3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHIONINE AMINOPEPTIDASE
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
2GG8A 2DFIA 2BWXA 4FO7A 2GG0A 5E5BA 1PV9A 3TAVA 4RZYA 3PKBA 2BHCA 4U69A 1YJ3A 3MATA 2IW2A 4FUKA 3FM3A 1YW9A 4IKTA 4RZZA 1R58A 3TB5A 2P9AA 1WLRA 2BWVA 4ZNGA 5FCHA 4S2TP 3S6BA 1Y1NA 3RVAA 2GTXA 4QR8A 5JI6A 4U6ZA 1CHMA 1WY2A 4U6JA 2ADUA 1XGNA 2GG3A 1W2MA 4R60A 4IECA 1XNZA 1A16A 4S01A 2EA4A 4ZWUA 2EA2A 1C22A 2P98A 2HOWA 4PNCA 1M35A 1QXYA 4RGZ1 4U6EA 2V6CA 4U71A 2GG7A 2Q93A 4ZWOA 4PV4A 1KQ0A 2GG9A 5D6EA 1WL6A 4U70A 1KP0A 2V3ZA 3BIPA 4A6WA 2BHBA 1JAWA 1R5GA 2NQ6A 4FLIA 2BB7A 3L24A 3PKCA 1WKMA 2GG5A 3CTZA 4U6CA 5FCFA 2Q95A 1WL9A 4KM3A 4JUQA 4S00A 2EVMA 1XGSA 4A6VA 2Q92A 1C27A 2BN7A 5JFRA 2Q94A 2ZSGA 4FKCA 3CB5A 2BWSA 5CDVA 3PKDA 2G6PA 2GGCA 4IKSA 3PKEA 4U76A 2Q96A 4HXXA 3Q6DA 5CIKA 4FLLA 3BIQA 2OAZA 2B3HA 2BH3A 2GA2A 2GU6A 4IF7A 4MATA 4FO8A 1N51A 1W7VA 4U1BA 4U73A 5CDEA 1YVMA 2GZ5A 2BHAA 4ZWPA 1XGMA 5JHUA 1BOAA 1XGOA 3IG4A 1QXZA 1R5HA 1WN1A 3D27A 3CB6A 5CNXA 2GGBA 2EVOA 1C24A 1B59A 2GU7A 2V3YA 3FMRA 2MATA 3MX6A 1C21A 4IDYA 2B3KA 2GG2A 3PKAA 4IKRA 4EGEA 1MATA 2BHDA 1QZYA 3FMQA 3IU9A 4IU6A 5D6FA 4IKUA 4OOKA 2BWYA 4S2RP 4B28A 4Z7MA 2BWWA 2V3XA 1B6AA 3IU7A 3L7GA 3MR1A 4U75A 2Q8KA 1YW8A 5CDLA 1C23A 1QXWA 2B3LA 3BITA 2P99A 5CLSA 3RORA 3IU8A 2BWTA 4FLJA 1YW7A 2BWUA 2NQ7A 1BN5A 4U6WA 2EVCA 1KQ9A 4FLKA 2OKNA 2GU5A 4IPAA 1WBQA 5CE6A 1O0XA 2GU4A
chains in the Genus database with same CATH superfamily
2GG8A 2DFIA 2BWXA 4FO7A 2GG0A 5E5BA 1PV9A 3TAVA 4RZYA 3PKBA 2BHCA 4U69A 1YJ3A 3MATA 2IW2A 4FUKA 3FM3A 1YW9A 4IKTA 4RZZA 1R58A 3TB5A 2P9AA 1WLRA 2BWVA 4ZNGA 5FCHA 4S2TP 3S6BA 1Y1NA 3RVAA 2GTXA 4QR8A 5JI6A 4U6ZA 1CHMA 1WY2A 4U6JA 2ADUA 1XGNA 2GG3A 1W2MA 4R60A 4IECA 1XNZA 1A16A 4S01A 2EA4A 4ZWUA 2EA2A 1C22A 2P98A 2HOWA 4PNCA 1M35A 1QXYA 4RGZ1 4U6EA 2V6CA 4U71A 2GG7A 2Q93A 4ZWOA 4PV4A 1KQ0A 2GG9A 5D6EA 1WL6A 4U70A 1KP0A 2V3ZA 3BIPA 4A6WA 2BHBA 1JAWA 1R5GA 2NQ6A 4FLIA 2BB7A 3L24A 3PKCA 1WKMA 2GG5A 3CTZA 4U6CA 5FCFA 2Q95A 1WL9A 