3MB5A

Crystal structure of p. abyssi trna m1a58 methyltransferase in complex with s-adenosyl-l-methionine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
MIREGDKVVLVDPRGKRYLITVSKRDFHTDLGILKLEEIIGRNFGEAIKSHKGHEFKILRPRIVDYLDKMKRGPQIVHPKDAALIVAYAGISPGDFIVEAGVGSGALTLFLANIVGPEGRVVSYEIREDFAKLAWENIKWAGFDDRVTIKLKDIYEGIEEENVDHVILDLPQPERVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKDYFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Insights into the hyperthermostability and unusual region-specificity of archaeal Pyrococcus abyssi tRNA m1A57/58 methyltransferase.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 75
structure length 255
sequence length 255
ec nomenclature ec 2.1.1.219: tRNA (adenine(57)-N(1)/adenine(58)-N(1))-methyltransferase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit
A PF14801 GCD14_N tRNA methyltransferase complex GCD14 subunit N-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.330.20 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3mb5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mb5A02
4PCLA 3P71T 1ZHFA 3C6MA 3KPYA 2PX8A 3UWPA 4AZVA 4DQ0A 2PXCA 4RVHA 2UZ4A 3ME5A 3TMAA 5EC8A 3BZBA 4QVKA 4GUAA 3TOSA 2HR1A 5E1DA 4AZSA 5LQRA 3JWJA 3FUUA 3UJCA 5EMLA 4E31A 1XDUA 2AOWA 3K6RA 2ADMA 3AXSA 1EG2A 3TM4A 2EJUA 2GB4A 4R05A 2QY6A 3NDIA 4OQEA 1WZNA 3I58A 1ZGAA 1EQAA 1NBHA 5FA8A 3LDFA 5B1SA 3V97A 4QQNA 3LSTA 2XBMA 1G8AA 2EX4A 1D2HA 3M6UA 1R18A 2DULA 5HIMA 3CJTA 4E2WA 5BXYA 4KWCA 4PGGA 3KU1A 3LCUA 2ZIEA 4IV8A 4KIFA 3TKYA 3SR4A 5EMJA 3P8ZA 1XDZA 3G8BA 5IH3A 5C0OE 5EHGA 3ANXA 3LKDA 1O9GA 3M6WA 5K0NA 4C08A 2FYTA 2PJDA 4AZTA 1RI4A 4PYIA 5EVJA 5EHIA 4C05A 3ID6C 2UYHA 1FJXA 4MIKA 3CJRA 4DM3A 4GOND 2AVDA 4FR0A 3AJDA 2QE6A 5KVAA 4YUXA 1VPTA 2P3LA 3LCVB 3HP7A 3O31A 3KPJA 3O7WA 5JR3A 3UJAA 1G6Q1 5H02A 3MHTA 5GWXA 2CMHA 3EVFA 3S68A 4YV2A 3SVZA 1QAQA 3K0BA 4PNEA 5LSAA 3BUSA 3KQOA 3OU2A 2NYUA 1JG3A 5E1MA 4FT2A 4OX9Y 3NWEA 2P3QA 1NV8A 2B9EA 3FUWA 3GGDA 5HOQA 1ZQ9A 1ZGJA 2PWYA 2NXJA 2OBFA 4FZVA 4PYQA 3GRRA 1MHTA 2ZZNA 3EVAA 5CCBA 3L8DA 5E2AA 2IGTA 2P7IA 3LDUA 4GOLD 3BWMA 2G71A 2PT9A 5DWQA 2PV0A 5DSTA 3Q7EA 3KQVA 3DOUA 4QDKA 4RX1A 5M5BA 3T7RA 5ICGA 1D2GA 4PYOA 3TRKA 1VP3A 3P9NA 3TQSA 5BP7A 3OE4A 1NKVA 2YTZA 3PVCA 2I62A 1RI1A 3THRA 4KW7A 3ELWA 1FBNA 4BLUA 4OQDA 1XCLA 3NMUF 3HA5A 2P7HA 2FCAA 2GS9A 3TKAA 2B25A 2ORED 2ZWVA 3R9XB 2QYOA 4KVZA 2PX2A 2AOUB 2OB1A 1EAMA 5EGSA 3B7PA 3E23A 1DCTA 3LPMA 3PLAE 3QV2A 3GRYA 4PGHA 5ICEA 2WA2A 4HC4A 5G02A 4HTFB 3KQTA 1XCJA 2ONYA 3FUTA 4PINA 1JG4A 3UA4A 2E5WA 4P7JA 5FA5A 5K0EA 5K09A 1N7IA 2GAFA 3PFHA 3QOXA 1JQEA 2HWKA 4WVLA 5E8JA 3SSMA 3NVKI 5E1BA 3G7UA 2G70A 4EVIA 1PJZA 1XDSA 1YB2A 3MCTA 3PFGA 1JSXA 5E9WA 3GO4A 1X1AA 2XYRA 3FPHA 3G2QA 5DRYA 3HCDA 2B78A 1G55A 5T67A 2Z6UA 1QYRA 3VC2A 1SQFA 