3MATA

E.coli methionine aminopeptidase transition-state inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
264
structure length
264
Chain Sequence
AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli methionine aminopeptidase: implications of crystallographic analyses of the native, mutant, and inhibited enzymes for the mechanism of catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords METHIONINE AMINOPEPTIDASE
total genus 86
structure length 264
sequence length 264
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 1999-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3matA00
3IU9A 4OOKA 4EGEA 5D6EA 3BIPA 1YW9A 2Q95A 2GU5A 1XGSA 4U6ZA 2GG8A 5CDVA 1O0XA 2GG2A 5CNXA 4Z7MA 2BHCA 4U6CA 1KQ0A 3IU8A 3TB5A 1W7VA 1PV9A 2IW2A 1R5HA 4FKCA 1KQ9A 3BIQA 5JI6A 2Q92A 2GG3A 4FLIA 4IPAA 2GU7A 3FMQA 4S2TP 2BWYA 3RVAA 1BOAA 1R5GA 3CTZA 1QZYA 3L7GA 2Q8KA 2EA2A 5CE6A 5FCHA 5JFRA 4FO7A 4MATA 3Q6DA 3PKBA 4PV4A 2V3XA 4RZZA 2G6PA 4U1BA 2BN7A 4FLKA 2EVCA 4U6EA 5JHUA 1Y1NA 1YVMA 4ZWOA 2GG5A 2Q96A 4IF7A 2BWSA 2GGBA 4U75A 4ZWUA 2GG7A 2HOWA 3TAVA 4S01A 2BHDA 2EVOA 1M35A 1CHMA 2EA4A 2BWXA 1XGOA 2DFIA 3MX6A 4IKUA 4RZYA 4FLJA 1C27A 2GZ5A 4FO8A 2V6CA 4IECA 4IKRA 1C24A 1YJ3A 2GA2A 3CB6A 2Q93A 5CDLA 3RORA 5CLSA 2MATA 1BN5A 4IDYA 2ZSGA 4S00A 2GG9A 3IG4A 4S2RP 1B59A 2GU6A 2BB7A 5CIKA 1C23A 4A6WA 2P99A 4FLLA 1XGMA 1QXZA 4JUQA 3PKCA 2GTXA 2OAZA 1QXWA 1XGNA 1WL6A 1YW8A 4PNCA 2B3HA 1YW7A 4IU6A 2P9AA 4KM3A 1MATA 4FUKA 2OKNA 1B6AA 1C22A 4A6VA 3L24A 4ZNGA 2B3KA 1JAWA 3PKAA 4U6WA 4R60A 2GU4A 2BWVA 2V3ZA 2BHBA 4IKSA 4RGZ1 3PKDA 4QR8A 1WBQA 2GG0A 1WN1A 3BITA 2ADUA 3FMRA 4IKTA 2BWTA 2V3YA 4ZWPA 1C21A 2BH3A 5E5BA 1XNZA 2P98A 3MATA 5D6FA 4U69A 3S6BA 1A16A 2B3LA 2NQ6A 2NQ7A 1WKMA 4U76A 2BHAA 3D27A 3PKEA 1WLRA 1N51A 3IU7A 2Q94A 3CB5A 4U73A 1W2MA 3FM3A 4B28A 4U6JA 1R58A 1QXYA 1WY2A 2GGCA 2BWWA 3MR1A 5FCFA 2EVMA 5CDEA 1KP0A 4U70A 4HXXA 1WL9A 2BWUA 4U71A
chains in the Genus database with same CATH superfamily
