3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
b'AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
molecule tags Hydrolase/hydrolase inhibitor
source organism Escherichia coli
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
2BWVA 2BHBA 4OOKA 4IKRA 4ZNGA 3D27A 2MATA 4HXXA 4ZWOA 3MATA 2GU4A 4IKTA 3L7GA 2EA2A 4JUQA 3MX6A 1QXYA 5CE6A 2B3LA 2GGBA 4U71A 2DFIA 2V3YA 2EVMA 1BN5A 1KQ9A 2BH3A 4FKCA 1WKMA 4S01A 5FCFA 2GZ5A 4ZWUA 4IF7A 4FO7A 1C22A 1YVMA 4IKSA 4R60A 2BWTA 5JI6A 4KM3A 1WN1A 4IDYA 4S00A 5JHUA 4IU6A 2B3KA 3CB6A 2EA4A 2BWWA 4A6WA 1A16A 2Q95A 3PKDA 3PKCA 4ZWPA 2P9AA 2IW2A 1YJ3A 2Q96A 2Q92A 3IU9A 3MR1A 1B59A 2BWXA 2GU7A 2EVCA 5JFRA 1B6AA 3CB5A 4IECA 1M35A 4U6EA 2GU6A 1KP0A 1N51A 1XNZA 2B3HA 3TB5A 5FCHA 2HOWA 2ADUA 5CNXA 2BN7A 4FUKA 4U69A 3FMRA 4A6VA 1XGSA 3BITA 1C21A 1XGMA 2GG8A 3PKAA 4FLLA 1XGNA 1WBQA 3IG4A 4PNCA 4RZYA 2P99A 2GG7A 2V3XA 1QZYA 1KQ0A 2OAZA 4U76A 3BIPA 4U6ZA 1PV9A 1O0XA 4RZZA 4IKUA 4B28A 1XGOA 3PKBA 1Y1NA 2NQ6A 2GA2A 5E5BA 4MATA 2GG3A 2ZSGA 1WLRA 4S2TP 4FLJA 3L24A 2GU5A 4U70A 3TAVA 2V6CA 1R5HA 1C23A 1QXWA 2BWUA 2GG9A 1WL9A 2GGCA 3FMQA 1YW7A 4EGEA 2GG2A 2OKNA 1BOAA 2BB7A 1JAWA 2GG0A 3Q6DA 3FM3A 3CTZA 5CDLA 4U73A 4S2RP 1C27A 3IU8A 3S6BA 2Q93A 5D6FA 1CHMA 3IU7A 2BHDA 1C24A 1W2MA 4QR8A 2NQ7A 2Q94A 4RGZ1 4Z7MA 3RVAA 5CDVA 4U6JA 5CLSA 2GG5A 2Q8KA 4U6CA 3RORA 2BHAA 1W7VA 2G6PA 2P98A 4U6WA 2EVOA 1QXZA 1WL6A 1YW8A 4FLIA 4IPAA 3BIQA 5CDEA 2BWSA 1WY2A 2V3ZA 5D6EA 1R5GA 4FLKA 2GTXA 1MATA 5CIKA 2BHCA 4FO8A 3PKEA 4U1BA 2BWYA 4U75A 1YW9A 1R58A 4PV4A
chains in the Genus database with same CATH superfamily
2BWVA 2BHBA 4OOKA 4IKRA 4ZNGA 3D27A 2MATA 4HXXA 4ZWOA 3MATA 2GU4A 4IKTA 3L7GA 2EA2A 4JUQA 3MX6A 1QXYA 5CE6A 2B3LA 2GGBA 4U71A 2DFIA 2V3YA 2EVMA 1BN5A 1KQ9A 2BH3A 4FKCA 1WKMA 4S01A 5FCFA 2GZ5A 4ZWUA 4IF7A 4FO7A 1C22A 1YVMA 4IKSA 4R60A 2BWTA 5JI6A 4KM3A 1WN1A 4IDYA 4S00A 5JHUA 4IU6A 2B3KA 3CB6A 2EA4A 2BWWA 4A6WA 1A16A 2Q95A 3PKDA 3PKCA 4ZWPA 2P9AA 2IW2A 1YJ3A 2Q96A 2Q92A 3IU9A 3MR1A 1B59A 2BWXA 2GU7A 2EVCA 5JFRA 1B6AA 3CB5A 4IECA 