 A;  2LPE A;  3K1R B;  3WKE A;  3BS5 A;  5KT2 A;  5KG3 A;  3OJS A;  2GLE A;  4KIT B;  3KZI U;  5AKY A;  4P4O A;  1PK1 A;  1NK4 A;  4IRD A;  5KG4 A;  4QZG A;  1QLN A;  3RB6 A;  4DF4 A;  3NS1 A;  3L3F X;  1NK8 A;  4RQ7 A;  3PY8 A;  4B9S A;  1RQL A;  3QUQ A;  4DOC A;  1ZRN A;  2PMZ F;  4KN4 A;  2GOL A;  5DLF A;  1M6Y A;  2NO5 A;  2M0N A;  4F50 A;  7ICK A;  4PHD A;  5C0Y A;  2NRT A;  8ICW A;  4DFP A;  3FM9 A;  8ICX A;  1C20 A;  2YMP A;  5ALP A;  1F44 A;  5L1J A;  3PSP A;  5T14 A;  3UPQ A;  2HOF A;  1X9M A;  4F5R A;  4QJF B;  5KAF U;  2YTU A;  1UQV A;  4EX6 A;  5KFX A;  3ZDA A;  3HJE A;  4B9U A;  2WF6 A;  4DL6 A;  2W9B A;  4M04 A;  5KFQ A;  1CI4 A;  1ZD3 A;  4UB5 A;  4K4I A;  3RJF A;  2XIC A;  3ZDD A;  3PX4 A;  4BWJ A;  2XO7 A;  4Y2J A;  1WCN A;  3I76 A;  4C8O A;  8ICV A;  5AKJ A;  3IM1 A;  3GV8 B;  1D8Y A;  2JXJ A;  4KTQ A;  1ZQE A;  3LYS A;  2UVR A;  1NK6 A;  1N60 A;  4O0I A;  3H0M B;  3UXO A;  5CEH A;  2KIV A;  1JAL A;  1X9X A;  1XO1 A;  4C4T A;  1XWL A;  2W9C B;  2F2A B;  4DFD A;  4A8E A;  8ICK A;  1SWW A;  5CB1 A;  5J2J A;  4F5O A;  1ZQA A;  3M6K A;  1IV8 A;  3VCB A;  2W11 A;  2IOF K;  5HHI A;  2WAQ F;  2E8O A;  2EZZ A;  4OCZ A;  2NRV A;  3RR7 A;  2C22 A;  1S8O A;  4QZC A;  2FJ6 A;  1S9F A;  1JMS A;  1N56 A;  5KG7 A;  3RR8 A;  4F2R A;  1N62 A;  4OD0 A;  4KLU A;  1OW5 A;  1L3V A;  2E8M A;  4KLE A;  1L7M A;  5AKG A;  4I2H A;  5AK3 A;  4XA5 A;  1U45 A;  2YB1 A;  4ICA A;  3IHQ B;  4DCC A;  8ICE A;  1ZQW A;  3IP4 B;  9ICO A;  1MC8 A;  5KFT A;  3MGV A;  3EUB 2;  9ICJ A;  1DXS A;  2AXT U;  4ECS A;  3PO4 A;  4QW8 A;  5EOZ A;  1DGS A;  4R64 A;  4M9J A;  2JEF A;  2MAX A;  4RPZ A;  1WYG A;  3M9N B;  2C28 A;  3HT3 A;  3OTQ A;  8ICY A;  5KFR A;  5DGB A;  4UB6 U;  3ISD A;  3RH4 A;  4QZF A;  2OCE A;  3WK8 A;  2PI5 A;  4LZG A;  4ECY A;  4M9L A;  4CNQ A;  3PSI A;  1XSN A;  2W43 A;  2MRL A;  1QSY A;  4NLC A;  2FLN A;  1L7O A;  5HR7 A;  1VLB A;  4PHA A;  3ED5 A;  1N63 A;  3BQ1 A;  3NVW A;  3CYM A;  2J6T A;  4YMO A;  4EEY A;  3N97 B;  3WK7 A;  2JH7 A;  4I2G A;  5D46 A;  4RT2 A;  4QWE A;  4F5N A;  5CP2 A;  5ALN A;  4QIW C;  4UAU A;  3KHL A;  4R8U A;  7ICQ A;  2YMM A;  5ALQ A;  1MQ3 A;  4KLF A;  5DQI A;  5KFN A;  3PO5 A;  3QX7 A;  4C4S A;  7ICI A;  1TK5 A;  4PL2 