3MB5A

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-methionine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 75
structure length 255
sequence length 255
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3mb5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mb5A02
2CMHA 2ZZKA 1QAQA 2FRXA 1QANA 2IDKA 8MHTA 3OFKA 1XCJA 5F2OA 5K03A 2H1RA 1UIRA 1YZ3A 4O29A 1JSZA 1EJ0A 3T7SA 2P8JA 1MJFA 5F2KA 3ME5A 3VYWA 1VP3A 5E2AA 1N7IA 2P3OA 4HGYA 4RSRA 5CVJA 3OE5A 3UA3A 5HIKA 4DZRA 3HVHA 2ZBRA 1YB2A 2P1DA 3MERA 1DL5A 1Q0SA 1EAMA 2FCAA 1IXKA 4C06A 3KQQA 5EZSA 5KQSA 1F38A 1NKVA 2AOTA 1L3CA 3EGIA 3NTVA 4RV9A 4RTQA 1P1CA 4MIKA 4E30A 2IP2A 3CJRA 3SSNA 4R05A 1L1EA 3BGDA 4X61A 3H2BA 2C7PA 1JG3A 5HFJA 1FP1D 5LQKA 2YUIA 5P8WA 1KYWA 2IGTA 3GNLA 3TMAA 4PGHA 5GINE 2B2CA 4GOLD 3CVOA 3TPZA 4E32A 3FUWA 4HTFB 4B17A 1KIAA 1R6AA 4BY9E 5DM4A 1KPHA 3DR5A 3GRVA 1PJZA 4M36A 3C3PA 3IYLW 4PIMA 3EMBA 2Z6QA 1KP9A 1KXZA 1P91A 1SVUA 5DLYA 5LQAA 3TRKA 5DTMA 4GC5A 2JHAA 2PXAA 2QRVA 3FUVA 3R3HA 5FHRA 2B25A 3O31A 3VSEA 3T7TA 1JTEA 2YTZA 4PINA 5KQRA 3L8DA 4M38A 3BWCA 4OA5A 1ZKDA 3EGEA 4R6XA 3TM4A 4PYOA 3LBFA 3TM5A 4XUCA 5EG5A 4DMGA 1YFLA 1N2XA 3BUSA 3GXOA 5U4XA 3B3JA 2OKCA 3FPHA 2YR0A 1L9KA 1PRYA 5CD1A 3AY0A 4QDJA 3R6TA 4GEKA 2GPYA 4AUKA 1QZZA 2CWWA 4PYNA 4LG1A 3M6WA 4KW7A 3OZRA 3GRZA 2I7CA 3ELWA 4RWZA 2AN4A 4FGZA 2P35A 1VIDA 4EK9A 4DKJA 1XXLA 2AOUB 2JH8A 5EOVA 3RW9A 2AVNA 1EQAA 1NW7A 3QOXA 1VLMA 1WZNA 2H00A 4FP9A 2O06A 3A26A 4RTOA 3EVZA 3LDUA 2NXNA 1JG1A 3KPVA 2PGXA 1O54A 1RI1A 2H11A 2PV0A 3DXYA 2OZVA 3HEMA 3DTNA 1MHTA 1R18A 5K8VA 4GOMD 3JWIA 2YX1A 4FT2A 2IH4A 1G55A 3X0DA 2WK1A 3PFGA 2IBSA 5DWQA 5F2NA 1IM8A 1I4WA 1P39A 4IV0A 3MAGA 3B89A 1FBNA 2AN3A 1VQ1A 2PJDA 5EGSA 4ER5A 1H1DA 5K05A 2NXJA 5K0GA 2VDWA 3P2KA 5K0CA 3VC2A 2ZWVA 3KQOA 3JWHA 4EVIA 3QOWA 2NXCA 3FRIA 3HA5A 3KHKA 4IKPA 2HNKA 4X60A 7MHTA 4BP1A 1I9GA 4LWPA 4BLUA 4RVDA 1D2CA 4R8SA 5DM0A 2OBFA 3G89A 4Y2HA 2NP6A 2OYRA 1VBFA 1X19A 2AOWA 3HTXA 2IH2A 3OE4A 2B3TA 2QM3A 3FUUA 4A6DA 4JXJA 2ZBPA 2YVLA 3OZSA 5H02A 2UZ4A 3KR1A 5EQJB 3MTIA 4C05A 1OR8A 5B1SA 2BH2A 3BT7A 4PGGA 2GAFA 1JTFA 2ERCA 3GCZA 5K0LA 1YF3A 3IHTA 4AX8A 3VC1A 2OB1A 1SKMA 1D2GA 3BZBA 4U7PB 3FPJA 3A4TA 1TW2A 3KR0A 2ADMA 2PSSA 3EVAA 3M6UA 2GA9A 2NNWB 3UJCA 3QV2A 5GWXA 1YFJA 1I1NA 2ZIEA 3R9XB 5EMMA 4CKBA 5FWDA 1JQDA 3OPNA 3M4XA 5CM2Z 5HILA 3EEYA 5DSXA 4C03A 2ZZMA 3AJDA 3WSTA 3KR9A 3I9FA 3TKAA 2P3QA 4CTJA 1EJ6A 1XDUA 3BGIA 1FP2A 5K0BA 1JG4A 5CCXA 1JSXA 3FTEA 2XVAA 3DUWA 2UYQA 2JHPA 5CUQA 4H0NA 5FA8A 3HCDA 1VPTA 3HCCA 4KDRA 3LGAA 2BM8A 5E9QA 3FTFA 1XCLA 1NW6A 2AS0A 3KPYA 3LDFA 5FULA 3UJ9A 4PIPA 2Q41A 1X1DA 5IH3A 1TPYA 5K0FA 4OQDA 1XDSA 5FUBA 3K0BA 4F85A 2ZULA 2IBTA 4P7GA 3M6XA 5HZMA 4DQ0A 2G1PA 5DRTA 1XTPA 4X1OA 5DTRA 3MTEA 3AXTA 5GP1A 4YV2A 2P41A 3GRYA 4GOND 4YUXA 3KQPA 4RTRA 2ESRA 2GB4A 3GO4A 1NW3A 3ELYA 3FTCA 5D1HA 1ZGJA 3C6MA 4GC9A 5FA5A 3TFWA 4IWNA 2EJTA 3PS9A 4ZTBA 3UFBA 5IKMA 2C7OA 1JQ3A 1NV9A 2B9EA 4GUAA 4CKCA 4QQNA 3DP7A 5T64A 2OPBA 3A7EA 3IEIA 1NBIA 2QRVB 2G71A 3EGVA 3SGLA 4C07A 4OBXA 5FADA 4E2XA 1VL5A 4G56A 3EVBA 4RVFA 3UJ7A 3AWIA 3KQSA 2EG5A 4L7VA 2IDJA 5LQRA 2XVMA 3P9KA 4XUDA 2HMYB 2OO3A 4A6EA 3NVKI 4PYJA 3BKWA 3CKKA 4C08A 2O05A 2OY0A 2VDUE 5DX8A 4KWCA 5JR3A 4CTKA 3P71T 3LCUA 5K09A 3LL7A 5ICEA 2WA1A 5FWAA 2G72A 4RX1A 4AZVA 2QYOA 3LX6A 4ER6A 5E1DA 1M6YA 3OU7A 4HGZA 4CXMA 1M6EX 5CVVA 3A27A 2XYQA 3FRHA 3TKYA 3HP7A 1NW5A 4GF5A 3CCFA 1L3IA 1NE2A 3FUTA 4DF3A 5LQUA 2NP7A 2PVCA 4FR0A 2FK7A 3G2QA 3NWBA 5DM1A 2YXDA 3EVGA 3E05A 2JHCA 4KVZA 3T0IA 3OU6A 3HCAA 3SVZA 1R8YA 2BR4A 3THSA 2HR1A 1BKYA 3C0KA 4OQEA 5KYGA 5LQJA 4ER3A 2PX4A 3EVEA 1NV8A 3MCTA 4ER7A 5K0NA 3LHDA 1JQEA 4EMSA 3HNRA 4DCMA 3LKDA 4LECA 3DXXA 2R6ZA 2PLWA 3EEOA 2C7QA 2YXEA 3M6VA 2IIPA 1F3LA 3LECA 1X1AA 2VDVE 3CGGA 2ORED 4GBED 4RVGA 2VS1A 3LKZA 2PX2A 3Q87B 3AXSA 3R24A 1UFKA 4PCLA 5CVEA 3UJAA 3TLJA 3ER8A 3PX2A 1U2ZA 4KDCA 1DUSA 4MQ4A 5FCDA 4AZWA 3TOSA 5HIMA 3UJBA 4XCXA 2AVDA 5DSTA 3SX0A 5DPMA 3NWEA 4PCAA 4YUVA 2P7HA 3DMHA 4YMGA 5BP7A 2ZZNA 4YMHA 3KKZA 2OB2A 1JG2A 2AOVA 4OX9Y 1YZHA 2F8LA 3FPEA 3C6KA 1WXWA 3A25A 1SUIA 3GRRA 1WS6A 1B42A 5E1OA 2ZCJA 4E33A 4AZSA 4M7RA 1G8AA 2P3LA 5EKXA 2AN5A 3EMDA 5HIIA 3LCVB 3G5TA 4HRAA 2I9KA 1INLA 2G8NA 4PONA 4FSXA 4P7FA 3JWJA 3LSTA 3OZTA 2PT6A 5BW4A 4E2ZA 1ZQ9A 1Q0TA 5T6BA 2IFTA 3M33A 5T67A 3V8VA 4CKEA 1M0EA 2EFJA 2I62A 3CC8A 3EVDA 3P9IA 3KPJA 5DXAA 5EHIA 2XBMA 2O07A 3P9NA 1G6Q1 1ZGAA 3D2LA 1WG8A 4FT4A 3BWBA 1EG2A 2DPMA 1Z3CA 2NYUA 3DMFA 3R0QA 4K6MA 4KRGA 4E2YA 4NECA 5LR6A 3FYDA 2CKDA 2ZWAA 4QQKA 3PT9A 1V39A 3HVIA 4ISCA 2YQZA 4F84A 5EC8A 4RTKA 3ANXA 3OU2A 4PYQA 1FPQA 1O9HA 2UYOA 3GWZA 3U81A 2UYHA 3MHTA 4IV8A 2Z6AA 4E70A 2WA2A 4OA8A 4ATNA 3REOA 10MHA 3UZUA 2O57A 1SUSA 3DULA 5ERGB 1RJGA 2ZBQA 3KQWA 2V7EA 4BLWA 3FUXA 3HA7A 5EVJA 3PVCA 1D2HA 3FTDA 4KIGA 2K4MA 3KR2A 4X63A 1N7JA 4V0QA 5EEGA 2PKWA 2PXCA 3ORHA 4HG2A 5LQNA 1RI2A 1HNNA 3CJTA 5C9ZA 2IPXA 5KVAA 4OBWA 1AV6A 1ZG3A 4QTTB 2ZVJA 4RTLA 3UJ8A 3G7UA 2BR5A 5EMKA 5JUWA 2AOTB 