1M35A 4U6EA 2GU6A 1KP0A 1N51A 1XNZA 2B3HA 3TB5A 5FCHA 2HOWA 2ADUA 5CNXA 2BN7A 4FUKA 4U69A 3FMRA 4A6VA 1XGSA 3BITA 1C21A 1XGMA 2GG8A 3PKAA 4FLLA 1XGNA 1WBQA 3IG4A 4PNCA 4RZYA 2P99A 2GG7A 2V3XA 1QZYA 1KQ0A 2OAZA 4U76A 3BIPA 4U6ZA 1PV9A 1O0XA 4RZZA 4IKUA 4B28A 1XGOA 3PKBA 1Y1NA 2NQ6A 2GA2A 5E5BA 4MATA 2GG3A 2ZSGA 1WLRA 4S2TP 4FLJA 3L24A 2GU5A 4U70A 3TAVA 2V6CA 1R5HA 1C23A 1QXWA 2BWUA 2GG9A 1WL9A 2GGCA 3FMQA 1YW7A 4EGEA 2GG2A 2OKNA 1BOAA 2BB7A 1JAWA 2GG0A 3Q6DA 3FM3A 3CTZA 5CDLA 4U73A 4S2RP 1C27A 3IU8A 3S6BA 2Q93A 5D6FA 1CHMA 3IU7A 2BHDA 1C24A 1W2MA 4QR8A 2NQ7A 2Q94A 4RGZ1 4Z7MA 3RVAA 5CDVA 4U6JA 5CLSA 2GG5A 2Q8KA 4U6CA 3RORA 2BHAA 1W7VA 2G6PA 2P98A 4U6WA 2EVOA 1QXZA 1WL6A 1YW8A 4FLIA 4IPAA 3BIQA 5CDEA 2BWSA 1WY2A 2V3ZA 5D6EA 1R5GA 4FLKA 2GTXA 1MATA 5CIKA 2BHCA 4FO8A 3PKEA 4U1BA 2BWYA 4U75A 1YW9A 1R58A 4PV4A
chains in the Genus database with same CATH topology
2BWVA 2BHBA 4OOKA 4IKRA 4ZNGA 3D27A 2MATA 4HXXA 4ZWOA 3MATA 2GU4A 4IKTA 3L7GA 2EA2A 4JUQA 3MX6A 1QXYA 5CE6A 2B3LA 2GGBA 4U71A 2DFIA 2V3YA 2EVMA 1BN5A 1KQ9A 2BH3A 4FKCA 1WKMA 4S01A 5FCFA 2GZ5A 4ZWUA 4IF7A 4FO7A 1C22A 1YVMA 4IKSA 4R60A 2BWTA 5JI6A 4KM3A 1WN1A 4IDYA 4S00A 5JHUA 4IU6A 2B3KA 3CB6A 2EA4A 2BWWA 4A6WA 1A16A 2Q95A 3PKDA 3PKCA 4ZWPA 2P9AA 2IW2A 1YJ3A 2Q96A 2Q92A 3IU9A 3MR1A 1B59A 2BWXA 2GU7A 2EVCA 5JFRA 1B6AA 3CB5A 4IECA 1M35A 4U6EA 2GU6A 1KP0A 1N51A 1XNZA 2B3HA 3TB5A 5FCHA 2HOWA 2ADUA 5CNXA 2BN7A 4FUKA 4U69A 3FMRA 4A6VA 1XGSA 3BITA 1C21A 1XGMA 2GG8A 3PKAA 4FLLA 1XGNA 1WBQA 3IG4A 4PNCA 4RZYA 2P99A 2GG7A 2V3XA 1QZYA 1KQ0A 2OAZA 4U76A 3BIPA 4U6ZA 1PV9A 1O0XA 4RZZA 4IKUA 4B28A 1XGOA 3PKBA 1Y1NA 2NQ6A 2GA2A 5E5BA 4MATA 2GG3A 2ZSGA 1WLRA 4S2TP 4FLJA 3L24A 2GU5A 4U70A 3TAVA 2V6CA 1R5HA 1C23A 1QXWA 2BWUA 2GG9A 1WL9A 2GGCA 3FMQA 1YW7A 4EGEA 2GG2A 2OKNA 1BOAA 2BB7A 1JAWA 2GG0A 3Q6DA 3FM3A 3CTZA 5CDLA 4U73A 4S2RP 1C27A 3IU8A 3S6BA 2Q93A 5D6FA 1CHMA 3IU7A 2BHDA 1C24A 1W2MA 4QR8A 2NQ7A 2Q94A 4RGZ1 4Z7MA 3RVAA 5CDVA 4U6JA 5CLSA 2GG5A 2Q8KA 4U6CA 3RORA 2BHAA 1W7VA 2G6PA 2P98A 4U6WA 2EVOA 1QXZA 