3MB5A

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-methionine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
b'MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 75
structure length 255
sequence length 255
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3mb5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mb5A02
4QDKA 2VDWA 3RW9A 2O0LA 3DR5A 2HMYB 2NXNA 3LKDA 4PNEA 3R6TA 4BP3A 4EKIA 1JG4A 3G88A 5LQNA 1KR5A 3BWYA 2JH9A 5EKUA 4PYJA 4PYMA 3EGVA 2ZW9A 3HA7A 2XYRA 4RTSA 2ZIGA 4DQ0A 5DWQA 3ELUA 2ONYA 1INLA 3TMAA 1JQEA 2PGXA 2P1DA 3HNRA 2ZZMA 1DL5A 3OZTA 3K6RA 1NT2A 3A26A 3B3FA 2N47A 1RI2A 3T7SA 1VP9A 5CUQA 5FWAA 5HIIA 4DCMA 2YX1A 3GRVA 3BXOA 3EVBA 1X1DA 1FP2A 1L3BA 3UJ7A 3OPNA 2R6ZA 2WA2A 4YMHA 4XUEA 3WSTA 5FULA 4ER6A 4L7VA 4AZVA 2H00A 3LSTA 2ZZNA 3KQQA 4RTMA 1XCLA 3BKWA 4MTLA 3SXJA 1NBIA 1NW7A 2AOXA 4E33A 1MJFA 5DRYA 3TOSA 3ID6C 3NJRA 2UZ4A 3SGLA 5K0BA 3R24A 1IXKA 5E1BA 1XJ5A 3EVAA 4EK9A 4CTKA 1EAMA 1NW5A 3SSOA 3PFGA 3I9FA 5E9WA 2E5WA 3HVIA 5GIOE 1KP9A 5E1OA 3SM3A 2PXAA 2Z6AA 1JQ3A 3HCFA 1KXZA 2ZIFA 2QE6A 2AN3A 3E05A 4CKBA 4POOA 1O9HA 3M6VA 3BGIA 2A14A 2NP6A 5EEGA 2AN4A 3FTCA 3FUUA 2O05A 3PLAE 4GOND 4ATNA 1H1DA 5GWXA 5F2OA 3TR6A 2OY0A 5DM1A 4BP1A 3HCEA 5E9JA 4DF3A 5LQKA 3HM2A 2BM9A 2OPBA 3G8AA 3SR4A 2OO3A 5F2KA 2GH1A 2IBSA 3FTEA 3C6KA 1T43A 3CVOA 2CMGA 1KPHA 4C08A 4GOOD 1RI5A 4OBWA 3GWZA 1JG1A 3M6WA 3PVCA 5FQOA 2IBTA 2P41A 1L3CA 3BT7A 5EZSA 1YZ3A 3U81A 4YUVA 5U4XA 1KYZA 4QVKA 4AZWA 3FPJA 4HGZA 4QVGA 3P9CA 3AJDA 2ZCJA 4F85A 1UWVA 1WXWA 3LDFA 1ZGAA 3PFHA 3UBTA 4X60A 3B3GA 4DKJA 5DTMA 4YUWA 3I64A 1Z3CA 3B3JA 5K09A 3UWPA 2QRVB 3NW9A 1JTEA 3IV6A 3HEMA 3O4FA 4MQ4A 4MHTA 1SG9A 5T64A 2UYHA 3EVZA 3EVDA 4U7TB 3ELWA 3P2KA 4FP9A 2FK8A 3AXSA 2Z6UA 3NMUF 3A7DA 1XTPA 3NTVA 1RI1A 2OB1A 3I58A 3MB5A 3UFBA 2ZTHA 3V97A 3OFKA 4ER0A 5BW5A 5LR6A 1WXXA 2OKCA 3CJQA 3P9IA 1P91A 4E2YA 3GIWA 3A27A 4GUAA 1YFLA 3FUTA 2YXDA 1RJGA 3EGIA 2PXCA 3KQWA 5FUBA 1NW8A 3UJ9A 2WK1A 5FHQA 4YV0A 4LWPA 3CJRA 5K0LA 1QZZA 3HVHA 3IEIA 4CKCA 3LGAA 1RJDA 4X61A 5EPEA 2JHAA 3FTDA 5KYGA 5LQJA 5LQUA 4KIFA 3NDIA 4PWYA 3DXZA 5IKMA 1FPQA 3FRHA 4E70A 4RTQA 1V39A 1YB2A 3HA3A 2AN5A 2HTEA 2OB2A 3PT9A 3FPFA 5FADA 1EIZA 5EC8A 2G1PA 3GO4A 5BXYA 4X63A 2HWKA 1R00A 4P7FA 5P8WA 5F2NA 3MTIA 3OZSA 3P2IA 5CVVA 2EX4A 4A6DA 5GINE 4GEKA 5K0FA 2EFJA 1L3IA 2VS1A 3HA5A 5EMJA 2ZBQA 3MTEA 4GQBA 4HSGA 3EVFA 4ISCA 4R6WA 2IDJA 8MHTA 3GXOA 4M7RA 3SVZA 3REOA 2EG5A 3LL7A 4P7KA 4E32A 3DH0A 4HRAA 4RVFA 1D2CA 2BR5A 3KQSA 4ZTBA 3OCJA 3VC2A 3KR9A 3BWBA 1F38A 4HGYA 4M37A 4PYLA 2B9EA 2NXCA 4PYIA 4YV2A 5LSAA 2DULA 4RTNA 4FSXA 4XCXA 2PY6A 1FP1D 4HH4A 5HIJA 2I6GA 4YUXA 3FYDA 1ZG3A 2AOTA 2V74B 1R74A 3O7WA 4Y2HA 4U7PB 4BY9E 2ERCA 2PBFA 2JG3A 3M33A 1Q0SA 2P35A 3TLJA 3R0QA 4Y30A 2OYRA 4DZRA 1QAOA 1KIAA 4LECA 2ZWAA 1O54A 1RJFA 5DRTA 1BHJA 1XCJA 4XUDA 2I62A 4RYLA 5CVUA 5GM1A 5H02A 1FJXA 2I7CA 5C1IA 2GB4A 1U2ZA 2FYTA 3DMFA 3FYCA 4GOLD 1JSXA 3TKAA 2DPMA 3I5UA 3KQPA 2AR0A 3GJYA 1RJEA 4RTOA 3TQSA 3TRKA 3G5LA 3EVCA 3DP7A 5GP1A 3UA4A 1JTFA 2P40A 3QOWA 1QYRA 3ER9A 3L8DA 4EMSA 2QY6A 3E8SA 3G2QA 1I4WA 2AZTA 3FUWA 3ANXA 3LCUA 5EG5A 4RV9A 3UZUA 4IKPA 3UJ6A 2ZBPA 3P71T 2JJQA 2NXEA 1JG2A 4QPPA 2VP3A 5EMKA 2WA1A 5C9ZA 2IFTA 5KQSA 2FK7A 4BLVA 1NBHA 2B78A 5DSXA 4IWNA 3OE4A 5K8VA 5JR3A 4YUYA 3M4XA 4KVZA 3UJBA 3NWBA 3NWEA 3E23A 1ZKDA 3G7UA 2ZWVA 5CM2Z 4OX9Y 2FRXA 2YQZA 3ME5A 5K0CA 1G6Q1 4C4AA 1VLMA 3HTXA 3TFWA 5DLYA 4F86A 1X19A 3BKXA 2IPXA 2YR0A 3C0KA 3K0BA 3KR1A 5EZQA 3X0DA 5K0JA 3KQTA 2ZLBA 5FTWA 4KDRA 1R18A 4RSRA 3LCVB 4Z2YA 4QTTB 3AY0A 5FHRA 2IIPA 4IV0A 3KKZA 2AOVA 2BR4A 1WZNA 3KR2A 2P7IA 4FT2A 4RTKA 3Q87B 2C7PA 3OU7A 2NNWB 5CVDA 3TKYA 3UJCA 3VSEA 3CJTA 2XBMA 1D2HA 1BC5A 5B1SA 3BWCA 2GLUA 3EVGA 4O29A 4H0NA 2PV0A 1NW3A 3EMBA 3KQYA 3T7RA 3VC1A 5LQAA 2IDKA 3ELYA 2PSSA 4CKEA 3OZRA 1NE2A 2H11A 3DLCA 3GRZA 2QM3A 3LECA 10MHA 4WXHA 1NV9A 2VDUE 2BR3A 1G60A 1VPTA 3HCDA 4MWZA 2AOWA 3T0IA 4PGHA 3THRA 5G02A 4GBED 4RVDA 5DSTA 4F84A 2JHPA 3G8BA 2Y1XA 3SSNA 1VL5A 7MHTA 1XDSA 3EEOA 3G89A 3LCCA 4HC4A 2CL5A 5DM2A 1QAQA 4GOMD 4DA4A 1AV6A 2ESRA 3G2OA 4K6MA 4RVHA 1JQDA 3EMDA 5FCDA 4PGGA 1JSZA 5DXJA 5EVJA 3NVKI 1G38A 2IP2A 4KRGA 1I1NA 3JWIA 5DTQA 5HEKA 3TM5A 2K4MA 1R6AA 5EQJB 2PX2A 2OBFA 2ZULA 5CCXA 4C06A 1Q0TA 3M6UA 4PYQA 4HTFA 2AVNA 2G8NA 4M38A 5ICGA 2AOTB 3AXTA 5DM0A 4A6EA 1FBNA 4CWAA 1MHTA 5HOQA 3V8VA 4RX1A 3S68A 5EIFA 4QTUB 2P3QA 4XUCA 1SVUA 5K03A 3GDHA 2BZGA 5CIYA 3HCAA 1D2GA 3FRIA 2JHCA 1IY9A 3DULA 3FUVA 4E2ZA 5K05A 2F8LA 1QAMA 3HP7A 3O31A 3MERA 2AVDA 2FPOA 5EEHA 4RWZA 3PTAA 4ER3A 3KQMA 4QQKA 2UYCA 2NP7A 1P39A 3SSMA 3P2EA 5GM2A 5K0NA 2ZIEA 3PB3A 1JR4A 1YFJA 3DXYA 5D1NA 2NXJA 1UIRA 3NDJA 4QQNA 2GA9A 4C03A 1Y8CA 2ONZA 2AOUA 4E2XA 5ICFA 2VZ9A 3LBYA 3KPJA 4PCLA 4YUZA 2PWPA 2NYUA 2OZVA 1WY7A 4V0RA 4FT4A 3FTFA 3LHDA 2G72A 2YXEA 1AF7A 3UJAA 4HG2A 4RTPA 2V7EA 3MHTA 2ZSUA 3PX3A 2GS9A 3DMHA 2XYVA 4V0QA 5D1HA 2ADMA 2ZZKA 3EGEA 4OQEA 4RTRA 5HZMA 1RI3A 1ORHA 3KPYA 4G56A 4PCAA 2BH2A 3P9KA 3DOUA 3ER8A 1HMYA 4QPNA 3DMGA 