1HMYA 3KQMA 1R00A 2IH5A 3LCCA 5E8JA 3UBTA 5DRYA 2GLUA 3P8ZA 2EX4A 2ZIFA 3HCEA 4FS8A 2XYVA 4MWZA 5E9WA 5GM1A 9MHTA 3OCJA 4YUZA 2P7IA 2B78A 3NMUF 1DCTA 1ORIA 4QVGA 4Z2YA 3FPFA 4YV1A 1L3BA 1WXXA 2HV9A 4V0RA 1BHJA 2QE6A 4DA4A 1AQJA 3B3FA 3HVKA 5K0JA 4HC4A 4RTSA 4DM3A 3HM2A 3THRA 3PTAA 3G88A 1KPIA 3UJDA 2FHPA 4RTNA 3PLAE 4P58A 1X1BA 1WY7A 1IY9A 3E23A 3M70A 4GQBA 3KQTA 3EVCA 3BGVA 3BWMA 3G2PA 5ICFA 4YUYA 1R8XA 1X1CA 1JR4A 2ZW9A 4M37A 5EPEA 1QAMA 1XVAA 2E5WA 5BXYA 2P40A 5KS2A 3T7RA 2HWKA 2NXEA 3JWGA 2VP3A 1ORHA 4POOA 4EQZA 3PX3A 3PB3A 2YXLA 4P7JA 2AR0A 3BXOA 4WXHA 3DLCA 1NBHA 3KQVA 1YUBA 4X41A 3GDHA 2N47A 2O0LA 1BOOA 4U7TB 4WVLA 4ER0A 3V97A 1RJDA 1BC5A 5CCBA 2XYRA 3RODA 1RI5A 3B7PA 3GRUA 1XDZA 4MHTA 4HTFA 4PNEA 4E31A 2A14A 2BM9A 5C0OE 3HA3A 3G2OA 3PFHA 5D1NA 2HTEA 2AZTA 2R3SA 1RI3A 2PXXA 1R74A 3I5UA 2ZLBA 4HH4A 4YUWA 2PBFA 2LD4A 2DULA 3NJRA 4QDKA 5HOQA 5GIPE 3ELDA 4AZTA 3ER9A 4RTPA 1QAOA 3O4FA 3GU3A 5DXJA 2AOUA 3K6RA 5ICCA 5E8RA 2Z6UA 3S68A 3E8SA 3I53A 5MHTA 5HIJA 3NDJA 3SSOA 2CL5A 3DMGA 3G5LA 5DX1A 2GS9A 4PYIA 2ONYA 2PT9A 3LDGA 2JG3A 3GGDA 5EMJA 3UA4A 3IV6A 2PY6A 4QVKA 3P2EA 1ZHFA 5EIFA 5GOZA 1O9GA 3DH0A 3E7PA 5LQCA 4QTUB 1G38A 1RJFA 4BLVA 4C04A 2ZTHA 4FSDA 4Y30A 3EPPA 2JJQA 3P97A 4UOEA 3O7WA 4R8RA 5EMLA 2OXTA 5DT2A 2C7RA 1KYZA 2BR3A 3B3GA 3SMQA 2KW5A 2BZGA 3NVMB 5E9JA 3GIWA 3KU1A 2ZIGA 3NDIA 5GIOE 5ICGA 2PX5A 1XJ5A 3MB5A 2PWYA 5E2BA 3Q7EA 3FPGA 4DCGA 3LBYA 2GH1A 1G60A 5K0EA 3F4KA 1RJEA 5FTWA 1QYRA 2G70A 3MQ2A 2VZ9A 5K01A 5DX0A 4RTJA 4P7KA 1NT2A 1SQGA 4GOOD 5CVDA 3P2IA 5EEHA 4RTMA 4E2WA 3RIEA 1P1BA 3G2MA 1G8SA 1AQIA 2AOXA 3HVJA 5EKUA 3NW9A 1KPGA 3TR6A 4C4AA 3KQYA 2CMGA 5E1BA 3OFJA 5E1MA 1VP9A 5LSAA 5BW5A 1VE3A 3EVFA 3P9CA 1NW8A 4EKIA 2V74B 3DOUA 3MCZA 5CVUA 2UYCA 4PYMA 3BWYA 5G02A 2FPOA 3CBGA 3DXZA 5HEKA 4CWAA 4PWYA 2Y1WA 2ONZA 3HCFA 5EZQA 5DM2A 1AF7A 3KPUA 1SG9A 1RI4A 5CIYA 3MGGA 3KPWA 1KR5A 2ZSUA 3CJQA 3I64A 3A7DA 5EIWA 2Y1XA 5FHQA 5GM2A 2PX8A 3FZGA 4FZVA 2PWPA 3I58A 4XUEA 3SM3A 4PYKA 3TQSA 3ERCA 3ID6C 5FQOA 4YV0A 3G8BA 2EJUA 1FJXA 4LWOA 1Y8CA 2FK8A 4PYLA 4QPPA 4BP3A 4KIFA 1UWVA 2ZFUA 3C3YA 4EKGA 3G8AA 1KHHA 1TW3A 4RVHA 3UWPA 5FQNA 3ELUA 4R6WA 2FYTA 3LPMA 3UJ6A 4F86A 1EIZA 4MTLA 3GJYA 1SQFA 4HSGA 2I6GA 5C1IA 2JH9A 2QY6A 5DTQA 3SSMA 3DLIA 3FYCA 3B5IA 4RYLA 3HCBA 3BKXA 5EHGA 1T43A 3SR4A 5M5BA 3SXJA 4QPNA
chains in the Genus database with same CATH superfamily
4ZREA 1P72A 2AMYA 1U5BB 1LA2A 2FRXA 3QXSA 2YJNA 4WDRA 2RD2A 2OFWA 2E82A 1EXWA 4RSGA 3E61A 3KELA 2H1RA 5CFQA 1AZTA 1PE0A 3ZW7A 4Q24A 3K1AA 1VHDA 5BSKA 1YK1A 2FZWA 4A1OA 2H08A 2GHIA 3DEJA 4L0MA 2COUA 2ALJA 4ZALA 4LUCA 1BMTA 2YFKA 2P9JA 1M1YE 1IQ0A 4M6WB 3HVHA 3NJ8A 2G9RA 2YVUA 1AKWA 1K97A 2SKCA 1MVOA 4MQUA 1EAMA 1Z0KA 2JLYA 4C06A 2R47A 4DQVA 1Y6QA 4ABYA 2RB5A 2HBRA 3VSBA 2HW8A 3RVKA 1L3CA 1U2SA 3CQ9A 1CJSA 4QU0A 2DCMA 2JPDA 4L27A 5DDIP 1AO0A 3HGQA 1J8QA 4N0PA 4EZIA 3E15A 3TBKA 2Q49A 3HU2A 2Z4SA 1ZH4A 2QQFA 3S8EA 3VR4D 4F04A 2YHUA 3AI1A 2RHOA 4QBTA 5ETJA 3TMAA 6NULA 3BJRA 3P26A 3DBRA 1U0TA 3KYJB 4XSVA 3PK0A 3SKVA 4P4SB 1N2ZA 1RJ9A 2ZJFA 4TXLA 2C4HA 3W9BA 1L5ZA 2XMQA 3MWYW 3QU5A 3ZDBA 1FMFA 1IH8A 1KPHA 3DR5A 3RUEA 3ROTA 4CLRB 5D8DA 4MV9A 1ZAYA 3MWGA 1Y6RA 1P1HA 1OCEA 2O8VA 3JAMA 1LF0A 2BUAA 5LQAA 4GU5A 1ETHA 2MHCA 1CCWA 1LSSA 1RD4A 2Q5JA 3E8MA 1KK1A 1G19A 1PZMA 1CR2A 1Q50A 2QRVA 4B3RB 1XIVA 3U4GA 2GPTA 2CEKA 1GRCA 2WWWA 2PFKA 4P98A 3ZWWA 5TB5A 1NQ5A 2Y2UA 4BL5A 1HA3A 5CLFA 3NDBB 3F6BX 2HPZA 3K1ZA 4FD3A 3H9BA 4OXKA 4DBZA 4KKXB 1UFQA 2Q3FA 5EKDA 2ZYVX 4N5LA 3BUSA 1VJTA 3A9TA 3TKLA 3EIUA 3G2HA 1PVDA 2OBBA 4N5NA 4ZI7B 5TLSA 4RHFA 1N6KA 4QDJA 2ST1A 1YZTA 3MRVA 4MARA 3SKYA 3KKMA 1MC4A 2GPAA 1QYVA 3V8RA 3WRWA 1FU4A 2JFZA 5HR5A 2A4MA 1HL7A 5H59A 4GWKA 2IH4A 3CKLA 2GBLC 4KWEA 4RLQA 3W7BA 1XZCA 5HJ7A 2H1OA 1Z15A 2P2SA 3O84A 4E0BA 4ZMRA 1VPEA 2FP4B 1LSJA 1M6WA 1K92A 1X1SA 2YV1A 3AZOA 3D8TA 1D04A 2CMDA 2O06A 2ZYTX 3WLLA 2XOXA 3ZWAA 5IPFA 1JG1A 3KPVA 4FI3C 2FGKA 2H11A 2PV0A 2OGWA 2O2YA 3DTYA 4IY1A 1RYFA 3CWCA 4ZV9A 2WSBA 1HFWA 2HJRA 3AZPA 1CIPA 1K5HA 1QVRA 3IV9A 2DM6A 1P6QA 3QVXA 2B98A 4GSYA 5E95A 4YRBA 2QW1A 4MDYA 1YR2A 4XSHA 1OFVA 5F2NA 2BEJA 4IDDA 4I50A 5DLEA 4YYEA 4ARIA 2AE2A 3WGNA 2IY9A 1HRKA 4CCYB 5CLLA 1YDWA 1ODJA 3OT5A 2NXJA 3DAHA 1FP6A 4DIOA 1HSOA 4IQ4A 4QG3A 1RZVA 2CBZA 2ZAYA 3OTOB 1LBHA 3QPAA 1N3YA 3F9CA 7YASA 1IZ9A 3SVLA 2O3UA 3CLTD 2FSFA 1ZIDA 3DE3X 4L4XA 4FX2A 2W6ZA 1WHSA 3A2LA 4LJSA 3WV4A 2HFJA 5JEEA 1KZ9A 3DPIA 221PA 1ES9A 2B1JA 4CFZA 1WSBA 2PH5A 4NP6A 4LYJA 3MCVA 1DAPA 2CF5A 1HLGA 3DV2A 4LTNA 2OP1A 3IE2A 3M4ZA 4LNHA 3WFJA 1P0FA 3GCZA 5FPYA 1Z82A 1Q3KA 2QQSA 4OQNA 3SX2A 3WK4A 4G0WA 1DQSA 1OV4A 5EMNA 4F91B 4MP3A 5FBRB 3FPJA 4BWYA 5JPIA 3EVAA 3O6VA 1TGVA 2R6HA 1R4NA 1ZLXA 1RRVA 3DO5A 5JBQA 5JZOA 1KIFA 1NURA 4LZAA 2A35A 2Y4NA 2GPNA 4EYOA 4R7GA 5HXAA 3D3EA 3AVYA 2POCA 3AUKA 3QJ5A 1QIFA 2GD2A 3G5MA 5ARDA 4Z7OB 1DQRA 121PA 1UWLA 2Q4EA 3DUWA 3EXG2 2AC4A 1JKFA 4G63A 5TGDA 1G8MA 3V8QA 2E4AA 4HPWA 4CR8A 1TCBA 3DOEA 3PGLA 4RXMA 2IQ5A 1B8VA 1PZHA 2FZVA 5JBNA 