1WL6A 1YW8A 4FLIA 4IPAA 3BIQA 5CDEA 2BWSA 1WY2A 2V3ZA 5D6EA 1R5GA 4FLKA 2GTXA 1MATA 5CIKA 2BHCA 4FO8A 3PKEA 4U1BA 2BWYA 4U75A 1YW9A 1R58A 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWV A;  2BHB A;  4OOK A;  4IKR A;  4ZNG A;  3D27 A;  2MAT A;  4HXX A;  4ZWO A;  3MAT A;  2GU4 A;  4IKT A;  3L7G A;  2EA2 A;  4JUQ A;  3MX6 A;  1QXY A;  5CE6 A;  2B3L A;  2GGB A;  4U71 A;  2DFI A;  2V3Y A;  2EVM A;  1BN5 A;  1KQ9 A;  2BH3 A;  4FKC A;  1WKM A;  4S01 A;  5FCF A;  2GZ5 A;  4ZWU A;  4IF7 A;  4FO7 A;  1C22 A;  1YVM A;  4IKS A;  4R60 A;  2BWT A;  5JI6 A;  4KM3 A;  1WN1 A;  4IDY A;  4S00 A;  5JHU A;  4IU6 A;  2B3K A;  3CB6 A;  2EA4 A;  2BWW A;  4A6W A;  1A16 A;  2Q95 A;  3PKD A;  3PKC A;  4ZWP A;  2P9A A;  2IW2 A;  1YJ3 A;  2Q96 A;  2Q92 A;  3IU9 A;  3MR1 A;  1B59 A;  2BWX A;  2GU7 A;  2EVC A;  5JFR A;  1B6A A;  3CB5 A;  4IEC A;  1M35 A;  4U6E A;  2GU6 A;  1KP0 A;  1N51 A;  1XNZ A;  2B3H A;  3TB5 A;  5FCH A;  2HOW A;  2ADU A;  5CNX A;  2BN7 A;  4FUK A;  4U69 A;  3FMR A;  4A6V A;  1XGS A;  3BIT A;  1C21 A;  1XGM A;  2GG8 A;  3PKA A;  4FLL A;  1XGN A;  1WBQ A;  3IG4 A;  4PNC A;  4RZY A;  2P99 A;  2GG7 A;  2V3X A;  1QZY A;  1KQ0 A;  2OAZ A;  4U76 A;  3BIP A;  4U6Z A;  1PV9 A;  1O0X A;  4RZZ A;  4IKU A;  4B28 A;  1XGO A;  3PKB A;  1Y1N A;  2NQ6 A;  2GA2 A;  5E5B A;  4MAT A;  2GG3 A;  2ZSG A;  1WLR A;  4S2T P;  4FLJ A;  3L24 A;  2GU5 A;  4U70 A;  3TAV A;  2V6C A;  1R5H A;  1C23 A;  1QXW A;  2BWU A;  2GG9 A;  1WL9 A;  2GGC A;  3FMQ A;  1YW7 A;  4EGE A;  2GG2 A;  2OKN A;  1BOA A;  2BB7 A;  1JAW A;  2GG0 A;  3Q6D A;  3FM3 A;  3CTZ A;  5CDL A;  4U73 A;  4S2R P;  1C27 A;  3IU8 A;  3S6B A;  2Q93 A;  5D6F A;  1CHM A;  3IU7 A;  2BHD A;  1C24 A;  1W2M A;  4QR8 A;  2NQ7 A;  2Q94 A;  4RGZ 1;  4Z7M A;  3RVA A;  5CDV A;  4U6J A;  5CLS A;  2GG5 A;  2Q8K A;  4U6C A;  3ROR A;  2BHA A;  1W7V A;  2G6P A;  2P98 A;  4U6W A;  2EVO A;  1QXZ A;  1WL6 A;  1YW8 A;  4FLI A;  4IPA A;  3BIQ A;  5CDE A;  2BWS A;  1WY2 A;  2V3Z A;  5D6E A;  1R5G A;  4FLK A;  2GTX A;  1MAT A;  5CIK A;  