3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
4EGEA 3PKCA 3TB5A 2IW2A 4U70A 4U6ZA 1BN5A 1O0XA 3TAVA 2ADUA 5FCFA 1JAWA 2EA4A 1B6AA 1QZYA 3MATA 2BN7A 5CIKA 4IPAA 3IU8A 2V3ZA 5JFRA 4U76A 3PKAA 4OOKA 1C21A 1WY2A 2GG5A 4IKSA 3CTZA 4RZYA 1C22A 5JHUA 3MX6A 1YW7A 3IG4A 4MATA 1Y1NA 2G6PA 4U6CA 3BITA 1C23A 1QXYA 5D6EA 3BIPA 2GG8A 3PKDA 2Q92A 3PKEA 4A6WA 2BHCA 1KQ9A 1BOAA 4QR8A 1M35A 2OKNA 1KQ0A 3FM3A 2P98A 3L24A 5CDLA 4RZZA 4RGZ1 1WL6A 2OAZA 1WKMA 5CLSA 4IF7A 3CB6A 3PKBA 1N51A 1QXWA 4U69A 1YVMA 1KP0A 2GU4A 4JUQA 3S6BA 1WBQA 2V3XA 2NQ6A 2Q8KA 2GGBA 4ZWUA 1W2MA 2GGCA 2GG9A 2HOWA 4FO7A 4KM3A 2GZ5A 1B59A 2GA2A 4Z7MA 5FCHA 4IKUA 4ZNGA 2B3KA 5D6FA 1YW8A 3BIQA 4U73A 4R60A 2MATA 1WL9A 5E5BA 2BWTA 2P9AA 4U1BA 4PV4A 2Q93A 4B28A 1C27A 2BWYA 4IKRA 4FUKA 4U6WA 2NQ7A 4FLKA 3D27A 4PNCA 3MR1A 3FMQA 3FMRA 2EVCA 2GG0A 4IU6A 2BWVA 4IDYA 1XGNA 2GTXA 2GU6A 4ZWPA 1R5GA 5CE6A 1R5HA 1XGSA 3CB5A 2GU7A 2BWUA 2GG7A 2GG2A 4IECA 2EVMA 2ZSGA 2GG3A 4S2RP 4U71A 2BB7A 5CDVA 2B3LA 2BWSA 5CNXA 3RVAA 2V3YA 2BH3A 3IU7A 2GU5A 4IKTA 1XGOA 4FLIA 4U75A 1YJ3A 2BHBA 1MATA 3L7GA 2EA2A 1A16A 1YW9A 4FKCA 4FLJA 4S01A 4S00A 2EVOA 2Q94A 3RORA 1PV9A 2V6CA 2BWWA 2BWXA 1C24A 1XGMA 1R58A 4FO8A 4ZWOA 2Q96A 5CDEA 5JI6A 1W7VA 2DFIA 4A6VA 1QXZA 4U6EA 4S2TP 1WN1A 2BHAA 4FLLA 2BHDA 3IU9A 2Q95A 1CHMA 4HXXA 1WLRA 2B3HA 3Q6DA 4U6JA 1XNZA 2P99A
chains in the Genus database with same CATH superfamily
4EGEA 3PKCA 3TB5A 2IW2A 4U70A 4U6ZA 1BN5A 1O0XA 3TAVA 2ADUA 5FCFA 1JAWA 2EA4A 1B6AA 1QZYA 3MATA 2BN7A 5CIKA 4IPAA 3IU8A 2V3ZA 5JFRA 4U76A 3PKAA 4OOKA 1C21A 1WY2A 2GG5A 4IKSA 3CTZA 4RZYA 1C22A 5JHUA 3MX6A 1YW7A 3IG4A 4MATA 1Y1NA 2G6PA 4U6CA 3BITA 1C23A 1QXYA 5D6EA 3BIPA 2GG8A 3PKDA 2Q92A 3PKEA 4A6WA 2BHCA 1KQ9A 1BOAA 4QR8A 1M35A 2OKNA 1KQ0A 3FM3A 2P98A 3L24A 5CDLA 4RZZA 4RGZ1 1WL6A 2OAZA 1WKMA 5CLSA 4IF7A 3CB6A 3PKBA 1N51A 1QXWA 4U69A 1YVMA 1KP0A 2GU4A 4JUQA 3S6BA 1WBQA 2V3XA 2NQ6A 2Q8KA 2GGBA 4ZWUA 1W2MA 2GGCA 2GG9A 2HOWA 4FO7A 4KM3A 2GZ5A 1B59A 2GA2A 4Z7MA 5FCHA 4IKUA 4ZNGA 2B3KA 