4KM3A 4JUQA 4S00A 2EVMA 1XGSA 4A6VA 2Q92A 1C27A 2BN7A 5JFRA 2Q94A 2ZSGA 4FKCA 3CB5A 2BWSA 5CDVA 3PKDA 2G6PA 2GGCA 4IKSA 3PKEA 4U76A 2Q96A 4HXXA 3Q6DA 5CIKA 4FLLA 3BIQA 2OAZA 2B3HA 2BH3A 2GA2A 2GU6A 4IF7A 4MATA 4FO8A 1N51A 1W7VA 4U1BA 4U73A 5CDEA 1YVMA 2GZ5A 2BHAA 4ZWPA 1XGMA 5JHUA 1BOAA 1XGOA 3IG4A 1QXZA 1R5HA 1WN1A 3D27A 3CB6A 5CNXA 2GGBA 2EVOA 1C24A 1B59A 2GU7A 2V3YA 3FMRA 2MATA 3MX6A 1C21A 4IDYA 2B3KA 2GG2A 3PKAA 4IKRA 4EGEA 1MATA 2BHDA 1QZYA 3FMQA 3IU9A 4IU6A 5D6FA 4IKUA 4OOKA 2BWYA 4S2RP 4B28A 4Z7MA 2BWWA 2V3XA 1B6AA 3IU7A 3L7GA 3MR1A 4U75A 2Q8KA 1YW8A 5CDLA 1C23A 1QXWA 2B3LA 3BITA 2P99A 5CLSA 3RORA 3IU8A 2BWTA 4FLJA 1YW7A 2BWUA 2NQ7A 1BN5A 4U6WA 2EVCA 1KQ9A 4FLKA 2OKNA 2GU5A 4IPAA 1WBQA 5CE6A 1O0XA 2GU4A
chains in the Genus database with same CATH topology
2GG8A 2DFIA 2BWXA 4FO7A 2GG0A 5E5BA 1PV9A 3TAVA 4RZYA 3PKBA 2BHCA 4U69A 1YJ3A 3MATA 2IW2A 4FUKA 3FM3A 1YW9A 4IKTA 4RZZA 1R58A 3TB5A 2P9AA 1WLRA 2BWVA 4ZNGA 5FCHA 4S2TP 3S6BA 1Y1NA 3RVAA 2GTXA 4QR8A 5JI6A 4U6ZA 1CHMA 1WY2A 4U6JA 2ADUA 1XGNA 2GG3A 1W2MA 4R60A 4IECA 1XNZA 1A16A 4S01A 2EA4A 4ZWUA 2EA2A 1C22A 2P98A 2HOWA 4PNCA 1M35A 1QXYA 4RGZ1 4U6EA 2V6CA 4U71A 2GG7A 2Q93A 4ZWOA 4PV4A 1KQ0A 2GG9A 5D6EA 1WL6A 4U70A 1KP0A 2V3ZA 3BIPA 4A6WA 2BHBA 1JAWA 1R5GA 2NQ6A 4FLIA 2BB7A 3L24A 3PKCA 1WKMA 2GG5A 3CTZA 4U6CA 5FCFA 2Q95A 1WL9A 4KM3A 4JUQA 4S00A 2EVMA 1XGSA 4A6VA 2Q92A 1C27A 2BN7A 5JFRA 2Q94A 2ZSGA 4FKCA 3CB5A 2BWSA 5CDVA 3PKDA 2G6PA 2GGCA 4IKSA 3PKEA 4U76A 2Q96A 4HXXA 3Q6DA 5CIKA 4FLLA 3BIQA 2OAZA 2B3HA 2BH3A 2GA2A 2GU6A 4IF7A 4MATA 4FO8A 1N51A 1W7VA 4U1BA 4U73A 5CDEA 1YVMA 2GZ5A 2BHAA 4ZWPA 1XGMA 5JHUA 1BOAA 1XGOA 3IG4A 1QXZA 1R5HA 1WN1A 3D27A 3CB6A 5CNXA 2GGBA 2EVOA 1C24A 1B59A 2GU7A 2V3YA 3FMRA 2MATA 3MX6A 1C21A 4IDYA 2B3KA 2GG2A 3PKAA 4IKRA 4EGEA 1MATA 2BHDA 1QZYA 3FMQA 3IU9A 4IU6A 5D6FA 4IKUA 4OOKA 2BWYA 4S2RP 4B28A 4Z7MA 2BWWA 2V3XA 1B6AA 3IU7A 3L7GA 3MR1A 4U75A 2Q8KA 1YW8A 5CDLA 1C23A 1QXWA 2B3LA 3BITA 2P99A 5CLSA 3RORA 3IU8A 2BWTA 4FLJA 1YW7A 2BWUA 2NQ7A 1BN5A 4U6WA 