2CY0A 2R7LA 1OC4A 4OSEA 2AS0A 1KAQA 3IUMA 3TB4A 3MBKA 3K9NA 1ZBQA 3W2FA 1X1DA 3D2CA 2D59A 5BV0A 4D7AA 1TM5E 4ZZIA 3W8FA 1CY0A 2XWSA 1G17A 2ZXEA 3GCWA 2NUAB 2CVPA 1Y5NA 1TTHA 1D9ZA 3UHPA 2V65A 4CLXA 3FXAA 3NM5A 5A3VA 3ZI4A 1HE2A 1FTSA 4M3NA 3AM5A 3PD0A 3GO4A 3Q40A 1RE1A 1CEEA 1JA1A 1TCVA 3ONVA 2JLQA 1B0AA 2C58A 1GXSB 4MEBA 3RWOA 2ZUSA 1EVZA 1NNSA 2VWPA 3L9WA 4TXHA 3RU7A 4N03A 4BMXA 1HQCA 2HBZA 5K3SA 1OD6A 4JBHA 3WWEA 1DQNA 2A9JA 2AG0A 2W4IA 4TMKA 4NIMA 1THGA 2R8XA 3EDMA 3IFSA 1R15A 1N8NA 3P9KA 5DHPA 4DUGA 1DAHA 1FMJA 2HEGA 4RPHA 2CV2A 1I2DA 3L7IA 1ABEA 2GFIA 2HWWA 3AI7A 4HAXA 4GLFA 2P4UA 2J0VA 3B1KA 3CT4A 1R27A 5CGQB 3RF7A 4DA0A 3EA5A 4IHAA 2VXCA 4QO7A 4E7OA 2QY9A 1P0IA 4PFJA 1M6EX 1XL1A 2QTMA 4LYEA 4ZOEA 1J20A 1PR9A 1L5KA 4OPMA 2IZ5A 4ZEVA 1BMQA 1NW5A 1D3AA 5F3DA 4MJXA 2YINC 2ZBDA 1XK6A 3GP3A 3NHKA 1AGRA 4QICA 4L72A 4WL0A 3KYDB 2V7PA 5I7AA 3WKAA 1A8PA 4OLFA 2RGYA 4HAWA 3MSCA 4N5HX 4UFNA 4YIHA 1OFUX 3TI7A 1Z34A 4U1RA 4XGRA 4HT3B 4NU6A 2K5UA 1K9VF 4KLAA 1DJMA 2XHZA 3AESB 3OJ0A 2O1WA 1NW9B 1BKYA 3WGHA 4DIMA 1U0EA 3GUZA 3S3TA 5LFAA 3L77A 5CITA 4OU5A 2Z57A 3HNRA 3TEMA 3K6SB 2XDWA 3BM5A 3ECSA 3T5MA 3RAJA 2KPOA 3MWDB 3TJZA 2SKEA 3UB2A 1NN3A 2AZDA 5FTLA 4GP9A 1DC5A 2JIOA 4B4UA 3QVSA 4P22A 5BRAA 5KQMA 3NEYA 4NZYA 1PR1A 4HUQB 5KNDA 1DUSA 1JEJA 3DVQX 3E7WA 3QY0A 4GR9A 3FPKA 4X6XA 5EZ5A 2W2OA 2BEUA 1F8XA 2IYWA 3GVCA 5AK3A 4G9GA 1NRIA 4Y1RB 3WKBA 3MG9A 5D3QA 4MXDA 1BDJA 4TMVA 1G59A 2PH7A 1JN0A 2OCYC 2XTMA 3BXEA 4CMJA 4CV1A 3O8LA 2NTNA 1ISMA 4OX9Y 3T3OA 1C4XA 1SUIA 4GI7A 1WO8A 1WS6A 1CUSA 3UTCA 1CVLA 3CY6A 3EMDA 4Y1FA 5BV2P 4MAFA 1BHSA 3QW4B 2PS1A 2G8NA 1MC8A 3CZ9A 2A78A 1W4AA 4GI5A 4G81A 3UICA 2BGNA 3GYBA 4Q1DA 4RVOA 1ZQ9A 3KZVA 2VKTA 3QEOA 2FHSA 2IX9A 3O4HA 2HGZA 3QVUA 4BXOA 2WD8A 3BYZA 1PS8A 5J59A 1PWZA 2ZS7A 3JQAA 1YJQA 3SEAA 2IV7A 1Q14A 1IJEA 2LIPA 3KPJA 5J2UF 1TJPB 4KLRA 2Q2WA 1R3DA 1L4BA 3C85A 1E9FA 3NC4A 1UBCA 3ADCA 3ZU2A 4B44A 2D4HA 2NYUA 4MUGA 2E4UA 2GK4A 1O5TA 3LWBA 1AMUA 3UGJA 4W1PA 1P4RA 4GVPA 4JQSA 4DQXA 3EXHC 1KVSA 3COWA 1EWYA 1GGFA 1NVTA 4EEXA 2W6MA 1QNLA 1E2QA 2NO5A 4FU0A 3IBYA 3VZQA 1UZAA 2O8CB 1WPXA 4OMUA 1JEYA 3STHA 1PIWA 1ZI9A 2N9UA 3CW9A 3WICA 1G20E 3OEHA 4NU0A 4BJ6A 3JVVA 3TTUA 4O4JB 2FWBA 5AP9A 5KYKA 5G0WA 1PX2A 3H83A 1XRMA 3WNBA 1YNSA 1M5UA 2JFWA 3H2YA 1E9SA 2ODPA 3RRXA 2WWFA 4EW2A 2JAQA 3ZHSA 4WGGA 2IX3A 3O9MA 3KR2A 4L0DA 4NJMA 3PTLA 1W49A 2AXNA 1AKMA 1MRZA 2ID8A 2PKWA 2W6NA 5EYPB 1MUUA 5LQNA 4ALNA 4E1AA 5FKJA 1D0VA 1Z0UA 3GYGA 3H4IA 3GFSA 3NHPA 4M99A 4JEHA 2BKXA 3TLGA 3K6JA 2B5WA 4AJ9A 1ILWA 3KVRA 3BILA 3LT5A 1F1BA 4H7HA 1JKJA 4LBWA 4ARUA 4WV3A 4BZZA 4NDNE 3RTGA 1Y6ZA 1NP3A 4F3YA 3IA7A 3CNQS 1AK1A 5H3LA 5HQTA 2Q29A 2RC5A 1MQ9A 2CVZA 5DRYA 3HY6A 3Q9SA 4QNMA 2M6LA 2GRAA 5DGTA 5FPHA 3UC9A 1G8GA 3ZQKA 4YUZA 1X1EA 2XODA 1I1OA 1NZJA 1S9HA 2VF5X 1SKQA 5SY6A 2DQ4A 4US0R 2WJZB 4ZO7A 4DCJA 1ULZA 3DF7A 1Z56C 2E55A 2J3QA 5C1BA 2ZEJA 2FMFA 2ZUEA 2TMGA 3PNVA 1KPIA 1XF9A 4RPLA 5AO9A 3H11B 5MGNA 3MBOA 5BN4B 4URXR 5IT0A 4P58A 1JKMA 4C9BA 3DLPX 2PWBA 2Q6IA 4GQBA 4UVHA 5JZ9A 2O8EA 1KK2A 1TA9A 4EW3A 3EBLA 1Z5WA 1SPXA 4CL2A 2AFRA 5ARBA 2ZJBA 4CEHA 2WJYA 4KZPA 3GF4A 3TQOA 3WP1B 4HGNA 4JC5A 3BJEA 3QH4A 4LHZA 5ALJA 1ML3A 5DHUA 3UXEA 2O9JA 2P62A 2YXLA 2Q7OE 1NXTA 1XNHA 5K1ZA 5JH7A 2RGAA 3KL4A 4JBGA 3ZVNA 1PZNA 4CL3A 1TO2E 4JELA 3UUGA 4U6SA 2FX5A 5BWMA 3FJ1A 2G28A 2HJSA 3WFZA 3GL9A 3I4LA 4E2FA 2Q7XA 2OCGA 1IMOA 3KXLA 4FYWA 5A9TA 2N47A 2BOVA 3MOIA 2WNHA 4BEJA 5IFLA 1GGJA 5JEDA 4PHGA 1RXVA 3DQZA 3VHQA 2A8YA 3W04A 4ECEA 4JQOA 1GITA 4DQDA 5JCXA 2GASA 1JFRA 1S4MA 2BFAA 2WJIA 4FYYA 1Y98A 5GZ6A 5JS8A 2BM9A 1PZGA 3QJYA 2ZJZA 3G2OA 4JUCA 1I30A 5D1NA 3TI9A 3HB7A 3HDYA 5B6PA 5FFFA 1L5QA 1U4SA 2NT4A 4ESEA 4BVLA 1JQKA 3PWKA 1X0VA 2RGUA 3UMYA 1RQ7A 3LBHA 3EODA 2WFAA 1Q83A 4JFRA 3ELDA 1PNRA 1UDRA 3O4FA 2IJGX 4Q93A 3GLFA 3QQ8A 1PNQA 2A58A 3COJA 1N5IA 3ZLBA 4S1OA 2J59A 2XY4A 3PPYA 3GMDA 3RDPA 1MLDA 2R11A 1GNQA 3F6SA 4JZYA 3UJHA 1KI6A 5LNK1 1X7XB 1ZIYA 4YCJA 3UMGA 2CVQA 4PY2A 1HYGA 2BFFA 3DGEC 1VFPA 1DCKA 5A5GA 2DC1A 3B9BA 2A86A 3ZZ0A 5EIFA 3UFXA 4PVDA 2PO5A 3DH0A 4FIDA 4RJKA 2MMCA 1S9DA 4OY3A 1WULS 5J4HA 1UT6A 4K6FA 3K6SA 4DMKA 2RKOA 1GG9A 4UUOA 1TC2A 5G3ZA 1TFUA 3QVVA 3GLQA 2YIJA 3KJIA 3NHLA 2ZSEA 5LA6B 2DF8A 1PQUA 1EI9A 3L7OA 3I9MA 4FHGA 4LNUB 4PSVA 4UOEA 4LXGA 5HSGA 1EFPA 1BQ4A 2HCTA 4L8WB 4ZTZB 1C0IA 3BHIA 1EE9A 3OWHA 4FC6A 1RKQA 4RFVA 1GVHA 1JR3A 3AK4A 5DSZA 1FF9A 1Q84A 3IHKA 3EEFA 1QYRA 4C4RA 3WTCA 4B85A 3ANNA 3ZWBA 4BIIA 2I6QA 3ZY3A 3FETA 2XB8A 3Q3VA 4MNTA 4L3WA 2QUKA 3TZQA 3HVJA 3G2MA 2AOXA 2OMEA 3G79A 4G5FA 1JZSA 4HN9A 4B6OA 3KYCA 1AGPA 1A71A 4L76A 3VU9B 4M9QA 1P5ZB 1UKVY 1KYVA 2BGIA 2X58A 4ALJA 1XMJA 3EVFA 3GA7A 1YBVA 5TEVA 3V8PA 1KEEB 2B8EA 2VJMB 4FXOA 4YCLA 4FKMA 1RMTA 1A7JA 1KOFA 1FFDA 1VA4A 1OJ7A 2J31A 2X40A 2VQDA 3GHHA 3LC0A 4RVSA 4Q4HA 5SZHB 3VPAA 1I6MA 3C24A 1R6UA 2GTIA 1NFRA 2QVYX 2I4OA 2JJ2A 1J5XA 3HBFA 3I09A 5DM70 2GUGA 4J0QA 3K1JA 4HDNB 1XRLA 2L0XA 3NKFA 3VU3A 1XAHA 3H42B 3BQBA 5DEIA 3VPXA 1LD3A 1C30B 