3IU9A 4OOKA 4EGEA 5D6EA 3BIPA 1YW9A 2Q95A 2GU5A 1XGSA 4U6ZA 2GG8A 5CDVA 1O0XA 2GG2A 5CNXA 4Z7MA 2BHCA 4U6CA 1KQ0A 3IU8A 3TB5A 1W7VA 1PV9A 2IW2A 1R5HA 4FKCA 1KQ9A 3BIQA 5JI6A 2Q92A 2GG3A 4FLIA 4IPAA 2GU7A 3FMQA 4S2TP 2BWYA 3RVAA 1BOAA 1R5GA 3CTZA 1QZYA 3L7GA 2Q8KA 2EA2A 5CE6A 5FCHA 5JFRA 4FO7A 4MATA 3Q6DA 3PKBA 4PV4A 2V3XA 4RZZA 2G6PA 4U1BA 2BN7A 4FLKA 2EVCA 4U6EA 5JHUA 1Y1NA 1YVMA 4ZWOA 2GG5A 2Q96A 4IF7A 2BWSA 2GGBA 4U75A 4ZWUA 2GG7A 2HOWA 3TAVA 4S01A 2BHDA 2EVOA 1M35A 1CHMA 2EA4A 2BWXA 1XGOA 2DFIA 3MX6A 4IKUA 4RZYA 4FLJA 1C27A 2GZ5A 4FO8A 2V6CA 4IECA 4IKRA 1C24A 1YJ3A 2GA2A 3CB6A 2Q93A 5CDLA 3RORA 5CLSA 2MATA 1BN5A 4IDYA 2ZSGA 4S00A 2GG9A 3IG4A 4S2RP 1B59A 2GU6A 2BB7A 5CIKA 1C23A 4A6WA 2P99A 4FLLA 1XGMA 1QXZA 4JUQA 3PKCA 2GTXA 2OAZA 1QXWA 1XGNA 1WL6A 1YW8A 4PNCA 2B3HA 1YW7A 4IU6A 2P9AA 4KM3A 1MATA 4FUKA 2OKNA 1B6AA 1C22A 4A6VA 3L24A 4ZNGA 2B3KA 1JAWA 3PKAA 4U6WA 4R60A 2GU4A 2BWVA 2V3ZA 2BHBA 4IKSA 4RGZ1 3PKDA 4QR8A 1WBQA 2GG0A 1WN1A 3BITA 2ADUA 3FMRA 4IKTA 2BWTA 2V3YA 4ZWPA 1C21A 2BH3A 5E5BA 1XNZA 2P98A 3MATA 5D6FA 4U69A 3S6BA 1A16A 2B3LA 2NQ6A 2NQ7A 1WKMA 4U76A 2BHAA 3D27A 3PKEA 1WLRA 1N51A 3IU7A 2Q94A 3CB5A 4U73A 1W2MA 3FM3A 4B28A 4U6JA 1R58A 1QXYA 1WY2A 2GGCA 2BWWA 3MR1A 5FCFA 2EVMA 5CDEA 1KP0A 4U70A 4HXXA 1WL9A 2BWUA 4U71A
chains in the Genus database with same CATH topology
3IU9A 4OOKA 4EGEA 5D6EA 3BIPA 1YW9A 2Q95A 2GU5A 1XGSA 4U6ZA 2GG8A 5CDVA 1O0XA 2GG2A 5CNXA 4Z7MA 2BHCA 4U6CA 1KQ0A 3IU8A 3TB5A 1W7VA 1PV9A 2IW2A 1R5HA 4FKCA 1KQ9A 3BIQA 5JI6A 2Q92A 2GG3A 4FLIA 4IPAA 2GU7A 3FMQA 4S2TP 2BWYA 3RVAA 1BOAA 1R5GA 3CTZA 1QZYA 3L7GA 2Q8KA 2EA2A 5CE6A 5FCHA 5JFRA 4FO7A 4MATA 3Q6DA 3PKBA 4PV4A 2V3XA 4RZZA 2G6PA 4U1BA 2BN7A 4FLKA 2EVCA 4U6EA 5JHUA 1Y1NA 1YVMA 4ZWOA 2GG5A 2Q96A 4IF7A 2BWSA 2GGBA 4U75A 4ZWUA 2GG7A 2HOWA 3TAVA 4S01A 2BHDA 2EVOA 1M35A 1CHMA 2EA4A 2BWXA 1XGOA 2DFIA 3MX6A 4IKUA 4RZYA 4FLJA 1C27A 2GZ5A 4FO8A 2V6CA 4IECA 4IKRA 1C24A 1YJ3A 2GA2A 3CB6A 2Q93A 5CDLA 3RORA 5CLSA 2MATA 1BN5A 4IDYA 2ZSGA 4S00A 2GG9A 3IG4A 4S2RP 1B59A 2GU6A 2BB7A 5CIKA 1C23A 4A6WA 2P99A 4FLLA 1XGMA 1QXZA 4JUQA 3PKCA 2GTXA 2OAZA 1QXWA 1XGNA 1WL6A 1YW8A 4PNCA 2B3HA 1YW7A 4IU6A 2P9AA 4KM3A 1MATA 4FUKA 2OKNA 1B6AA 1C22A 4A6VA 3L24A 4ZNGA 2B3KA 1JAWA 3PKAA 4U6WA 4R60A 2GU4A 2BWVA 2V3ZA 