4L7VA 4FT4A 2P41A 1BC5A 2ZSUA 5HILA 5DTMA 4CKEA 4ER0A 5E1OA 1KXZA 2JH9A 1EIZA 1KPGA 2OPBA 3HA7A 4CWAA 2ONZA 1RJDA 2C7PA 5CVJA 4XUEA 3TPZA 4XCXA 3UJ7A 4E2YA 2EG5A 3T7TA 3KPWA 2ZBPA 3EVGA 3G88A 3MERA 3R24A 3B3JA 4PYMA 3C3YA 4ER3A 3LECA 5EEHA 4KDCA 3T0IA 1XTPA 4QPPA 3OZTA 4YMHA 4X63A 3C6KA 4CKCA 4FGZA 1FP1D 1IM8A 2BZGA 4CKBA 5K0CA 5EKXA 5ICFA 1G8SA 1M6YA 1R00A 4RVDA 5KS2A 3FYCA 2GPYA 3MCZA 3ORHA 4RV9A 5LQNA 2IBTA 3RODA 1VIDA 5FHRA 5HIIA 1G38A 1DL5A 9MHTA 1INLA 2Y1XA 2ZFUA 3O4FA 5DTRA 1UWVA 1FPQA 4KIGA 1XXLA 3ELUA 8MHTA 1SUIA 1X1DA 5EQJB 1PRYA 2YX1A 3M33A 2B2CA 3HCAA 4FS8A 3BT7A 1QAMA 3FTFA 4O29A 5GINE 1XVAA 2HTEA 3GXOA 3LKZA 3M6VA 2G8NA 1WXWA 3THSA 2Q41A 1NV9A 2AZTA 1YFLA 2AR0A 5BW4A 4DKJA 2CKDA 2P40A 1KP9A 5EG5A 2KW5A 1NT2A 2AOUA 2OB2A 4OA8A 5DT2A 5T6BA 1FP2A 5GM1A 4A6DA 4RTLA 1KIAA 4V0QA 4Z2YA 2AOTB 3TLJA 3IYLW 3P9CA 4K6MA 3CJQA 3PX2A 4GC9A 3FZGA 2O06A 2CWWA 4IWNA 1H1DA 4HTFA 2O07A 3UJ9A 1SG9A 3IV6A 3ELYA 4LWOA 5EMKA 4WXHA 4BP1A 4RTQA 3HCFA 1NW7A 3BKWA 1NBIA 2CL5A 4RTSA 1Q0SA 3A25A 4RTMA 1JTEA 2BR4A 3EVCA 1YZ3A 3I64A 2I7CA 3EVZA 1N2XA 2VDVE 3EMDA 3HA3A 5CVDA 1T43A 2G1PA 2IH4A 1NW8A 4C06A 3CGGA 4C03A 4LG1A 1YUBA 4RYLA 1KYWA 3B5IA 3G89A 2C7QA 3HVJA 4FSDA 4LECA 2HV9A 4M36A 3QOWA 1WY7A 4PYLA 4POOA 3VC1A 2PXXA 2ZZKA 3MAGA 1L3CA 4PCAA 3R0QA 2IH2A 2R6ZA 1B42A 2NXEA 1WXXA 1VP9A 2YQZA 4EQZA 4RVFA 4C07A 4E30A 3KR0A 3GCZA 3B3GA 2IFTA 2JHPA 5EPEA 4QTTB 4YUZA 2LD4A 3KQMA 2AS0A 3FPFA 2ZWAA 1R74A 5GIPE 2BR3A 3GU3A 3P97A 3DH0A 5LQKA 3F4KA 3BGVA 3PB3A 1TW2A 3A26A 5DXAA 5EIFA 1D2CA 2HNKA 5K03A 2ZIFA 3CVOA 1NE2A 4GOOD 5FHQA 3DXXA 5D1HA 2XVAA 4P7GA 3X0DA 3AY0A 1EJ6A 3DMHA 4QQKA 5E8RA 2Z6QA 3FRIA 3UBTA 5BW5A 3CKKA 3CCFA 4RTJA 3BWYA 4IV0A 1KYZA 1P1BA 3E8SA 4YV1A 4XUDA 2NP6A 2XYVA 1QAOA 4Y2HA 1U2ZA 2HMYB 3MTEA 2OXTA 2XYQA 4PIPA 3T7SA 3P9KA 2AN5A 4QVGA 4AUKA 3GWZA 3P2IA 5DRTA 2O0LA 3BGIA 2P1DA 2EFJA 3NTVA 3BGDA 4QPNA 2FHPA 3AXTA 1I9GA 2ZLBA 2ZULA 3DXZA 3KR2A 2V74B 3WSTA 3M4XA 2IDJA 3C0KA 2AOTA 5LR6A 3CC8A 3I9FA 2VS1A 3DULA 4PONA 4RSRA 4AX8A 2PVCA 3G5LA 5T64A 3UA3A 1JG2A 3GDHA 1VL5A 3KPUA 2AOVA 4HGYA 4F86A 3A27A 2UYCA 3P2KA 5C1IA 5IKMA 2NXNA 1BOOA 4V0RA 5K0JA 4R6WA 4B17A 1VQ1A 2O57A 4G56A 5F2NA 3EGIA 3A4TA 1X1CA 2GH1A 5DM1A 4UOEA 10MHA 5CVVA 5DX1A 4RTRA 2ZBQA 4CTKA 2H11A 3FTEA 2YXDA 4ZTBA 5E2BA 5FCDA 3Q87B 5FWDA 2OKCA 3TR6A 3OPNA 3JWGA 4Y30A 5DLYA 5EZSA 4C04A 3B89A 4CTJA 3HEMA 5GM2A 4E2ZA 1WS6A 3AWIA 3CBGA 3R3HA 4LWPA 3GRZA 4DCMA 4DMGA 5D1NA 3V8VA 1F38A 2BM9A 1YFJA 3EVBA 1SVUA 5FULA 5K8VA 5DSXA 7MHTA 2PX5A 5DM2A 3UJDA 3HCBA 4H0NA 3DP7A 4RWZA 3GJYA 1P1CA 2GA9A 4RTNA 2UYOA 2FRXA 4PWYA 3HNRA 3DMGA 2PXAA 1F3LA 4R6XA 3SMQA 2VDWA 3VSEA 1UFKA 4HRAA 5HEKA 4NECA 5DX8A 2I6GA 4GC5A 3P9IA 1ORIA 2VP3A 4IKPA 4X61A 5KYGA 1L9KA 1NW5A 5ERGB 3EGVA 3HCCA 3LX6A 4GBED 1TPYA 5LQUA 2IH5A 2F8LA 