1F8GA 1PDWA 1HRDA 4FOTA 4CKWB 3SAJA 2CMFA 2OWEA 2PUJA 4WZAE 2CVFA 3HDJA 1FX0B 4AN4A 3FDZA 4ETMA 4LDAA 4PV7A 4PR3A 1MQ8B 1EBFA 3G8AA 4L57A 5DN9A 4CQLB 1BCSB 4NQZA 4Q4LA 4Z0TA 2FN7A 3UJ6A 4E13A 1B43A 1LLUA 2GOYA 3Q11A 3ADPA 1XAIA 3GCXA 3FB1A 1BFUA 4UU8A 2XIJA 5ARCA 5IN5A 3RANA 4DMHA 1SRRA 1YR6A 2F1IA 2JF0A 5A5EA 4PPFA 1A5ZA 1GTRA 2H06A 1Q1NA 2JD0A 4J16A 1XMQB 1PJ8A 4UBLA 3CEAA 1Q7GA 5KWIA 2MDTA 2I2BA 3M49A 1F0PA 4LE2A 2ZIVB 1ODCA 4FKZA 4R2JA 2YJTD 4BRUA 3LZCA 3PGKA 3AR3A 4R9VA 4K46A 4O29A 5JY6A 4MK4A 4YP0A 3F74A 1T5IA 2BEVA 4RDIA 1KI4A 2P0EA 3HY3A 1H93A 1UIMA 3N86A 5EXDA 5C34B 3AEKB 1SXPA 1FUUA 3BHMA 1DL5A 2OZPA 4ZCSA 3N8HA 1NQWA 4K9DA 3MAAC 4W5RA 3R7SA 1QO9A 3I8SA 4C76A 2WWTA 4EFLA 2FDCA 1DP4A 4DMRA 3IPRA 3RVDA 1USIA 2VBCA 5JYDA 4V24A 4AN0A 2YY5A 3EVNA 5AVUA 3TG8A 4JCCA 1QPBA 1TYAE 1MCZA 1Z5OA 4QHTA 1CF4A 1LSUA 3AONB 1IJBA 1PT5A 1ACLA 2PH3A 1BOFA 4B7UA 4MYSA 4HLUC 2CXNA 4CEJB 1PVOA 4HXFB 1VXRA 4ZYTA 5JNSA 3EXG1 3FHLA 2Z5VA 2UYYA 3IBGA 2DEUA 1UUFA 1JDBC 2GJ4A 3PJEA 2NU8A 1LK7A 2VAMA 5FWXB 2ZI3A 1T9AA 1PTJC 2ZRIA 5GINE 1XKTA 1QDLB 1A76A 5FV4A 2HY7A 4GPEA 1KKLA 1O5IA 4FUQA 1R6AA 1UOPA 1ZRHA 3HDTA 4AP6A 1M2KA 5L3VA 1B6TA 2P9QA 4P31A 4GX1A 4MQLA 4Y0VA 2AYYA 4XVUA 4ITUA 1B6GA 1CS0A 1GGVA 4QGAA 3L92A 1EJBA 1K4YA 1KMHB 2UYGA 2X3YA 3ZS9A 5AKIA 4ZVSA 4D4MA 1WU7A 1TTPB 5IAAA 4YMTA 2VAPA 3M9LA 3FUVA 1FSFA 2Z5LA 4B6QA 2B25A 1D2EA 2ZAIA 3FAKA 3KJNA 1LBTA 5FO0A 4EELA 2A5GA 1YQXA 3JPYA 2B4QA 4R6XA 4MWBA 2HHAA 4DMGA 4JB2A 3EF1A 3VVCA 1MORA 1G21E 2IDMA 3CNOA 1XK7A 1E94E 1OZ0A 2HUPA 3EZGA 3F2IA 4KO4S 1PO7A 4P4TA 3AFOA 4AF7A 1PRYA 1TM3E 2EQAA 4YJ3F 1NKSA 1U90A 1G9SA 1ZWLA 2HRCA 4JUIA 1M54A 3EC7A 3CWZA 3GLSA 4G1MB 1M74A 1ZU5A 2UUPA 1RU3A 4A15A 4ZT6A 2GZ1A 3KVVA 2XNJA 3ZV6A 1WZEA 2WHEA 2ZG6A 3GFTA 1G291 2DQZA 4M7PA 4WVFA 3DAOA 5EP1A 3TLZA 4JLKA 1DIOB 2JASA 4TS3A 4V2IA 1H2XA 3T9DA 4E7PA 5BNZA 2HIHA 4BV2A 1JKJB 2AFIE 5IULC 1KP3A 4DV4B 5JARA 3JQGB 5CT8A 2X8WA 1KEEA 2ISQA 1J2EA 3JCZA 1CX9B 2D3TA 4MMZB 1YS7A 5C1IA 4KR9A 4AWXA 1AQYA 4DIEA 5FH9A 4L02A 3W8RA 4MJ3A 2X8BA 2GSDA 1WQ4A 2AMFA 5BSWA 3PWTA 5JPCA 3OQMA 5HA5A 2TECE 4KE7A 3RTEA 2FX3A 4YRGA 2EU8A 2WHQA 3VAZA 4G4SP 4L2IA 1XEWY 1L6RA 3FPTA 2QTCA 4NCXA 1TEXA 4CCSA 3J80A 1B23P 1TAGA 1CS4C 1EA7A 1SOVA 1T4GA 4UEKA 4G89A 1C3EA 1VYVA 4IGKA 5AOAA 1IG0A 2G88A 2IITA 3S28A 1ZPDA 3G0IA 4BNXA 4H60A 3VYRB 1JLMA 3ZWKA 3DO6A 3FRJA 1TEVA 3W2TA 2QRMA 3HPRA 3L18A 4X24A 2HWUA 3B6JA 4R8SA 4D97A 1MEEA 3W06A 3QUAA 1XAJA 4LYHA 5IT9A 1WXGA 3SCZA 1ECPA 1W36D 2G63A 3I2GA 3FR7A 4N5DA 4INZA 4Z7NB 1JTFA 1C9JA 1EX7A 1CLUA 4RENA 3JQBA 1ML4A 1J0XO 3GARA 4RIEA 4JBIA 2GPBA 1CNMA 3L79A 4TROA 4LE1A 1FFSA 5DN6A 1UAAA 4JVLA 4TV9F 1O89A 2A92A 4L2IB 1QCZA 3QFHA 5JD6A 1NMEA 3FHCB 5BVHB 2EKDA 2CLMB 1OBOA 2GBCA 4K3UA 1YL6A 1U3GA 3PIRA 1JUDA 1IVYA 1DADA 2QTGA 5BW8A 4YRLA 4O5OA 5A0TA 1FYWA 1PGJA 2ERYA 4PSKA 3A28A 2HSEA 4KSCA 2ORVA 1I7PA 3LLSA 4WACA 2QLMA 4J1TC 3RFCA 4Y7DA 5FI5A 1K4MA 1LBQA 3UAZA 3VPHA 1N6RA 1HWYA 1V8DA 3I62A 1G5TA 1LNQA 1NYLA 3R9IA 8GPBA 3LGAA 2BM8A 4FK8A 2C8LA 3ABRB 3AV0B 1QUEA 4UOQA 3WYCA 1TZBA 4QDTA 3HKEA 1T2NA 4L74A 5F64A 5LOVF 3MUNA 2H6EA 5KC8A 2W6PA 2CCGA 3QPDA 3R0JA 3EUEA 3EUAA 3BRQA 4LTMA 1C4OA 1SN7A 1V8OA 4QHSA 1P9RA 2R6FA 3VI4B 4RY9A 4GR4A 2EQ5A 4DW8A 2YZ7A 4YV2A 4GOND 5FAKA 3OH8A 3FTCA 5BMOA 1KEWA 3EC1A 4N3CA 3W8DA 1U8XX 1W5FA 4IWNA 5ISMA 5JS6A 1RWOA 4UNRA 2QP4A 5T64A 4LRUA 3CUYA 2QTFA 3WKCA 2Q6OA 1R0KA 3SDBA 3U4CA 5BPHA 1NMQA 1ZFNA 1DU4A 2PKXA 2XMSA 3I3OA 4HYEA 4HWRA 4UE3S 4D56A 2CNDA 3QI7A 3EVBA 1FYFA 4D9FA 1V43A 1AHIA 2EG5A 2J87A 2JD1A 2GYWA 2NZYA 4AROA 5KYWB 1X7ZB 1UPTA 3IEPA 4OHKA 4G4JA 4A6EA 4DSOA 1RWBA 3NVKI 4F2GA 4NEGA 3NGLA 5DX8A 5J58A 4C6TB 3L6UA 3NRBA 3FPUA 1K2WA 3WLIA 5L4NA 2PS9A 4L8YA 3EWIA 1QYDA 5JVDF 5ALTA 3KK0A 3S7TA 1QGUB 3DHVA 4E51A 3EDRA 5HGXA 1QIJA 4ID3A 1HUQA 2YWBA 4F6LA 2ZM6B 1T4MA 1LFDB 1DB3A 2IF2A 1YQGA 4HFRA 1EBUA 4FM9A 3NEAA 3T7EA 3A3PA 1A2QA 4ZU1X 7REQA 1Z4OA 3AGQA 4BKPA 1E64A 2EZ4A 3UG7A 1AXRA 1OXXK 2WRZA 1P2DA 4I5EA 1MR3F 2I3DA 1CJBA 3SVZA 3WGZA 4Z9AA 3NWPA 2BMEA 2C9OA 4P9NA 2VQEB 4CLOA 1MG0A 4OQEA 2VI5A 2JIPA 2WF5A 3C39A 4ER7A 2I6FA 4A03A 4AG5A 1XJQA 1HG1A 4CIBA 1JQEA 2QRGA 3NHSA 1FDIA 5DBGA 4YEDA 5HKKD 2GPJA 1ZA1A 2FW7A 2E37A 2CHEA 3WNZA 1L1FA 4A2WA 3FKQA 3U17A 3IAM6 1VKJA 5KTKA 2CV0A 4WHMA 3KJHA 2VTKA 1C80A 4H1TA 4BZXA 2H4XA 2HLNA 2JJ8A 2ZYWX 2WINI 4L28A 5IHPA 2VYVA 1UODA 1QCYA 4GRIA 2GZDA 2PMEA 3H5WA 5L7WA 3G8DA 4H3HB 3MJHA 5HK9A 2OXCA 3OP1A 5DI3B 3DBLB 1F2TA 4ESVA 2V3CC 4X6YA 2P7HA 1V48A 2QSUA 3DUFA 1WB5A 4MV4A 4W82A 4HXYA 2ZYGA 1RLIA 4BVKA 1WR8A 3VOSA 1GTJ1 3HJFA 1KSGA 3W7AA 4Z9XA 3OIWA 5DW0A 1P5FA 4E33A 2I8LA 3UOAB 5K4HA 4QBIA 5C7IO 3VO2A 1CJMA 4BNGA 3E18A 3NCTA 2O2ZA 2M6KA 2IYYA 3VO8A 2J1LA 2QU7A 4DDUA 1SXGA 2RJNA 3JALA 3SJ7A 1ICEA 3AIIA 4E2ZA 1CE8A 3DYIA 3LFUA 4XQ0A 4AAYA 4GPBA 2V0NA 2WHYA 2Z95A 3M33A 3FM9A 3LY9A 4BVBA 5F5NA 5LQSA 2V54A 2CUTA 1CZOA 1I33A 3GMSA 3PIDA 1XHLA 3Q88A 5FOUA 2WU1A 3W6ZA 3ZGNA 5BRJA 2JI9A 4P93A 4TV9A 1JIKA 5HDBB 3I01M 