3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
3Q6DA 4KM3A 5FCFA 2B3HA 2BWWA 4A6VA 2GZ5A 4RZYA 4RGZ1 1YJ3A 1C21A 4EGEA 2OAZA 2Q95A 3CB6A 2OKNA 1WBQA 3L24A 4IF7A 4A6WA 5CLSA 5JHUA 1QXZA 1R5GA 3PKEA 1XGNA 3MATA 5JFRA 4MATA 3CB5A 1KQ0A 1JAWA 2MATA 1CHMA 2GA2A 1O0XA 3TB5A 2BWSA 1XGOA 3RVAA 4ZWPA 1B6AA 5CNXA 4IECA 1W7VA 2BWYA 2Q96A 3PKDA 5CDLA 3IU9A 1PV9A 4RZZA 4HXXA 1XGSA 2G6PA 2GU4A 4ZWOA 1C22A 1C27A 2GU5A 1M35A 2NQ7A 3FMRA 1KP0A 1YW7A 4R60A 4U69A 5D6FA 1MATA 1R58A 2ZSGA 2V6CA 2BN7A 1XGMA 4FUKA 2GU7A 4FLIA 4S00A 1YW8A 1B59A 1WL6A 3BITA 2EVMA 2P9AA 3IU8A 1R5HA 1WKMA 2Q94A 3BIPA 1C24A 1YVMA 2Q93A 4PV4A 2GG7A 2Q92A 4S2TP 2V3ZA 4IKRA 4Z7MA 5D6EA 2B3LA 4FLLA 2BHAA 4U6JA 4U6WA 4ZWUA 2BWTA 3IU7A 2B3KA 3PKAA 2BHDA 4S2RP 4U75A 4U6CA 4JUQA 2BWVA 1YW9A 4OOKA 3MR1A 1QXWA 3CTZA 4FO8A 2EVOA 3TAVA 2Q8KA 3PKCA 2GGCA 2EA2A 1N51A 4U70A 5JI6A 1WN1A 2HOWA 4QR8A 4U6EA 5CIKA 2GG0A 3IG4A 4U1BA 4B28A 1WL9A 1A16A 2GU6A 4U71A 3S6BA 1BN5A 1WY2A 2BHBA 2P99A 2P98A 4IKTA 1W2MA 2GGBA 1C23A 5CE6A 2GG5A 3BIQA 3MX6A 2V3YA 1Y1NA 4IPAA 2BH3A 4FLJA 1BOAA 5E5BA 2EVCA 2GG3A 1QXYA 2GTXA 4U6ZA 1KQ9A 4ZNGA 4IDYA 1XNZA 2DFIA 2EA4A 4S01A 3PKBA 2BWXA 3FMQA 4FLKA 1WLRA 4IU6A 3L7GA 3FM3A 2V3XA 4IKSA 2GG9A 2BHCA 4U76A 4U73A 2GG8A 3D27A 2BB7A 2BWUA 2IW2A 4FKCA 4IKUA 3RORA 4FO7A 5CDEA 2NQ6A 5CDVA 2GG2A 4PNCA 5FCHA 1QZYA 2ADUA
chains in the Genus database with same CATH superfamily
3Q6DA 4KM3A 5FCFA 2B3HA 2BWWA 4A6VA 2GZ5A 4RZYA 4RGZ1 1YJ3A 1C21A 4EGEA 2OAZA 2Q95A 3CB6A 2OKNA 1WBQA 3L24A 4IF7A 4A6WA 5CLSA 5JHUA 1QXZA 1R5GA 3PKEA 1XGNA 3MATA 5JFRA 4MATA 3CB5A 1KQ0A 1JAWA 2MATA 1CHMA 2GA2A 1O0XA 3TB5A 2BWSA 1XGOA 3RVAA 4ZWPA 1B6AA 5CNXA 4IECA 1W7VA 2BWYA 2Q96A 3PKDA 5CDLA 3IU9A 1PV9A 4RZZA 4HXXA 1XGSA 2G6PA 2GU4A 4ZWOA 1C22A 1C27A 2GU5A 1M35A 2NQ7A 3FMRA 1KP0A 1YW7A 4R60A 4U69A 5D6FA 1MATA 1R58A 2ZSGA 2V6CA 2BN7A 1XGMA 4FUKA 2GU7A 4FLIA 4S00A 1YW8A 1B59A 1WL6A 3BITA 2EVMA 2P9AA 3IU8A 1R5HA 1WKMA 2Q94A 3BIPA 1C24A 1YVMA 2Q93A 4PV4A 2GG7A 2Q92A 4S2TP 2V3ZA 4IKRA 