3FUXA 1SUIA 3IYLW 4PYNA 4PYKA 1L9KA 1RI4A 2XVAA 3THSA 5KQRA 3C3PA 4KIGA 4OBXA 1VQ1A 3EPPA 4GF5A 1SUSA 3LKZA 5DX0A 5ICCA 2IH5A 2IH4A 2LD4A 2GAFA 4DCGA 1WG8A 4KW7A 3A25A 3UA3A 4YV1A 3CC8A 2C7RA 1QANA 3G2MA 4LWOA 1XVAA 4KWCA 4AX8A 1SQFA 3ORHA 1PRYA 3GGDA 4M36A 1AQJA 3A4TA 3GU3A 4AUKA 5EMMA 4BLWA 1F3LA 1PJZA 1TPYA 3GRYA 5E8JA 2UYOA 2C7OA 5LQRA 5BP7A 5CVJA 4ER5A 4RTLA 5DXAA 5E8RA 2AS0A 4X41A 4C07A 2PT6A 4OA5A 5E2AA 5FWDA 5K01A 2PLWA 4OQDA 4QDJA 4LG1A 3D2LA 3I53A 4PINA 1YF3A 2PX5A 4FR0A 4WVLA 3EEYA 3C3YA 2ZFUA 2EJTA 1SQGA 3B7PA 5EHIA 2HV9A 3QV2A 5DX1A 4AZSA 4B17A 3KU1A 2XYQA 5EHGA 4EKGA 1R8YA 1ZGJA 2ORED 3KPVA 2C7QA 4R8RA 1M6EX 1M6YA 3P8ZA 3T7TA 5ERGB 4KDCA 3UJ8A 2OXTA 4HTFB 3KR0A 4C05A 1DUSA 3Q7EA 1KHHA 2YTZA 5T6BA 5HIMA 5LQCA 1BKYA 4CXMA 2KW5A 4IV8A 2VDVE 3F4KA 4P7JA 4DMGA 1YZHA 2PKWA 4MIKA 1M0EA 2GPYA 2O06A 3R9XB 3HCBA 2QYOA 2Y1WA 3CGGA 3HVJA 3PX2A 1NV8A 5GIPE 2O07A 4YMGA 1EQAA 1HNNA 3GCZA 2HR1A 5DPMA 3BGDA 3SMQA 1VIDA 1EG2A 1OR8A 1X1BA 2EJUA 3MCZA 4E2WA 1DCTA 5C0OE 4E30A 4R8SA 3TM4A 3IHTA 5E9QA 4FS8A 3A7EA 2AOUB 3MAGA 1X1AA 2H1RA 5DT2A 1XDZA 1ZQ9A 1YUBA 2PVCA 2ZVJA 3G5TA 3JWGA 2YVLA 2P3OA 3AWIA 4JXJA 2G70A 3B5IA 3GNLA 4PYOA 5K0GA 4R05A 1XXLA 3TPZA 4ER7A 5ICEA 5E2BA 2CMHA 1KPGA 1O9GA 3DUWA 3G2PA 2IH2A 1EJ6A 3VYWA 3LPMA 5KVAA 1IM8A 5M5BA 3OFJA 5GOZA 2PX4A 1ORIA 3FPGA 4OA8A 1BOOA 4R6XA 5HFJA 4AZTA 4E31A 2O57A 3ELDA 2PT9A 3HCCA 3NVMB 3BGVA 4FZVA 1NKVA 3CKKA 3OU2A 4P58A 4NECA 3M70A 4PIPA 3RODA 4EQZA 3KPUA 3OE5A 3JWJA 3BUSA 1SKMA 3CCFA 3BZBA 1KPIA 1VE3A 2B3TA 4PIMA 1N7JA 2R3SA 4FGZA 1G55A 1X1CA 4C04A 3CBGA 2Z6QA 2B25A 4RTJA 3DXXA 3GRRA 3KQOA 5E1DA 3DTNA 3MGGA 1I9GA 1B42A 2JH8A 5EGSA 3MQ2A 4CTJA 2PJDA 1N2XA 3OU6A 9MHTA 4GC9A 2UYQA 5CD1A 5DX8A 3RIEA 2BM8A 1NW6A 1JG3A 3FPHA 3M6XA 5DTRA 1AQIA 1P1CA 2I9KA 1VP3A 1KYWA 2Q41A 2PX8A 2IGTA 3KHKA 3B89A 5CVEA 1R8XA 1ZHFA 2P7HA 1G8SA 2B2CA 1P1BA 1VBFA 2P3LA 3HVKA 3LDUA 2FCAA 5FA8A 2PWYA 4PONA 1UFKA 1WS6A 1G8AA 3ERCA 1L1EA 4DM3A 4UOEA 3LX6A 4EVIA 5DM4A 3MCTA 5E1MA 5FA5A 5K0EA 4FSDA 3SX0A 5HIKA 1XDUA 3LDGA 3C6MA 1TW3A 4BLUA 3LBFA 3H2BA 5IH3A 2XVMA 2HNKA 2ZBRA 5MHTA 4RVGA 3R3HA 3E7PA 5CCBA 5JUWA 3KQVA 3DLIA 3FZGA 2QRVA 5EIWA 5T67A 3EVEA 3P9NA 3FPEA 2CKDA 3PS9A 5EMLA 3QOXA 3BWMA 1EJ0A 3GRUA 5EKXA 2YUIA 1TW2A 3UJDA 3JWHA 3P97A 4P7GA 2PXXA 2P8JA 5EOVA 2YXLA 4GC5A 2CWWA 5HILA 5BW4A 5KS2A 1N7IA 2FHPA 4X1OA 3KPWA 5FQNA 2G71A
chains in the Genus database with same CATH superfamily
1ZK1A 2BDTA 3E9MA 2HZ7A 3LWDA 5CM9C 5BMVF 2IP4A 1NAIA 1VL8A 3Q0IA 1Z08A 2FEWB 2HNAA 4LOIA 1DZIA 3JATB 4R7TA 3DNPA 3P4UA 1ARZA 3I1FA 3OLWA 3S1AA 3RGGA 3CN7A 4LMBA 1Z3IX 3GLIE 1Q1BA 1MB4A 3QELB 1USUA 3ED1A 1BMTA 1TMOA 1NULA 1OA0A 1VJDA 1WB6A 1V8ZA 1VHWA 2W2MA 3EBPA 3U17A 5BUSA 2OM6A 5FEUA 3T8YA 3T6KA 2BDUA 3JYPA 3P0IA 2CHQA 4G07A 1MJGA 1L7BA 1XO1A 2Q2QA 3PJEA 4LXXA 3UJ7A 3A3OA 4HV4A 1E9RA 1I2BA 4NOMA 2ONKA 3HUFA 4HWTA 4KO4S 4M9ZA 4BX9A 1QKKA 1TB4A 2WF9A 2Z5LA 1JLLA 4TS1A 2RONA 1NMXA 4FUQA 4RTMA 3ADDA 5D7NA 5G0WA 4C43A 5FV7A 4D3ZA 1L5MA 5ALGA 5EIEA 5LOVA 1FNSA 2B4QA 1YTLA 2VWPA 3S2EA 4CQMD 1TCUA 3LK7A 5DCYA 5FKJA 3VJLA 3ZQJA 1COWA 3UKJA 4BNZA 4UOEA 3K70C 2Q4RA 3GJXC 4PLYA 3VZDA 1EX7A 4HDKB 3K4PA 4Y0AA 3CN9A 3D7NA 3DKIA 2XCQA 4JL5A 4WESB 2BGKA 2W0MA 1AB6A 1FU4A 3JARA 3K9BA 3UWSA 1ZD8A 2IOHA 5CFQA 1DWUA 1ODTC 4CKBA 1FFWA 1X7HA 3QG5A 1PT9A 3AQ4A 1RYNA 1B16A 5CH5A 2OXCA 3FUUA 4LVNA 4QYIA 4S2EA 5EEGA 1CZ5A 3E5NA 3NEAA 5D2CA 5FPHA 3UYKA 5LNK6 1GT6A 2GKSA 3P9QA 4CBVA 1DAKA 1V2GA 3SR4A 3QKRB 1HDGO 2XVZA 4NCJA 1DWOA 2E1PA 3FSJX 3WK5A 5ECDA 3OF3A 5IT0A 3D59A 3EW7A 4K2HA 3M81A 2XDYA 4TRNA 1TCBA 3NBMA 3UHJA 2ZVPX 1DEHA 5LOVF 1C5KA 4Y8VA 3WRYA 5K3EA 3OZBA 3PVCA 3UK0A 9LDBA 2IBTA 3PL1A 3ZZMA 4DV6B 3ZDAA 2VQFB 3I39X 1Z4KA 4JYMA 3PEVA 4ALJA 4I08A 4ZCLA 3IHKA 4GYJA 5KCMA 1U0LA 1I30A 3RRNA 1O95C 4ZT7A 1QCCA 4PRZA 5ILQA 4DXAA 5LD2B 3NP7A 2QXYA 3OKCA 3L7OA 3PC2A 4W5JA 4JK3A 1ODLA 5F77A 5A3VA 5AUNB 4O5OA 3G0HA 1F5NA 1QF7A 3M49A 4ENSA 2WMDA 3UJHA 5T64A 1WIWA 1I10A 4UUPA 2C83A 2CB0A 3TLEA 4BMNA 5BW5A 1K86A 1Q2XA 1E1YA 1Y7PA 5H8WA 2JLXA 3DBRA 3KVYA 4INAA 1MJ5A 1TEHA 2B6NA 1ISHA 2O2SA 3RUHA 4DLRA 4FS3A 4TT8A 4W8GA 2Y76A 1BXGA 3S3TA 5IDXA 1VI2A 3KDPA 1P29A 1FLNA 1HH4A 1O3YA 3SG0A 2AZDA 3ZDXB 4DMMA 1X0XA 3PCTA 3O8LA 2J5BA 2XYHA 4QLAA 5DKFA 3SZRA 4HS4A 1E2BA 1ACJA 2XEXA 4KIFA 2JL1A 2G1AA 2WPDA 3ENZA 3F7NA 4ACAA 5FADA 1LY1A 3EWIA 3FPFA 1YZNA 2QRUA 2G1PA 2XUOA 1IXYA 4EW1A 4X63A 1MEEA 1TLFA 3DHVA 4P7FA 2NZ2A 2BTQA 3LLVA 2QTFA 3LFUA 1CR5A 2B8WA 2FFQA 2ZI4A 1N2JA 3JYNA 1U9IA 5TC4A 3TQOA 5JBQA 3RYIB 1S01A 2HLDA 3WC4A 2YV2A 3R0JA 4DJ5X 2VS1A 3U7QB 4L4XA 4B32A 3V33A 4UAJA 3MGAA 1Y1QA 2Q1XA 2NZXA 1KJZA 3OX3A 5G41A 4ACBA 1N2EA 3H13A 2DFLA 2BP7A 1O89A 1PSWA 2MOKA 5KNDH 4Q3KA 2DQKA 3HKCB 1IK6A 4KQCA 1K6JA 2I7DA 4P0TA 4CR8A 2YJ6A 3VC2A 3UMGA 1OAOC 2Y68A 3ENNA 4HB4A 1NKSA 3IHLA 3EXHA 4J1TA 5DH9A 2H18A 4Q21A 4N5IX 1OIVA 3EF3A 4EY3A 3NBYC 4DV4B 1Y3HA 4Q3OA 5C1PA 3JAMA 4A26A 4LZAA 2MWMA 1ZD4A 2ODTX 1JVNA 3M3HA 2CJWB 2I8LA 3O3OB 2O2JA 2QQFA 4HH4A 2G63A 