2NX2A 1G5FA 1SAYA 3AF1A 4KQKA 4H0FA 4M1WA 2VPXA 3HBLA 4X20B 5IM5A 4GMGA 4MHOA 4UFPA 4A0FA 3VJMA 2Y1OA 2O59A 3FYDA 2CKDA 3ZS8A 3ESZA 4L75A 5IU6A 1UDBA 4O1HA 3OLWA 1QS0B 2V03A 2PLRA 1C3OA 2IYVA 3QE3A 4YYZA 1X1QA 3OU2A 3U81A 1OAAA 1U5CA 3K2EA 2E87A 2W00A 4Y2YA 5CT4A 2GGSA 4ZQFA 3QNUA 2EOAA 2NMVA 3O2SB 2RONA 2YXBA 4NAHA 2EBWA 3PHCA 2D5AA 5AHOA 1IWOA 3G85A 5C8YF 4YT8A 5KTPA 2XXAB 3GQVA 4EY5A 1UXIA 1QO0A 1X74A 3ED5A 4KN6A 2R0QC 3TVYA 4PLHA 4NBSA 3RFFA 1HE1C 1MO2A 2D0PB 4GR5A 1KS9A 4QREA 4S12A 1ZOLA 5CPBA 2GXSA 4G0VA 5I45A 1CUCA 4HG2A 2H8GA 4REMA 1VMIA 1P74A 1C1YA 2HRBA 3P9YA 4X65B 5A0VA 3KALA 4NARA 2NN3C 3KUCA 3MC1A 2CF6A 1LQ2A 1FJHA 3MD0A 2WOJA 2OILA 1NP6A 4RTLA 4K86A 3VPFA 4DNPA 5CP8A 2A9KA 3BWEA 1E2DA 3OZWA 2FLVA 2AOTB 3K9FC 4O6VA 4D6XA 1X7XA 1QYIA 5HQ3B 2A67A 2IHBA 3E5HA 2KJQA 3NIGB 2VWQA 1XCGB 2QD4A 1UH5A 4QC2A 4X6LA 3TLAA 4RMJA 4B2IA 3HCEA 1EVEA 5KPJA 1QGUA 3FY4A 1KQ3A 2R5FA 4F8EA 4UM8B 2SNIE 3KEGA 3U7RA 1AURA 3ORFA 4JA0A 4P0TA 5K3AA 1QHHB 2ZRHA 3OHPA 4WFJA 3F5QA 1ZLYA 1GPJA 4PRZA 4RM3A 3RVBA 3T3HA 3UK6A 4CQMA 4CKYA 1O57A 1M34A 1ZGCA 2PDAA 2WUFA 2XD4A 1T0UA 3AJAA 3HVKA 5EE9A 3RTBA 4RTSA 2FKNA 3DKKA 2F64A 4LRSB 3TVDA 2FY8A 4OYHA 1W5EA 1LI5A 3K15A 2XWBF 2C54A 4KPUB 3PX7A 5SY9A 3EVCA 5ICFA 1PTJA 1ETUA 1XNJA 4MWGA 2FZKA 1GSOA 1CNEA 4Y0NA 1MOPA 4BKUA 3IDQA 4DLAA 4G0YA 1U8EA 3RRFA 3OKCA 1M6HA 4P7BA 1ORHA 4TRNA 1SBNE 4CCWA 4J7AA 2SCUA 2BWJA 4HDQB 3GA5A 3W5CA 1XCMA 2P0AA 4O4HA 1F1JA 1L5YA 1B74A 4DBVO 4DLVA 5L3RA 3O4RA 4RHTA 1US8B 3ZW9A 3BF8A 4V39A 4ER0A 5F23A 4YH1A 4JU8A 2YZ2A 1MGOA 3RYCA 1HDIA 1ENYA 1R50A 4MHTA 2FWRA 4LJ6A 4QUHA 4DA7A 3UCXA 3IEUA 5JJKA 1V5EA 2HTEA 2PGJA 5CFOA 3KQUA 2PXXA 2QG4A 3ZHYA 3CR7A 1Y7LA 1TQHA 3DDOA 1XROA 2BBOA 4YRTA 1NRJB 1ZHHA 4F3NA 3W8EA 4NBLA 1DGQA 5F1PA 1KK3A 3RVMA 5AKLA 2WUVA 2I5PO 4FBLA 3WLAA 4B73A 5B1YA 5JDCC 5BPFA 5ICCA 1M1ZA 4BNYA 4CDRA 2B7CA 1JU9A 3ECCA 3L40A 2CBXA 2X8AA 2RJ3A 5BYJA 1ADFA 5I4CA 2GLTA 3T5GA 3V7YA 1VKRA 5F7ZA 2P9CA 4JI2B 3PHGA 4XX1A 3SS7X 3U2QA 2F9MA 3S7ZA 3DMPA 3DOHA 3OUTA 4IFEA 2QN9A 1SVKA 2H2WA 1E5LA 1SXIA 3G8YA 4MLZA 5E4YA 3IOMA 1YASA 1DBPA 4FFBA 4LOAA 2ZR7A 2YVKA 3F5MA 1V45E 3L0BA 2V7UA 1KYZA 3CF0A 3Q15C 5DASA 2RCNA 3NVMB 1TX4B 3VU0A 2WU8A 2QDKA 4NHOA 2EERA 1MO4A 1OYWA 3NBFA 1PNTA 4X8LA 1AS3A 1Q11A 3JQDA 4IH1A 1JHZA 2QRUA 2G70A 3MQ2A 2H2HA 1X8KA 2OV8A 1YRAA 4P7KA 3R7WA 1QO7A 1SZJG 2B0CA 2ZYSA 3IOYA 1AKEA 4ZO9A 4IR7A 5EEHA 1XA4A 1PV1A 3KNZA 4NENB 5DHAA 3Q9UA 1IXRC 3MGCA 3FYUA 3DAYA 1TD1A 3KQYA 1PWXA 5E1BA 4ETIA 4OLAA 1MQSA 3ZKWB 3L8MA 2C1XA 1OI2A 1VP9A 4B3XA 5EHZA 4BIMA 5BWNA 1FY2A 2GXUA 1KY2A 1Y80A 2GNAA 2XNDA 3AJRA 3KOWA 3WYFA 3N2KA 1PN3A 1VRWA 5TMBA 1XEXB 2UVDA 4CWAA 4EGCB 1FLDA 2Y1WA 1C7JA 4OH1A 4MA5A 2WKPA 3QBTA 1JSCA 4UHJA 5HQ3A 5B2EA 1R88A 2P9FA 1J07A 4CV3A 1IXSB 3F3KA 5FXMA 2VHWA 3LVBA 2CXXA 4XUEA 3I58A 4LZJA 1RW4A 4HXEB 3O91A 2IYPA 4MUHA 4TUYB 4HUQA 3EOAI 5DXFA 3RH0A 3WQSB 4EHHA 3E1KA 3IPCA 3ORSA 5DTJA 5ER9A 3ICOA 2GN8A 1TW3A 1LKZA 1T9ZA 4LDPA 4OJKA 4RVHA 3YASA 4BU1A 1X3LA 3G68A 3AX6A 4BKQA 3WAGA 3JAKB 5C3MA 3D6UA 4NU8X 4L5IA 3PUVA 4TYYA 1M73E 1SQFA 4HS4A 4QUIA 3A4VA 3ZI0A 1ZK0A 2G17A 1W9MA 4JHXA 4WIAA 4JT4A 3SQLA 5M5BA 2PKCA 2PBLA 3AMVA 3NBQA 4ZGBA 3LJKA 3PQEA 3C16C 4H7DA 4JVSB 4Y67A 5CX1A 1SNYA 3WGMA 4BO2A 5JXJA 2QR2A 3REQA 3Q3EA 3ROEA 3QYFA 1N9KA 1CB0A 1FFWA 2JATA 4D9CA 1ZVQA 3NHBA 1R9JA 4DYHA 2EFCB 2C84A 2NAPA 2OYSA 3ASVA 5F2KA 3WJAA 1QOQB 3FN4A 1OXMA 3WLFA 1K6IA 1YVEI 2CHQA 3NG1A 1J8DA 5FL7A 4DZRA 4DMFA 3AP3A 1A4IA 3LUJA 1Z7EA 3MERA 5TGZA 5MF6A 1GAJA 2CT8A 5A3JA 1FFYA 3MGBA 2H92A 4LV5B 4B33A 3M4YA 1NKVA 4RC9A 4QAJA 3SZOA 1P1CA 5EJ7A 1OA1A 3R3WA 2P91A 1JLRA 1AS0A 1SIOA 2IXBA 2ZTVA 2GNOA 1RYDA 3AR6A 3KB8A 3OCWA 4IQFA 3ROXA 3HUDA 4ZJPA 3LUFA 4JT8A 5EIEA 2O8DA 1TJ3A 2IYEA 1RBQA 6GPBA 5I3ZA 1YOVB 3AVTA 1T4CA 4U2EA 5F3RA 4DCSA 4Q12A 1RWXA 1LS1A 3FFXA 3KFVA 2R6GA 4URUR 1N5RA 1YTLA 2GFAA 1ECCA 3TPZA 2X9VA 2ZUTA 4PANA 3WOVA 1ZQ1A 5HP4A 2VJOA 4Q5IA 3VR4A 1BMFD 1P91A 1UMDB 4J3NA 3D4LA 1MJ5A 1G0NA 3BCRA 1KOGA 5BR7A 4RA9A 3W5DA 3VSEA 2XWQA 4ROSA 2AQ8A 3NATA 3W5JA 2WTXA 3CURA 1U5AA 2Z4TA 3R5XA 4IHQA 3TAHA 1KSJA 2XUDA 4QGHA 5IEBA 1IK6A 1MW8X 4MKFA 4PCUA 1LK0A 3R6TA 3HUFA 3CVWA 1KBZA 1Z5PA 3AB3A 3RYHB 2G36A 4COOA 1A27A 1JJ7A 2P9EA 5JNVA 3IKMB 5JJIA 2C78A 4YXWA 3GUHA 3U5ZB 1A9XA 2QKYA 1PD1A 4KAXA 4KQMA 4UUPA 3IQXA 1VBNA 3DP9A 1E3WB 4NWIA 3BJIC 3TFQA 5I48A 1PKXA 3TTTA 1E2UA 1GILA 4XX0A 1CFZA 2OV3A 3EVZA 3LDUA 4YQFA 4I36A 1O54A 1SA0A 1TUEA 4WJZA 3L1UA 3C3JA 2W6IA 4PZCA 2HXSA 3W5IA 1KDPA 4GOJA 2I3ZA 4OEHA 4C4TA 3RQIA 3JYHA 4TGLA 3OQBA 4LOJA 1G2OA 4PR0A 4RD0A 2FUG6 2QL7A 4JIMA 2K2QB 3TZCA 1UBFA 3IT2A 3S1AB 3ZE1B 1YGPA 1E4EB 4HZIA 3VO9A 4S2EA 5A2QA 1YZVA 2GHQA 3ZVLA 1DDOA 1RLTA 3QOWA 2NXCA 3HA5A 5EVCA 3EMKA 4EO4A 4EVIA 4RZSA 4FIZA 4IZOA 4LWPA 1KS2A 3CE6A 1BRTA 3CWQA 3GRAA 2ZT5A 1U0SY 2IPLA 3HKDB 4Y2TA 1LPMA 3BIFA 3S81A 5EXXA 3HTXA 2ANCA 3K72B 3CMMA 4ZRMA 2WIJA 5DCWA 3WGVA 1A4RA 1RHRA 1QTQA 5AKKA 3UMSA 4V0NA 4UATA 2UZ4A 1FS4A 5EQJB 2RMKA 3P0RA 3CRZA 1BMFA 