2VDUE 3B3FA 2OY0A 3FUVA 3C3PA 2OYRA 4RTOA 2C7RA 3KQWA 4RVGA 3UZUA 4GEKA 4GQBA 1I1NA 4ISCA 4BP3A 1R8YA 3LL7A 3NVMB 3U81A 3KQSA 3A7EA 2Y1WA 4U7TB 3MQ2A 5GP1A 1MJFA 1R6AA 5FUBA 3OZRA 5K0BA 3OU7A 2WK1A 5FWAA 1KHHA 2G72A 2YXLA 4EK9A 3KHKA 3BWCA 1Y8CA 4GF5A 2P35A 2DPMA 4OBXA 4A6EA 3UJ6A 4DZRA 4E70A 2NNWB 4PYNA 2N47A 1HNNA 5LQCA 5K0GA 1EJ0A 3OZSA 3LCCA 1VBFA 3FPGA 3GIWA 4OBWA 3RIEA 4E33A 4EKGA 1V39A 5DXJA 2ZCJA 4YMGA 1RJFA 1ZG3A 4R8SA 1YZHA 5DM4A 1BKYA 3GRUA 4OA5A 5C9ZA 4HH4A 4EMSA 5DTQA 1YF3A 4X1OA 3M70A 3P2EA 2V7EA 3PS9A 3UFBA 1IXKA 2YR0A 2IBSA 1HMYA 1L1EA 3HVHA 4EKIA 1NW3A 2BM8A 2QRVB 2PBFA 3IHTA 4PIMA 1JTFA 3SX0A 3FPEA 3MGGA 4BLVA 5HZMA 2JHCA 1VLMA 3DXYA 4BLWA 4PYJA 2PLWA 1TW3A 1RI2A 5FADA 1KPIA 3ER8A 2O05A 2Z6AA 3E05A 1L3IA 4HSGA 1AQJA 2JJQA 3DR5A 5K05A 1ORHA 3EVEA 5K01A 3KKZA 3DLCA 4YUVA 2XVMA 4KRGA 5P8WA 4CXMA 3G2PA 3KR9A 4ER5A 3PTAA 2ZW9A 1Q0TA 3LDGA 3ER9A 5KQSA 3BKXA 4YUYA 2ERCA 1RJEA 5E9JA 5LQJA 1O9HA 5CD1A 2BR5A 4KDRA 3LGAA 2I9KA 4ATNA 4YV0A 5FQNA 3LHDA 4DA4A 3ERCA 4AZWA 2AOXA 2P3OA 3FYDA 3SGLA 5EIWA 2YXEA 4MQ4A 1WG8A 1VE3A 4YUWA 5U4XA 1SKMA 4X41A 5HIKA 5FQOA 5EMMA 2NXCA 4M37A 2R3SA 5EZQA 2AN3A 2FK8A 3REOA 2JH8A 3SSOA 5GIOE 2PKWA 1ZKDA 3GNLA 4JXJA 4E32A 4MTLA 2ZIGA 3EEYA 1Z3CA 2UYQA 3PX3A 4E2XA 3G2OA 5EKUA 1RI5A 1SUSA 3R6TA 1N7JA 1G60A 5JUWA 5MHTA 5CCXA 3GRVA 5CIYA 4DCGA 5EEGA 5GOZA 4M38A 4QTUB 1L3BA 2CMGA 3OCJA 3TFWA 2JHAA 5HIJA 3E7PA 5EOVA 2WA1A 1I4WA 2VZ9A 3HM2A 1M0EA 2H00A 1QZZA 3HVIA 3JWIA 3UJBA 2IIPA 5F2OA 5K0LA 3TM5A 5DX0A 3D2LA 5CVUA 3EVDA 1NW6A 2K4MA 4M7RA 2QM3A 2ZBRA 2ZTHA 2A14A 5F2KA 2ZZMA 2PX4A 2H1RA 3FRHA 5FTWA 3HVKA 2PT6A 3SSNA 4P7KA 3FUXA 5DPMA 3G8AA 3KPVA 3HTXA 1JQ3A 3DMFA 3M6XA 4XUCA 3NDJA 3MB5A 2C7OA 2QRVA 4HG2A 1XJ5A 4FP9A 2PY6A 3KQPA 2OZVA 2ZVJA 5E9QA 4F84A 1DUSA 3I53A 1JSZA 1O54A 3OE5A 3ELDA 4FSXA 1KPHA 1BHJA 2FK7A 3A7DA 3LBYA 1P91A 1R8XA 3OU6A 3MTIA 2JG3A 3HCEA 2NP7A 3DLIA 4MWZA 3RW9A 4F85A 1M6EX 3I5UA 2IP2A 3DTNA 3FPJA 1X1BA 4P7FA 3NJRA 5K0FA 4X60A 4PYKA 3EPPA 2IDKA 2PGXA 3G2MA 3JWHA 3FTDA 1P39A 3LBFA 3OFKA 4ER6A 4RTPA 2EJTA 1JQDA 1AV6A 2AN4A 2B3TA 2P8JA 3IEIA 4MHTA 1OR8A 4HGZA 2BH2A 3NW9A 1X19A 5CM2Z 3EMBA 3DUWA 3BXOA 4C4AA 3FTCA 3VYWA 5CUQA 5DM0A 3SXJA 5HFJA 3H2BA 2YVLA 5KQRA 5LQAA 1RJGA 1RI3A 3NWBA 2PSSA 3EEOA 1AF7A 1IY9A 1QANA 2PWPA 4U7PB 4R8RA 5CVEA 4RTKA 3SM3A 4GOMD 3KQQA 4ER7A 1KR5A 2GLUA 3KQYA 3EGEA 2YUIA 3G5TA 3PT9A 2ESRA 3OFJA 2AVNA 2OO3A 3UJ8A 4QDJA 5ICCA 1AQIA 1JG1A 4DF3A 1SQGA 2IPXA 1JR4A 3KR1A 4BY9E 1UIRA 4P58A 2FPOA 3BWBA
chains in the Genus database with same CATH superfamily