3A9SA 5IX8A 4YDRA 1H6BA 2X0IA 4A6XA 4BNTA 4EQ6A 1BVRA 1GZ4A 1FFCA 1F2UA 3RVNA 4BQIA 1NJGA 3CHYA 3DCJA 3PC7A 2H9IA 4EB3A 4RE6A 4WZBA 2DBYA 4W6QA 3KV3O 2OVBA 1ODSA 1T34A 1KMHB 5DCUA 4ZALA 4UQOA 1XCJA 2I62A 2WYHA 1U2ZA 2D2XA 2JANA 1FVXA 3PDIB 1Z73A 4Y2JA 3VVBA 3LXMA 1RHMA 2ID7A 1WU8A 2Z2KA 1VHJA 3G9TA 4P5PA 3UV7A 4AJNA 2Q99A 5ADUS 3T4XA 1D5CA 3QLVA 5FRDA 3RF6A 5GP1A 4NYMR 2CW5A 5HUQA 3RSFA 3GB9A 3AHDA 4Q4DA 1GTZA 3NBAA 1RLIA 2SKEA 4UOQA 2PBRA 2AZTA 2REQB 3LNCA 1L9XA 1D0IA 1MDFA 1SMKA 2VPZA 2W90A 4N7JA 3PEWA 4G0UA 3P71T 4K46A 2IU6A 1E2IA 4QPZA 3RSHA 4CEHB 1I1HA 1E6CA 3PXDA 4HNAA 4HAOA 2EG9A 3AW8A 4GMXA 1XRRA 1A1SA 1VPLA 2XY4A 2OO7A 3L8YA 5CT6A 3ZWYA 5IBRA 2H5EA 1YHNA 4JGGA 2CSXA 1NNUA 1SUBA 4KRXA 4E5PA 1J97A 3U4IA 3P7MA 1UODA 3W3AD 3SU8A 4OX9Y 4CTNA 5K0CA 3AOGA 1ECFA 3O3NB 1PJRA 4D9HA 5HM6A 3LH5A 2IPXA 4KC0A 3KUUA 1R0XA 3K09A 4Q9HA 2Z1DA 4HWPA 1D2AA 4RSRA 1KFCB 3GARA 3NHZA 3VSCA 2ENUA 2IIPA 3KYDB 4IV0A 2RGCA 4CF6A 4Z3DA 4I3GA 1HT2E 1BGVA 1VSQA 4QYSA 4Z86A 2J5XA 1EA5A 2OORC 4UD2A 2HIAA 1P2BA 2XBMA 2HJGA 5HQJA 5CA1A 5A7FA 4IDEA 2HGZA 2V6MA 1HO3A 3GZTB 2AN9A 2C3OA 2FPUA 1IQ0A 1YZLA 3M5DA 1NLYA 3ELYA 3ZV3A 5KSOA 3HY4A 3GRZA 4YT5A 5LKAA 1V71A 1AKQA 1CR0A 1F4PA 3EZ6A 4DDUA 3BQBA 3OLZA 2XGJA 3QU7A 1ZUIA 4LYAA 2Y6VA 1T5LA 2XUDA 3AO0B 1FFXB 2Y1EA 3U7RA 3OQOA 4LOAA 4QUKA 4LNUB 4RFSA 1KOGA 4IRXA 5FPYA 1I3NA 3DM5A 2R68A 4XD2A 2XNSA 3UCFA 4ZYLA 5FUVA 1XNJA 1BJRE 3F90A 2MSKA 3FGZA 3O2JA 1OQAA 1PBTA 4R9NA 3QTTA 3RRJA 4IJQA 1KI9A 4JN6B 1VPDA 1CZRA 4KGZA 4PGGA 4RA6B 4AJIA 1CG6A 3EMVA 3PQDA 1OX6A 1G19A 3G49A 1B43A 1TAGA 4MWBA 1KAQA 4KRGA 1DWPA 5HEKA 3ZWNA 3AHGA 3H2ZA 4PBTA 2O20A 4UQPA 1OYVA 4FI3C 4WFQA 4EG4A 4MO9A 3KQNA 4OLFA 1JDPA 3K70B 1W4CA 2AOTB 2UZ1B 4CWAA 1RS0A 1GV1A 1TK3A 3I2JA 3EFHA 4RA9B 4B9EA 5K03A 2F9MA 3MJFA 3IEVA 2R7AA 1EEXB 3ZJTA 1XT6A 2RGEA 4DQLA 5M04A 2RCYA 3A1NA 4AB1A 1X39A 3K7EA 1DQZA 3HO8A 1QGDA 5CR9A 5K05A 5CEEA 3UEOA 3ZDRA 1I2ZA 1T3HA 4S12A 5L3SB 2C61A 1QAMA 2XX3A 1KO8A 1GYPA 3ILYA 4HTAA 4DJJA 3NR2A 4Z8YA 3T3MB 5B3KA 4BNKA 1TTHA 4L5JA 3IPAA 1IEVA 1MEOA 4MJ7A 3KSUA 3UAWA 1YNSA 1SC6A 1Y8CA 4QDTA 4RPJA 4MWSA 5H4GA 4G8JA 4D2IA 5JAMA 3EOAI 1KZ6A 1WDKA 1V4VA 4O63O 3GEGA 4RMHA 4C2TA 3GAAA 2F9LA 5KNCH 2P62A 4G1MB 1BSVA 1P75A 2IY8A 2VYND 2BN4A 4L51A 2HHHB 2OZEA 4EFDA 4TLCA 4V0QA 5D1HA 5DGDA 1U98A 3C5VA 5ALPA 1MB0A 2A7QA 1TT5A 2IGBA 4CMGA 3QBEA 4FB5A 3E3AA 1JFSA 2MSLA 1S9HA 1F4VA 3QFSA 4MW0A 2NPOA 4UTOA 2XUPA 3NIGB 3EIEA 5CBPA 4CQLB 3L4BA 2J31A 5A7GA 4KIGA 1R6UA 4BKPA 1FUIA 1NDHA 3NAGA 3VPXA 4TV8B 3MS2A 1LFAA 1VQ1A 3AW9A 3BRWD 4OOFA 2XDPA 3VPBA 1Y9JA 5IJAA 3WDKA 4C29A 2IH4A 2OHIA 2H1CA 5E4JA 3S2GA 1RQLA 3A1DA 3U9LA 2ERYA 5LZ8A 3HWX1 2NTVA 3OQPA 3K35A 1RJ9A 1GTL1 3QLEA 4MLPA 4PU0A 4YRJA 4D57A 1QH9A 2BELA 4BLWA 1RP1A 1OWPA 1QFSA 1RM3A 5B1DA 3JZAA 4Q18A 3C6YA 4OREX 4G01B 2FPPA 4UCXA 2HIGA 2QVYX 3ZGZA 3GFGA 4BJHB 4BKMA 4CIXA 4QHTA 5INTA 4LQLA 2VOEA 5IKPA 3AC0A 1QPZA 3NAZA 2DECA 4ZVPA 1SN7A 4R2KA 5K01A 4JT9A 1SEVA 3MRTA 3KXKA 3OLCX 1OLUB 1V1MA 2WD8A 3A70A 2VUSA 3L41A 4YLGA 4FR0A 4E08A 4TWIA 3C3YA 3RCBA 2XB2A 4OHRA 4HJXA 4PLVA 3S7TA 2BHSA 1QFJA 2GEDA 2YWJA 5EZYA 3NIDB 4QYTA 3AH8A 3WWDA 3I9NA 4OL0A 2BF7A 4G0VA 1AHNA 2BHNA 2WWGA 2HW8A 3LFHA 1RC8A 4IVPA 1DPGA 2FZVA 4H1HA 4V3BA 5HIMA 2P9EA 2CUKA 2EZ8A 3QHAA 4KACA 4MUEA 1JLHA 1RCUA 4ES6A 5GJVC 4C14A 1CR4A 2CVHA 2Q8PA 4NX2A 4QDXA 3F0TA 4N0PA 2QPOA 5JZVA 1JAIA 4YFVA 5TPWB 2PX6A 3I2FA 3C1OA 2ZIVB 3JATA 5DPMA 4N7BA 5CBKA 1YB7A 2MSWA 2XB6A 5ER6A 3BDIA 3ED5A 2NGRA 2GJ9A 3FFBA 2EJUA 3E22B 3TNYA 2VQ3A 1RQNA 1GGNA 1TUEA 3QELA 5C0OE 4LMPA 3EA0A 3H75A 4REMA 2Q1CX 4YJHB 5EZYF 1YKSA 1GN9A 5TS2A 5C5DA 1V8DA 2OXEA 3WWPA 3G82C 3A7EA 2CJPA 1VHLA 1U3CA 3DPUA 1T4CB 5DT2A 4PZZA 2ZVJA 1OTXA 1TEVA 3DMRA 4O8CA 8ATCA 1YB6A 4JXJA 5ALLA 4EMUA 1IHDA 3MPOA 2P67A 4MXDA 1SXQA 3KZNA 3KWMA 3K6KA 4JIMA 4MRNA 4KQ9A 3F96A 3KSDO 2HDNB 1DUIA 3WKBA 1SY7A 4J4HA 3PRKE 5FBRB 2JA1A 1V4NA 1M7GA 4MUKA 4Z1MD 5GOZA 1E2EA 4RAQA 4OA8A 1Y89A 3PGJA 3O3CA 1SB9A 2WM8A 5YASA 1IZ0A 4LY9A 4CL0A 5K6RA 1WNTA 3GDFA 5BNZA 3THWB 4HDKA 4CI9A 1FYVA 1F8UA 1G5PA 3AERB 4U6QA 3A04A 4ALKA 3CCFA 2FR8C 4KQHA 1VGRA 2YWBA 4WE3A 4HNSA 1XQVA 1XZQA 4WESA 5D6OA 3W1VA 3L4JA 5TY0A 4LF9B 4M1OA 3Q9SA 1SUFA 4UTZA 1A27A 3RAGA 3SEAA 3B9PA 3GAFA 4H4DA 5JXHA 4RORA 4R31A 2PL5A 3NC4A 3PD0A 1NQUA 1FNMA 1TIBA 4UDXX 1J5PA 5AHKA 4QOSA 4TVSA 2UYQA 2OECA 1L4UA 4WEQA 2F3RA 3USCS 3QKRA 2R85A 2X22A 3BHMA 3NNSA 1E9DA 2W48A 1R6VA 3FDJA 3KKEA 1IEXA 3PI7A 3RS3A 4A0FA 5JISA 2BFAA 1AQ6A 2A5YB 3TPFA 1O6FA 4DN6A 4XX1A 3U3RA 3PCXA 1NQVA 2IXBA 4JB2A 4KFSA 5B1YA 1BDIA 1E1LA 2GM9A 4KLRA 5IANA 3V2HA 2HC9A 4FYJA 3SLKA 1CUZA 3ND6A 1UOQA 5BY2A 2VK2A 3FVRA 2DHDA 1PL6A 5K0EA 3GUZA 1WHTB 3I1IA 2MHCA 3EHDA 1ACMA 3FTNA 4FN4A 1EVYA 1P9RA 1WXGA 2HNBA 5KQMA 3GLGE 4RVGA 1UBGA 3AYZB 3G9ZA 4EJFA 4GPTA 4RKQA 3STWA 3WV5A 3DLIA 2VDQB 3IDOA 2YHIB 5DLEA 4R83A 1E1RD 2ZI3A 2ZWIA 4MCHA 2F2TA 4NZMA 4JROA 3HJUA 4JOBA 3DE0X 3VNQA 1D7OA 1XZDA 2FJPA 4KE6A 2O2XA 1UAAA 5JD4A 1PU2A 1T5BA 2E48A 2HRBA 1N3IA 