2BHBA 4IKSA 4RGZ1 3PKDA 4QR8A 1WBQA 2GG0A 1WN1A 3BITA 2ADUA 3FMRA 4IKTA 2BWTA 2V3YA 4ZWPA 1C21A 2BH3A 5E5BA 1XNZA 2P98A 3MATA 5D6FA 4U69A 3S6BA 1A16A 2B3LA 2NQ6A 2NQ7A 1WKMA 4U76A 2BHAA 3D27A 3PKEA 1WLRA 1N51A 3IU7A 2Q94A 3CB5A 4U73A 1W2MA 3FM3A 4B28A 4U6JA 1R58A 1QXYA 1WY2A 2GGCA 2BWWA 3MR1A 5FCFA 2EVMA 5CDEA 1KP0A 4U70A 4HXXA 1WL9A 2BWUA 4U71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU9 A;  4OOK A;  4EGE A;  5D6E A;  3BIP A;  1YW9 A;  2Q95 A;  2GU5 A;  1XGS A;  4U6Z A;  2GG8 A;  5CDV A;  1O0X A;  2GG2 A;  5CNX A;  4Z7M A;  2BHC A;  4U6C A;  1KQ0 A;  3IU8 A;  3TB5 A;  1W7V A;  1PV9 A;  2IW2 A;  1R5H A;  4FKC A;  1KQ9 A;  3BIQ A;  5JI6 A;  2Q92 A;  2GG3 A;  4FLI A;  4IPA A;  2GU7 A;  3FMQ A;  4S2T P;  2BWY A;  3RVA A;  1BOA A;  1R5G A;  3CTZ A;  1QZY A;  3L7G A;  2Q8K A;  2EA2 A;  5CE6 A;  5FCH A;  5JFR A;  4FO7 A;  4MAT A;  3Q6D A;  3PKB A;  4PV4 A;  2V3X A;  4RZZ A;  2G6P A;  4U1B A;  2BN7 A;  4FLK A;  2EVC A;  4U6E A;  5JHU A;  1Y1N A;  1YVM A;  4ZWO A;  2GG5 A;  2Q96 A;  4IF7 A;  2BWS A;  2GGB A;  4U75 A;  4ZWU A;  2GG7 A;  2HOW A;  3TAV A;  4S01 A;  2BHD A;  2EVO A;  1M35 A;  1CHM A;  2EA4 A;  2BWX A;  1XGO A;  2DFI A;  3MX6 A;  4IKU A;  4RZY A;  4FLJ A;  1C27 A;  2GZ5 A;  4FO8 A;  2V6C A;  4IEC A;  4IKR A;  1C24 A;  1YJ3 A;  2GA2 A;  3CB6 A;  2Q93 A;  5CDL A;  3ROR A;  5CLS A;  2MAT A;  1BN5 A;  4IDY A;  2ZSG A;  4S00 A;  2GG9 A;  3IG4 A;  4S2R P;  1B59 A;  2GU6 A;  2BB7 A;  5CIK A;  1C23 A;  4A6W A;  2P99 A;  4FLL A;  1XGM A;  1QXZ A;  4JUQ A;  3PKC A;  2GTX A;  2OAZ A;  1QXW A;  1XGN A;  1WL6 A;  1YW8 A;  4PNC A;  2B3H A;  1YW7 A;  4IU6 A;  2P9A A;  4KM3 A;  1MAT A;  4FUK A;  2OKN A;  1B6A A;  1C22 A;  4A6V A;  3L24 A;  4ZNG A;  2B3K A;  1JAW A;  3PKA A;  4U6W A;  4R60 A;  2GU4 A;  2BWV A;  2V3Z A;  2BHB A;  4IKS A;  4RGZ 1;  3PKD A;  4QR8 A;  1WBQ A;  2GG0 A;  1WN1 A;  3BIT A;  2ADU A;  3FMR A;  4IKT A;  2BWT A;  2V3Y A;  4ZWP A;  1C21 A;  2BH3 A;  5E5B A;  1XNZ A;  2P98 A;  3MAT A;  5D6F A;  4U69 A;  3S6B A;  1A16 A;  2B3L A;  2NQ6 A;  2NQ7 A;  1WKM A;  4U76 A;  2BHA A;  3D27 A;  3PKE A;  1WLR A;  1N51 A;  3IU7 A;  2Q94 A;  3CB5 A;  4U73 A;  1W2M A;  3FM3 A;  4B28 A;  4U6J A;  1R58 A;  1QXY A;  1WY2 A;  2GGC A;  2BWW A;  3MR1 A;  5FCF A;  2EVM A;  5CDE A;  1KP0 A;  4U70 A;  4HXX A;  1WL9 A;  2BWU A;  4U71 A; 