1YMQA 2QT0A 2ZYWX 3OPYA 3PWZA 1EFAA 1UQTA 1MO3A 3DE4X 3X2EA 5LQSA 5ALZA 3QF7A 4ROSA 3H1EA 1Z2DA 2Q0SA 3ISVA 2OLJA 3OPMA 5HOEA 1XCGB 4KP7A 4D96A 4FZ3A 2H0QA 1C1XB 2VK2A 1FQOA 3PFKA 1FMLA 3M5WA 3UWOA 3HMQA 3NFYA 1QGUA 2A0UA 1OH5A 2FSVC 5DNVA 2MSWA 4DFDA 5JZBA 1EXWA 1MCZA 4UNPA 5T57A 2FOIA 4YJ2A 3I2KA 2REQB 3IP3A 1G8AA 4ND2A 1I1QB 4IDPA 4E2WA 4BMDA 4ZDIA 3GA0A 3TKYA 5EMJA 1IG0A 1KMNA 2DSTA 5FJIA 1Y4UA 1HZZC 3ND5A 4FKBA 3ANXA 4UUNA 4N3BA 4Y2YA 2VEDA 5EHGA 3PNSA 5FEMA 5HKOA 1KF0A 2VTEA 3HFJA 1KDVA 5IWCA 4Q4LA 3V8EA 1YS4A 4U7GA 4JLBA 3QPDA 2XA9A 1S1CA 2PNJA 4I4NA 1DKRA 3WYEA 3DBLA 4PRZA 5IAOA 2OMEA 2XQIA 1T0IA 2ZIZA 3OU2A 1EGAA 4P08A 4WLNA 2XRFA 4V0KA 1LLUA 2JK0A 2P9QA 3CRRA 2IVZA 1V47A 3CXUA 3M6MD 1YH3A 1E6EA 1YB6A 1KS2A 3CUUA 3O2JA 1NV8A 2B9EA 3CG4A 4RL6A 3I23A 2PWYA 3HB9A 4FZVA 4D0LB 1MQ9A 5I3ZA 4AZ0A 1E2MA 5C2JB 4LGYA 3VNAA 2HCJB 3QVOA 1DMRA 1YQXA 1P1KA 1LDEA 2P4HX 4B3HA 5IT4A 1IM5A 3MGKA 4PC7A 3AG6A 1XSEA 5CPFA 2BGTA 4GKJB 2P69A 1D2GA 3HU2A 4PYOA 3TGPA 3P9NA 4R2MA 4G1MB 2Y66A 3THRA 5KKCA 1UXOA 1AY0A 1JW9B 2BFPA 1GT6A 3CLTD 4FD3A 3LD9A 4AECA 4DR1B 4IZOA 3FNRA 1ZJ6A 3MB8A 2PO7A 3DEYX 5JOQA 4HDRA 1QDNA 4CEIB 1RWOA 2ZJ7A 5EZYA 2R8YA 3VKFA 1JI3A 3AP3A 5L45A 1PR4A 1XDWA 2P5UA 2WYVA 2YUTA 1X7YB 2A5LA 1UDBA 2JGDB 2QZPA 3L8CA 4LRUA 1IHUA 1PZNA 4R7ZA 3N2LA 4UNSA 4BMXA 2YS7A 3RAPR 4DGSA 1SOVA 5AXDA 5I47A 3KVNA 4JJ8A 3MWFA 5GMOA 1P5ZB 3RARA 2XUIA 3TLCA 4BMPB 2OG1A 4DQKA 2IW3A 1W581 2MM0A 1T3ZA 4EIWA 2P9GA 4OBBA 4XFJA 4HNUA 2H6EA 1Z74A 5D3MB 3V2GA 2MR6A 4A1OA 5HFNA 1MVLA 4X84A 3A9RA 5E1BA 4BV8A 3RKSA 3UV7A 1PJZA 4QBFA 1E2QA 1QDLB 2GCOA 3OKPA 4HFRA 2J7KA 4NOLA 2NV2B 4JL6A 5GQSA 2R1VA 1C4XA 4ETNA 2FFRA 1UK7A 4FT4A 4XVCA 2EFYA 4IRXA 1KPGA 1E5TA 3GB9A 2Z2JA 1V9LA 5ELXA 1VHTA 4AC9A 4BNVA 4WA8A 2JVJA 1YZLA 2QX4A 3G0OA 3GFVA 3N2YA 4FNMA 2W11A 4H1TA 2VRCA 3ZHVA 2BEWA 1ZNWA 2XYPA 3HBJA 1EFRA 2A5DA 2OOKA 3CB4A 3UWSA 1RSZA 3HWRA 3KJQA 4IGFA 2HZBA 3L6DA 4LHVA 2CXSA 3CV3A 1ZR2A 5K0CA 2Y1FA 3ZUPA 4LZNA 2FN7A 1IN1A 2OXIA 3VO9A 4C6TA 4L02A 4TRRA 2G07A 2BEUB 1PEDA 1NULA 2W43A 3O4FA 1IAQA 5IJWA 1SUFA 2RGGA 3BK1A 1T0BA 4C30A 3Q98A 1YXMA 3FGZA 1O96A 5EQJB 2QVLA 3K9FC 2YYAA 1ZINA 3IQFA 3GXOA 3INNA 4G5FA 1I4DD 1FDIA 2C61A 1UWKA 4RK4A 4XLLA 5HNKA 3R9XA 2ENWA 3AF0A 4O25A 1C80A 1WZEA 1I2BA 4Y1GA 4M7PA 1QHHA 1ADYA 2Y3IA 1ILWA 1AV7A 1J06A 3KDAA 2Z5LA 5HA5A 3SKVA 3FM9A 3QK7A 3W6NA 4QG7A 4BBZA 3EIWA 3L49A 1S4QA 1G4UR 1ICEA 2GBIA 2WYHA 3E9YA 3PC7A 5G4KB 4UE3S 3VH4A 1P1IA 4GGPA 4J49A 3T1YB 3FZGA 2G0AA 3EPRA 1FP6A 4HAVA 1CZ5A 3JD3A 2H1FA 3ZLBA 3TN7A 4D4HA 3KWFA 2ILTA 4KXQA 5ADWA 4RIFA 4YDRA 3HXOA 1PYGA 2FVXA 2IHKA 3HJRA 3NC4A 1RLJA 4LOLA 2YWBA 1GFIA 1GUYA 2Q3FA 3GPIA 3L1UA 1EVQA 1N2XA 2OTCA 3EXIB 4ZO8A 4EEZA 3IS3A 3HA3A 2B2XA 2QAIA 1Z83A 2BC9A 3OCUA 2AH5A 3CR8A 8ABPA 1VKZA 2HHHB 3TOCA 1LU9A 2HMUA 2NU7B 3AUYA 4DVJA 1HURA 3Q3VA 2EOAA 3LBAA 2UYYA 4M36A 2BLNA 3MGCA 5JJLA 4YP9A 1P77A 2DKFA 2Z1NA 1K6XA 3CMMA 1WF3A 1IH8A 4ZAVA 1G41A 4D3DA 5CHYA 1YJAA 1B42A 1UEJA 1J99A 1VP9A 1WXXA 3MTAA 3DKPA 4GBMA 4P4SA 3VHQA 2PUFA 3GJQA 1MJGM 2WJHA 