3AFIA 2CWWA 3PUKA 1OXXK 2FHPA 3M1IA 2QR2A 2JCYA 4TMYA 3R7AA 1C7FA 4DR1B 1UBHS 2PKEA 4Q48A 5B3JA 1J9GA 2NXNA 4OATA 1VB3A 3IPLA 3W5CA 2O2DA 4UFOA 4MV5A 1P7YA 1JG6A 1CZNA 4R3WA 5AUQA 3O2NA 3CX7A 2JLQA 3ISVA 3K3PA 3BIOA 4MCIA 1WF6A 1BS2A 2ZIGA 3SSAA 4MUYA 5JDCA 3EQ2A 5ALXA 1R4ZA 3EQ6A 1VKOA 3GH3A 2W2TA 3GVPA 1KOLA 1CR6A 1POWA 2OCIA 2P1DA 4CFSA 5JDIC 4Z4FA 2CT8A 2IYPA 5GJBA 4QEZA 4NNOA 2R8BA 2WUGA 1X7DA 4RC9A 3VOAA 5E4FA 1VJCA 1O5IA 4MI1A 3GNSA 4LF6B 2O5VA 5AM5A 4O25A 4E5UA 2Z56A 2V9ZA 1UBMS 3KQQA 3OEYA 3RYIA 2JI6A 2C54A 3W6OA 1MOZA 2AOXA 1IZ8A 1LDYA 4TLEA 1U0OC 1JH9A 3DFUA 4G4IA 1URPA 4JBNA 1UMDB 3SFZA 2EF0A 4QBHA 4XIFA 1M6NA 4WNIA 3HKCA 4MKRA 3UMJA 5EJ2A 2C00A 3HVIA 4TOIA 2QAJA 4GMGA 3BFVA 3OJEA 1NF9A 2EZTA 4KWIA 1J4AA 4EYKA 4IUDS 4KE7A 3BGIA 4HFMA 4ZVSA 3FNBA 1PNTA 1KJ9A 2CJWA 1AK9A 1XK6A 2DR0A 3A9WA 4A4DA 3U3KA 2GXAA 5IJ9B 4BP1A 4L27A 1PR1A 2GN9A 4FFRA 1L4NA 2BVNA 3RBXA 4C2BA 4ZQBA 4CMEA 5BWOA 2IBSA 1G3MA 1SXJA 4N3NA 1E1NA 3JD4A 5A4MS 4G2TA 4IAOA 1F0KA 2ZYIA 4A7PA 1KO5A 1JHYA 1Y4SA 1KMHA 2RB4A 2P6RA 1XROA 2A84A 2ZOSA 3ODPA 3QKWA 4O5AA 1G6HA 3PDIA 2ZXEA 4YUVA 3W9BA 5IN4A 1MEJA 3FJ1A 4I4IA 4WZAB 4I5FA 4RPKA 4AZWA 5JCJD 1RQ2A 1U9JA 3C7CB 3GJTA 3NAMA 4WKNA 5GGYA 3FBTA 3K1ZA 4BLQA 5LM3A 1TYEB 2EW8A 2I6FA 3W79A 4AS1A 2Q62A 4IVQA 4ZGWA 2PMWB 5B57C 1RRKA 3B1WA 4YP1A 1OREA 1VKZA 1M6WA 2PLFA 1C7EA 4CEHA 1JYSA 1AT1A 1JTEA 4BAGA 2LDXA 1XMIA 3CUVA 4MQ4A 4RF3A 5LLDA 4A2PA 5CYFA 5JSKA 1YK1A 2YUTA 3CMCO 1SPBS 2BEWB 2PRYA 4MRAA 2CV2A 2C1EA 1LBQA 3NORA 4Q3BA 3U4GA 3UFBA 3QLJA 3A2NA 2GJAA 4Z53A 1EFKA 3NWOA 3N6RA 4EG5A 4ZT3A 1R9GA 4HWOA 5AD1A 4DDMA 2RJOA 4PX5A 1UAGA 2ZTLA 4R71A 1W4BA 3PXBA 2GJ4A 2CB9A 1PK9A 3PZRA 1II0A 1I80A 2EL9A 1ZSVA 2Q2WA 5AHRA 5KREA 1E98A 4AI6A 3EC7A 3GLUA 3ZBUA 3THYB 1M0EA 2WW8A 3LYLA 4BASA 1ZVQA 4MS3B 1Z0IA 5AT1A 4BCBA 1NFQA 3RWOA 1IHXA 3DUFB 2O2GA 1NVBA 2C57A 1D4FA 3KYDA 3MCAA 3SQOA 4RTQA 1X7WB 2IE0A 2I3BA 2OILA 3KKQA 3TX6A 3PJRA 3HV0A 3K5HA 2JFXA 2C3MA 4NY1A 4NVRA 1XMSA 4N5MA 4FFSA 5AM0A 2BJHA 1IXZA 1ELOA 3NETA 5JU6A 2BONA 1B93A 1BMFA 4TN1A 4Z0NA 3LFTA 3TI9A 3UATA 4AW9A 1NMZA 2G06A 3CGWA 4OM8A 1ANKA 1B6TA 4ZO4A 2W4MA 5FLKA 3PYLA 4ESOA 4ISCA 4B43A 4ZIRB 2IDJA 8MHTA 3IT0A 1PG5A 4KV9A 1ZLXA 4LNUA 4CN9A 4OXKA 2XRYA 3GAMA 2Q6TA 3MRSA 1FFYA 2H0RA 3GC6A 1N77A 2H8GA 2R60A 1YVUA 1ZK3A 2Q4EA 2PQ6A 4GPBA 1GUYA 2WG0A 3B53X 2GD2A 3MUOA 1F38A 5AVJA 4RA6A 4X95A 2M6LA 5FBKA 4Q03A 2QX7A 1WUIS 3E58A 3AIMA 4JC8A 1DC3A 1AY0A 2ZRMA 3ORSA 5J4LA 5KCZA 2H48A 1JHZA 1MPXA 2ORYA 2AOTA 2UZ1A 3VO9A 4KPYA 2MYPA 2QIOA 5DBOA 2BHLA 4DWOA 1U7ZA 2QZZA 1KZHA 2VH5R 1A04A 1FSPA 4RA9A 1OV4A 4K9KA 4ZP1A 4G4GA 4WFIA 3DT8A 5D84A 1FSGA 2ASEA 1BWSA 1QU2A 4FX2A 2QP4A 1H8ED 3QA3E 1Y9DA 2BF4A 4LBZA 2R8EA 2L17A 2PYIA 4XUDA 5H02A 1XJCA 1J7JA 2AYYA 3DMFA 3G0IA 2Q5CA 3ZNOA 5L3SA 3ZW9A 3PEYA 3VZRA 2G5TA 4AF7A 1QHEA 2DPMA 4ZJYA 5T7BA 1QONA 4C7KA 6GPBA 4RAOA 1ID1A 5JEEA 4B09A 2OSVA 1AQLA 2F6RA 4IM7A 1OC4A 4K9SA 2Q2OA 1UBNA 2H5LA 3N0RA 3NHSA 2Q3HA 5ESRA 3KZMA 5EG5A 3ANXA 3HJAA 3LAWA 4PR0A 3RO7A 1NP7A 3QVLA 4RPLA 3RTAA 2SECE 3OM1A 4QQRA 1TAUA 2WM3A 1BQ4A 4N9WA 2TS1A 3OEHA 1W76A 1Z0FA 3V7WA 5CFNA 1NBHA 4NK4A 1DEOA 4L0DA 1SKBA 2NZWA 2ZUFA 2QUAA 3P52A 2NUAB 2C9CA 3O8NA 2NQ8A 3LWNA 1Q7GA 1Z4JA 2OUKA 3UIEA 3L1VA 1OKKA 3DLHA 1ECPA 5D3KA 1C0IA 3DYVA 3UMSA 4DCPA 3FHLA 3GAZA 4R8VA 2EKZA 1RABA 1BKSB 2J6HA 2PH7A 3T61A 4CQLA 1PTKA 1NMEA 3OURA 3LY9A 4TV8A 3EA5A 3HC7A 1E7SA 1ISIA 3OX2A 1LK7A 5MFPA 3AZPA 3CZPA 2CLKB 1J33A 2CXNA 3GGJA 3PC4A 4GI5A 4I1OA 4IIEA 3V8RA 4AY3A 4BE7B 2BR4A 2QTMA 4AY4A 3MLEA 4B7UA 1ZIOA 3GRCA 5JJIA 3YASA 1W5EA 4YIKA 4QDOA 3OZWA 2OHGA 5FTNA 1C0LA 4QFMA 3LLCA 4I2VA 3OZRA 2Q7DA 4D4KA 3RIGA 1MC1A 3K53A 2VEOA 2ZATA 1CBUA 3GJQA 4MLCA 1P77A 5G0UA 1I9CA 3T0IA 4BB5A 5A2QA 1XHEA 4Q82A 4QLBA 5EJMA 1CR2A 1SVKA 2B8JA 1I1OA 2YOFA 3GOHA 3RTEA 3OIWA 4EHIA 2Y1CA 3GFFA 1OLUA 1U2EA 4DTCA 5JRZA 1UBFA 4V0ME 3SZMA 4TV8F 4RV4A 4GRDA 4JX8A 4ZOQI 4X7RA 1TECE 2YW9A 2YJ3A 1YS9A 4TGLA 3VPSA 3EMDA 3IQHX 2EARA 1VL0A 1U63A 1JSZA 5DYNA 5JYDA 2J5QA 1V8BA 4IHQA 3H1GA 3L1KA 4U4AA 3BMOB 4DZZA 3LCRA 4TMTA 2AL7A 2IQ5A 2I4TA 5K2MA 1OLSB 3M4NA 2SKCA 2H2FA 4QBIA 5BV0A 3USZA 1FBNA 3WP1B 4XFJA 1Z12A 4QJ3A 2C9BA 3SJAA 2VYCA 3QNUA 2OHVA 2CUNA 2Q5LA 1UBKS 3LUCA 3LPDA 3OIFA 4RZ2A 3UG6A 1I33A 2W4QA 3W77A 1BD4A 3R9KA 1IY9A 3UGQA 5TPWA 2YNMC 4DJFC 1QHSA 1AV7A 2VJQA 4YMSA 1OFTA 2KS6A 4MV8A 4Q6WA 4QXOA 1CK4A 2ZB2A 3E22A 5FI0B 2GYUA 4YJ2B 3S5UA 4DWWA 3LY7A 2UYCA 1P2FA 2D5LA 4YJHA 1L0BA 1RRVA 3DAOA 5TE9A 2G6BA 1T9ZA 3RBVA 2FF5A 4EPYA 4G81A 3UANA 1F6DA 1T4CA 5JCOC 3LZ6A 3LBYA 4YUZA 3K5WA 1IZYA 4RANA 2VCEA 2CV0A 4IZIA 4NESA 2EBUA 3GP5A 3MWKA 2Z09A 1MV8A 1SELA 4PO9A 3UJAA 3NVAA 1QUFA 1WDTA 1PX0A 2V5AA 4U9IS 1ZCJA 4OQEA 2ZXFA 1I0IA 1Z5VA 3DTVB 3UT5B 3CT6A 2AZXA 2PRSA 1AX9A 3IIIA 1O4WA 3D81A 3MT7A 3RU3A 3THWA 1RI4A 3ZEIA 3WO0A 3AERA 1A2OA 4DW8A 3WICA 3CNQS 4TSFA 1Z6XA 3GGOA 4J0CA 3ZY3A 2CNKA 4MW4A 1WSDA 1LDEA 5L3QB 4NS1A 2CMFA 2OAQ1 3U0BA 3UB3A 5DX0A 1EX6A 1FEZA 4EY6A 4X1KA 3PJFA 4EI8A 1FK8A 1Y5MA 