2BHC A;  4FO8 A;  3PKE A;  4U1B A;  2BWY A;  4U75 A;  1YW9 A;  1R58 A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 2BWV A;  2BHB A;  4OOK A;  4IKR A;  4ZNG A;  3D27 A;  2MAT A;  4HXX A;  4ZWO A;  3MAT A;  2GU4 A;  4IKT A;  3L7G A;  2EA2 A;  4JUQ A;  3MX6 A;  1QXY A;  5CE6 A;  2B3L A;  2GGB A;  4U71 A;  2DFI A;  2V3Y A;  2EVM A;  1BN5 A;  1KQ9 A;  2BH3 A;  4FKC A;  1WKM A;  4S01 A;  5FCF A;  2GZ5 A;  4ZWU A;  4IF7 A;  4FO7 A;  1C22 A;  1YVM A;  4IKS A;  4R60 A;  2BWT A;  5JI6 A;  4KM3 A;  1WN1 A;  4IDY A;  4S00 A;  5JHU A;  4IU6 A;  2B3K A;  3CB6 A;  2EA4 A;  2BWW A;  4A6W A;  1A16 A;  2Q95 A;  3PKD A;  3PKC A;  4ZWP A;  2P9A A;  2IW2 A;  1YJ3 A;  2Q96 A;  2Q92 A;  3IU9 A;  3MR1 A;  1B59 A;  2BWX A;  2GU7 A;  2EVC A;  5JFR A;  1B6A A;  3CB5 A;  4IEC A;  1M35 A;  4U6E A;  2GU6 A;  1KP0 A;  1N51 A;  1XNZ A;  2B3H A;  3TB5 A;  5FCH A;  2HOW A;  2ADU A;  5CNX A;  2BN7 A;  4FUK A;  4U69 A;  3FMR A;  4A6V A;  1XGS A;  3BIT A;  1C21 A;  1XGM A;  2GG8 A;  3PKA A;  4FLL A;  1XGN A;  1WBQ A;  3IG4 A;  4PNC A;  4RZY A;  2P99 A;  2GG7 A;  2V3X A;  1QZY A;  1KQ0 A;  2OAZ A;  4U76 A;  3BIP A;  4U6Z A;  1PV9 A;  1O0X A;  4RZZ A;  4IKU A;  4B28 A;  1XGO A;  3PKB A;  1Y1N A;  2NQ6 A;  2GA2 A;  5E5B A;  4MAT A;  2GG3 A;  2ZSG A;  1WLR A;  4S2T P;  4FLJ A;  3L24 A;  2GU5 A;  4U70 A;  3TAV A;  2V6C A;  1R5H A;  1C23 A;  1QXW A;  2BWU A;  2GG9 A;  1WL9 A;  2GGC A;  3FMQ A;  1YW7 A;  4EGE A;  2GG2 A;  2OKN A;  1BOA A;  2BB7 A;  1JAW A;  2GG0 A;  3Q6D A;  3FM3 A;  3CTZ A;  5CDL A;  4U73 A;  4S2R P;  1C27 A;  3IU8 A;  3S6B A;  2Q93 A;  5D6F A;  1CHM A;  3IU7 A;  2BHD A;  1C24 A;  1W2M A;  4QR8 A;  2NQ7 A;  2Q94 A;  4RGZ 1;  4Z7M A;  3RVA A;  5CDV A;  4U6J A;  5CLS A;  2GG5 A;  2Q8K A;  4U6C A;  3ROR A;  2BHA A;  1W7V A;  2G6P A;  2P98 A;  4U6W A;  2EVO A;  1QXZ A;  1WL6 A;  1YW8 A;  4FLI A;  4IPA A;  3BIQ A;  5CDE A;  2BWS A;  1WY2 A;  2V3Z A;  5D6E A;  1R5G A;  4FLK A;  2GTX A;  1MAT A;  5CIK A;  2BHC A;  4FO8 A;  3PKE A;  4U1B A;  2BWY A;  4U75 A;  1YW9 A;  