5D6FA 1YW8A 3BIQA 4U73A 4R60A 2MATA 1WL9A 5E5BA 2BWTA 2P9AA 4U1BA 4PV4A 2Q93A 4B28A 1C27A 2BWYA 4IKRA 4FUKA 4U6WA 2NQ7A 4FLKA 3D27A 4PNCA 3MR1A 3FMQA 3FMRA 2EVCA 2GG0A 4IU6A 2BWVA 4IDYA 1XGNA 2GTXA 2GU6A 4ZWPA 1R5GA 5CE6A 1R5HA 1XGSA 3CB5A 2GU7A 2BWUA 2GG7A 2GG2A 4IECA 2EVMA 2ZSGA 2GG3A 4S2RP 4U71A 2BB7A 5CDVA 2B3LA 2BWSA 5CNXA 3RVAA 2V3YA 2BH3A 3IU7A 2GU5A 4IKTA 1XGOA 4FLIA 4U75A 1YJ3A 2BHBA 1MATA 3L7GA 2EA2A 1A16A 1YW9A 4FKCA 4FLJA 4S01A 4S00A 2EVOA 2Q94A 3RORA 1PV9A 2V6CA 2BWWA 2BWXA 1C24A 1XGMA 1R58A 4FO8A 4ZWOA 2Q96A 5CDEA 5JI6A 1W7VA 2DFIA 4A6VA 1QXZA 4U6EA 4S2TP 1WN1A 2BHAA 4FLLA 2BHDA 3IU9A 2Q95A 1CHMA 4HXXA 1WLRA 2B3HA 3Q6DA 4U6JA 1XNZA 2P99A
chains in the Genus database with same CATH topology
4EGEA 3PKCA 3TB5A 2IW2A 4U70A 4U6ZA 1BN5A 1O0XA 3TAVA 2ADUA 5FCFA 1JAWA 2EA4A 1B6AA 1QZYA 3MATA 2BN7A 5CIKA 4IPAA 3IU8A 2V3ZA 5JFRA 4U76A 3PKAA 4OOKA 1C21A 1WY2A 2GG5A 4IKSA 3CTZA 4RZYA 1C22A 5JHUA 3MX6A 1YW7A 3IG4A 4MATA 1Y1NA 2G6PA 4U6CA 3BITA 1C23A 1QXYA 5D6EA 3BIPA 2GG8A 3PKDA 2Q92A 3PKEA 4A6WA 2BHCA 1KQ9A 1BOAA 4QR8A 1M35A 2OKNA 1KQ0A 3FM3A 2P98A 3L24A 5CDLA 4RZZA 4RGZ1 1WL6A 2OAZA 1WKMA 5CLSA 4IF7A 3CB6A 3PKBA 1N51A 1QXWA 4U69A 1YVMA 1KP0A 2GU4A 4JUQA 3S6BA 1WBQA 2V3XA 2NQ6A 2Q8KA 2GGBA 4ZWUA 1W2MA 2GGCA 2GG9A 2HOWA 4FO7A 4KM3A 2GZ5A 1B59A 2GA2A 4Z7MA 5FCHA 4IKUA 4ZNGA 2B3KA 5D6FA 1YW8A 3BIQA 4U73A 4R60A 2MATA 1WL9A 5E5BA 2BWTA 2P9AA 4U1BA 4PV4A 2Q93A 4B28A 1C27A 2BWYA 4IKRA 4FUKA 4U6WA 2NQ7A 4FLKA 3D27A 4PNCA 3MR1A 3FMQA 3FMRA 2EVCA 2GG0A 4IU6A 2BWVA 4IDYA 1XGNA 2GTXA 2GU6A 4ZWPA 1R5GA 5CE6A 1R5HA 1XGSA 3CB5A 2GU7A 2BWUA 2GG7A 2GG2A 4IECA 2EVMA 2ZSGA 2GG3A 4S2RP 4U71A 2BB7A 5CDVA 2B3LA 2BWSA 5CNXA 3RVAA 2V3YA 2BH3A 3IU7A 2GU5A 4IKTA 1XGOA 4FLIA 4U75A 1YJ3A 2BHBA 1MATA 3L7GA 2EA2A 1A16A 1YW9A 4FKCA 4FLJA 4S01A 4S00A 2EVOA 2Q94A 3RORA 1PV9A 2V6CA 2BWWA 2BWXA 1C24A 1XGMA 1R58A 4FO8A 4ZWOA 2Q96A 5CDEA 5JI6A 1W7VA 2DFIA 4A6VA 1QXZA 4U6EA 4S2TP 1WN1A 2BHAA 4FLLA 2BHDA 3IU9A 2Q95A 1CHMA 4HXXA 1WLRA 2B3HA 3Q6DA 4U6JA 