4Z7MA 5D6EA 2B3LA 4FLLA 2BHAA 4U6JA 4U6WA 4ZWUA 2BWTA 3IU7A 2B3KA 3PKAA 2BHDA 4S2RP 4U75A 4U6CA 4JUQA 2BWVA 1YW9A 4OOKA 3MR1A 1QXWA 3CTZA 4FO8A 2EVOA 3TAVA 2Q8KA 3PKCA 2GGCA 2EA2A 1N51A 4U70A 5JI6A 1WN1A 2HOWA 4QR8A 4U6EA 5CIKA 2GG0A 3IG4A 4U1BA 4B28A 1WL9A 1A16A 2GU6A 4U71A 3S6BA 1BN5A 1WY2A 2BHBA 2P99A 2P98A 4IKTA 1W2MA 2GGBA 1C23A 5CE6A 2GG5A 3BIQA 3MX6A 2V3YA 1Y1NA 4IPAA 2BH3A 4FLJA 1BOAA 5E5BA 2EVCA 2GG3A 1QXYA 2GTXA 4U6ZA 1KQ9A 4ZNGA 4IDYA 1XNZA 2DFIA 2EA4A 4S01A 3PKBA 2BWXA 3FMQA 4FLKA 1WLRA 4IU6A 3L7GA 3FM3A 2V3XA 4IKSA 2GG9A 2BHCA 4U76A 4U73A 2GG8A 3D27A 2BB7A 2BWUA 2IW2A 4FKCA 4IKUA 3RORA 4FO7A 5CDEA 2NQ6A 5CDVA 2GG2A 4PNCA 5FCHA 1QZYA 2ADUA
chains in the Genus database with same CATH topology
3Q6DA 4KM3A 5FCFA 2B3HA 2BWWA 4A6VA 2GZ5A 4RZYA 4RGZ1 1YJ3A 1C21A 4EGEA 2OAZA 2Q95A 3CB6A 2OKNA 1WBQA 3L24A 4IF7A 4A6WA 5CLSA 5JHUA 1QXZA 1R5GA 3PKEA 1XGNA 3MATA 5JFRA 4MATA 3CB5A 1KQ0A 1JAWA 2MATA 1CHMA 2GA2A 1O0XA 3TB5A 2BWSA 1XGOA 3RVAA 4ZWPA 1B6AA 5CNXA 4IECA 1W7VA 2BWYA 2Q96A 3PKDA 5CDLA 3IU9A 1PV9A 4RZZA 4HXXA 1XGSA 2G6PA 2GU4A 4ZWOA 1C22A 1C27A 2GU5A 1M35A 2NQ7A 3FMRA 1KP0A 1YW7A 4R60A 4U69A 5D6FA 1MATA 1R58A 2ZSGA 2V6CA 2BN7A 1XGMA 4FUKA 2GU7A 4FLIA 4S00A 1YW8A 1B59A 1WL6A 3BITA 2EVMA 2P9AA 3IU8A 1R5HA 1WKMA 2Q94A 3BIPA 1C24A 1YVMA 2Q93A 4PV4A 2GG7A 2Q92A 4S2TP 2V3ZA 4IKRA 4Z7MA 5D6EA 2B3LA 4FLLA 2BHAA 4U6JA 4U6WA 4ZWUA 2BWTA 3IU7A 2B3KA 3PKAA 2BHDA 4S2RP 4U75A 4U6CA 4JUQA 2BWVA 1YW9A 4OOKA 3MR1A 1QXWA 3CTZA 4FO8A 2EVOA 3TAVA 2Q8KA 3PKCA 2GGCA 2EA2A 1N51A 4U70A 5JI6A 1WN1A 2HOWA 4QR8A 4U6EA 5CIKA 2GG0A 3IG4A 4U1BA 4B28A 1WL9A 1A16A 2GU6A 4U71A 3S6BA 1BN5A 1WY2A 2BHBA 2P99A 2P98A 4IKTA 1W2MA 2GGBA 1C23A 5CE6A 2GG5A 3BIQA 3MX6A 2V3YA 1Y1NA 4IPAA 2BH3A 4FLJA 1BOAA 5E5BA 2EVCA 2GG3A 1QXYA 2GTXA 4U6ZA 1KQ9A 4ZNGA 4IDYA 1XNZA 2DFIA 2EA4A 4S01A 3PKBA 2BWXA 3FMQA 4FLKA 1WLRA 4IU6A 3L7GA 3FM3A 2V3XA 4IKSA 2GG9A 2BHCA 4U76A 4U73A 2GG8A 3D27A 2BB7A 2BWUA 2IW2A 4FKCA 4IKUA 3RORA 4FO7A 5CDEA 2NQ6A 5CDVA 2GG2A 4PNCA 5FCHA 