2EVCA 1KQ9A 4FLKA 2OKNA 2GU5A 4IPAA 1WBQA 5CE6A 1O0XA 2GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG8 A;  2DFI A;  2BWX A;  4FO7 A;  2GG0 A;  5E5B A;  1PV9 A;  3TAV A;  4RZY A;  3PKB A;  2BHC A;  4U69 A;  1YJ3 A;  3MAT A;  2IW2 A;  4FUK A;  3FM3 A;  1YW9 A;  4IKT A;  4RZZ A;  1R58 A;  3TB5 A;  2P9A A;  1WLR A;  2BWV A;  4ZNG A;  5FCH A;  4S2T P;  3S6B A;  1Y1N A;  3RVA A;  2GTX A;  4QR8 A;  5JI6 A;  4U6Z A;  1CHM A;  1WY2 A;  4U6J A;  2ADU A;  1XGN A;  2GG3 A;  1W2M A;  4R60 A;  4IEC A;  1XNZ A;  1A16 A;  4S01 A;  2EA4 A;  4ZWU A;  2EA2 A;  1C22 A;  2P98 A;  2HOW A;  4PNC A;  1M35 A;  1QXY A;  4RGZ 1;  4U6E A;  2V6C A;  4U71 A;  2GG7 A;  2Q93 A;  4ZWO A;  4PV4 A;  1KQ0 A;  2GG9 A;  5D6E A;  1WL6 A;  4U70 A;  1KP0 A;  2V3Z A;  3BIP A;  4A6W A;  2BHB A;  1JAW A;  1R5G A;  2NQ6 A;  4FLI A;  2BB7 A;  3L24 A;  3PKC A;  1WKM A;  2GG5 A;  3CTZ A;  4U6C A;  5FCF A;  2Q95 A;  1WL9 A;  4KM3 A;  4JUQ A;  4S00 A;  2EVM A;  1XGS A;  4A6V A;  2Q92 A;  1C27 A;  2BN7 A;  5JFR A;  2Q94 A;  2ZSG A;  4FKC A;  3CB5 A;  2BWS A;  5CDV A;  3PKD A;  2G6P A;  2GGC A;  4IKS A;  3PKE A;  4U76 A;  2Q96 A;  4HXX A;  3Q6D A;  5CIK A;  4FLL A;  3BIQ A;  2OAZ A;  2B3H A;  2BH3 A;  2GA2 A;  2GU6 A;  4IF7 A;  4MAT A;  4FO8 A;  1N51 A;  1W7V A;  4U1B A;  4U73 A;  5CDE A;  1YVM A;  2GZ5 A;  2BHA A;  4ZWP A;  1XGM A;  5JHU A;  1BOA A;  1XGO A;  3IG4 A;  1QXZ A;  1R5H A;  1WN1 A;  3D27 A;  3CB6 A;  5CNX A;  2GGB A;  2EVO A;  1C24 A;  1B59 A;  2GU7 A;  2V3Y A;  3FMR A;  2MAT A;  3MX6 A;  1C21 A;  4IDY A;  2B3K A;  2GG2 A;  3PKA A;  4IKR A;  4EGE A;  1MAT A;  2BHD A;  1QZY A;  3FMQ A;  3IU9 A;  4IU6 A;  5D6F A;  4IKU A;  4OOK A;  2BWY A;  4S2R P;  4B28 A;  4Z7M A;  2BWW A;  2V3X A;  1B6A A;  3IU7 A;  3L7G A;  3MR1 A;  4U75 A;  2Q8K A;  1YW8 A;  5CDL A;  1C23 A;  1QXW A;  2B3L A;  3BIT A;  2P99 A;  5CLS A;  3ROR A;  3IU8 A;  2BWT A;  4FLJ A;  1YW7 A;  2BWU A;  2NQ7 A;  1BN5 A;  4U6W A;  2EVC A;  1KQ9 A;  4FLK A;  2OKN A;  2GU5 A;  4IPA A;  1WBQ A;  5CE6 A;  1O0X A;  2GU4 A; 