2EZUA 5LXTF 1ZJJA 2GI4A 3RFUA 4DCGA 3R3SA 4G1VA 1AKNA 1K68A 2REBA 2YRXA 5JSYA 4BO6A 1XVAA 1Q95A 4AX8A 3GBSA 4BNDB 1O96B 2J3EA 4FIBA 3GA7A 4NATA 4NYJR 4PXYA 1PJZA 5GOTA 4ZOBA 2OMKA 1VKJA 5E8JA 3RLFA 3ZCTA 4WBNB 4CZ2A 3H7AA 4FD2A 2WT4A 1T9GS 4IRUB 2F9FA 3QWZA 4TKMA 5GONB 4BMPB 2VZLA 4OA5A 3IAEA 5KPJA 1NVWQ 2D2IA 2QTBA 4JVOA 3V1NA 3FIJA 5DHRA 3OZGA 4KDIA 1N6IA 1WHTA 3VDXA 4EY4A 5A62A 4RJ2A 4B3RB 3PITA 2QVBA 3W9SA 1GPBA 1FJHA 1D2NA 3IVAA 4RHEA 4DREA 1QIDA 1D8TA 1FQOA 1ZEJA 1Z4MA 1ZY2A 2YHIA 3G7NA 4J9VA 3VH2A 3ZN2A 1YCFA 3FPKA 1ZDMA 3H8SA 3PQ7A 4K88A 4XSGA 1S02A 3WNZA 1OX4B 1KHHA 5A3RA 4L4ZA 3OIVA 1JBQA 1ODCA 2CXPA 4KG7A 4WRRA 3VZBA 2VH1A 2KW5A 3K20A 1IM5A 4LMRA 3HJBA 5H7XA 1AZWA 1P9OA 5F9MA 3WBBA 4XLLA 1CZLA 2OV4A 1LBEA 1OSNA 1XGKA 1ZI9A 2ZYWX 1JJAA 1PK7A 2A5FA 3OSZA 3QKSB 4QREA 1YMUA 1HC7A 1XV5A 3W5AA 3R9XB 1P3DA 1SBZA 4HDCA 3LCJA 1EQAA 2PUCA 2YS7A 1QIHA 1CNMA 3R3WA 1RTKA 3H4IA 2AW3A 1TNDA 3OLXA 2B34A 4ITUA 1LVHA 4I3HA 1GSOA 1P9LA 3GG9A 1WKVA 4X94A 2C42A 1OXSC 1I01A 1P1IA 2G77B 1Q17A 3IERA 4J6EA 1VYUA 2AUTA 1I2CA 4D9KA 1FFBA 4DUZB 2BFFB 3BL5A 3CU5A 1ZGCA 3A6DA 3GWGA 3IP3A 3LBAA 5KSPA 1YMQA 2F3TA 5AOCA 3R7BA 3WNCA 2OGZA 4S0XA 5C37A 3Q15C 1AKUA 3SFVA 4EGCB 1COZA 1UEJA 3WFZA 1E1MA 3R3YA 4DLPA 5EJGA 5TT1A 1T0IA 4L0CA 3S6JA 4YECA 4ND6A 1F6BA 1BOOA 2YBEA 4FI3F 4WEOA 5C3UA 2PLAA 3ELDA 4EKYA 4JI7B 3NVMB 1DQYA 1UMDA 3OU2A 4OHKA 1CZOA 1OIXA 4PIPA 5DK4A 3KPUA 4CQJA 1GARA 2JH3A 5KI6A 2DCMA 2JBHA 3ZXYA 3I05A 4FZJA 1OTHA 2A5DA 4GI3A 4RK5A 4QELA 4ZI7B 2XOEA 1WRBA 1U0RA 1VRWA 3ENWA 3KUKA 2C94A 3CSSA 3ECAA 2B4RO 4JKYA 3ZGOA 1NASA 5DP1A 3LI2A 4HBZA 4K7JA 5JATA 3WRVA 5C8VA 1A9XB 4ZQHA 1DDGA 5IJ9A 2GPWA 2BM8A 4OB6A 4EOGA 2VT3A 4MHOA 5BV7A 1ENPA 3CZ4A 3MS7A 1UM9A 5IARA 3ZVMA 1YE8A 1G8SA 1GY8A 1PG0A 2DP4E 2DFDA 2P5SA 3CO0S 3HHEA 1KH1A 4WOPA 3UT0A 3K71B 1SO8A 1PFYA 3E2MA 5D87A 1E32A 1L5ZA 1WAMA 4N7RA 1X1TA 3QBJA 4N0EA 4WZAA 3OLYA 4E5MA 4HUTA 2PUGA 4NC9A 4DCTA 3R0IA 3WJAA 5HIKA 3QH4A 5HJEA 1PJQA 4KU4A 3ZJVA 2KM1A 4DUGA 4WADA 1TW3A 1SHUX 4Z3KA 1ABBA 1KI7A 1ZU5A 2DR3A 2NVWA 4YO7A 1M54A 2WWXA 3A1EA 4XVHA 4FYWA 2IV3A 3VHRA 4IBOA 3MUFA 1FSSA 2SNIE 3GJ4A 3MFQA 3RI3A 4JI0B 3I2GA 3UJPA 5IK2A 2CKDA 5FBQB 2PH5A 2AW5A 2JIMA 2JGNA 3QOXA 4XIYA 3NGLA 2EFEB 1GNRA 1SBYA 2BEWA 2HHAA 1N36B 1CY7A 1F1BA 1XVVA 3A1VA 4GC5A 3A6FA 4K8RB 4QGGA 3AHEA 4D99A 1B74A 1L4YA 3SBOA 4HAZA 1QZXA 4QDKA 4YDHB 5K2OA 1Q14A 3EZ7A 4MQEB 4G1CA 1J9ZA 5IMSA 1GILA 1V8OA 3L92A 4Q4HB 4FYIA 4TTAA 2CK3A 4KVAA 4EF4A 4B76A 2EBFX 4PHCA 3H9BA 1T9DA 4FDAA 2QTAA 4IIXA 2GJ8A 4NP6A 1NP6A 1P0FA 1QX4A 1Z6AA 2QRPA 3THYA 1T2UA 2F55A 1R5JA 2H29A 3DW1X 4WGGA 4MS3A 3S8MA 2Q29A 1E1QD 1MRZA 3DUFA 2P30A 3OZFA 5KOJB 1DRVA 2FSVA 2X42A 1DL5A 3COSA 1A77A 1X7WA 2BJWA 2WRZA 3FF4A 3SJUA 4XVCA 1W30A 3QPWA 3HI4A 3OFSA 4H77A 3L49A 4UE6A 4XWWA 1SUWA 1IBMB 3NKFA 4B44A 4UUBA 2YHBA 2OCKA 3O90A 4D0RA 4I3FA 1GPAA 5HF9A 3W8EA 4CV0A 3M83A 2XT6A 2H00A 3QTLA 4TTTS 2ZKIA 5WRFA 2ZZNA 2HU2A 5FUYA 4BBZA 3CW8X 1IG0A 3AVXA 1TM2A 3TQTA 2FSGA 3BSWA 1PWXA 1MV5A 4ZIRA 2WZQA 4Q47A 3F7MA 1V8FA 3R4VA 4TT3A 1XQ9A 2YZ7A 3AHJA 5KSWB 1L4HA 3B9QA 3TNJA 5AW0A 1K6IA 4WK0B 2JRCA 2I2FA 2QN9A 4W9RA 3LOQA 3AF3A 1GRNA 3BXEA 4DBLC 2VPWA 1DKMA 3QX9A 4MLDA 1KS2A 3TOZA 1OWMA 3B1JA 2CY0A 3DDSA 2E9SA 3IC5A 5TR9A 4H1UA 2H0QA 3ABQB 1WHSB 5GWXA 4QM7A 1GL7A 1Z37A 3JR7A 1TUIA 4WOKA 5EP2A 3ZBTA 5AK3A 4B7CA 2DQSA 3T5AA 4NNJA 2FR8A 3BH6A 2BGMA 3RHSA 5HUHA 3OCUA 3CVOA 1IUNA 4TTRA 4QSMA 4G37A 3FDZB 4MZXA 1PN3A 3ZK9A 4AQDA 1YJ5A 2GZAA 3B52X 4G8DA 2XQVA 4M0KA 1G2QA 3CH6A 1BQEA 4WOJA 1G7SA 4C6RA 4DWJA 4YRGA 5AOAA 2YIJA 1L3CA 6AT1A 5IZCC 4KNYA 4LZOA 5U4XA 1J0BA 5F1YA 1Y5LA 3B20A 4PC6A 1DTWB 5H81A 2QU8A 4YRFA 5JCPA 3FHTA 4MINA 1LB1B 3P96A 1KY3A 1E5TA 4HGZA 1QV9A 3QIAA 3TKLA 1KEEB 1UWVA 1P2GA 2VZ0A 1HGXA 2HJHA 2YL2A 3B2NA 4OV6B 4PLHA 5JS8A 4ZOLB 1QZUA 5FWXA 4YUWA 2IXDA 4HWGA 4I66A 3SFTA 5BVHB 1KSHA 2QWXA 4JJZA 3CH5A 5AM2A 4NRDA 5DEIA 3FDFA 3SICE 3VNAA 5AKEA 1GKLA 4M1TA 4AWAA 3T3GA 1G8KA 1SG9A 1YQGA 1Z4OA 1ZLYA 2ZAOA 3EVDA 3L77A 5IUKC 5J9FA 5JO9A 3JRWA 4EVSA 5KTNA 3P27A 2NUAA 2RD2A 3AVWA 1RI1A 3KQLA 4WT7A 5F5LA 4ER0A 3NGXA 1YQEA 4U7DA 1YH3A 2BT4A 4G5GA 3HYNA 1RJGA 2NO5A 4YCSA 1H0SA 3THXA 1XEWX 1FMFA 1YVPA 3KQWA 1BCSB 1T8SA 1OOEA 1PO7A 2E87A 4YV0A 4UJ5A 3T1YB 2ZYAA 2F48A 4HVAA 5K3CA 2BSQA 3D6UA 4WDQA 3GFRA 4RQUA 5CH8A 2OD2A 1J0XO 1J6UA 1EWVA 1Z45A 5EXPA 2X8JB 3OBIA 4JI8B 4XGQA 2ZUCA 2FRDA 2G1KA 1QWSA 2W2LD 1WCIB 3GK3A 3B9RA 3FFWA 2R8ZA 2LKCA 5BXYA 2ZXUA 2G08A 3HKDB 1KF0A 4XGKA 1H85A 4D8YA 1XPRA 4TYQA 3Q1LA 3CF6R 2ANBA 4JLBA 4MH0R 4M9RA 1GVHA 1S2MA 4UHFA 1JHQA 1LDBA 4GECA 3AR7A 1L5WA 2GHQA 2WJAA 3AT1A 4KLZA 4CMAA 5K0FA 4JJGA 3HA5A 3KKNA 4KB5A 5JDIA 1DARA 2IYVA 3L8EA 1KZ7B 1OA1A 1SUAA 2UZAA 4UXJA 4EJ2A 4QX6A 3R5SA 4LYYA 3A6HA 5AHWA 3V3TA 3WK8A 2YVAA 3IE0A 1YS1X 3P1JA 1PT7A 2BR5A 3CNNA 5H1YA 1XRQA 2X5XA 4D5GA 1M2EA 2CV1A 4WPGA 4BIMA 3O74A 2QN1A 3T7AA 1SC4A 4XWYA 3TMKA 3D6HA 2ZRQA 3BMOA 3R6GA 2A3NA 3DOCA 1U2TA 5JV5A 1OLSA 4V2UA 3ADPA 4F45A 1L7XA 1R74A 2DT5A 4N12A 