1QZYA 2ADUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6D A;  4KM3 A;  5FCF A;  2B3H A;  2BWW A;  4A6V A;  2GZ5 A;  4RZY A;  4RGZ 1;  1YJ3 A;  1C21 A;  4EGE A;  2OAZ A;  2Q95 A;  3CB6 A;  2OKN A;  1WBQ A;  3L24 A;  4IF7 A;  4A6W A;  5CLS A;  5JHU A;  1QXZ A;  1R5G A;  3PKE A;  1XGN A;  3MAT A;  5JFR A;  4MAT A;  3CB5 A;  1KQ0 A;  1JAW A;  2MAT A;  1CHM A;  2GA2 A;  1O0X A;  3TB5 A;  2BWS A;  1XGO A;  3RVA A;  4ZWP A;  1B6A A;  5CNX A;  4IEC A;  1W7V A;  2BWY A;  2Q96 A;  3PKD A;  5CDL A;  3IU9 A;  1PV9 A;  4RZZ A;  4HXX A;  1XGS A;  2G6P A;  2GU4 A;  4ZWO A;  1C22 A;  1C27 A;  2GU5 A;  1M35 A;  2NQ7 A;  3FMR A;  1KP0 A;  1YW7 A;  4R60 A;  4U69 A;  5D6F A;  1MAT A;  1R58 A;  2ZSG A;  2V6C A;  2BN7 A;  1XGM A;  4FUK A;  2GU7 A;  4FLI A;  4S00 A;  1YW8 A;  1B59 A;  1WL6 A;  3BIT A;  2EVM A;  2P9A A;  3IU8 A;  1R5H A;  1WKM A;  2Q94 A;  3BIP A;  1C24 A;  1YVM A;  2Q93 A;  4PV4 A;  2GG7 A;  2Q92 A;  4S2T P;  2V3Z A;  4IKR A;  4Z7M A;  5D6E A;  2B3L A;  4FLL A;  2BHA A;  4U6J A;  4U6W A;  4ZWU A;  2BWT A;  3IU7 A;  2B3K A;  3PKA A;  2BHD A;  4S2R P;  4U75 A;  4U6C A;  4JUQ A;  2BWV A;  1YW9 A;  4OOK A;  3MR1 A;  1QXW A;  3CTZ A;  4FO8 A;  2EVO A;  3TAV A;  2Q8K A;  3PKC A;  2GGC A;  2EA2 A;  1N51 A;  4U70 A;  5JI6 A;  1WN1 A;  2HOW A;  4QR8 A;  4U6E A;  5CIK A;  2GG0 A;  3IG4 A;  4U1B A;  4B28 A;  1WL9 A;  1A16 A;  2GU6 A;  4U71 A;  3S6B A;  1BN5 A;  1WY2 A;  2BHB A;  2P99 A;  2P98 A;  4IKT A;  1W2M A;  2GGB A;  1C23 A;  5CE6 A;  2GG5 A;  3BIQ A;  3MX6 A;  2V3Y A;  1Y1N A;  4IPA A;  2BH3 A;  4FLJ A;  1BOA A;  5E5B A;  2EVC A;  2GG3 A;  1QXY A;  2GTX A;  4U6Z A;  1KQ9 A;  4ZNG A;  4IDY A;  1XNZ A;  2DFI A;  2EA4 A;  4S01 A;  3PKB A;  2BWX A;  3FMQ A;  4FLK A;  1WLR A;  4IU6 A;  3L7G A;  3FM3 A;  2V3X A;  4IKS A;  2GG9 A;  2BHC A;  4U76 A;  4U73 A;  2GG8 A;  3D27 A;  2BB7 A;  2BWU A;  2IW2 A;  4FKC A;  4IKU A;  3ROR A;  4FO7 A;  5CDE A;  2NQ6 A;  5CDV A;  2GG2 A;  4PNC A;  5FCH A;  1QZY A;  2ADU A; 