#chains in the Genus database with same CATH topology
 2GG8 A;  2DFI A;  2BWX A;  4FO7 A;  2GG0 A;  5E5B A;  1PV9 A;  3TAV A;  4RZY A;  3PKB A;  2BHC A;  4U69 A;  1YJ3 A;  3MAT A;  2IW2 A;  4FUK A;  3FM3 A;  1YW9 A;  4IKT A;  4RZZ A;  1R58 A;  3TB5 A;  2P9A A;  1WLR A;  2BWV A;  4ZNG A;  5FCH A;  4S2T P;  3S6B A;  1Y1N A;  3RVA A;  2GTX A;  4QR8 A;  5JI6 A;  4U6Z A;  1CHM A;  1WY2 A;  4U6J A;  2ADU A;  1XGN A;  2GG3 A;  1W2M A;  4R60 A;  4IEC A;  1XNZ A;  1A16 A;  4S01 A;  2EA4 A;  4ZWU A;  2EA2 A;  1C22 A;  2P98 A;  2HOW A;  4PNC A;  1M35 A;  1QXY A;  4RGZ 1;  4U6E A;  2V6C A;  4U71 A;  2GG7 A;  2Q93 A;  4ZWO A;  4PV4 A;  1KQ0 A;  2GG9 A;  5D6E A;  1WL6 A;  4U70 A;  1KP0 A;  2V3Z A;  3BIP A;  4A6W A;  2BHB A;  1JAW A;  1R5G A;  2NQ6 A;  4FLI A;  2BB7 A;  3L24 A;  3PKC A;  1WKM A;  2GG5 A;  3CTZ A;  4U6C A;  5FCF A;  2Q95 A;  1WL9 A;  4KM3 A;  4JUQ A;  4S00 A;  2EVM A;  1XGS A;  4A6V A;  2Q92 A;  1C27 A;  2BN7 A;  5JFR A;  2Q94 A;  2ZSG A;  4FKC A;  3CB5 A;  2BWS A;  5CDV A;  3PKD A;  2G6P A;  2GGC A;  4IKS A;  3PKE A;  4U76 A;  2Q96 A;  4HXX A;  3Q6D A;  5CIK A;  4FLL A;  3BIQ A;  2OAZ A;  2B3H A;  2BH3 A;  2GA2 A;  2GU6 A;  4IF7 A;  4MAT A;  4FO8 A;  1N51 A;  1W7V A;  4U1B A;  4U73 A;  5CDE A;  1YVM A;  2GZ5 A;  2BHA A;  4ZWP A;  1XGM A;  5JHU A;  1BOA A;  1XGO A;  3IG4 A;  1QXZ A;  1R5H A;  1WN1 A;  3D27 A;  3CB6 A;  5CNX A;  2GGB A;  2EVO A;  1C24 A;  1B59 A;  2GU7 A;  2V3Y A;  3FMR A;  2MAT A;  3MX6 A;  1C21 A;  4IDY A;  2B3K A;  2GG2 A;  3PKA A;  4IKR A;  4EGE A;  1MAT A;  2BHD A;  1QZY A;  3FMQ A;  3IU9 A;  4IU6 A;  5D6F A;  4IKU A;  4OOK A;  2BWY A;  4S2R P;  4B28 A;  4Z7M A;  2BWW A;  2V3X A;  1B6A A;  3IU7 A;  3L7G A;  3MR1 A;  4U75 A;  2Q8K A;  1YW8 A;  5CDL A;  1C23 A;  1QXW A;  2B3L A;  3BIT A;  2P99 A;  5CLS A;  3ROR A;  3IU8 A;  2BWT A;  4FLJ A;  1YW7 A;  2BWU A;  2NQ7 A;  1BN5 A;  4U6W A;  2EVC A;  1KQ9 A;  4FLK A;  2OKN A;  2GU5 A;  4IPA A;  1WBQ A;  5CE6 A;  1O0X A;  2GU4 A; 