4MDHA 1JT9A 4C05A 5HMLA 1GP2A 2OCLA 4H3VA 2W70A 4GL2A 3OPVA 3WB2A 3C4QA 3VC1A 1D2GA 1HFJA 3WLPA 1U8CB 4HK4A 3ZJ5A 3RO7A 4KRYA 4YASA 3RRNA 1KI6B 1M1NB 1RKVA 4AIIA 4EL5A 2YZKA 3FCEA 2C5AA 1QJ4A 1U6JA 1Y3IA 2A3RA 3KDAA 1JPUA 2RI0A 2ZI7A 3LPAA 3QMWA 1JDTA 5CM2Z 1JVBA 5HILA 3V6MA 2JFVA 4TTIA 4PZAA 3KU4A 4TMYA 1LDBA 3ZE9A 3O3MB 4IS3A 5PNTA 1A8SA 2HIGA 2WIKA 3I8XA 2QYHA 2QS9A 2VHTA 4FR2A 2EIHA 2XUJA 3H2ZA 5AHXA 3RRYA 4KDRA 4LEIA 1RXYA 1CFJA 3SXUA 3KEOA 2XGGA 3UJ9A 4B4OA 3WYGA 5B2ZA 2D6FA 3EHEA 3AKCA 4FE3A 4NYJQ 5ITZB 1H2AS 4B4DA 4A1FA 2VH2A 1ZS9A 4WCDA 4C5AA 5J43A 5LVAA 3M6XA 1V0JA 4MZXA 2D8AA 2BFEA 2H7XA 2PA3A 3C45A 2ARKA 3D9QX 4KPYA 1SCNE 2VDOB 1U7TA 3ZV5A 1AC5A 2Q18X 3PR1A 4FMCB 3NEPX 4JDPA 4ARBA 2Z2YA 3CKYA 1JEOA 2B6NA 2CZCA 2WBLC 2Z08A 3L4EA 2YRWA 4GC9A 2I91A 4TKZA 3K8YA 1X7DA 4KGDA 5CX1B 3EQ2A 3QELA 3UUWA 4ZVUA 1C7IA 2PL5A 4RFSA 1CEYA 1OI4A 3QEMB 4EW1A 1JILA 5KQGA 1EUYA 4WXPA 3EGVA 1X7YB 3EXIA 3AR4A 5CFMA 3SGLA 2QT9A 3SLGA 4FNMA 4NU5A 4L7VA 2G76A 5ALQA 5EZYF 1JHRA 2QZJA 2XVMA 4GSKA 1DC4A 3B6ZA 4AF8A 4ZK2A 4G8CA 5B1DA 1HQYE 3OM9A 4HSEA 2NT3A 2JGLA 1MV8A 1VZ2A 2KLBA 3WHPA 4JCOA 4BOYA 3OOJA 5TDHA 1MJGA 1R3UA 1XQWA 4JVMA 4OSPA 2ZPAA 3UJ3X 1KKUA 4HJRA 1PCXA 2VA9A 3B85A 1N0VC 2IRWA 2IBMA 1GPWB 3MD9A 3MJ4A 4LVNA 3AB8A 3WBJA 5IVDA 4CXMA 1P2BA 2B21A 1QXSA 4ZT2A 1DINA 2AW5A 2PEZA 3TIGA 2BM1A 3GLIE 2LZ0A 2XB2A 1XEXA 2YWFA 5G0VA 1S6YA 5U1PA 1SB9A 1G8JA 1VKNA 1QK4A 3AF3A 3PNOA 4QBGB 5LIPA 1EZ1A 2J7PA 2PX6A 3PI6A 2VF4X 1FTQA 2HU8A 4GH5A 5B37A 4B6EA 4U5XA 4Q19A 4PO8A 2ZR0A 3IEMA 2EARA 1KL7A 1JR2A 5M04A 3NBYC 3R4CA 1YZLA 3ACBA 4Y2SA 3AHFA 3ZHUA 5L7TA 3ZOKA 4W5QA 2VDKB 3CB4A 3DXXA 3ZU6A 3EEOA 2ZUBA 3QE9Y 3I1FA 1DKLA 3M6VA 1EFDN 1PJ4A 4XLZA 4RWEA 2C4UA 4GD3Q 4D9GA 3VGPA 2YIMA 1TTTA 2J3DA 4HDMA 3T94A 1FFBA 2V8OA 4I1YA 5B7QA 5HIMA 4JEMA 5E0KB 1JDZA 4HN2A 3WKDA 2TRSB 2GVZC 3KV3O 5KMGA 3GLIA 4YUVA 2FN9A 2R8EA 1CWUA 1WIWA 4X00A 4YBZA 5EIHA 3ZDRA 1RAGA 4F5WA 2ZZNA 1LRLA 3BD6A 1PLJA 5F33A 3OUZA 2PZMA 1EYZA 4QX6A 3WIVA 2DE0X 1Z74A 3IO5A 3HG7A 3OCZA 2GX6A 4UNSA 4EZBA 2FOIA 4MH0R 3GJZA 3COVA 4O2AF 4U0JA 3EZLA 3QVWA 5KHOC 1Q0QA 2VUUA 3OO1A 4ZYUA 4OG2A 2PJRA 3LSTA 4TXNA 1QPGA 1JLKA 3ZV4A 3CX8A 1YR3A 1DAGA 1JJIA 3BGWA 3GOHA 1WU8A 2DVMA 2NO0A 4EJMA 5JE8A 1M8JA 1XN4A 1TLLA 4NONA 2QVBA 2JIMA 4MR7A 2X0DA 4UNQA 5L3ZA 4BNNA 3C48A 4Q9HA 3OIUA 2H16A 2ZJAA 4L5CA 2L2QA 3A36A 1TJYA 1UXKA 3HI6A 4K6MA 4CIYA 1KETA 2H7YA 1FP4A 5B4TA 1D2AA 5LR6A 1FU8A 4LDJA 1VLZA 2ZWAA 4JQCA 4CM6A 3Q7RA 2ZBUA 3HMKA 3ILVA 4P6VF 5AM3A 2XQJA 2WJGA 3EF0A 2FMUA 3I9V6 4PYQA 5C3UA 4RTKA 1NR7A 5GADl 4JJAA 3LD9A 3N8NA 7GPBA 2WVJA 4ZANA 4UD2A 2VR1A 1A0OA 5IKXA 2C92A 1EJ2A 4CG1A 4FLEA 2OUKA 1O03A 2JKZA 3FVVA 2VBFA 2PUDA 2P2YA 3IRVA 5TIIA 1ATZA 1E6EA 3AUSA 5CEFA 2IQIA 5JAMA 2P75A 4GAEA 4U0KA 1ZD4A 2IHUA 2WUEA 5F51A 4CG3A 3OTGA 3U61B 4LSZA 3EB9A 4TMTA 4ZQGA 4AP9A 3CJTA 3WQQA 1M1XB 2WIFA 2Q28A 3CLSD 2YFYA 2GEJA 3D6NB 4I1VA 4UDNA 2Q3HA 5EP4A 2AYXA 2RIPA 3LA6A 3PDUA 2F4NA 4A7PA 4Q3AA 4GPD1 2JFOA 3NV9A 3IIMA 3SJAA 4CUZA 3G9ZA 1E2EA 2IXTA 3PDWA 2FAXA 2D2IA 1GPBA 3UMCA 2CDNA 2Z58A 3LQFA 1F7UA 3TOCA 3JZMA 2EX4A 4R9NA 5E9WA 8OHMA 4G23A 9MHTA 1NY6A 1VBKA 3SQNA 1DCTA 5A3QA 1ORIA 3D8HA 4GYYA 1JU4A 2C4MA 2CNKA 2ZP1A 3THOA 1AQJA 5JJLA 2ZUFA 1OFTA 2O5VA 3MEQA 1T10A 3IAUA 4UEJA 2ROQA 4LYAA 1LI7A 1BTOA 3UOGA 3EIFA 3N5CA 3LK6A 2NZUG 2ZJ4A 3PD7A 4I3GA 5D86A 4MCHA 5FOVA 3TYXA 1N1DA 4JXXA 5SZJA 5EYPA 3DWFA 2Z0MA 3LQ4A 3WLNA 1ENOA 1AV7A 3QG5A 4DJTA 4PTZA 3QE4A 1KEPA 2QTNA 2GCOA 3M5CA 4HZUA 3SLRA 4BFUA 1AXGA 4CKCB 3HJHA 3A1SA 1H2RS 3AYXB 4LYDA 2GJKA 4ZOLF 1W88B 3IEKA 2XCIA 1C7RA 4N8DA 3U3DA 1JNYA 2AFVA 2PG3A 3KLNA 1D6MA 1NUTA 4DXAA 2P69A 1XZNA 1NBHA 3DLCA 3Q3CA 4IGFA 3RC7A 5DLPA 2VHUA 3F2VA 4NVRA 2CW5A 1Z18A 2DR0A 4R2HA 5B53A 3HB0A 4JUDX 2B4YA 3ED1A 1RWKA 4E11A 5DGCA 4JB0A 3S40A 4YCAA 2HXGA 2P9HA 2XYRA 4CV2A 1CQXA 3RODA 4XRRA 5CJPA 3VJKA 1Z75A 2ZRBA 4QYSA 1N2HA 4GRAA 2JIRA 3AM4A 3RIHA 5ALOA 5JSHA 1TZCA 2AZTA 3L8EA 4OHMA 4KOEC 4QATA 2X0RA 4ZYLA 3UWOA 3N70A 3T35A 2DULA 2SECE 3IESA 3IULA 2GSWA 2YN0A 1V6SA 4DS3A 2VP4A 4RK1A 5E8RA 2QPAA 4QGSA 2EIXA 5F9FA 1QVZA 2Q62A 4K6KA 4OLHA 2FOLA 4KR3A 2L17A 4I9UA 5DYTA 4M87A 4H35A 2FPPA 1Q1GA 3IIEA 3PLRA 4IDEA 3JQPA 1JEEA 2YJ3A 4ZOAA 5K3CA 3K70D 2PHZA 1IL0A 4X54A 5HW0A 2YYZA 4GYKA 1QHXA 2JVJA 2W0SA 3H99A 4QFCA 4XEHA 5KI6A 4O3FA 2PY6A 2ZK7A 4KFUA 3STUA 1ZL2A 5LLSA 2QG6A 3WAKA 1NX9A 2FQ1A 3G7NA 4KVGA 1OFIA 3BDIA 2WWRA 5MGBA 3IDFA 2BEWB 2OG1A 2VJBA 1GZ6A 3E5MA 2IZ6A 4JMPA 1M7BA 2WKWA 5FB3A 1GZDA 1R0LA 2XQKA 2ZSKA 4JEUA 4R8RA 3CEJA 4KR2A 2IS4A 2BR3A 1ZXBA 4CNQA 1Z2OX 3NNNA 4K6CA 2GN4A 3NDIA 3G13A 2PX5A 1J9EA 3E6AA 3L7CA 4X84A 3GJ3A 3SBEA 5HTOA 4RF2A 4XB2A 3V80A 1LUAA 2Q99A 4NE9A 5YASA 3MM4A 4KFSA 2V55B 1YZKA 1YFZA 2QRZA 4HJXA 2ATXA 1R8JA 4YP6A 4A26A 5IJ0A 1OC2A 2PO7A 4O0LA 2AFHB 3ML1A 3AEUB 4H6VA 5CVDA 2HDNB 1X7GA 5JYCA 5A3RA 5HVNA 1D7AA 1WJGA 4EHIA 4POAA 3AR8A 1SCUA 3I2KA 1Z2AA 2VUSA 1K86A 2CMGA 2VNJA 2ZT6A 3BXFA 4P4SA 4TLMB 1AOXA 1KZ4A 2VT7A 5G4KA 4LFCB 4KVFA 