A;  3HKZ C;  5HMM A;  4QZH A;  3WK5 A;  1QSS A;  4K4G A;  3UQ0 A;  1JRO A;  4IR1 A;  3ISB A;  2XCP A;  2F8L A;  3JPS A;  3C2L A;  4NLB A;  1XU4 A;  4M6W B;  1QSL A;  4MHV A;  4IR9 A;  2D6F C;  2HHQ A;  2W9M A;  1UT5 A;  2KV2 A;  5KG0 A;  3SMV A;  2KP7 A;  4DO9 A;  2XY6 A;  2RHF A;  2IMW P;  3GIM A;  2RDI A;  1IXR A;  1QCK A;  4BX9 C;  2IHN A;  5DBC A;  2WF9 A;  4F8R A;  1TV9 A;  2V9W A;  5KT5 A;  8ICI A;  2K4P A;  2FLL A;  1BPY A;  4O5K A;  5KFY A;  1KKX A;  3V7K A;  2HSZ A;  2M9N A;  3N7P D;  1KTQ A;  4RPY A;  3SEN A;  5KFM A;  3TAP A;  4I2B A;  4QWC A;  1S77 D;  5ALS A;  4Y2V A;  1N5X A;  1ZQZ A;  4MEY A;  2ATL A;  2FLP A;  5L1I A;  4ECW A;  4NM2 A;  5KFJ A;  9ICH A;  4QWA A;  9ICV A;  4DSF A;  3IG5 A;  1ZQH A;  3PV8 A;  2W3S A;  5KL8 B;  4DOB A;  2LHT A;  3PVX A;  1Z00 A;  3TFR A;  5KFU A;  4J9N A;  5G5H A;  5J2K A;  5B5E U;  3FDS A;  4QNL A;  3H0L B;  4FZM A;  3E58 A;  2LYH A;  4EEL A;  4RNN A;  4CE6 A;  1X40 A;  1BPB A;  4WJ3 B;  1NK9 A;  3AM9 A;  5KFB A;  2ESE A;  2D3D A;  1F0M A;  1K1S A;  1RYU A;  1Z4O A;  1TFR A;  2BHN A;  2KMD A;  2E3T A;  4F71 A;  5J0P A;  2ZUC A;  1SGG A;  1Q3U A;  4QZ8 A;  4MEX A;  1A76 A;  2IOF A;  2CPR A;  3WK4 A;  3ISC A;  1QQ6 A;  5KFL A;  1S0V A;  4MF8 A;  7ICF A;  5KT3 A;  3UMC A;  4QZI A;  4DSK A;  3TAR A;  5DBB A;  5AM5 A;  3DDH A;  4IQV A;  2AGP A;  2G0A A;  4TUS A;  1HUO A;  4NY8 A;  4IS7 A;  5AM4 A;  1SWV A;  5DDY A;  4TQR A;  2G06 A;  2AH5 A;  1SL2 A;  1TE2 A; 
#chains in the Genus database with same CATH homology
 2HHW A;  2ZUD A;  5J0R A;  3OHB A;  5KG6 A;  3RTV A;  4ECZ A;  2F1H A;  4BXO A;  2F1I A;  2NRX A;  7ICP A;  4M6W A;  3KHR A;  4ECV A;  5J2E A;  3GQC A;  4RNM A;  4O3O A;  4K4H A;  3RJG A;  4DSI A;  2ZTE A;  4Q45 A;  3T3F A;  2ASL A;  3V6J A;  1NJY A;  4PHE A;  1ZJM A;  4QWB A;  3H4B A;  8ICL A;  4X5V A;  2BCR A;  4BXO B;  4ED1 A;  4I27 A;  3QE9 Y;  2PFO A;  1S0O A;  2ZTC A;  4LZD A;  4RQ4 A;  5HNK A;  9ICG A;  5BOM A;  4NM1 A;  2BQU A;  3KHH A;  5J2G A;  2HVI A;  1ZQI A;  4KLJ A;  5EWG A;  9ICE A;  1RPL A;  2ZTD A;  2I1Q A;  8ICT A;  4GLX A;  3SV3 A;  3T5H A;  3MGI A;  4FS2 A;  9ICI A;  2Q0Z X;  2HHV A;  1KFT A;  5J2D A;  4QZD A;  1DOQ A;  3M9O B;  4J9Q A;  3G6X A;  1L5U A;  9ICA A;  4RQ3 