#chains in the Genus database with same CATH topology
 3Q6D A;  4KM3 A;  5FCF A;  2B3H A;  2BWW A;  4A6V A;  2GZ5 A;  4RZY A;  4RGZ 1;  1YJ3 A;  1C21 A;  4EGE A;  2OAZ A;  2Q95 A;  3CB6 A;  2OKN A;  1WBQ A;  3L24 A;  4IF7 A;  4A6W A;  5CLS A;  5JHU A;  1QXZ A;  1R5G A;  3PKE A;  1XGN A;  3MAT A;  5JFR A;  4MAT A;  3CB5 A;  1KQ0 A;  1JAW A;  2MAT A;  1CHM A;  2GA2 A;  1O0X A;  3TB5 A;  2BWS A;  1XGO A;  3RVA A;  4ZWP A;  1B6A A;  5CNX A;  4IEC A;  1W7V A;  2BWY A;  2Q96 A;  3PKD A;  5CDL A;  3IU9 A;  1PV9 A;  4RZZ A;  4HXX A;  1XGS A;  2G6P A;  2GU4 A;  4ZWO A;  1C22 A;  1C27 A;  2GU5 A;  1M35 A;  2NQ7 A;  3FMR A;  1KP0 A;  1YW7 A;  4R60 A;  4U69 A;  5D6F A;  1MAT A;  1R58 A;  2ZSG A;  2V6C A;  2BN7 A;  1XGM A;  4FUK A;  2GU7 A;  4FLI A;  4S00 A;  1YW8 A;  1B59 A;  1WL6 A;  3BIT A;  2EVM A;  2P9A A;  3IU8 A;  1R5H A;  1WKM A;  2Q94 A;  3BIP A;  1C24 A;  1YVM A;  2Q93 A;  4PV4 A;  2GG7 A;  2Q92 A;  4S2T P;  2V3Z A;  4IKR A;  4Z7M A;  5D6E A;  2B3L A;  4FLL A;  2BHA A;  4U6J A;  4U6W A;  4ZWU A;  2BWT A;  3IU7 A;  2B3K A;  3PKA A;  2BHD A;  4S2R P;  4U75 A;  4U6C A;  4JUQ A;  2BWV A;  1YW9 A;  4OOK A;  3MR1 A;  1QXW A;  3CTZ A;  4FO8 A;  2EVO A;  3TAV A;  2Q8K A;  3PKC A;  2GGC A;  2EA2 A;  1N51 A;  4U70 A;  5JI6 A;  1WN1 A;  2HOW A;  4QR8 A;  4U6E A;  5CIK A;  2GG0 A;  3IG4 A;  4U1B A;  4B28 A;  1WL9 A;  1A16 A;  2GU6 A;  4U71 A;  3S6B A;  1BN5 A;  1WY2 A;  2BHB A;  2P99 A;  2P98 A;  4IKT A;  1W2M A;  2GGB A;  1C23 A;  5CE6 A;  2GG5 A;  3BIQ A;  3MX6 A;  2V3Y A;  1Y1N A;  4IPA A;  2BH3 A;  4FLJ A;  1BOA A;  5E5B A;  2EVC A;  2GG3 A;  1QXY A;  2GTX A;  4U6Z A;  1KQ9 A;  4ZNG A;  4IDY A;  1XNZ A;  2DFI A;  2EA4 A;  4S01 A;  3PKB A;  2BWX A;  3FMQ A;  4FLK A;  1WLR A;  4IU6 A;  3L7G A;  3FM3 A;  2V3X A;  4IKS A;  2GG9 A;  2BHC A;  4U76 A;  4U73 A;  2GG8 A;  3D27 A;  2BB7 A;  2BWU A;  2IW2 A;  4FKC A;  4IKU A;  3ROR A;  4FO7 A;  5CDE A;  2NQ6 A;  5CDV A;  2GG2 A;  4PNC A;  5FCH A;  1QZY A;  2ADU A; 
#chains in the Genus database with same CATH homology