#chains in the Genus database with same CATH homology
 2GG8 A;  2DFI A;  2BWX A;  4FO7 A;  2GG0 A;  5E5B A;  1PV9 A;  3TAV A;  4RZY A;  3PKB A;  2BHC A;  4U69 A;  1YJ3 A;  3MAT A;  2IW2 A;  4FUK A;  3FM3 A;  1YW9 A;  4IKT A;  4RZZ A;  1R58 A;  3TB5 A;  2P9A A;  1WLR A;  2BWV A;  4ZNG A;  5FCH A;  4S2T P;  3S6B A;  1Y1N A;  3RVA A;  2GTX A;  4QR8 A;  5JI6 A;  4U6Z A;  1CHM A;  1WY2 A;  4U6J A;  2ADU A;  1XGN A;  2GG3 A;  1W2M A;  4R60 A;  4IEC A;  1XNZ A;  1A16 A;  4S01 A;  2EA4 A;  4ZWU A;  2EA2 A;  1C22 A;  2P98 A;  2HOW A;  4PNC A;  1M35 A;  1QXY A;  4RGZ 1;  4U6E A;  2V6C A;  4U71 A;  2GG7 A;  2Q93 A;  4ZWO A;  4PV4 A;  1KQ0 A;  2GG9 A;  5D6E A;  1WL6 A;  4U70 A;  1KP0 A;  2V3Z A;  3BIP A;  4A6W A;  2BHB A;  1JAW A;  1R5G A;  2NQ6 A;  4FLI A;  2BB7 A;  3L24 A;  3PKC A;  1WKM A;  2GG5 A;  3CTZ A;  4U6C A;  5FCF A;  2Q95 A;  1WL9 A;  4KM3 A;  4JUQ A;  4S00 A;  2EVM A;  1XGS A;  4A6V A;  2Q92 A;  1C27 A;  2BN7 A;  5JFR A;  2Q94 A;  2ZSG A;  4FKC A;  3CB5 A;  2BWS A;  5CDV A;  3PKD A;  2G6P A;  2GGC A;  4IKS A;  3PKE A;  4U76 A;  2Q96 A;  4HXX A;  3Q6D A;  5CIK A;  4FLL A;  3BIQ A;  2OAZ A;  2B3H A;  2BH3 A;  2GA2 A;  2GU6 A;  4IF7 A;  4MAT A;  4FO8 A;  1N51 A;  1W7V A;  4U1B A;  4U73 A;  5CDE A;  1YVM A;  2GZ5 A;  2BHA A;  4ZWP A;  1XGM A;  5JHU A;  1BOA A;  1XGO A;  3IG4 A;  1QXZ A;  1R5H A;  1WN1 A;  3D27 A;  3CB6 A;  5CNX A;  2GGB A;  2EVO A;  1C24 A;  1B59 A;  2GU7 A;  2V3Y A;  3FMR A;  2MAT A;  3MX6 A;  1C21 A;  4IDY A;  2B3K A;  2GG2 A;  3PKA A;  4IKR A;  4EGE A;  1MAT A;  2BHD A;  1QZY A;  3FMQ A;  3IU9 A;  4IU6 A;  5D6F A;  4IKU A;  4OOK A;  2BWY A;  4S2R P;  4B28 A;  4Z7M A;  2BWW A;  2V3X A;  1B6A A;  3IU7 A;  3L7G A;  3MR1 A;  4U75 A;  2Q8K A;  1YW8 A;  5CDL A;  1C23 A;  1QXW A;  2B3L A;  3BIT A;  2P99 A;  5CLS A;  3ROR A;  3IU8 A;  2BWT A;  4FLJ A;  1YW7 A;  2BWU A;  2NQ7 A;  1BN5 A;  4U6W A;  2EVC A;  1KQ9 A;  4FLK A;  2OKN A;  2GU5 A;  4IPA A;  1WBQ A;  5CE6 A;  1O0X A;  2GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...