2I4OA 2ZJZA 1NI3A 4L8FA 3W4KA 1M66A 4EY7A 4QOJA 2YJGA 4C4RA 2FSUA 4M8LA 2CNWA 3BIWA 1L5YA 3WGLA 1G63A 4LECA 1I6KA 4N1AA 1UK9A 2AC4A 2H85A 1Z34A 2GBIA 4NU0A 1JEQB 5ALYA 2GHRA 4II2A 5CT4A 3RE1A 1AUQA 2E21A 2FYTA 1NRIA 1KQGA 3QI2A 1JSXA 1V43A 3C1TA 1I4EB 2WZCA 1A5AB 2WUEA 1DE0A 2JK0A 4YJ2A 1RCFA 2J32A 1ZH8A 2A9VA 3TDMA 1PQ4A 2Y1LA 4LYFA 3PPYA 2V97A 2SICE 5IEJA 3Q8MA 1G98A 4U0KA 4HAXA 2AX4A 2H8KA 4Z9YA 2PQMA 2QY6A 1V48A 1RAAA 1M2OB 3M6AA 2ODPA 3OESA 1QQBA 5B37A 2X9QA 1E8NA 1T1GA 2NXEA 3WB9A 3G9UA 3M4ZA 3QPDA 4N82A 1GTVA 3FLMA 1FZTA 4N3BA 2RAUA 2B78A 2VK4A 4NICA 4F2WA 2IF2A 2V7VA 1UOOA 1J0AA 1AGPA 1TKRA 1U7UA 3L02A 3UT5A 3DTVA 2OFXA 2C88A 3J7TA 4E3WA 1T2DA 4JP5A 3G7UA 4L6AA 5IU6A 5LVAA 4TZ6A 2EFHB 1UP4A 1YCGA 4OL9A 3QSGA 4C4AA 5LZ4A 2R87A 3M1LA 2J9RA 1QQ7A 1CUGA 1G5HA 2J09A 3KR1A 4GRIA 4YN3A 2QD1A 4EMTA 1AN9A 1N5RA 1T9AA 2Q2VA 2JASA 5KO2A 3C85A 1P2DA 2P2LA 4E6EA 5L3QA 1P4AA 4OFXA 3O94A 2GNAA 3KQUA 2H5JA 5KHOC 2Z1NA 2FW1A 1NN0A 1OJLA 2LCQA 3FGOA 4G26A 4LGCA 4QRIA 2C4KA 4P3PA 4CU2A 3DL4A 5LLSA 3OTHA 3I76A 1WUJS 3W2HA 3EULA 1HQDA 1H2EA 1IHOA 1KJIA 2O1SA 1NY5A 4RHXA 1RXWA 4BNDA 3S81A 1O96A 3QVJA 2RK3A 4IIYA 1XTJA 3C15C 3PDJA 4AY5A 3O93A 2P77A 3IUQA 4EAAA 3QFFA 3RYCB 1T3LA 4WBNA 10MHA 4PO8A 2GF7A 5ECGC 5GONA 4PGHA 3G0DA 2R8OA 3X1JA 3LWBA 4CDGA 1X74A 3LL4A 2DPGA 4PO3X 3SC6A 1KZ1A 3SZOA 1KDTA 2POQX 2WSSD 1G3IA 1N2SA 1VLQA 3E9NA 4KUEA 4ZDJA 1UMBB 4TTVA 3OF2A 4XIJA 4RM3A 4JKOA 5LYYA 2OFWA 2OL4A 1DAHA 2GRUA 5C51B 2PGJA 3HFGA 2HPVA 2UYYA 5CLIA 1NA5A 3CINA 4TVBA 4X8MA 1FYFA 1LCIA 3VAZA 4BFUA 2DFNA 1GNPA 4IDBA 1MCZA 3O75A 5I5EA 4IDCA 4KPUB 4V2IA 5F78A 4C89A 4QYXA 3DZGA 4KQGA 3JQFC 2GDZA 1C3LA 1HDIA 2P3QA 2ZSAA 1NURA 1ZW6A 2B82A 2HJVA 3DD5A 4WBNF 5GONF 3WOVA 4RJIA 5HBGA 2ALJA 5KYWB 3R9XA 5U1PA 4E2ZA 1BFDA 1IDN1 3CLTC 3CY6A 3NBZC 4OQNA 5I4KA 3U1VA 1MT0A 3AVOA 1EFPB 3BMXA 2A9QA 2A78A 1XK7A 2XE7A 4HWSA 4BVKA 4DCOA 1YBMA 5J5AA 4B75A 2FN8A 2P2YA 4OQFA 5A4IS 5B36A 3AFMA 4MULA 4PC1A 5FAKA 1YFJA 9GPBA 1T0HB 3FWYA 2JI4A 1N8TA 4KITB 1OU0A 1SK8A 4MW6A 2BFFA 2XH8A 2Y2VA 1IRIA 3QITA 1GFWA 2NYUA 4P08A 3UN1A 1K6XA 4F9GA 4KYTA 3HDGA 3KTDA 2OXIA 4CUZA 4JX9A 2PH3A 4YBZA 1NIJA 2EBHX 2GS9A 3P0RA 1E66A 4B2LA 1NJSA 4R8KA 2ZZKA 3E1GA 1CYDA 1NBAA 4Z51A 2CYBA 2ZJOA 1RXCA 2JCVA 1QYVA 3COYA 3M0EA 1LFDB 3ZGLA 1D6NA 1JQLB 1U2DC 2WHEA 1G6OA 3WK4A 1GRCA 4M0CA 1TF5A 1XBTA 2XCLA 4HR7A 1BXKA 3WIVA 4AMUA 3HL0A 4H0CA 3LV8A 2GSDA 3NOVA 5I9SA 4C4ZA 1ZNXA 3VJRA 3WMWA 1XEWY 3JQPA 4ZI7A 3LDHA 5ISMA 1PGJA 2QMOA 4V0KA 4CCSA 3L0OA 3AVVA 3CZMA 1UXOA 2OO5C 2Y05A 4K5QA 1PL7A 3D3EA 4MGKR 4FWTA 4FD3A 1VSTA 2P11A 1G3UA 1NUQA 2R1TB 1A9XA 1AKYA 3K30A 4OHXA 3U4QB 2DBVO 1PVDA 1LJLA 1QH8B 2VT6A 4LHZA 3HYLA 1AQJA 2QD5A 3ZV4A 5FFFA 1ADYA 1ORVA 1QNFA 1TK2A 3L0CA 4FNAA 4JLOA 3REFA 4AQYB 3QPUA 2CLLB 5ILGA 1QP4A 1IY0A 3EARA 1CS4C 5DXAA 5E8RA 1N6RA 2AMLA 4HD8A 1T1IA 1VE5A 2F1IA 4JJ8A 1WCYA 2JGJA 4CDNA 1ZZEA 4BLTA 3NWPA 2FPMA 5KINB 3EX7C 1RIIA 3B36A 3BAFA 4DNOA 1D5WA 4PGMA 1HNZB 4ZI7F 1NR7A 3AB3A 4MNTA 3GBVA 5IJWA 1SQ5A 2W6JD 3DFIA 3M5CA 4X6YA 1DBVO 2WPNA 2C9DA 2WIBA 3FYUC 5FLYA 1M1YE 3ZCQA 2JW5A 4HDNA 1C41A 2IYFA 4BO7A 3UJ8A 4ZAZA 1S2GA 5KAPA 1KI3A 3WIOA 3AYXB 4UZFA 3Q7EA 4CR6A 4UBLA 3GN1A 2I4MA 4E51A 2P27A 3PFBA 3TTYA 4MGZR 5L3ZA 3H5NA 3NH9A 3TN7A 4EX7A 2XKJE 1O03A 4LZLA 2HT6A 3IE2A 3L7NA 2AR7A 2VDVE 4CTOA 1VPWA 3OZVA 5ALSA 4Q3EA 2QE7A 4MQEA 4D0GA 1CE8B 4Q4HA 2PMBA 4X5OA 4H6XA 4LY6A 2YS6A 2XTMA 3IVMA 1X87A 3AIIA 2D0DA 5CB6A 2NG1A 4HY3A 5BNFA 1MO5A 3E7WA 1EHIA 1S2NA 1VIDA 1TF2A 1BJTA 4U7GA 4ZVTA 3Q11A 1ITZA 4H60A 4KMSA 1A50B 3SIWA 2OWDA 2XKBA 3LHKA 4MR7B 2FRVA 3Q7QA 3UAVA 3WFJA 4BVAA 2P91A 5KOJA 3WL4A 3J81k 3K05A 3K5PA 3EPKA 3SZ3A 2N1MA 2CXOA 2Y9MB 3O0DA 4WL0A 3ITNA 3SNHA 1ZUD1 1QPGA 3AL3A 3WWCA 2ZDHA 2YNMA 4FYYA 1YO6A 2O2CA 4KIWA 3EGWA 1RAGA 3CT4A 2CC2A 2XMRA 3CKLA 4B6OA 2ZYSA 3ZKAA 2QMYA 1OI3A 2PHZA 2WFAA 2XQFA 2XUKA 1EJ6A 4CDRA 1M5RA 1Z18A 3JD2A 5F3WB 6ADHA 2QT9A 5EQTA 2FWNA 3WL8A 5JQWA 2CYCA 1EWTA 3FR7A 4WNCA 4EG1A 3IUPA 2YY5A 5K51A 5I7WA 4CVNA 2PO7A 3HXKA 2C04A 3N2KB 1K2VN 4UNNA 2DKNA 1KPIA 3AP2A 1U3UA 5BWLA 5K7SA 1M0SA 1M67A 1ORTA 3AR2A 4L3OA 5IFLA 4HDSB 2ZT7A 4E14A 3NANA 4HMOA 1EE9A 2C1XA 4RKWA 3TGLA 1JUDA 1KFEB 4GKVA 2JIZD 4LVUA 2AG6A 3KQKA 1WHSA 4YH1A 3GUCA 2L69A 1BHO1 1P1CA 1O4VA 4FYPA 2ZAIA 2Z2XA 4MVJI 4CHTA 3SDZA 4B85A 4LRUA 1C3JA 4ZYYA 3PT5A 3V9PA 1DRJA 2P7HA 2QP3A 3OM9A 2P3LA 3FDZA 3ZQ4A 2DR2A 2BUCA 3LDUA 1FTYA 4GQAA 2L82A 4J2HA 3NTRA 2KWIA 2GEFA 3Q3JB 1Z0DA 3KTAB 1TD1A 2PJZA 2ZETA 1Y6GA 4F4CA 3TCKA 3ZE0B 2VHQA 1XFDA 1ATIA 3FVQA 4ZXFA 4FSDA 2EGUA 2GXQA 3W5VA 1S1MA 4CIVA 1P45A 1QOPB 3BRCA 1GR0A 1OTYA 3HR7A 1KEEA 3G6KA 2HNKA 1RWNA 2OE2A 2YDXA 3MJTA 2Q5QA 5BXQC 5TGTA 3HYRA 3ZDZB 1DUVG 2WPDD 3IEKA 1JIIA 3MSXA 4HQRA 3SDSA 4B6PA 4Y0NA 4EHDA 2VSOA 4V0LA 5BVHA 3BWEA 2D2FA 1LF5A 2GEUA 2BGLA 2ZQYA 2P5TB 2YWRA 3FG9A 5ALIA 5EMLA 3EGXB 4I0WB 4AYTA 3ZHRA 3BWMA 3DE1X 3FYSA 3GLHB 3UMYA 4UHBA 5JT1A 3EJ6A 3UJDA 4P7GA 1OGIA 4HF7A 3FNGA 1YB1A 1ZR4A 1ZOOA 4DC0A 4IJWA 3JS5A 4NCNA 1KDOA 