#chains in the Genus database with same CATH topology
 3IU9 A;  4OOK A;  4EGE A;  5D6E A;  3BIP A;  1YW9 A;  2Q95 A;  2GU5 A;  1XGS A;  4U6Z A;  2GG8 A;  5CDV A;  1O0X A;  2GG2 A;  5CNX A;  4Z7M A;  2BHC A;  4U6C A;  1KQ0 A;  3IU8 A;  3TB5 A;  1W7V A;  1PV9 A;  2IW2 A;  1R5H A;  4FKC A;  1KQ9 A;  3BIQ A;  5JI6 A;  2Q92 A;  2GG3 A;  4FLI A;  4IPA A;  2GU7 A;  3FMQ A;  4S2T P;  2BWY A;  3RVA A;  1BOA A;  1R5G A;  3CTZ A;  1QZY A;  3L7G A;  2Q8K A;  2EA2 A;  5CE6 A;  5FCH A;  5JFR A;  4FO7 A;  4MAT A;  3Q6D A;  3PKB A;  4PV4 A;  2V3X A;  4RZZ A;  2G6P A;  4U1B A;  2BN7 A;  4FLK A;  2EVC A;  4U6E A;  5JHU A;  1Y1N A;  1YVM A;  4ZWO A;  2GG5 A;  2Q96 A;  4IF7 A;  2BWS A;  2GGB A;  4U75 A;  4ZWU A;  2GG7 A;  2HOW A;  3TAV A;  4S01 A;  2BHD A;  2EVO A;  1M35 A;  1CHM A;  2EA4 A;  2BWX A;  1XGO A;  2DFI A;  3MX6 A;  4IKU A;  4RZY A;  4FLJ A;  1C27 A;  2GZ5 A;  4FO8 A;  2V6C A;  4IEC A;  4IKR A;  1C24 A;  1YJ3 A;  2GA2 A;  3CB6 A;  2Q93 A;  5CDL A;  3ROR A;  5CLS A;  2MAT A;  1BN5 A;  4IDY A;  2ZSG A;  4S00 A;  2GG9 A;  3IG4 A;  4S2R P;  1B59 A;  2GU6 A;  2BB7 A;  5CIK A;  1C23 A;  4A6W A;  2P99 A;  4FLL A;  1XGM A;  1QXZ A;  4JUQ A;  3PKC A;  2GTX A;  2OAZ A;  1QXW A;  1XGN A;  1WL6 A;  1YW8 A;  4PNC A;  2B3H A;  1YW7 A;  4IU6 A;  2P9A A;  4KM3 A;  1MAT A;  4FUK A;  2OKN A;  1B6A A;  1C22 A;  4A6V A;  3L24 A;  4ZNG A;  2B3K A;  1JAW A;  3PKA A;  4U6W A;  4R60 A;  2GU4 A;  2BWV A;  2V3Z A;  2BHB A;  4IKS A;  4RGZ 1;  3PKD A;  4QR8 A;  1WBQ A;  2GG0 A;  1WN1 A;  3BIT A;  2ADU A;  3FMR A;  4IKT A;  2BWT A;  2V3Y A;  4ZWP A;  1C21 A;  2BH3 A;  5E5B A;  1XNZ A;  2P98 A;  3MAT A;  5D6F A;  4U69 A;  3S6B A;  1A16 A;  2B3L A;  2NQ6 A;  2NQ7 A;  1WKM A;  4U76 A;  2BHA A;  3D27 A;  3PKE A;  1WLR A;  1N51 A;  3IU7 A;  2Q94 A;  3CB5 A;  4U73 A;  1W2M A;  3FM3 A;  4B28 A;  4U6J A;  1R58 A;  1QXY A;  1WY2 A;  2GGC A;  2BWW A;  3MR1 A;  5FCF A;  2EVM A;  5CDE A;  1KP0 A;  4U70 A;  4HXX A;  1WL9 A;  2BWU A;  4U71 A; 