 3Q6D A;  4KM3 A;  5FCF A;  2B3H A;  2BWW A;  4A6V A;  2GZ5 A;  4RZY A;  4RGZ 1;  1YJ3 A;  1C21 A;  4EGE A;  2OAZ A;  2Q95 A;  3CB6 A;  2OKN A;  1WBQ A;  3L24 A;  4IF7 A;  4A6W A;  5CLS A;  5JHU A;  1QXZ A;  1R5G A;  3PKE A;  1XGN A;  3MAT A;  5JFR A;  4MAT A;  3CB5 A;  1KQ0 A;  1JAW A;  2MAT A;  1CHM A;  2GA2 A;  1O0X A;  3TB5 A;  2BWS A;  1XGO A;  3RVA A;  4ZWP A;  1B6A A;  5CNX A;  4IEC A;  1W7V A;  2BWY A;  2Q96 A;  3PKD A;  5CDL A;  3IU9 A;  1PV9 A;  4RZZ A;  4HXX A;  1XGS A;  2G6P A;  2GU4 A;  4ZWO A;  1C22 A;  1C27 A;  2GU5 A;  1M35 A;  2NQ7 A;  3FMR A;  1KP0 A;  1YW7 A;  4R60 A;  4U69 A;  5D6F A;  1MAT A;  1R58 A;  2ZSG A;  2V6C A;  2BN7 A;  1XGM A;  4FUK A;  2GU7 A;  4FLI A;  4S00 A;  1YW8 A;  1B59 A;  1WL6 A;  3BIT A;  2EVM A;  2P9A A;  3IU8 A;  1R5H A;  1WKM A;  2Q94 A;  3BIP A;  1C24 A;  1YVM A;  2Q93 A;  4PV4 A;  2GG7 A;  2Q92 A;  4S2T P;  2V3Z A;  4IKR A;  4Z7M A;  5D6E A;  2B3L A;  4FLL A;  2BHA A;  4U6J A;  4U6W A;  4ZWU A;  2BWT A;  3IU7 A;  2B3K A;  3PKA A;  2BHD A;  4S2R P;  4U75 A;  4U6C A;  4JUQ A;  2BWV A;  1YW9 A;  4OOK A;  3MR1 A;  1QXW A;  3CTZ A;  4FO8 A;  2EVO A;  3TAV A;  2Q8K A;  3PKC A;  2GGC A;  2EA2 A;  1N51 A;  4U70 A;  5JI6 A;  1WN1 A;  2HOW A;  4QR8 A;  4U6E A;  5CIK A;  2GG0 A;  3IG4 A;  4U1B A;  4B28 A;  1WL9 A;  1A16 A;  2GU6 A;  4U71 A;  3S6B A;  1BN5 A;  1WY2 A;  2BHB A;  2P99 A;  2P98 A;  4IKT A;  1W2M A;  2GGB A;  1C23 A;  5CE6 A;  2GG5 A;  3BIQ A;  3MX6 A;  2V3Y A;  1Y1N A;  4IPA A;  2BH3 A;  4FLJ A;  1BOA A;  5E5B A;  2EVC A;  2GG3 A;  1QXY A;  2GTX A;  4U6Z A;  1KQ9 A;  4ZNG A;  4IDY A;  1XNZ A;  2DFI A;  2EA4 A;  4S01 A;  3PKB A;  2BWX A;  3FMQ A;  4FLK A;  1WLR A;  4IU6 A;  3L7G A;  3FM3 A;  2V3X A;  4IKS A;  2GG9 A;  2BHC A;  4U76 A;  4U73 A;  2GG8 A;  3D27 A;  2BB7 A;  2BWU A;  2IW2 A;  4FKC A;  4IKU A;  3ROR A;  4FO7 A;  5CDE A;  2NQ6 A;  5CDV A;  2GG2 A;  4PNC A;  5FCH A;  1QZY A;  2ADU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...