1SM4A 2WV7A 2VNKA 4DSNA 1JQBA 4JI1B 2O2JA 5CFRA 2PRYA 2IU4A 1KOJA 3DXZA 4MB6A 4TWZA 2IYRA 2JGMA 2YV3A 5A7HA 3UHFA 5IAJA 1KMMA 4KXNA 3TJMA 4NBUA 1JG6A 1F2VA 2BAGA 5ALGA 3OQ1A 4G26A 4D9JA 1KORA 4MVJI 5HKAA 3R0VA 1YJXA 4FGKA 1KRXA 1TUBA 3AEQB 1SU7A 1P1IA 2JBAA 2PWPA 4JA2A 2J6IA 5EZ6B 5T3UA 2EKPA 4L51A 4X62B 2ZI9A 4F11A 4MVYA 4TL7A 1THZA 2PD3A 2VPWA 1X8XA 4QTXA 3V7NA 3K71B 2WDZA 1C29B 1S1CA 2B8NA 1DSSG 2DWOA 4UVDA 1T5OA 1RXSA 2QVLA 4ALLA 5EESA 2VWHA 1DRVA 1W8IA 3CZQA 3CUWA 3FNGA 4HX5A 4R6WA 1OQAA 3O8BA 2Y2VA 5DULA 4UQPA 4HYQA 1Q22A 4A27A 1G6HA 3DFFA 3ZPXA 4BGIA 4QPNA 3MJDA 5FA6A 4A8JA 4WKPA 4YJHB 4EW6A 2IDKA 4J29A 3KKLA 5DHRA 3VKGA 2IVZA 2PUVA 2H65A 2E4YA 2V5AA 4GS5A 5I8PA 1I3OA 2DUJA 3FUCA 3NX4A 3VYVA 4NAUA 3WVNA 1VRCA 3T7SA 1JXAA 1N2BA 2WMNB 5GZ1A 1RXEA 2F8SA 4HQNA 3D7NA 1VP3A 3UNXA 1SXJC 1M0SA 1M8GA 3O8NA 3TGLA 1E3JA 4FTWA 4J6EA 3T34A 2VQFB 2IL1A 1PEDA 4BNKA 3HRHA 3VPBA 4MROA 3VNRA 1P31A 4WKGA 1RP1A 3MS2A 2WHPA 5K2OA 4BTVA 3NTVA 1WABA 1Y1LA 3T1YB 4RV9A 1ADCA 1MH9A 1KJIA 3OE1A 3RI3A 1J22A 1I32A 4RULA 1LDGA 2C57A 4C3OB 4MX8A 3ZCPA 3E9CA 4CM5A 2Q6LA 1N6IA 3TTSA 2WC1A 4F9TA 3NVDA 4HNTA 4ZAGA 4UQLA 3KAPA 1ZICA 1GAWA 1L8QA 5BSMA 4EHJA 3Q8KA 6REQA 2BL4A 4C30A 3EW7A 4FGSA 5SYAA 1CXZA 2IOFK 4DDHA 2BKEA 2GM9A 3CEMA 4RM2A 4W8GA 1DV2A 1Z45A 5D85A 3ENQA 4ND7A 4O3MA 3U37A 1KIAA 4MB0A 1YJAA 2AHOA 1DEKA 2VJLA 4CTMA 3IMGA 5IAEA 3GLVA 3T0FA 3UHJA 1VPWA 4NH4A 4OHCA 5KTMA 1WV0A 4N40A 1M1YB 2ZJ2A 2WR8A 3DM9B 2O4UX 5F5LA 4C4OA 3UAOA 1JGTA 2INGX 2A59A 4H7KA 1Y1RA 4MI3A 2WZCA 2W7TA 3WRXC 5IJ9A 4FYKA 3T3EA 1M2OB 2GN1A 1ZKDA 4R8VA 1X6VA 5DLDA 3WGOA 3TTWA 1VIVA 3C3KA 5JHHB 4MPPA 3GJ0A 3GXOA 1RSZA 5U4XA 1FQWA 2JJMA 3ES9A 3EIHA 4MR9B 3ECAA 4A92A 3R3UA 3VR1A 3HWX1 2OO5C 3OY7A 2NSDA 3LZDA 4B3SB 4RD1A 1UOQA 3O0DA 3LRTA 5JADA 1CE8B 1KARA 4TXJA 3GRZA 4MWSA 4AS1A 2VHEA 1QQ6A 1VL1A 3FJOA 5TQ2A 1EK0A 3TE6A 5I7OA 2FSVA 4LY3A 4BVFA 3ZDDA 2H9IA 1GLGA 2OXIA 3OZBA 4RVNA 4KODA 4INJA 2D7DA 2MT9A 2F3RA 1KMIY 2FNAA 2AX3A 2OO7A 2WM8A 3KKKA 2EP8A 3L1IA 2F62A 4Q4AB 2VK4A 1OYYA 5D3KA 1F4LA 2NSJA 2Q6VA 5TJHA 3G59A 3V2IA 2Q5QA 5H7XA 1G55A 2NTYC 2OCBA 4ZVLA 1DRKA 4G1BA 2LKCA 3I5YA 3EIXA 5FPSA 1XXHE 3VRHA 4O4HB 2ZSJA 3F7NA 2W90A 5DHTA 3PXXA 1VSVA 4PZDA 1BE0A 2D5BA 3OC6A 2H8KA 3Q6NA 1A9PA 2X42A 3DMNA 4KQIA 3FCYA 5FORA 4ASUA 2HO4A 2DH5A 4IOKA 2RHRA 3CW2A 3DL0A 2IYOA 1TZJA 3KFXA 2JA2A 5KYXA 3SR0A 2GBGA 1I9GA 4LHWA 1F5SA 3O93A 1DQYA 2AFIA 4K7JA 3RASA 5ESXA 3VNBA 1VPDA 3EQZA 5JC8A 1KY5A 3DDNA 3JPWA 4XXHA 5CURA 2D62A 3PC4A 3HFSA 3KBOA 4C6SA 2C5LA 4KR6A 2XIQA 1AZSC 3LG2A 3BERA 4JOCA 1V37A 2FWAA 5H02A 2B8JA 4UDYX 1CD5A 4Q4AA 2YRXA 4R2LA 5CB4B 2I76A 4PFKA 2BFPA 4G0QA 1PJRA 1SUDA 3BVPA 4P3YA 1N5LA 3B9PA 4O2AB 2IUUA 3G9QA 2OHVA 2PSSA 1VHWA 5L53A 1GCGA 1FRZA 1H05A 1OTXA 2HRQA 2ZIEA 1FYEA 4YJ2B 3BBLA 2EBUA 3RD5A 4BNZA 4DDKA 3OPNA 1EFAA 1QH0A 4O8ZA 3WJ1A 4EOGA 1UJ4A 4BMYA 2JDID 4EPYA 2ZBFA 1APBA 1CY1A 1U2DC 2CLIB 2P3QA 3DTVD 1XDUA 3MYRA 3DS8A 1II8B 1JG4A 3PGA1 4KIJA 5DV9A 3SZGA 4YPOA 2WZDA 3CS3A 3T1QA 3HO6A 3AG6A 3BK1A 4MUXA 1B8OA 1JS1X 3PDHA 2ZUVA 5K4AA 5CA0B 2FFHA 2WMDA 3BL5A 1UJBA 3D6FA 1NJ6A 2RGEA 4YN3A 1XCLA 5JAQA 4EECA 1K4KA 2XVYA 3E9EA 1IUOA 2VDMB 3VR3D 4DLBA 3PC6A 5IVKA 4C6RA 3FOCA 3U5TA 1COZA 4BJ1A 3NBZC 3Q41A 3JYQA 4N12A 4S0XA 2PQ0A 2EFGA 2W4MA 3MWDA 2A1UA 2JDIA 2XYPA 2HF9A 4C0JA 4HNVA 2QT1A 5EJ6A 1GDHA 2R25B 3PUXA 5FL3A 3GFGA 4MKIA 4ESHA 5JCOC 1ZN7A 1QKKA 2ESRA 4J3FA 3GLIB 4UDOA 2VKQA 3PNKA 5KNBA 1G1AA 1XD9A 3C5VA 1HNXB 1RHMA 4CM3A 4RMHA 3DP7A 2Z56A 3FDIA 2OXEA 1Z6QA 2BUBA 2HSZA 1NQVA 1GTG1 1XCOA 2G40A 4OJNA 3VVLA 4I81A 5FADA 3HUTA 1DHRA 4JX8A 2CK3D 4OIMA 4MW9A 1YULA 2YY7A 2X76A 1ZL0A 2F43A 3W3AD 1I8TA 5B55A 3HBJA 4G0OA 3JWPA 5A02A 2EGGA 1NNLA 2LE0A 3O83A 3O2QB 4FQ5A 2CB0A 2PL1A 4R54A 4EG6A 1K7EB 1P0MA 3P71T 3HHEA 1I01A 4IVNA 5HE9A 2R6JA 2GF9A 3EZYA 4UZFA 5FWAA 5FO1A 1GCOA 3S2ZA 3V2GA 4DIKA 3ZNNA 3K0CA 2W9XA 4TUYF 1E98A 3LYLA 1RXUA 3NHAA 1KQNA 3UH0A 5CNJA 1YHYA 1H23A 3QWIA 4U5QA 2DFNA 3HVUA 3CNEA 4Y2VA 4LXUA 5JXGA 3FUTA 5EWLB 1CUFA 3VZPA 3M1IA 5F1YA 1N78A 5KVCA 1FYXA 4GPZA 4KVZA 3IQWA 4CL8A 5FJIA 1GZHB 1GZUA 1QRDA 1FDRA 1R8YA 1VCIA 3PJRA 4ND5A 4NF2A 3M3DA 3THSA 3PITA 3GROA 4GX2A 1ZMOA 4JYCA 1IK4A 3ZZNA 1AQ6A 5B7GA 1BHO1 4XJVA 2NQTA 3T06B 5C46F 4DCMA 2ZREA 3KXDA 4CQMD 1T6NA 5CXUA 3GCDA 3ZDAA 3D0RA 1NVBA 3OURA 2OOSA 3PIIA 4NOMA 4UMDA 1HF3A 4GBED 3LX5A 2JCYA 4J9UE 4EH1A 3T7KA 3BPSA 3LKZA 3UV7A 5JHGB 4C87A 4Q1VA 4MQ5A 4EGFA 1TT5A 2Q5HA 4MQ4A 1KAOA 2WYVA 2ZS8A 4IX9A 4I4CA 1TEHA 3TNFA 2OHGA 2H4YA 3TNLA 2PZAA 3ZJTA 2ZPTX 4YMHA 1M2NA 4KN9S 2C61A 1R64A 4OFXA 4YFVA 5JS7A 4RA6B 1YB7A 1IBKB 4Z3DA 1VSBA 2PSHA 4IGAA 1ZY2A 1KEVA 4P08A 3LGXA 3T5DA 2LP4Y 2XAAA 5EKXA 2P3LA 1E7QA 1P81A 1NXOA 4YDSA 1MFZA 3TNJA 3D1LA 3WQHA 4RMIA 1U1DA 2P5YA 2GF0A 1LW7A 2M6SA 2QJTA 4L8GA 2OORA 1QRAA 3OPQA 4YFYA 5E6UB 1O0CA 1U3WA 1H2BA 3KZKA 1ZN9A 4K9PA 5IKEA 1UC9A 4HGRA 4DL9A 5K20A 4ZAZA 1ECLA 2JKVA 2PSFA 3GDOA 4NR0A 4Z51A 4Q4CA 2EEZA 3C3XA 2GNPA 3P9IA 3GAMA 4I1PA 1A69A 5FPTA 1RZUA 4L9AA 