1Q17A 3ECCA 3CO5A 2UZIR 5DHAA 3UGJA 3IEMA 2R62A 4PW0A 1I7NA 4QTTB 1STOA 3HI6A 3HKCB 2HMWA 1JLLB 3FPFA 4RFLA 1XOIA 3R76A 2O8EB 1BXGB 3G2LA 3IVCA 3AY3A 4I2VA 1IJBA 1HPLA 2KX7A 3OCXA 1JEOA 5KPDA 1LNSA 3IPLA 3BEOA 3LOUA 5E6RA 4HAUA 4O2BA 3UNXA 1AGNA 1GPUA 3C3EA 3NTXA 4QHTA 1XNRB 2FWRA 4JXXA 2QIPA 1G3UA 1QHNA 4S2UA 2KSQA 3G6KA 4P31A 2FKAA 3ESDA 1N2SA 4EJSA 3BWYA 4ANFA 1EB8A 1QTIA 2BZSA 3M0EA 2JI8A 1I3LA 3QVJA 1BE8A 4OFWA 2WM3A 1T35A 3WDSA 3P9KA 3D8UA 3AFMA 3BGIA 3G79A 3KL4A 2BGJA 5DM60 2QPLA 2XOXA 4E3ZA 1SIUA 5EHZA 1W0JD 3CPJB 4XQGA 1J42A 2A30A 4JLOA 4MKFA 2Y67A 4TKLA 5JS6A 2DE0X 5BRNA 2JBWA 1Q14A 3IXQA 3UVEA 2Z3ZA 4HVAA 4IHQA 4N01A 2ORVA 4I9FA 3C3WA 1GFZA 4K9RA 4XYGA 4Y0VA 2JD0A 4QDUA 2P9FA 2Q2QA 2J59A 2BUBA 2WI8A 4I5EA 1E0JA 4JVOA 4MA5A 4W4TA 2R4TA 1NYRA 2JJYA 3MGBA 3I8XA 2EZ4A 1VQ1A 3VYVA 3IVXA 1U3CA 2PBRA 2X2EA 3WLIA 3QLVC 2W2OA 2JPDA 5CITA 3GJZA 3HU1A 2GX6A 4CTKA 4PICA 1X1TA 2AR7A 4LK2A 3X1YA 3H8WA 3W34A 2XXAA 1QS0A 2O52A 1HRDA 2Q6TA 2EZTA 1JHPA 4I1OA 1QONA 4L6AA 3N2GB 4TV8A 1ZMRA 2BUAA 2D0OB 4UZEA 5EMNA 4D4IA 3F7TA 4BN5A 1FU4A 2Q2WA 4MWOA 2XJ4A 1AN0A 1C9EA 4R81A 1T8WA 5E4YA 1BEEA 1TLFA 1E66A 3O8QB 4DQVA 5CM8B 3DAFA 3ZHRA 5F23A 3ZDQA 3TCXB 4CL0A 3DMGA 1U9IC 2NUPB 1M72A 1EWQA 3LZDA 3QVGA 3B1JA 3GWGA 1ESCA 1F8UA 1GNTA 3K4HA 4N1AA 3TQCA 2R65A 4EPYA 1HTTA 2VQ3A 1TVCA 4M0EA 5LYJA 3SJUA 2PZMA 4IJ5A 4X6LA 2ST1A 5F35A 2H2DA 4QGHA 4REMA 4DEVA 3ICEA 5TY0A 3AFNA 3DAYA 1WMAA 1XZKA 2AFHB 2VDUE 3QTTA 4U6SA 4ZZ2A 3WVNA 4AF7A 5A3QA 4U7DA 1WV1A 2XUZA 1KOGA 1VKHA 4PZDA 2VZ8A 4PWZA 3CO0S 3RTAA 2ISSD 1NPDA 3O4VA 1PJ8A 1H4TA 1WSBA 1BROA 2EFGA 2HHAA 5FLXA 3G1WA 2EX0A 2JLAA 1ONNA 4JJIA 4ZI7A 4KQFA 2V6IA 3H2ZA 3QIAA 3SJZA 1IC6A 1NW9B 4YBRA 5BV8A 4ALMA 1ZGGA 1E2PA 2IVFA 4EUFA 2Q3HA 2X22A 3FCEA 4DZRA 3B9RA 2QQEA 2P6OA 2HADA 4UFPA 1RE1A 1TM3E 1EJ0A 1BKSB 2WHEA 1ODCA 2GESA 2IF2A 3HY4A 4CM4A 3FCUB 3EQ6A 4CODB 2ZCJA 5KTNA 1OFHA 4YMGA 1PU2A 1FFAA 4FU0A 4IRUB 5BVHA 4OA5A 1XCPA 2CW5A 2Y1OA 4GH5A 2XVYA 3DYVA 2FGKA 5K4HA 4YJ3F 3TLEA 2ORIA 3WAJA 1YF3A 3M70A 4C76A 5J58A 3PRHA 3OEYA 3OPYI 2V7EA 1T2DA 2DR2A 2QOEA 1DVRA 5E0KB 1L1EA 2Z8YM 5H3CA 4FQ7A 1K5HA 4MIOA 4JL5A 4PNHA 3UUFA 2XVXA 3VO1A 1NMEA 4D9EA 2BSXA 4KQCA 5DWVA 3AW8A 3QF4A 3NTUA 2Q3DA 4H4CA 4Q4AB 1BYUA 3RBAA 1UT8A 9LDBA 3L7NA 1EFVB 1OT5A 3RHSA 4KSYA 4MYUA 5KJCA 5CT5A 5GY7A 2CV0A 2O05A 3LC0A 3O8NA 4AJLA 4XH9B 5B7NA 5K05A 3WL3A 3VZDA 2V6MA 1JU3A 1ZY2A 1U1FA 4NTZA 2VPYA 1ADJA 3HP1A 2XVMA 2PA0A 1EX7A 2R7MA 4K6FA 3KSUA 2CDAA 2F17A 1JR3E 1M2EA 1VTKA 1GG8A 2ZW9A 4JUIA 3DD1A 4XYBA 4UZFA 3ER9A 2GFHA 1QO0D 3UOGA 1JFSA 4MP6A 4FDUA 2EZ8A 4Q24A 4EQ6A 2D1TA 2BMFA 4G4JA 4YV0A 3BJMA 2GBLA 2EEPA 4PO9A 1UAAA 1ZHHA 1A5AB 1YTUA 1KETA 3DYIA 2V54A 5BW8A 5JI3E 1XZQA 2PRSA 3LF1A 4CM5A 1XAHA 3LT5A 1J5EB 4IJMA 4X7RA 2OQIA 3T1NA 5KTKA 1P6XA 1PFGA 1K7XB 2QTFA 4NPAA 3SSOA 5HJ2A 3J80A 1DIGA 1EKXA 5HZKA 5LNK1 4LRYA 1J00A 2GVZC 1B43A 1BW9A 1JHXA 2BZ0A 5JAOA 1K4YA 3KX2A 3C7CB 4R0MA 5EKUA 1EDDA 1PVVA 3V4OA 4KFUA 2A9OA 2WHYA 3LH5A 2BDUA 3V42A 2C94A 1YIOA 3IP5A 4D4LA 4GR9A 1ZVMA 2O3TA 4HDKA 4O2AA 1DHTA 2FQ1A 1OFUA 5TE9A 4IPTA 3FUCA 5HIJA 3ZD9A 1JA9A 4HDMA 1V1MB 3IV9A 3S44A 3PJGA 5REQB 3T5MA 4PC2A 1N5MA 2IE0A 3EYWA 3RADC 3I1JA 1G7TA 2X8WA 4KYUA 2XGOA 4MIYA 3LK7A 5DX0A 1WZIA 1W19A 2K4MA 3EVDA 4Q4HA 4FDTA 3AF3A 3HLYA 2ZS7A 2Y1EA 1AS3A 1DHRA 2GJAA 3DEIA 3EJ6A 3L8HA 2H1RA 2Z3VA 3IB3A 5G41A 2ZZMA 2NMVA 5A5VA 5JS1A 3G8AA 4M89A 2XB6A 3C6XA 4K46A 1WHTB 2VAVA 3DGEC 1YA6A 3W5BA 4WMLA 2QRVA 3JATB 3RR2A 5EWMB 1NURA 3OIGA 4G0PA 4LS3A 1S7CA 2OZVA 4GM0A 4I66A 2G40A 2X19A 3FF4A 4ON9A 3I53A 1RJ9B 4TKVA 2RHLA 3AK4A 3FLAA 4LHXA 4Q3NA 4POAA 2IZOA 4BV9A 3P2JA 1SEPA 3DCJA 4RQTA 3WRVA 4QRIA 1R64A 3QWHA 1LBTA 3DLPX 2CJPA 2BJVA 4BO8A 3OEWA 3TZLA 5C35A 4I3GA 3KZCA 5C7LO 1DG1G 4QULA 1IBLB 4WN9A 1NC1A 3AIIA 3P2OA 2ARKA 1GFWA 3ON5A 4YT4A 4ZZIA 4GP9A 2W6OA 2PSFA 1U7WA 4CNQA 1CZKA 4EA6A 3SS9X 1GNLA 5BNFA 3KCQA 2AN4A 5BUCA 1AZLA 4REOA 4KRXA 5KOIA 2B1QA 5H7XA 4MQLA 2D7JA 3VNVA 3IBSA 1UPBA 5H80A 4Y0NA 1X15A 2FPUA 1DLJA 2PYDA 4YRNA 4M1OA 2WUGA 4BO3A 3PA6A 1JHUA 5ARCA 2FF5A 4OJYA 3NPAA 1E63A 1X9HA 2H92A 4MLCA 4ER7A 1W0JA 3W7AA 2EQ5A 3TKLA 1H2YA 3NGMA 4FYYA 4AZ3B 2AVNA 1T0PA 3DZJA 1SVNA 4H7KA 2PMDA 2W6MA 4FX5A 3UCFA 1NUTA 2CLKB 1FXSA 2H5LA 2KE5A 3NUGA 4HUJA 2E87A 1ZNQO 2ZVDA 3LQ2A 3OEHD 2GTPA 1EB9A 2JAOA 1TD1A 3TL3A 1F14A 1G42A 1S3GA 5AW4A 5DM70 4BNMA 1QTRA 2AC7A 4GBJA 1UCFA 1ENYA 2XX3A 3M2PA 2HR1A 2C9CA 4JWKA 2Y1LA 2OM2A 4C89A 2MSKA 4OP1A 1MO5A 3A0RB 1RS0A 1QCCA 4JZYA 3A9CA 3CNEA 3D3NA 5FL7D 5BWMA 3K15A 4WOKA 4XLZA 3IUSA 4C5BA 2OCDA 3NATA 4YB8A 1YR7A 2F4VB 1EG7A 1PFVA 2AQIA 4M1QA 1ZJJA 2GZRA 2VUIB 5JMWA 3KE9A 3Q5EA 2SKDA 3LDFA 1Z06A 4IJ6A 4CR7A 5BT9A 4BIIA 1FRQA 1B3RA 1NQAO 1UPUA 2H9YA 2XUKA 3CKLA 4KAJA 4UVIA 4OJTA 2A1IA 1PZGA 2DHDA 2R66A 3G8BA 3GEMA 2A0XA 1OREA 1VBMA 4RH3A 4M8LA 3P9XA 1EQ2A 2Z1MA 4YYEA 1PUXA 3KRTA 5EVJA 3EMKA 2C07A 4AY6A 3QUTA 4H6PA 1USVA 1VPLA 2JIZD 1ZHOA 4H7JA 3QU7A 3D6VA 2W8BB 2BFDB 4KBYA 3RFCA 2KWIA 2P3LA 3GFPA 3KL2A 1I7LA 1DJLA 2HPVA 5TMEA 3NPMA 3TEFA 1QO7A 4WBNF 5EZYF 4HDNA 3A8TA 2OFPA 3H7AA 2IX9A 2X9NA 5E1MA 3SQNA 4PHHA 2F8MA 1K6IA 2UZ3A 2XRYA 4P9NA 4W7SA 2ECPA 4B3MB 1AM4D 4IJVA 1GITA 4LPKA 4KN6A 3RVDA 3HK2A 1W88A 2E82A 2X41A 2ZT5A 1ZGJA 2R6JA 1B6GA 1VKJA 3AQ4A 5CYFA 2CZQA 4FCTA 4WZAE 3EVAA 4ZALA 1HK7A 3BGSA 5HJEA 1KTIA 2ZZNA 1U9CA 2VYCA 4QU5A 3IQHX 5DYNA 2PT9A 1YB4A 3SKYA 2PV0A 4DDTA 2QY9A 2ES4A 2FUKA 4KWTA 4UAUA 3DOUA 1ANKA 4A4DA 1XHFA 2AXNA 4IQFA 2PGLA 5AH0A 5ICGA 5L4NA 1XPOA 1RWVA 4PTYA 3WKBA 3EY9A 5K6TA 2YTZA 3LKBA 1XXHE 4KK3A 3UXHA 3IODA 4QREA 3GLQA 1E1MA 4KW7A 1KI4A 5K9ZA 1KJIA 4GM1A 4FB5A 1QX3A 3BQNB 2E21A 