1XNZA 2P99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EGE A;  3PKC A;  3TB5 A;  2IW2 A;  4U70 A;  4U6Z A;  1BN5 A;  1O0X A;  3TAV A;  2ADU A;  5FCF A;  1JAW A;  2EA4 A;  1B6A A;  1QZY A;  3MAT A;  2BN7 A;  5CIK A;  4IPA A;  3IU8 A;  2V3Z A;  5JFR A;  4U76 A;  3PKA A;  4OOK A;  1C21 A;  1WY2 A;  2GG5 A;  4IKS A;  3CTZ A;  4RZY A;  1C22 A;  5JHU A;  3MX6 A;  1YW7 A;  3IG4 A;  4MAT A;  1Y1N A;  2G6P A;  4U6C A;  3BIT A;  1C23 A;  1QXY A;  5D6E A;  3BIP A;  2GG8 A;  3PKD A;  2Q92 A;  3PKE A;  4A6W A;  2BHC A;  1KQ9 A;  1BOA A;  4QR8 A;  1M35 A;  2OKN A;  1KQ0 A;  3FM3 A;  2P98 A;  3L24 A;  5CDL A;  4RZZ A;  4RGZ 1;  1WL6 A;  2OAZ A;  1WKM A;  5CLS A;  4IF7 A;  3CB6 A;  3PKB A;  1N51 A;  1QXW A;  4U69 A;  1YVM A;  1KP0 A;  2GU4 A;  4JUQ A;  3S6B A;  1WBQ A;  2V3X A;  2NQ6 A;  2Q8K A;  2GGB A;  4ZWU A;  1W2M A;  2GGC A;  2GG9 A;  2HOW A;  4FO7 A;  4KM3 A;  2GZ5 A;  1B59 A;  2GA2 A;  4Z7M A;  5FCH A;  4IKU A;  4ZNG A;  2B3K A;  5D6F A;  1YW8 A;  3BIQ A;  4U73 A;  4R60 A;  2MAT A;  1WL9 A;  5E5B A;  2BWT A;  2P9A A;  4U1B A;  4PV4 A;  2Q93 A;  4B28 A;  1C27 A;  2BWY A;  4IKR A;  4FUK A;  4U6W A;  2NQ7 A;  4FLK A;  3D27 A;  4PNC A;  3MR1 A;  3FMQ A;  3FMR A;  2EVC A;  2GG0 A;  4IU6 A;  2BWV A;  4IDY A;  1XGN A;  2GTX A;  2GU6 A;  4ZWP A;  1R5G A;  5CE6 A;  1R5H A;  1XGS A;  3CB5 A;  2GU7 A;  2BWU A;  2GG7 A;  2GG2 A;  4IEC A;  2EVM A;  2ZSG A;  2GG3 A;  4S2R P;  4U71 A;  2BB7 A;  5CDV A;  2B3L A;  2BWS A;  5CNX A;  3RVA A;  2V3Y A;  2BH3 A;  3IU7 A;  2GU5 A;  4IKT A;  1XGO A;  4FLI A;  4U75 A;  1YJ3 A;  2BHB A;  1MAT A;  3L7G A;  2EA2 A;  1A16 A;  1YW9 A;  4FKC A;  4FLJ A;  4S01 A;  4S00 A;  2EVO A;  2Q94 A;  3ROR A;  1PV9 A;  2V6C A;  2BWW A;  2BWX A;  1C24 A;  1XGM A;  1R58 A;  4FO8 A;  4ZWO A;  2Q96 A;  5CDE A;  5JI6 A;  1W7V A;  2DFI A;  4A6V A;  1QXZ A;  4U6E A;  4S2T P;  1WN1 A;  2BHA A;  4FLL A;  2BHD A;  3IU9 A;  2Q95 A;  1CHM A;  4HXX A;  1WLR A;  2B3H A;  3Q6D A;  4U6J A;  1XNZ A;  2P99 A; 