A;  3FYH A;  4F4K A;  3SV4 A;  5J0S A;  4ED0 A;  4JK1 A;  1PZN A;  1JXE A;  3V7L A;  4UBB A;  4RQ1 A;  2XC9 A;  7ICL A;  3H4D A;  3MFI A;  5KFZ A;  3LWL A;  3C2K A;  5KT2 A;  4HYK A;  4LVS A;  4KLH A;  4Q8E A;  5KG3 A;  3OJS A;  4YD1 A;  4RT3 A;  4KIT B;  3V72 A;  5F9N A;  4DQS A;  1SL1 A;  2IBK A;  9ICK A;  4P4O A;  1D9F A;  1NK4 A;  4IRD A;  3V6K A;  5KG4 A;  3B0Y A;  4QZG A;  5KT6 A;  3RB6 A;  1U48 A;  3GV7 B;  1QLN A;  4DF4 A;  1NK8 A;  1S0M A;  4RQ7 A;  3Q8L A;  1MQ2 A;  2ISP A;  3BQ0 A;  3PY8 A;  3C21 A;  4B9S A;  4C8K A;  8ICN A;  5KFF A;  2VA3 A;  4DOC A;  2HHX A;  3BQ2 A;  4MF2 A;  4KN4 A;  1RXV A;  5D49 A;  5DLF A;  4UB2 A;  1JIH A;  4I2I A;  4DF8 A;  5DGA A;  5EWE A;  5L1K A;  4KLT A;  4F50 A;  4DFJ A;  3RAX A;  1TAU A;  3Q8Q B;  3K4G A;  1BGX T;  3PW2 A;  4ED2 A;  1ZQN A;  1ZQK A;  1KSP A;  4DSL A;  7ICK A;  4J9K A;  4PHD A;  1ZQG A;  4KLD A;  1ZQV A;  2NRT A;  1JX4 A;  8ICW A;  2BCQ A;  1KRP A;  1S97 A;  3JPQ A;  4DFP A;  4UAY A;  4DWI A;  2R8H A;  3QZ7 A;  4YXJ A;  4G3I A;  8ICX A;  4RQ8 A;  4ED6 A;  1SKS A;  4ELV A;  1RYR A;  3K75 D;  2MUT A;  1UT8 A;  2PXI A;  5L1J A;  5DG8 A;  2KZM A;  5CWR A;  3UPQ A;  3PW7 A;  1X9M A;  2HVH A;  3MR6 A;  4F5R A;  3QEA Z;  4FS1 A;  4NLZ A;  4O3Q A;  5J0Y A;  5KFX A;  3ZDA A;  4TUP A;  3PML A;  1L3T A;  2VAN A;  4B9U A;  2C2R A;  4O9M A;  4DL6 A;  4YR2 A;  1N48 A;  4M9N A;  3Q8R B;  2W9B A;  5CJ7 A;  4M04 A;  3B0X A;  5KFQ A;  4EZ9 A;  4KMU A;  4TQS A;  4EBD A;  3RJK A;  4I28 A;  2F1J A;  5KTQ A;  4DQP A;  8ICJ A;  4UB5 A;  7ICV A;  2PI4 A;  3RJF A;  4K4I A;  2NRZ A;  4C8L A;  2KFZ A;  4DEZ A;  3ZDD A;  3PX4 A;  1ZYQ A;  4BWJ A;  5J0X A;  2XO7 A;  2A1J B;  4QZB A;  2ISO A;  2P6R A;  2Y1J A;  2AQ4 A;  1WCN A;  1X9W A;  3RJH A;  1MSW D;  4FBU A;  1ZQO A;  1NKB A;  4C8O A;  8ICV A;  3GFK B;  3JPR A;  3IM1 A;  4BWM A;  4F4Y A;  2W8K A;  4E0D A;  4F91 B;  3V6H A;  3GV8 B;  2BKE A;  1ZQP A;  1D8Y A;  5J29 A;  4QW9 A;  3Q8K A;  4JV0 A;  4XRH A;  4KTQ A;  1SZP A;  2BPF A;  3M9M B;  5KT4 A;  1BPX A;  4ECX A;  4F3O A;  4Z6E A;  2RDJ A;  1ZQE A;  3UQ2 A;  1ZQL A;  2BR0 A;  2UVR A;  3RJI A;  4I29 A;  4MFA A;  1NK6 A;  4KLS A;  7ICH A;  9ICC A;  1U9L A;  4Z6F A;  4ECT A;  7ICN A;  7ICG A;  2HHS A;  4O0I A;  