2CCKA 2PM8A 2E6KA 4IXTA 3PPXA 2HMYB 3AL2A 3TL2A 4PNEA 5COAA 1U6IA 3VNRA 4RMJA 2RGBA 4WZBE 1BCSA 2ZSFA 3BL6A 3BZUA 2WTXA 4RDIA 3UH1A 5CFLA 4LBWA 1ZGZA 3NYQA 1GUBA 1J70A 1BE8A 3QBVA 3TXYA 1HE4A 4P3OA 2QGZA 3B6EA 2X8JA 3Q3IA 2GPBA 4ZOLF 3WL3A 2X1LA 4Y2TA 1WCIA 3AUXA 4UFPA 5DM60 5C35A 2ACVA 2N47A 1UMCB 3F8SA 4XDGA 3HKDA 3KB8A 3JD1A 1FP2A 1CEQA 2J1LA 1CZKA 4LJ5A 1I5RA 1ZJ4A 2H1WA 2Q49A 3LSTA 2CNOA 1RZVA 1MOPA 3SZGA 2X9GA 1KP2A 3V8PA 4EATA 2QYTA 4LDNA 4HWRA 4P53A 5DRYA 4B3FX 3JU3A 2VTDA 4CV2A 2OV2A 3P2MA 3ID6C 1E3LA 3NJRA 1NT4A 1E7RA 2I1VB 3C48A 2MTBA 2D0OB 3H9UA 3KZ1E 4P4SB 2H1VA 3UOWA 3W0LB 4RDXA 5FFMA 1ZI6A 4NYMQ 4NAVA 3MF4A 1PHPA 1UJMA 1UJ5A 5A0VA 1KP9A 3IA7A 1HG0A 4XVRA 1UFVA 5E1OA 4RK7A 2AXNA 2ZS7A 1HY3A 3E05A 1UPXA 3D3NA 4IXWA 3PFCA 5JXIA 4BL5A 2EP5A 1VIYA 2Z4SA 4C3VA 1W0JA 1XZAA 3NTUA 1JEJA 3E48A 2DQ4A 3TR6A 2QSYA 5BURA 2NZUG 3HPQA 2BEJA 3NDRA 3TF5A 1QP0A 3N2EA 1THZA 3SMVA 4PG4A 2Q3BA 1ADFA 2M98A 2PAAA 1VHDA 2W2XA 4WXPA 4F56A 2GCGA 3TTTA 2IS1A 3RUEA 3RJ5A 1PJTA 3S2FA 2IEYA 1Q7RA 1JEQA 3LOPA 4LJYA 4NHEA 2P41A 4MZDA 2V65A 4ZOCA 1A9TA 3K96A 2VATA 1K5GA 2WU0A 4NZZA 3BD9A 4DXDA 3FPJA 1XMVA 4Z99A 1UKZA 2QA5A 4OXRA 4OHBA 2JVIA 3NPAA 2H4HA 2XV1A 2ZJ0A 4WN9A 4OY3A 1JEEA 4HDAA 2I3AA 2N0SA 2JFQA 4X60A 2W6ID 4BN4A 3JQ8B 1Z4NA 4HQ6A 1M2OA 4KNWA 4B35A 1PFUA 3PFNA 5B4VA 1RW4A 3D8BA 3EIOA 4UZEA 4EENA 4BNWA 3ROMA 1X9HA 3H2HA 4U5XA 3HJCA 4PHFA 4J7AA 3ER6A 1RRCA 1JDNA 4GOJA 1P5JA 1XC7A 2YN4A 4N5HX 3RVKA 4B6EA 3MB5A 4EY5A 3DHWC 4EO7A 4FWBA 3JQ9C 2HSGA 1HEYA 2RFLA 1U0BB 1EFLA 3DW3X 3GEDA 1P0PA 2CUZA 3FYUB 3ZEAA 4JI4B 1RMYA 4RCVA 1VCNA 4IQFA 2HV8A 1KMMA 2EERA 3K4QA 1SVSA 1GSHA 3KU4A 2FKNA 3CWQA 1YKFA 2HEIA 4HX2A 2B4AA 3J7AC 3NXSA 4PFKA 5KYGA 1U7TA 5LQJA 3PE4A 3DXZA 2RGDA 1LQ2A 2GX6A 2JJ1A 4PX9A 4URZR 3RF7A 3PT9A 3UGKA 3BREA 3JQBC 3GLFB 4Z9BA 4ENVA 1PVOA 1GDTA 1IL0A 5EMNA 2I6UA 3KLBA 1FIUA 3LY5A 2H07A 2VH2A 3HXQA 1LD3A 4RACA 1DBIA 3S28A 5IPFA 1KFBB 5CNMA 5HZGA 3IUMA 3LUAA 3GPDG 5IBPA 3V6MA 3RYCA 521PA 2HK6A 4FOLA 3ADBA 3INTA 3MTEA 3PGKA 3H17A 1V5GA 2X1MA 5CJ2A 1C2YA 4DCSA 1I4OA 3AESB 2A0WA 2PSFA 4FR5A 4DSZA 1RZRA 3CCCA 1UMBA 3DH0A 1HRKA 1RXUA 1XTIA 4L4YA 3P9XA 4C7MA 1N6OA 3PNVA 2AH5A 1K8QA 5LBTA 3GLRA 5KOYA 4KEAA 3NOXA 3FCOA 2I1LA 3VISA 2DULA 5AW6A 1TYAE 3KKMA 3P2YA 4NNPA 4YT8A 1E0KA 3L5OA 3I1YA 2I76A 1KQFA 4H9GA 2GT1A 4FC7A 2F17A 3LVBA 3AFGA 4Q16A 3WGYA 2R1VB 2ZYHA 2V74B 5BYKA 4KPUA 1QYDA 3U62A 2PBFA 4IDQA 3NHRA 4MGIR 3RIMA 3OWXA 5BOVA 3OFVA 4DZRA 4K0KB 4L9SA 3OHSX 2HJSA 1X42A 3RKRA 5KYWA 5DRTA 2KSQA 2ZB4A 3D4PA 3JRXA 3CWCA 1OF1A 2GB4A 1QOZA 4TMVA 4CEJB 4OUKX 5LCXA 4DBLE 1DG3A 1EFPA 2Q8QA 3A3PA 5E6RB 1E9CA 1O6BA 2QUIA 3JTEA 3QPAA 3MSCA 1EDEA 2GEKA 3OTGA 1PR9A 3EEBA 1BOFA 4BDSA 1M2FA 1SK9A 2JPDA 2OCBA 4IINA 4JLNA 4EMSA 2HF7A 4BGVA 1EK1A 1SXHA 2NAFA 3E8SA 3EVNA 4R01A 6NULA 1N6PA 2FPIB 1CJBA 1Z6GA 3EZYA 2ZBUA 5ADVA 1QCZA 3PRHA 1S8NA 3UJ6A 2WV7A 2ZROA 3HDYA 1KOJA 4B5LA 4EEKA 1K8YB 4GWGA 5EMKA 1U8ZA 3G8DA 1V96A 5KQSA 5CNJA 1I8TA 2XZDA 1RPAA 2I3ZA 4GZ5A 1RKXA 4G1BA 1NNSA 1JBEA 1H2HA 5BO5A 4ZXPA 4BMDA 3G17A 5LDHA 1E5XA 2X9NA 1RAEA 3RSLA 3SX2A 4FHGA 2GEJA 4D9EA 1TU0A 4PN7A 5JLAA 4XZ3A 3ZHXA 5B30A 1GZUA 1TEXA 3ME5A 3KEFA 5L6LB 3ZW7A 2COEA 1NG1A 5K8IA 4FLFA 2UUAB 3FI0A 4TTSA 1XN1A 1ZMTA 1J8FA 2NVUB 4CIYA 5IM5A 5DWVA 1GR1A 2GUGA 2ID4A 2EF1A 2G76A 2TECE 1QVVA 3QY9A 5I3ZA 3O91A 5EJIA 1M6VA 1SKYE 3DVRX 4XLTA 4QD3A 2I7XA 2P7IA 4Q1AA 2R47A 3VSEA 1IBSA 1VG1A 2QG6A 3U4QA 2R1TA 3U61B 4BBAA 1KL7A 1SEPA 1QH8A 4L50A 3EY9A 1PS9A 4C21A 4F6RB 3PEEA 4ARSA 2FU5C 1C7JA 3EIHA 2V5VA 4AD8A 3TFOA 3JQEA 1T0PA 1JW9B 2X2OA 1NE2A 2OGTA 4Y1RB 3OD5A 3BILA 4DDVA 1IN5A 1D2EA 1G60A 2HRQA 5FI3A 4YRIA 4QG7A 4RQAA 2BI7A 3U5TA 1DLIA 1RHQA 3V46A 3NHLA 5FBHA 3RGWS 4K9NA 1MX9A 2COUA 1LLFA 4N8EA 2QRGA 1FDOA 3OI7A 3FKSD 4JUAA 1X14A 2CL0X 3MWDB 4QA9A 5ECWA 4E5KA 1XL0A 2QV0A 1PWEA 1J8MF 5DBFA 3CLUD 2DFPA 2FR1A 1C3VA 2Y6UA 2O2YA 1WUYA 2UKDA 1I13A 3QUAA 4YR9A 5AKZA 3VUFA 1P1HA 5EQJB 1PQPA 2GO7A 2HMUA 4L9RA 5E95A 1FMJA 5AI9A 2AVNA 3U16A 4LSGA 2DGDA 5JROA 4QQFA 4AF6A 5HOQA 1N5MA 4G24A 4ODIA 2VWQA 4X71A 2F64A 3K8ZA 4C76A 1WEKA 1L7QA 5SICE 3ORRA 1ONOA 3H83A 3OFNA 4TSKA 1WP9A 2HLNA 1RYYA 1T2FA 1TVMA 3G23A 5H9VA 1D9ZA 1CE8A 1NXPA 2CD7A 2ZUBA 3WV4A 2ODEA 1QHNA 2F8LA 2Y71A 4I19A 2WJ3A 1ID8A 5GMOA 4IWYA 4LVOA 4QT0A 3LMKA 3O31A 5C1BA 4WKBA 4YCAA 3SYMA 3TIVA 3J81A 4ER3A 3KQMA 4I9NA 2X23A 1DAEA 2WDPA 1VLJA 3GFOA 3Q3CA 4FPXA 4MR7A 2PIDA 4LQDA 4BOYA 1YU6A 5HS6A 4WA8A 3ANTA 3U3OA 3WNBA 4P81A 3WLLA 2XUZA 2QL9A 5E3HA 5L6MB 4ZT6A 3RAFC 1U0SY 2FX2A 3I2YX 2QF7A 2QZ4A 2A33A 3WRWA 4FQ7A 4J76A 5F3RA 1JA1A 3PDCA 3QUBA 2OK8A 1TO2E 5JMWA 2XT9A 1PSDA 4MHSA 1KARA 5D6YA 2LVBA 2H1IA 1PZGA 1I14A 3T5BA 3WIBA 2P4QA 3I73A 1UJ4A 2YWGA 1HNWB 5L40A 2BH2A 2IVFA 1TFRA 5CLQA 1XTTA 5AP9A 3UV3A 3FKQA 1L1RA 1VDZA 2JLWA 3TPCA 4ZVNA 1NATA 4QUIA 1I7PA 3N2KA 4KFUA 2A0KA 1ORWA 4YP0A 3SNKA 1EESA 3SHFA 3WGJA 1E4EB 3EDRA 1TKBA 4LHWA 4Q9IA 2XJ4A 3R75A 1TQDA 2F62A 1T2VA 1D4ZA 2O9JA 2RBGA 3DPIA 1GPUA 4HDSA 4DSNA 2OQRA 3KJHA 