#chains in the Genus database with same CATH topology
 4EGE A;  3PKC A;  3TB5 A;  2IW2 A;  4U70 A;  4U6Z A;  1BN5 A;  1O0X A;  3TAV A;  2ADU A;  5FCF A;  1JAW A;  2EA4 A;  1B6A A;  1QZY A;  3MAT A;  2BN7 A;  5CIK A;  4IPA A;  3IU8 A;  2V3Z A;  5JFR A;  4U76 A;  3PKA A;  4OOK A;  1C21 A;  1WY2 A;  2GG5 A;  4IKS A;  3CTZ A;  4RZY A;  1C22 A;  5JHU A;  3MX6 A;  1YW7 A;  3IG4 A;  4MAT A;  1Y1N A;  2G6P A;  4U6C A;  3BIT A;  1C23 A;  1QXY A;  5D6E A;  3BIP A;  2GG8 A;  3PKD A;  2Q92 A;  3PKE A;  4A6W A;  2BHC A;  1KQ9 A;  1BOA A;  4QR8 A;  1M35 A;  2OKN A;  1KQ0 A;  3FM3 A;  2P98 A;  3L24 A;  5CDL A;  4RZZ A;  4RGZ 1;  1WL6 A;  2OAZ A;  1WKM A;  5CLS A;  4IF7 A;  3CB6 A;  3PKB A;  1N51 A;  1QXW A;  4U69 A;  1YVM A;  1KP0 A;  2GU4 A;  4JUQ A;  3S6B A;  1WBQ A;  2V3X A;  2NQ6 A;  2Q8K A;  2GGB A;  4ZWU A;  1W2M A;  2GGC A;  2GG9 A;  2HOW A;  4FO7 A;  4KM3 A;  2GZ5 A;  1B59 A;  2GA2 A;  4Z7M A;  5FCH A;  4IKU A;  4ZNG A;  2B3K A;  5D6F A;  1YW8 A;  3BIQ A;  4U73 A;  4R60 A;  2MAT A;  1WL9 A;  5E5B A;  2BWT A;  2P9A A;  4U1B A;  4PV4 A;  2Q93 A;  4B28 A;  1C27 A;  2BWY A;  4IKR A;  4FUK A;  4U6W A;  2NQ7 A;  4FLK A;  3D27 A;  4PNC A;  3MR1 A;  3FMQ A;  3FMR A;  2EVC A;  2GG0 A;  4IU6 A;  2BWV A;  4IDY A;  1XGN A;  2GTX A;  2GU6 A;  4ZWP A;  1R5G A;  5CE6 A;  1R5H A;  1XGS A;  3CB5 A;  2GU7 A;  2BWU A;  2GG7 A;  2GG2 A;  4IEC A;  2EVM A;  2ZSG A;  2GG3 A;  4S2R P;  4U71 A;  2BB7 A;  5CDV A;  2B3L A;  2BWS A;  5CNX A;  3RVA A;  2V3Y A;  2BH3 A;  3IU7 A;  2GU5 A;  4IKT A;  1XGO A;  4FLI A;  4U75 A;  1YJ3 A;  2BHB A;  1MAT A;  3L7G A;  2EA2 A;  1A16 A;  1YW9 A;  4FKC A;  4FLJ A;  4S01 A;  4S00 A;  2EVO A;  2Q94 A;  3ROR A;  1PV9 A;  2V6C A;  2BWW A;  2BWX A;  1C24 A;  1XGM A;  1R58 A;  4FO8 A;  4ZWO A;  2Q96 A;  5CDE A;  5JI6 A;  1W7V A;  2DFI A;  4A6V A;  1QXZ A;  4U6E A;  4S2T P;  1WN1 A;  2BHA A;  4FLL A;  2BHD A;  3IU9 A;  2Q95 A;  1CHM A;  4HXX A;  1WLR A;  2B3H A;  3Q6D A;  4U6J A;  1XNZ A;  2P99 A; 
#chains in the Genus database with same CATH homology