1R58 A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 2BWV A;  2BHB A;  4OOK A;  4IKR A;  4ZNG A;  3D27 A;  2MAT A;  4HXX A;  4ZWO A;  3MAT A;  2GU4 A;  4IKT A;  3L7G A;  2EA2 A;  4JUQ A;  3MX6 A;  1QXY A;  5CE6 A;  2B3L A;  2GGB A;  4U71 A;  2DFI A;  2V3Y A;  2EVM A;  1BN5 A;  1KQ9 A;  2BH3 A;  4FKC A;  1WKM A;  4S01 A;  5FCF A;  2GZ5 A;  4ZWU A;  4IF7 A;  4FO7 A;  1C22 A;  1YVM A;  4IKS A;  4R60 A;  2BWT A;  5JI6 A;  4KM3 A;  1WN1 A;  4IDY A;  4S00 A;  5JHU A;  4IU6 A;  2B3K A;  3CB6 A;  2EA4 A;  2BWW A;  4A6W A;  1A16 A;  2Q95 A;  3PKD A;  3PKC A;  4ZWP A;  2P9A A;  2IW2 A;  1YJ3 A;  2Q96 A;  2Q92 A;  3IU9 A;  3MR1 A;  1B59 A;  2BWX A;  2GU7 A;  2EVC A;  5JFR A;  1B6A A;  3CB5 A;  4IEC A;  1M35 A;  4U6E A;  2GU6 A;  1KP0 A;  1N51 A;  1XNZ A;  2B3H A;  3TB5 A;  5FCH A;  2HOW A;  2ADU A;  5CNX A;  2BN7 A;  4FUK A;  4U69 A;  3FMR A;  4A6V A;  1XGS A;  3BIT A;  1C21 A;  1XGM A;  2GG8 A;  3PKA A;  4FLL A;  1XGN A;  1WBQ A;  3IG4 A;  4PNC A;  4RZY A;  2P99 A;  2GG7 A;  2V3X A;  1QZY A;  1KQ0 A;  2OAZ A;  4U76 A;  3BIP A;  4U6Z A;  1PV9 A;  1O0X A;  4RZZ A;  4IKU A;  4B28 A;  1XGO A;  3PKB A;  1Y1N A;  2NQ6 A;  2GA2 A;  5E5B A;  4MAT A;  2GG3 A;  2ZSG A;  1WLR A;  4S2T P;  4FLJ A;  3L24 A;  2GU5 A;  4U70 A;  3TAV A;  2V6C A;  1R5H A;  1C23 A;  1QXW A;  2BWU A;  2GG9 A;  1WL9 A;  2GGC A;  3FMQ A;  1YW7 A;  4EGE A;  2GG2 A;  2OKN A;  1BOA A;  2BB7 A;  1JAW A;  2GG0 A;  3Q6D A;  3FM3 A;  3CTZ A;  5CDL A;  4U73 A;  4S2R P;  1C27 A;  3IU8 A;  3S6B A;  2Q93 A;  5D6F A;  1CHM A;  3IU7 A;  2BHD A;  1C24 A;  1W2M A;  4QR8 A;  2NQ7 A;  2Q94 A;  4RGZ 1;  4Z7M A;  3RVA A;  5CDV A;  4U6J A;  5CLS A;  2GG5 A;  2Q8K A;  4U6C A;  3ROR A;  2BHA A;  1W7V A;  2G6P A;  2P98 A;  4U6W A;  2EVO A;  1QXZ A;  1WL6 A;  1YW8 A;  4FLI A;  4IPA A;  3BIQ A;  5CDE A;  2BWS A;  1WY2 A;  2V3Z A;  5D6E A;  1R5G A;  4FLK A;  2GTX A;  1MAT A;  5CIK A;  2BHC A;  4FO8 A;  3PKE A;  4U1B A;  2BWY A;  4U75 A;  1YW9 A;  1R58 A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...