#chains in the Genus database with same CATH homology
 3IU9 A;  4OOK A;  4EGE A;  5D6E A;  3BIP A;  1YW9 A;  2Q95 A;  2GU5 A;  1XGS A;  4U6Z A;  2GG8 A;  5CDV A;  1O0X A;  2GG2 A;  5CNX A;  4Z7M A;  2BHC A;  4U6C A;  1KQ0 A;  3IU8 A;  3TB5 A;  1W7V A;  1PV9 A;  2IW2 A;  1R5H A;  4FKC A;  1KQ9 A;  3BIQ A;  5JI6 A;  2Q92 A;  2GG3 A;  4FLI A;  4IPA A;  2GU7 A;  3FMQ A;  4S2T P;  2BWY A;  3RVA A;  1BOA A;  1R5G A;  3CTZ A;  1QZY A;  3L7G A;  2Q8K A;  2EA2 A;  5CE6 A;  5FCH A;  5JFR A;  4FO7 A;  4MAT A;  3Q6D A;  3PKB A;  4PV4 A;  2V3X A;  4RZZ A;  2G6P A;  4U1B A;  2BN7 A;  4FLK A;  2EVC A;  4U6E A;  5JHU A;  1Y1N A;  1YVM A;  4ZWO A;  2GG5 A;  2Q96 A;  4IF7 A;  2BWS A;  2GGB A;  4U75 A;  4ZWU A;  2GG7 A;  2HOW A;  3TAV A;  4S01 A;  2BHD A;  2EVO A;  1M35 A;  1CHM A;  2EA4 A;  2BWX A;  1XGO A;  2DFI A;  3MX6 A;  4IKU A;  4RZY A;  4FLJ A;  1C27 A;  2GZ5 A;  4FO8 A;  2V6C A;  4IEC A;  4IKR A;  1C24 A;  1YJ3 A;  2GA2 A;  3CB6 A;  2Q93 A;  5CDL A;  3ROR A;  5CLS A;  2MAT A;  1BN5 A;  4IDY A;  2ZSG A;  4S00 A;  2GG9 A;  3IG4 A;  4S2R P;  1B59 A;  2GU6 A;  2BB7 A;  5CIK A;  1C23 A;  4A6W A;  2P99 A;  4FLL A;  1XGM A;  1QXZ A;  4JUQ A;  3PKC A;  2GTX A;  2OAZ A;  1QXW A;  1XGN A;  1WL6 A;  1YW8 A;  4PNC A;  2B3H A;  1YW7 A;  4IU6 A;  2P9A A;  4KM3 A;  1MAT A;  4FUK A;  2OKN A;  1B6A A;  1C22 A;  4A6V A;  3L24 A;  4ZNG A;  2B3K A;  1JAW A;  3PKA A;  4U6W A;  4R60 A;  2GU4 A;  2BWV A;  2V3Z A;  2BHB A;  4IKS A;  4RGZ 1;  3PKD A;  4QR8 A;  1WBQ A;  2GG0 A;  1WN1 A;  3BIT A;  2ADU A;  3FMR A;  4IKT A;  2BWT A;  2V3Y A;  4ZWP A;  1C21 A;  2BH3 A;  5E5B A;  1XNZ A;  2P98 A;  3MAT A;  5D6F A;  4U69 A;  3S6B A;  1A16 A;  2B3L A;  2NQ6 A;  2NQ7 A;  1WKM A;  4U76 A;  2BHA A;  3D27 A;  3PKE A;  1WLR A;  1N51 A;  3IU7 A;  2Q94 A;  3CB5 A;  4U73 A;  1W2M A;  3FM3 A;  4B28 A;  4U6J A;  1R58 A;  1QXY A;  1WY2 A;  2GGC A;  2BWW A;  3MR1 A;  5FCF A;  2EVM A;  5CDE A;  1KP0 A;  4U70 A;  4HXX A;  1WL9 A;  2BWU A;  4U71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...