 4EGE A;  3PKC A;  3TB5 A;  2IW2 A;  4U70 A;  4U6Z A;  1BN5 A;  1O0X A;  3TAV A;  2ADU A;  5FCF A;  1JAW A;  2EA4 A;  1B6A A;  1QZY A;  3MAT A;  2BN7 A;  5CIK A;  4IPA A;  3IU8 A;  2V3Z A;  5JFR A;  4U76 A;  3PKA A;  4OOK A;  1C21 A;  1WY2 A;  2GG5 A;  4IKS A;  3CTZ A;  4RZY A;  1C22 A;  5JHU A;  3MX6 A;  1YW7 A;  3IG4 A;  4MAT A;  1Y1N A;  2G6P A;  4U6C A;  3BIT A;  1C23 A;  1QXY A;  5D6E A;  3BIP A;  2GG8 A;  3PKD A;  2Q92 A;  3PKE A;  4A6W A;  2BHC A;  1KQ9 A;  1BOA A;  4QR8 A;  1M35 A;  2OKN A;  1KQ0 A;  3FM3 A;  2P98 A;  3L24 A;  5CDL A;  4RZZ A;  4RGZ 1;  1WL6 A;  2OAZ A;  1WKM A;  5CLS A;  4IF7 A;  3CB6 A;  3PKB A;  1N51 A;  1QXW A;  4U69 A;  1YVM A;  1KP0 A;  2GU4 A;  4JUQ A;  3S6B A;  1WBQ A;  2V3X A;  2NQ6 A;  2Q8K A;  2GGB A;  4ZWU A;  1W2M A;  2GGC A;  2GG9 A;  2HOW A;  4FO7 A;  4KM3 A;  2GZ5 A;  1B59 A;  2GA2 A;  4Z7M A;  5FCH A;  4IKU A;  4ZNG A;  2B3K A;  5D6F A;  1YW8 A;  3BIQ A;  4U73 A;  4R60 A;  2MAT A;  1WL9 A;  5E5B A;  2BWT A;  2P9A A;  4U1B A;  4PV4 A;  2Q93 A;  4B28 A;  1C27 A;  2BWY A;  4IKR A;  4FUK A;  4U6W A;  2NQ7 A;  4FLK A;  3D27 A;  4PNC A;  3MR1 A;  3FMQ A;  3FMR A;  2EVC A;  2GG0 A;  4IU6 A;  2BWV A;  4IDY A;  1XGN A;  2GTX A;  2GU6 A;  4ZWP A;  1R5G A;  5CE6 A;  1R5H A;  1XGS A;  3CB5 A;  2GU7 A;  2BWU A;  2GG7 A;  2GG2 A;  4IEC A;  2EVM A;  2ZSG A;  2GG3 A;  4S2R P;  4U71 A;  2BB7 A;  5CDV A;  2B3L A;  2BWS A;  5CNX A;  3RVA A;  2V3Y A;  2BH3 A;  3IU7 A;  2GU5 A;  4IKT A;  1XGO A;  4FLI A;  4U75 A;  1YJ3 A;  2BHB A;  1MAT A;  3L7G A;  2EA2 A;  1A16 A;  1YW9 A;  4FKC A;  4FLJ A;  4S01 A;  4S00 A;  2EVO A;  2Q94 A;  3ROR A;  1PV9 A;  2V6C A;  2BWW A;  2BWX A;  1C24 A;  1XGM A;  1R58 A;  4FO8 A;  4ZWO A;  2Q96 A;  5CDE A;  5JI6 A;  1W7V A;  2DFI A;  4A6V A;  1QXZ A;  4U6E A;  4S2T P;  1WN1 A;  2BHA A;  4FLL A;  2BHD A;  3IU9 A;  2Q95 A;  1CHM A;  4HXX A;  1WLR A;  2B3H A;  3Q6D A;  4U6J A;  1XNZ A;  2P99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...