1BQ4A 3KNZA 1V5IA 2P7HA 4CV0A 3VKHA 5FXMA 3BTVA 2XCUA 1V25A 3TI7A 5KNCH 3QW4B 4OXNA 4URWR 5ERXA 1G2OA 2QYOA 4KVZA 4GKVA 4BCCA 3IDOA 5KYYA 2YNMD 1S8OA 3EQ9A 2VHEA 1PW7A 4TMTA 4HLCA 3ZEAA 3SQXA 1J9GA 3ABIA 4UMFA 3E23A 3I32A 3BCRA 4N9QA 5AOAA 3U3KA 2WY2D 1FYEA 3G02A 4AFNA 4L9AA 5CH8A 1FSGA 2MINB 3M5CA 5ICEA 2DWQA 5LU8A 5T4EA 2PWAA 3S8MA 1PE0A 2VAPA 2OZKA 1O87A 1Z36A 2E6UX 2EFHB 3JQRA 2QMUA 3NBAA 3S2GA 4A8JA 3LW8A 1BX1A 4DC0A 1PGNA 2RGXA 4L3WA 1K5GA 1GXSA 3DFUA 4PG4A 4J1TA 2HWKA 4RF3A 4KR6A 2DTDA 2UZ1A 3G7UA 1VSBA 3MCTA 2WT9A 3FYUC 2BFAA 1KZGB 1OFIA 2ZU0C 5F76A 1IN8A 2F1IA 5FWXB 3MHPA 3OP4A 5C37A 2KLBA 3K5PA 4FEYA 4YCAA 1U04A 5HUHA 3NBKA 2Q5JA 4ER0A 4UBNA 1R7RA 2OGSA 4EHNA 5ALPA 3C3DA 1PGOA 4HH3C 4HXEB 4KQHA 3X2FA 2CWDA 2ZDQA 4H60A 1OY1A 3FFAA 1QFXA 2AI3A 2RAPA 3BWVA 3QNUA 4FBMA 4J0CA 4MV3A 4WT7A 3WLPA 4GR5A 4TLBA 3T7TA 3TUIC 1SVKA 4W8GA 3TIFA 4OM8A 1N77A 3JR7A 3QITA 3CTPA 2VZEA 2OORA 1C30A 5DTJA 1EX1A 3W90A 4RPGA 1X8KA 1JEYA 4FGZA 3AVTA 1XZEA 1DX9A 2Q5QA 4CIVA 3OF5A 3GNQA 3RRXA 4RVDA 2G9ZA 3FF1A 5HWSA 5KX5B 1LSUA 1KE1A 4AUNA 1TVMA 3DW1X 3VMFA 2HQRA 1DQRA 5HIIA 4J7CA 2ZP1A 1CY6A 5DTRA 5EQFA 3TG8A 4NBKA 3R5SA 2BM0A 4KX3A 4JLDA 3L79A 1QRSA 3QI7A 4QHYA 3T52A 2XNSA 4DMMA 3TSCA 3Q8MA 3SMVA 1FFBA 1NV9A 1SCNE 4E7OA 4ENRA 1ODFA 3RLFA 2JGEA 1A9XB 1MR3F 2D1QA 2FFBA 2EFCB 4A92A 2XGJA 4FMPA 2IUSA 4YP1A 3CKYA 4MQBA 4OBEA 2KW5A 2BDEA 1H22A 2CLDX 4ME6A 4YP6A 3QKIA 2WSSD 4EVRA 1Z0SA 5BUSA 1FP2A 2ZSAA 2H4HA 4DR3B 4HGPA 3T3EA 1E61A 1XZBA 2AOTB 5ALYA 3BMCB 4XCQA 3TR5A 2L0XA 3EZGA 1EDBA 1ZIDA 5A3VA 1LDMA 2CWWA 5K6AA 3ES9A 3HCRA 3NHJA 5K3SA 4BX9A 1R5JA 4D0GA 4LWOA 2O9JA 4ENVA 4OLFA 2XDQB 4QOHA 1E69A 5HF5A 1T6BY 3R9IA 4QPJC 3WWCA 3TQHA 1TO6A 2ODEA 4MROA 4QEDA 2I2XB 4PS0A 3UEOA 3B3QA 3UAVA 3B1FA 2FPWA 2GI4A 1LZKA 1GZ4A 1Y5IA 4JGGA 3VH2A 5LZ7A 2B20A 1GPMA 1RWXA 2WUFA 4LN1A 3O3OB 4TKMA 4WASA 3TCNA 4CMCA 5AM2A 1KBZA 2IYOA 2GYWA 4TLDA 4BMZA 1UAYA 1TYBE 1IN4A 2A35A 1LBQA 2XB4A 3B5JA 3GRAA 4K5QA 2A5JA 2H4YA 2R5NA 2I9KA 2AI1A 3DOHA 3WY9A 3RC8A 3ZQUA 4N7MA 3OZBA 5JJCA 2GASA 3FAZA 3WGOA 1UZNA 1KE2A 4LF7B 2XBUA 3I1FA 2EARA 4MGEA 2G0TA 4UASA 1RZ3A 4GAEA 2LD4A 4JOBA 4KNVA 4HJXA 1PK8A 4UKDA 2V7QD 2BELA 2JEOA 2ZWAA 4NXNB 2C5GA 2YIVX 4RKWA 4IDAA 1ABEA 1E9CA 1OTHA 2IPAB 3ED5A 1K98A 3R5HA 3TTWA 4D82A 1A8IA 2VDWB 3CGWA 3LOQA 5ABPA 4FUTA 1NXPA 1JHVA 4DV2B 3IHWA 5JISA 4MJXA 1CUHA 3C6ZA 3EDQA 5IAJA 3GVHA 5JALA 3IERA 2XVAA 1ZBDA 4FFMA 3U37A 1A27A 5JD5A 4MR7A 5IVPA 2BMWA 4LE1A 3GP5A 4OQZA 3VBEA 3ROXA 1DEAA 3OEHA 1SVIA 1GEEA 3FOZA 4N3AA 1W5BA 4YX9A 4LSZA 2H0AA 1Z13A 3SQDA 3D7NA 1R88A 1SKYE 1H4SA 2OK7A 1ZC3A 3KBBA 3NIFB 5FPSA 3JYHA 3ET5A 2AW5A 3Q7RA 3RF6A 2FDCA 1GNVA 2ZTMA 4I9UA 5DTEA 5HFAA 4UTNA 4Y98A 2B37A 1F0KA 3TINA 2ZSIA 4IG4A 2JIQA 4Q1FA 5JS2A 4C20A 3WSTA 3KOXA 4NY1A 1P1RA 1R50A 4TV8F 3BHIA 