3P9NA 4XFDA 2C8JA 1C50A 3QLVC 1SVWA 2J6HA 5HTKA 1WG8A 3BWBA 3B51X 3H0EA 3LUBA 3Q7SA 1ODSA 3DMDA 4FMPA 5EUQB 3ZWDA 1Z7YA 4DT1B 4MP6A 3HFGA 4MUJA 4PQRA 3FWYA 3K8OE 2H48A 2P2GA 4US2R 1N77A 2W6JA 3H2HA 4RUKA 4DB2A 3TAUA 1UEIA 3F3SA 5ALRA 3M4JA 3QE2A 4NV3A 5LZ2A 4RGVA 2HU7A 4P80A 5KOHB 1FPQA 1DO0A 1DPFA 4E5MA 1KAGA 3HJUA 3N75A 4MUKA 1Y3AA 4WNIA 1O6BA 1O2DA 3GLFE 5EXEA 2UZ0A 1YU9A 4BMDA 5KU1A 4MVJD 1G63A 3E70C 2BFDA 3BTUA 2CFRA 1ZVVA 1LX6A 3MLEA 4F4DA 4XM0A 4OH7A 3VKHA 4J9VA 5AKGA 2AJLI 3ZV7A 3I52A 1EVYA 1J99A 1G7CA 1F12A 1IB6A 4IFTA 3R8XA 1GHTA 1SU6A 3EK2A 3ITEA 2G6BA 1NUHA 4GYJA 1D4FA 1UC5B 4I8IA 2R79A 2VZ0A 4KTVE 1QIKA 2HT6A 2VJQA 3OZXA 4PPQA 3U1TA 1R2QA 2ZIUB 3I8OA 4Q18A 4NNJA 4W6ZA 1XJCA 3ONEA 5LDDC 3KJQA 4LX0A 4D4IA 1GQFA 2FWPA 4K6OA 3KLMX 4JMLA 3EOZA 4UNPA 4AQ7A 4C3UA 3IAHA 4D4GA 3ZY5A 2B78A 1VE9A 4WTOA 3SBDA 2MM2A 2X7HA 5J1SB 4UXHA 5CB8A 1RZRA 3DZCA 2OAEA 4QVGA 1U0FA 1KFKB 1AVTA 4TWRA 3RSFA 1Q17A 4CTNA 3QE0A 3DVAA 1ZXXA 3B3FA 4WH0A 1OGIA 1O97D 1U9IA 3TLYA 1OI7A 3ND7A 2GM3A 1XJWA 8LDHA 5LZ4A 1EHIA 2G08A 3HZRA 4RTNA 3KO8A 3A3NA 3Q9NA 4GP6A 3EJ6A 4ARSA 4TMFA 3ETLA 4OGGA 3DFUA 4Z54A 4MV5A 1BX3A 3F67A 4EAQA 5BXYA 4HH1A 1XVAA 1CUDA 3AKZA 3C3MA 4GKJB 1WLSA 3EF3A 2HA2A 3HBAA 1II0A 5BN5A 3L7AA 1MQAA 1U3TA 2GYYA 1BX0A 1UXOA 1WMSA 2C9DA 3OTWA 3ZQ4A 2PH1A 2BT4A 2LKDA 3GDHA 3G0DA 3N6XA 5AVWA 1R0ZA 3DE6X 3A9SA 3I0MA 3KJZA 4MGKR 2JIBA 3CA8A 2BBTA 2UVPB 1QMPA 4LQDA 5CK4A 3B82A 1RI5A 3DL2A 3QU2A 2A94A 2FLKA 2XE7A 3ASYA 3MLAA 2PBZA 3RROA 3WL8A 4AO8A 1BSVA 3FMVA 3FOAA 3NO4A 3Q6IA 4DJDC 3ZBUA 2FW8A 1CY2A 1IPFA 2C4KA 2R3SA 4S24A 4GHWA 1J25A 1F9EA 2G1JA 2HADA 2C95A 3K05A 3QIVA 1FFEA 2NUTA 3NJRA 5KAMA 1KJ9A 5GIPE 4FX5A 1ODLA 1KI9A 2FSIA 4LV8B 2JI7A 2DUWA 1J8MF 1SKYE 3DOOA 3K9QO 2Z6UA 2QMZA 1G21A 1CP2A 2REQB 4D41A 4F72A 1E1CB 3D1VA 2I34A 4EUSA 4C7KA 3QOYA 1CUGA 2NZWA 1FYDA 4OO3A 2XE6A 2EZTA 2IEDA 5DYYA 4FMCF 3D3WA 2F3TA 3L4KA 2VSXA 1CZHA 2QHXA 3EZ6A 3KUKA 1JHAA 4W9RA 4X91A 3QF7A 1EP1B 3BK2A 1EESA 1J9GA 2UVPA 2ATCA 5AH0A 1BFKA 4ZI3A 4Q7LA 4IOJA 5KNLA 1P1FA 1DOHA 2Z2XA 4K88A 4MS3A 1EM8B 2BP7B 3H9QA 4JBLA 1VPVA 2JFFA 2TSYB 4YTEA 3KWJA 3SYLA 1YGYA 4KUGA 4EP1A 3B3GA 4CM8A 1B1AA 5JSZB 1TT5B 5E9JA 5AXDA 2YNMC 3KU1A 4XCQA 5DO9A 4Z7JA 1GNVA 4Q4JA 3E0XA 4MV1A 5G3YA 3UKOA 1BDHA 3WWOA 3PQDA 1OH5A 1WUTA 2Z98A 3SLKA 1DVRA 3NYIA 3IEXA 3VHXB 1ORRA 3BH0A 1J0AA 3P2IA 1U7ZA 1G5RA 4IJ5A 3L8HA 5ESRA 4E5DA 2FSGA 4HDSA 2DR3A 2G9NA 3ZY4A 1ZD9A 3AESA 3U48A 1PYDA 3H19A 1QIGA 2JFHA 4NZNA 3DB2A 1GG8A 2ZDHA 3TSOA 2M32A 3A0UA 3E1GA 1AGXA 1NDUA 3DOUA 4PAOA 3FCSB 5CVUA 4PYMA 5I9SA 4D8TA 1WMEA 4ZXFA 3CBGA 4ZPJA 4OQ4A 1K6MA 2F9LA 2XUIA 3IQEA 4G2TA 4Q15A 1V4VA 1X9GA 5FOWA 5G4KB 4KUEA 4WY8A 1SO8A 2ZSDA 3AVXA 1HDOA 2HA7A 3RNOA 3I64A 3D0KA 5JQGF 3UPDA 3FZGA 3WC4A 4IDOA 1SZPA 4EKEA 3OKPA 3SM3A 5CA1F 4I9FA 4I2VA 4UBNA 1UAGA 1XU7A 2C42A 3ICWA 4NH0A 2HD4A 4KP7A 4XARA 4PYLA 4DZZA 4QPPA 4TWIA 3BA1A 2JCGA 3QOFA 4HQ6A 4YRCA 4BO0A 1M2JA 3QBDA 2SKDA 3FA2A 4X8OA 2GO7A 3R7WB 3AJ8A 1MEOA 3H1EA 1UK9A 1SWWA 2WJJA 5CDSA 4MSUA 4B4WA 2IHZA 1G3RA 1VMEA 3RRJA 4GXQA 1OLUB 1OZGA 3IIIA 3OFKA 4E4RA 5CG2A 5JSQA 2KE5A 1VYUA 5LXTF 4JU9A 1BXRB 1UMBA 3TE7A 3FF1A 4ZCIA 3IAFA 5CDTA 5EWMB 4G4IA 9GPBA 1MJFA 1A4XA 3LU1A 3AFHA 5MFPA 1G41A 1W7AA 2JI6A 1I2CA 2D2VA 2GZHA 1SR8A 1Z0ZA 2P3OA 4ZO8A 4ZRDA 4F9GA 1YRHA 3VJRA 1YKFA 1ZJ4A 4II3A 3HZZA 2CFCA 1IXKA 3CKMA 2VNSA 3DZIA 2CLLB 5KQSA 2PGIA 5DIFA 3QP9A 2KSQA 3ROMA 1HO3A 2AOTA 4AG6A 4EY3A 2RC6A 3WGLA 3TMKA 4TZTA 1MA0A 2R8ZA 3Q3HA 2HNBA 2G04A 3GMIA 4JP3A 4PSAA 1G4HA 5E6UA 2OGUA 3C6BA 5LP6C 5I01A 1GR0A 2XTZA 3H5IA 4I1IA 1JG3A 2HZBA 3IILA 5HFJA 4I50F 3CCBA 5E3IA 1XP5A 2P5TB 2GZ2A 2MM0A 2A2ZA 5KTNA 2MR6A 2A84A 5LYJA 1MABA 2BGJA 3CW8X 4I14A 1XALA 3B7GA 1J90A 3I73A 4FMDB 1Z26A 1IPHA 4F93B 3F7OA 3GRVA 1TAUA 3KKQA 1FLVA 4E07A 1KP9A 1EFKA 2WJ3A 4WY2A 1FDVA 2R48A 3QLUA 1ZIXA 2X8JB 5DE3A 3GPBA 2BGMA 3HY4A 2JAHA 3NHZA 2ZRLA 3E58A 5HBGA 2V97A 1ULHA 1A9YA 2Y77A 3C43A 4H1VA 4PLGA 2V7WA 5B1HA 5JCJA 1C3LA 1OJLA 3RFTA 3DEAA 4M22A 4G07A 1GTSA 2XT6A 2QBYA 3QKSB 2XUPA 1V7ZA 5CYGA 1TPZA 2G1AA 3UKDA 5A9SB 5I7RA 5IBQA 3DOFA 5HBRA 3T61A 4AKTA 2P4QA 1II8A 3DTVB 3O4VA 2QPTA 4WFQA 2HK6A 1EINA 1HOTA 2EAUA 4EF6A 3SICE 4RYDA 3K7EA 4B9EA 2QA5A 5IH7A 1U31A 3FH0A 4BZQA 4DLLA 4RWZA 3MT8A 4XB6B 4UBOA 5EJFA 5KNCA 2GZRA 2JH8A 2Q1CX 1QIIA 2AVNA 3CUTA 1WDLA 1KE1A 3TGPA 3M2TA 1N7GA 4CUKA 2BTQA 3D3JA 2DYKA 4KPFC 4RTOA 1ZCBA 1YDMA 2OORC 2RH5A 1GGKA 2X41A 3ESAA 4AY6A 3L0SA 2QXTA 3DTNA 1MB4A 1TCAA 1WE2A 3BWDD 3B6MA 3IP9A 2ZANA 3I39X 5C1OA 3SDSA 4IBOA 1EFHA 1XTJA 1E3EA 2QVCA 1DIBA 1UKYA 2C5EA 2EKQA 1H69A 1VL6A 2O2DA 3P2MA 4Y7CA 2HA0A 2DKFA 1ZMBA 1FXWF 1GGNA 1U80A 2QDXA 2QLNA 1IYZA 2XNCA 2OAP1 1X94A 4D8UA 4ER5A 5C53B 2CVOA 4JBXA 2VDWA 3P2KA 4K0KB 2ZWVA 1ZH8A 2ETVA 4CIXA 3FSGA 4G09A 2RGXA 4RAQA 1JLLA 2WU3A 2A3NA 3PICA 2I1VB 3QKUA 2CUNA 1QO0D 5KJ6A 2QD5A 4FYJA 1HTBA 2XRMA 1E0DA 1P8AA 2WLTA 1QQ5A 1X19A 1RRPA 1E5XA 1WMBA 1QH9A 3OE4A 4WKCA 5KYXB 2C7GA 4LF9B 1PR3A 3PR3A 1P5JA 2B20A 1DC7A 2C2OA