3TAQ A;  4B9M A;  4P4P A;  3UXO A;  3PMN A;  4YQW A;  1ZQQ A;  2IA6 A;  1KFD A;  3AU2 A;  1XO1 A;  3ZDB A;  5III A;  1XWL A;  3MAB A;  5IIK A;  2W9C B;  2FMQ A;  4DS5 A;  3TAN A;  2W9A A;  2ASD A;  5DQH A;  4DOA A;  5KFI A;  4B9L A;  2KN7 A;  3MR5 A;  8ICK A;  3OSP A;  5DB6 A;  5CB1 A;  5J2J A;  1COO A;  3PW5 A;  4GC7 A;  3PNC A;  4F5O A;  1ZQA A;  5KT7 A;  3E2E A;  2FPM A;  2JEJ A;  2JZB A;  1U4B A;  1ZQM A;  1JN3 A;  4EYH B;  4JV2 A;  2AQ0 A;  1NKC A;  5HHI A;  1C7Y A;  4ELU A;  4I2J A;  1LV5 A;  1ZQF A;  4YMM A;  4Q43 A;  1UA1 A;  2NRV A;  4PGQ A;  2ZJA A;  3RB0 A;  2C22 A;  2FMP A;  3RR7 A;  3RAQ A;  4QZC A;  1S9F A;  4KN7 A;  1SKW A;  1JMS A;  3BQT A;  5KG7 A;  1N56 A;  1HUZ A;  1XC9 A;  3RR8 A;  3RBE A;  4ECQ A;  4DS4 A;  4F2R A;  4JWN A;  4PPX A;  4EBE A;  4KLU A;  4F4W A;  4R63 A;  1RZT A;  9ICQ A;  1X2I A;  3LDA A;  1ZET A;  3PX6 A;  2AGQ A;  1L3V A;  4KLE A;  9ICN A;  1ZQS A;  3KTQ A;  4B9N A;  1WCL A;  2ZJ8 A;  5J0Q A;  3PR4 A;  4DLG A;  1SKR A;  4I2H A;  8ICM A;  8ICS A;  4XA5 A;  5J0T A;  4GXI A;  1U45 A;  2H5X A;  4IRC A;  4M9H A;  5BOL A;  3IHQ B;  4XUS A;  8ICE A;  4J9R A;  2Y1I A;  4RNO A;  1ZQW A;  9ICO A;  2AGO A;  1MC8 A;  4QWD A;  5KFT A;  1NJX A;  4M2Y A;  4MFC A;  7ICR A;  2P66 A;  4UB4 A;  9ICJ A;  4F4Z A;  4R66 A;  2R8I A;  2OWO A;  4ECS A;  1XSP A;  2R8K A;  3PO4 A;  1X9S A;  4QW8 A;  3ZD9 A;  5L9X A;  5EOZ A;  1DGS A;  1ZQC A;  2PFN A;  3EZ5 A;  3MGH A;  2VA2 A;  4UAZ A;  4R64 A;  4M9J A;  4YD2 A;  1NK0 A;  1CUK A;  1L3S A;  2JEF A;  5DQG A;  1NJW A;  4JV1 A;  4TUR A;  8ICR A;  2MAX A;  4RPZ A;  3GIL A;  2J6U A;  3M9N B;  2C28 A;  3HT3 A;  4XQ8 A;  8ICY A;  5KFR A;  5DGB A;  4QZE A;  3ISD A;  3RH4 A;  4QZF A;  1S0N A;  1T8E A;  2PI5 A;  4NLN A;  4DQQ A;  4M0A A;  4LZG A;  3G6Y A;  4ECY A;  4M9L A;  2A1J A;  4KLG A;  1XSN A;  1IM4 A;  1L3U A;  5IIL A;  4NLK A;  1NKE A;  2UVW A;  3OJU A;  1QSY A;  5KG2 A;  2FLN A;  3MBY A;  2KFN A;  8ICP A;  2ZJ5 A;  3T5L A;  4RUA A;  1H38 A;  3EPG A;  3H8W A;  4YP3 A;  3TI0 A;  9ICX A;  2XGP A;  5HML A;  5KFD A;  2BQR A;  3UXN A;  4YN4 A;  2FPK A;  5DG9 A;  5DB7 A;  1Z3E B;  1ZQX A;  4PHA A;  4MFF A;  9ICM A;  3BQ1 A;  1TKD A;  3Q8S B;  4GC6 A;  2JEG A;  4B9T A;  5KFE A;  1TK8 A;  