3LO8A 4AVYA 2BPOA 3FHJA 2Q3MA 2C99A 3WDLA 3ILSA 3C3CA 4Q39A 3TLGB 3QFHA 1K08A 4AJJA 1N75A 1XZKA 2PQ2A 4K6FA 4FHDA 4YRZA 5LZ7A 5LDGA 3I8OA 4J0KA 1VKHA 1TAHA 4G0OA 2PUEA 5J47A 4O02B 2IEGA 2EFCB 2JFPA 4AUKA 4EYQA 2Q8NA 4JEMA 1FY2A 2IHZA 3GJRA 4BNLA 4CUKA 2ILTA 5LQRA 2EU8A 4L57A 4UFNA 3F7OA 2ZJAA 3I12A 5CVJA 4ZGGA 5BP7A 3TL3A 3HV2A 4INPA 2GA8A 3PTLA 4XAQA 3M6MD 3KTAA 3MD0A 1TZCA 2DUJA 4FFOA 1R0RE 1Z2NX 3KCNA 3ECCA 3KWJA 2D4AA 2NO9A 5DBHX 1FJ2A 1UADA 2XSZA 1FUKA 3UHOA 2RG1A 5ESDA 4BZZA 3H0KA 4NMWA 4PO1A 2BZ1A 3OAAD 4EDHA 1NM5C 2O5EA 1H2ZA 1O77A 4RV5A 3TZLA 4HDOB 4JIGA 2H63A 1ZRSA 2HF8A 2O6LA 3EGXA 3VKGA 3IJ5A 5GZ3A 3KB6A 1XZIA 2O2IA 2ORVA 4R3NA 1Z7WA 1A9SA 4MUBA 4XWOA 2PGNA 4MQUA 2E85A 4CNBA 1YKGA 5GZ1A 2PSHA 4EO4A 3IP7A 2PD6A 1YONA 1NV8A 3L8CA 4O4LB 1HR0B 3DEFA 2IWRA 1UKAA 2HRDA 4Z1OA 5CFOA 2PRZA 2FN7A 3SMQA 3EH1A 1O57A 4UE3S 5D00A 1BD3A 1EB9A 1TXGA 3EW9A 3EPRA 3WZ2A 3I42A 3H2KA 4R8SA 4DNFA 3BIFA 3TMYA 2W9XA 3IAXA 4RJTA 3HYSA 4H7FA 4ND3A 1UMCA 2RH9B 4FFPA 5EYPB 3QF4B 1P74A 4RYDA 2F1JA 3GJ3A 3R41A 4XIGS 3EPLA 2WAMA 2HH9A 3QVUA 3N8DA 1LVGA 3HEBA 2QTHA 2PKRA 2V9CA 5A7HA 3LPMA 3R7NA 4EIWA 1F9AA 5CG1A 4OAPA 2Y3IA 4PFSA 4G0WA 3FPGA 4R6XA 5I8WA 4J16A 4LPKA 2P5UA 1F7UA 1LC0A 3W7BA 4P4SA 1Z0UA 3PSAA 4LZZA 5AW1A 4RY0A 2AFRA 2UVDA 4TQUS 4P5EA 2QZJA 4BBPA 4D92A 3H99A 2KYRA 1H23A 4EW2A 2H2IA 1C8KA 1GPH1 5GQSA 3CLSC 4YY3B 3D4BA 2B25A 1GZ6A 1Z56C 4NBUA 3DXXA 2MYNA 5MHTA 1R5NA 2AQIA 2BUBA 2JH8A 3BD6A 1GGJA 3GFSA 3KZCA 4B3DA 2XQIA 3TRHA 2R44A 4JQCA 2DC1A 1U2DA 3ISJA 2HYDA 4F5EA 1TJ4A 2QSZA 1CX9B 2FUG1 1UCFA 4EGAA 1BDBA 3I4LA 2J45A 2WJIA 3SIPA 1H4TA 2UUPA 2ZTVA 2Y77A 3I34X 4HDQB 2JFZA 1KIFA 3ABIA 4NS4A 4CLHA 1NVGA 3QW2A 2C95A 5FA8A 4XEUA 2AG5A 1S5PA 3HWWA 5D3ZA 1GAJA 1IWPB 2IHKA 2OO5A 2AK2A 1YT5A 2J6IA 1VRCA 4LF4B 4CCYB 3LW7A 1TM7E 2AX3A 2E2WA 4A16A 4C1NA 1IWBB 2YINC 2H7XA 5DEOA 1JR3A 3I04M 2DM6A 3LT1A 4AROA 4XVUA 3ZZ0A 3H2BA 3ZE9A 2XVMA 5J5CA 1LZLA 3DFMA 4DQVA 3JQ8A 3OHPA 2AUMA 4GM4A 2QRZA 5H0IA 3T38A 5CTJA 4EVRA 1U2GC 2P9ZA 2ZT5A 3F98A 3FN4A 3P0FA 4QU8A 4E0BA 4MUGA 3WKCA 3X1MA 4DM7A 2WAXA 2AYZA 2XZOA 2WYIA 3LS2A 2JFVA 1D2MA 1R0BA 2P6OA 1UJCA 3GRUA 5EA2A 1UUFA 3GFQA 2EZ4A 3WZMA 2WB2A 1NBME 1QTNA 5AKJA 5A5DA 4BMOB 2IHUA 2H4YA 1O2DA 4LQCA 5EPUA 1DIRA 3ZKWA 4KAAA 2FNAA 1ETHA 3FYUA 5H83A 5ICMA 1S7GA 3CF0A 3H5TA 3KFXA 3V1KA 3AG6A 3ZIUA 2GMWA 1RRMA 4ZJPA 5A4AA 1H93A 4PYJA 1E7QA 2XXBA 4W1SA 1A76A 2ZYDA 1G8HA 4I6JA 4MAFA 1OZGA 2VNSA 3OP4A 5G3YA 2ONYA 1EP9A 4UVEA 5HDBB 1N0WA 4PAWA 3FPTA 3TWOA 2QG9A 3FE2A 1XMQB 4WK4B 3T7SA 3PWSA 4EGFA 2W98A 4Z3OA 1EFTA 2XOKA 3AILA 3BXOA 3VO2A 3CR3C 4CV3A 3K70D 4H3SA 5H82A 5EIBC 1I32A 1XJWA 4WXMA 5FR1A 5F4ZA 2IUFA 4CYMA 1QHIA 4J0QA 2BFCB 1XCLA 1JPUA 4NCBA 1DKRA 5IP5A 2V5UA 2PKYX 4KR2A 1UBJS 5FNZA 4MYHA 4HPJB 1IUOA 5G53C 1JZTA 3DHYA 3VVCA 5BN1A 2UZ4A 2IOFK 1SBIA 4YAGA 2X77A 3AESA 3A4NA 1CUHA 1M2HA 4EHLA 5GIOE 5DGXA 4TLDA 2GZDA 2XUAA 3PQ4A 2Z6AA 1G8MA 1U5AA 4JC5A 1B00A 3EA4A 2EEZA 5KYKA 3CF2A 2VJLA 3H9GA 3I37X 1F8GA 4OSEA 4M4SA 4CL3A 4DR3B 1SVOA 4G85A 2B7BA 2R1VA 3V7UA 2XCUA 3DNFA 3K9NA 5G1PA 2X14A 5DHQA 5F52A 5LMUB 4CLXA 3LPAA 4KGXA 1QCDA 4ZC8A 1Z22A 4JXKA 2W2PA 4EELA 2F3PA 2GZ2A 1N2ZA 5DLQC 1KSGA 4Q9JA 3II6X 1PSZA 4Q9NA 4RWEA 4EHAA 3JTMA 4CEJA 1IHUA 1DQSA 1J49A 4OQMA 3U26A 5JRJA 3INNA 2EQAA 1ZW1A 5E6RA 2WB4A 3PHGA 2C29D 3F5MA 4DIKA 2GKGA 3VPGA 4GKKB 3CUWA 4I81A 4I9FA 3N2ZB 1Q77A 4MV7A 4QL3A 4BEBA 1IHPA 1RAHA 1GM5A 2P75A 3OTQA 1X70A 1VMKA 2NSLA 4IRMA 2JD0A 1QGYA 1YRLA 2W2QA 3CR8A 1XQYA 2A2ZA 2VDJA 5K09A 1QIMA 2HGSA 4KR3A 5BSGA 5KVSA 1BCRB 2OHXA 3CONA 2GAOA 4AUNA 1TQHA 4ZA2A 1N5KA 1Z62A 3BL8A 3EVZA 1ZYUA 3F6BX 1Z2AA 1DFIA 3KLMX 4P34A 5JO0A 4ILKA 4ZHQB 5MFZA 3O4GA 2OB1A 4FX5A 3AF4A 5D01A 3VR6A 3MELA 3ZH9B 2PIAA 5AO9A 4GUAA 3A27A 5I8PA 1Z0KA 1Z26A 2JLSA 2YXDA 4NZNA 5ALMA 4E5YA 1YFLA 1J1ZA 1PGQA 3AVTA 2A0FA 2OAP1 2W5UA 2C0CA 2NVUA 2VHYA 3G0CA 4I50B 3ZI0A 4ITVA 5HCIA 3R40A 1A7JA 2I7TA 3KVNA 4I6GA 1Z75A 2WHQA 3K9WA 3SC3A 2W6ZA 3FLBA 4UNPA 2QLMA 2CCJA 3NQ41 1DX9A 4DLBA 2QBYB 2NUPA 2V4MA 2AN5A 1YTUA 5CH3A 2YRWA 1CT9A 3QE3A 4KQ2A 6ABPA 3GFVA 1R88A 5CK4A 2HFKA 3I6YA 1DX6A 3QWIA 3MTQA 1P19A 2ES4A 4KPGA 3VR3A 4BHTA 4F6RA 4O2RA 4BWFB 4ZU3A 5LZ5A 3WOHA 1PW7A 1EXMA 4LOLA 9ATCA 1Q91A 4JI3B 4FLMA 4HEQA 2B37A 4Y1RA 2QVCA 3RS7A 1RD4A 1OXTA 2EFJA 1L3IA 4LDQA 1ECCA 3L7BA 2FE4A 1GZ3A 3TI7A 1ZD5A 4YAEA 1HKUA 3HGTA 3OZAA 1FXWF 3RVDA 5B3LA 4TVKA 2QPTA 4CLDA 1PNOA 2PZMA 1MVLA 3EYWA 2P6NA 3MWDA 1NHWA 1W8DA 1PD0A 4OYLA 3MGKA 3IDZA 1WVMA 2HLPA 3H5AA 3KJZA 3FIUA 3HN6A 1YC2A 4QNNA 5A4FS 2B4TO 1M34B 1N0HA 1TVEA 2ADFA 2D0IA 2Q1SA 3IQWA 3PYMA 2Q5OA 3FMPB 3QGMA 3RSZA 3TJMA 1Z8NA 4B83A 3AR5A 4DG8A 1GA1A 5KJ6A 1OD6A 4R7ZA 3MWLA 2ZTUA 3WGQA 4S24A 5ICSA 3TRJA 4E07A 1C7IA 1IK4A 4QXPA 3ZY6A 4M6WB 3DE3X 4D3FA 5B7QA 2MINB 2I4RA 1JFFB 2Y1OA 1QAOA 4HAVA 3UW1A 2FGJA 4IIFA 4YB8A 4UM8B 3WWOA 1XAHA 1YL6A 3WLQA 2O0KA 5KYXB 3C5EA 1SVNA 1Z2OX 3N7UA 5JXGA 2FWMX 4LJ8A 2A9FA 5LP6A 2PO5A 5CVUA 1WKCA 5AJWA 3AM1A 3INRA 4A8PA 1HLFA 1P2UA 4Y2PA 5K4AA 3ZC3A