4YXM A;  4O3P A;  5J2C A;  1TK0 A;  2XY5 A;  2J6T A;  4Q44 A;  4C8N A;  4YMO A;  4DL4 A;  4EEY A;  1ZQD A;  4C8M A;  1XSL A;  5J2B A;  7ICM A;  2P6U A;  3N97 B;  1KLN A;  5C5J A;  1K1Q A;  4KLM A;  4UB3 A;  1ZJN A;  3H40 A;  4I2G A;  8ICB A;  4FO6 A;  4O5E A;  2BPC A;  5D46 A;  4J9M A;  2BCU A;  4O3R A;  4M47 A;  4RT2 A;  4QWE A;  4F5N A;  9ICT A;  4O3N A;  3OSN A;  5J2H A;  2BCV A;  5CP2 A;  4DLE A;  2I9G A;  3HX0 A;  4PGY A;  3Q8P B;  2R8J A;  3KHL A;  3LWM A;  3EWA A;  4KLL A;  9ICU A;  4R8U A;  2XGQ A;  3GDX A;  7ICQ A;  3RH5 A;  9ICL A;  4DSJ A;  1MQ3 A;  4KLF A;  5DQI A;  5KFN A;  3PO5 A;  8ICQ A;  3JPO A;  7ICI A;  1BVS A;  1TK5 A;  4F93 B;  1ARO P;  4M9G A;  5HMM A;  4QZH A;  2C2D A;  4RQ2 A;  5DB9 A;  3Q8M A;  4UAW A;  1QSS A;  3BDP A;  4K4G A;  3PW4 A;  5KFW A;  4YCX A;  1TVA A;  2AU0 A;  3UQ0 A;  4IR1 A;  4YR3 A;  3ISB A;  3H8S A;  4PHP A;  4RQ6 A;  3ZDE A;  4P2H A;  2XCP A;  3EPI A;  3JPS A;  3GIK A;  3ZD8 A;  3RB4 A;  3MDA A;  3C2L A;  3C2M A;  4DFM A;  5HP4 A;  4IRK A;  3PW0 A;  1B43 A;  1XU4 A;  4M6W B;  1QSL A;  3RJE A;  7ICU A;  4IR9 A;  7ICS A;  2HHQ A;  2W9M A;  1UT5 A;  1ZQY A;  1BPE A;  5KG0 A;  4RPX A;  5CA7 A;  2FMS A;  5DB8 A;  4TUQ A;  5IIN A;  2KTQ A;  1T7P A;  4DL3 A;  2V4Q A;  3ETL A;  4DO9 A;  2XY6 A;  2GWS A;  2IMW P;  9ICF A;  2PFP A;  4R8U B;  4YVZ A;  2FPL A;  3GIM A;  2RDI A;  3RB3 A;  4J9O A;  1IXR A;  1UA0 A;  2R8G A;  4RQ0 A;  1HJP A;  3MR2 A;  5TZV A;  3RRG A;  3ZDC A;  1BPD A;  5KFP A;  1KDH A;  4YMN A;  4UQG A;  4RZR A;  2IHN A;  2MUT B;  5DBC A;  4ECR A;  4ED7 A;  5DG7 A;  3RBD A;  4FBT A;  4I2E A;  4F8R A;  1TV9 A;  2NRW A;  4NXZ A;  5J0W A;  3PR5 B;  2V9W A;  5KT5 A;  8ICU A;  3EYZ A;  8ICI A;  3H8J A;  1ZQU A;  3HWT A;  5KFK A;  7ICT A;  2BGW A;  5EWF A;  5J2F A;  5DLG A;  1ZQT A;  2FLL A;  1NJZ A;  2HHT A;  1BPY A;  4O5K A;  3THV A;  5KFY A;  4I2F A;  4KLQ A;  4ECU A;  3V7K A;  4DL2 A;  2M9N A;  3T5K A;  2HW3 A;  5CR0 A;  5IIO A;  5J2A A;  1KTQ A;  4ED3 A;  1S10 A;  1RYS A;  3JPT A;  4RPY A;  4Q8F A;  1RXW A;  5KFM A;  3TAP A;  1U47 A;  4O3S A;  4IQU A;  5BPC A;  2HHU A;  1NOM A;  2WTF A;  4O5C A;  3C1Y A;  4CCH A;  3EW9 A;  4I2B A;  5IIM A;  4QWC A;  1S77 D;  2DPI A;  5JUM A;  4YFK A;  4PH5 A;  1CEZ A;  9ICP A;  8ICG A;  3KHG A;  4ELT A;  1S76 D;  2ZUB A;  1ZQZ A;  4UB1 A;  3C5G A;  3GV5 B;  4BGD A;  5J0U A;  5J2I A;  4F5Q A;  4MEY A;  5J0O A;  3MDC A;  4DSE A;  2ATL A;  1BPZ A;  2FLP A;  4QZ9 A;  3PX0 A;  1ZQB A;  4J9P A;  4I2A A;  4KLI A;  5L1I A;  8ICC A;  4RUC A;  4ECW A;  2J6S A;  4NM2 A;  4J9S A;  5KFJ A;  2W9C A;  4F4X A;  1KEJ A;  4F92 B;  3TQ1 A;  4QWA A;  3LK9 A;  8ICO A;  1V9P A;  2AJQ A;  9ICH A;  4DSF A;  2VA8 A;  3AU6 A;  9ICV A;  7ICO A;  1T3N A;  1ZQH A;  4DL7 A;  3PV8 A;  3BJY A;  5KG1 A;  2W9B B;  3MFH A;  4DOB A;  3HPO A;  4KLO A;  4IQT A;  3PVX A;  1NK5 A;  4RU9 A;  1A77 A;  1Z00 A;  4R65 A;  3TFR A;  5KFU A;  3HP6 A;  9ICR A;  3NTU A;  2UVV A;  2BPG A;  4J9N A;  8ICH A;  5HHH A;  4YR0 A;  2B21 A;  4F2S A;  4JWM A;  3RJJ A;  1Z00 B;  5J2K A;  3FDS A;  1Y88 A;  2JEI A;  3TFS A;  1D9D A;  1QTM A;  4DQR A;  3C1Z A;  2UVU A;  9ICS A;  2W8L A;  2ASJ A;  3ORY A;  4NLG A;  3UXP A;  2LYH A;  2JZB B;  4RNN A;  3SYZ A;  3SI8 A;  5F9L A;  5CHG A;  4ED8 A;  1NK7 A;  3HW8 A;  1BPB A;  4I2D A;  1ZQJ A;  3OHA A;  1NK9 A;  5KFB A;  4B9V A;  8ICF A;  1K1S A;  2BHN A;  3JPP A;  1TFR A;  4YG2 A;  1JXL A;  1SL0 A;  4BDP A;  2BDP A;  5J0P A;  3M8R A;  2ZUC A;  3QZ8 A;  7ICJ A;  4QZA A;  3GIJ A;  4P4M A;  4EYI B;  4DFK A;  4QZ8 A;  5KFV A;  3RRH A;  5KG5 A;  4Z6D A;  3JPN A;  4PGX A;  4MEX A;  4EBC A;  3AUO A;  2DPJ A;  1B22 A;  5D4B A;  5KFG A;  2ALZ A;  1EXN A;  1TAQ A;  3V7J A;  4UBC A;  1A76 A;  1D8L A;  1T4G A;  4IQW A;  3ISC A;  4Z6C A;  2BQ3 A;  8ICA A;  4I2C A;  5KFH A;  1LB2 B;  4EZ6 A;  5KFL A;  4RQ5 A;  4MF8 A;  2XY7 A;  1S0V A;  3N4M B;  7ICE A;  3G6V A;  2KZ3 A;  1U49 A;  4JUZ A;  9ICB A;  2PFQ A;  3H7I A;  3QEB Z;  3OGU A;  4GXJ A;  7ICF A;  5KFS A;  5KT3 A;  4ZH4 A;  2KZZ A;  5DBA A;  4QZI A;  2BCS A;  3TAR A;  4DSK A;  2IHM A;  5DBB A;  1KFS A;  3GII A;  3T5J A;  2C2E A;  2DFL A;  4J9L A;  4IQV A;  4GXK A;  5KFA A;  2AGP A;  4TUS A;  2V4R A;  2XCA A;  1HUO A;  3RH6 A;  4NY8 A;  1ZQR A;  1XS9 D;  4F5P A;  4DL5 A;  5DKW A;  9ICW A;  5L1L A;  5KFC A;  3C5F A;  8ICZ A;  3NGD A;  3MR3 A;  5DDY A;  4DQI A;  4TQR A;  3SZ2 A;  5IIJ A;  3C23 A;  5KFO A;  1SL2 A;  3M8S A;  5DDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...