3PV0A 1GQ2A 5AW9A 3ZGVA 2I67A 2PVCA 3KXIA 3KJNA 3A4NA 4RSMA 5JV5A 2JDIA 1WE2A 4LXHA 4H31A 1TM7E 2RBGA 3LT2A 3QWFA 3WQHA 2WQZA 4ARUA 1XAJA 1GGFA 2DYKA 1DIBA 2YDXA 3AG5A 1Z5WA 3RYFA 4KO1S 3QEAZ 2OBYA 4G56A 2SKEA 2JGNA 4HEA1 3H11B 5CBPB 5I9TA 1RYDA 2ZI9A 1ABBA 2IQIA 4FB4A 4MQUA 4QXMA 2H11A 3OM9A 1GGJA 4LNUB 4WGGA 2QGZA 3G7NA 3H2GA 5CNJA 4NK5A 5EZSA 1A96A 3R3HA 2I7VA 4KE7A 2V7BA 4ILKA 2PMWB 3RHZA 3JQ8A 2ASVA 2YZKA 3GFQA 2FPIB 4FEGA 2IEBA 5DLDA 3EHDA 3G0CA 1JQ5A 4W1PA 3BN3A 3T3HA 3F7OA 5L3SB 2R1TB 1FUKA 3A6LA 3AB8A 4TVOA 3VJMA 2IZ7A 3C1UA 4ZI7F 2VJNA 2UYOA 2W7TA 3R2JA 5IYZA 2JNWA 4NYMR 3PNLA 3K70C 2OWDA 3I5AA 5JEEA 3ORYA 4TROA 5EHNA 2P78A 1UAGA 5A1JA 4MR9A 5DX8A 3X1XA 4IXMA 4LJ6A 2PHZA 2GXUA 1NUPA 4G0XA 3WHLA 4RCYA 3QYJA 4LUCA 1HYBA 3LA6A 4IHJF 2JLRA 3FUVA 2IS2A 1XELA 2HA4A 2CT8A 5C8VA 1E1DA 1UFRA 3RSHA 2CL0X 2W6JD 2YNMA 4X97A 4C43A 3LL7A 1QP7A 1IWPB 1Z12A 2A9PA 1YVUA 1JQJC 1VJCA 1XGKA 3EF3A 4GX5A 4L5IA 3TD9A 4KTVE 4EF6A 5A4DA 3EJWA 3I62A 2H7VA 2YV5A 2ATXA 3C48A 2GZ3A 4GOXA 2JFPA 4LDJA 2YV1A 5FWAA 2PV7A 3EBLA 1P4JA 2RIPA 4UXIA 4OBXA 1AT1A 3T3MB 3FVVA 1XZPA 2QN1A 3ZGXA 1DP4A 3SX4A 2QG6A 2QRGA 1A9TA 1Z5NA 4U9IS 2YY6A 1FDOA 1U8EA 3OVMA 1Q7CA 4WOPA 4ZAYA 5SY6A 1VI6A 1BKYA 2TSYB 2VT3A 3FE2A 3H83A 4YCBA 4B6PA 4DMKA 3S7ZA 1FDTA 2R0QC 5JAQA 4EHBA 3UMBA 2P77A 4U4AA 4RJLA 3WYNA 1S3FA 4BN0A 1FCJA 2XCLA 3EQ2A 2YW9A 2JB9A 1OGJA 1QF6A 3GGOA 1ZI8A 1RWPA 3FPEA 4FDLA 4JJKA 1A8PA 1VLMA 1PNVA 4QYWA 1ZMTA 4NPCA 2Q07A 3DE7X 4HNHA 2G25A 1A4IA 3K0FB 4KLAA 4Q34A 4XIJA 3WL8A 2W48A 1SC9A 3HADA 4TPKA 2H1OA 3G9ZA 1G5IA 1QKIA 3OWHA 2CLIB 3A1DA 4Z49A 2GVNA 1J8YF 4OREX 5I4IA 4D9BA 1XTBA 3OPXA 2YMPA 4U7HA 3IESA 4O2AF 4HMOA 5ILOA 3ETLA 4X65B 1VYTA 3T1QA 2A5FA 1CZ4A 5AKXA 4P3NA 3LGXA 5L3ZA 1CS0A 1LI7A 1N5DA 3ZS9A 1V16B 2I4OA 4ZVTA 1Y98A 2MJLA 3IHLA 4HBGA 4D2IA 3GVPA 2QJWA 5JSUA 2VYVA 3EH2A 3FYDA 3NG1A 2QB5A 3F49S 3SGLA 3QKRA 3SHWA 3SYTA 2I4MA 4YCNA 5CW2A 2Q1DX 1L4YA 2YXBA 3EAQA 3M9LA 1KI1A 2WSSA 4BATA 2PPVA 4C3OB 2I1QA 1JKIA 1UDRA 2IUFA 3FHLA 4QYXA 1Z26A 1B8NA 4YFVA 4M9QA 1Z3CA 3PQDA 2IZ1A 4J90A 3FI0A 3UFXB 1MQSA 2F4NA 3O75A 4O6VA 2W58A 3U5TA 2O2GA 4QECA 5T41A 1H2WA 1M67A 1DDIA 3LUKA 1QLWA 4DMFA 5FBHA 3GLVA 3T9CA 1RWQA 4BC0A 4IXTA 2C0CA 3PHLA 1GARA 1KK1A 4EUSA 4IJQA 4NYJQ 1SWVA 4L9SA 3DDOA 4PZZA 1ZUWA 1Z4IA 1DEOA 2ZS8A 3BXZA 1B8VA 1VPEA 2XUJA 5DSZA 4JXZA 1YS6A 3VJKA 1QIMA 1E5LA 1BHO1 2E2WA 4GOJA 4BMVA 4DUGD 1OTXA 5KTMA 2Q1CX 5IVIA 4UE6A 1QQ5A 1Q20A 5L6LB 2G6BA 1U0EA 2UZAA 3R41A 3F6YA 2ZJYA 2D3TA 3DTVD 1CCWA 1OSNA 1DUVG 1XJCA 1QHYA 1MT0A 2XITA 2QUBA 2Z3WA 3FHJA 1CSEE 1PQ4A 2PY6A 1PBTA 2ZVJA 3VHXB 1QM5A 2A86A 2Z4TA 3LQKA 5AO9A 4BZWA 1SIBE 1VI5A 1TK9A 3LBYA 2CDCA 3GYBA 1DC7A 4UEWA 1E64A 4BFVA 1OXKB 4JMPA 1VB5A 2V7QA 1SHJA 2A0KA 5KYUB 3N9IA 4MYSA 4PPQA 1GNQA 2WQ7A 1HT2E 4JI7B 1J56A 3FPJA 4DSOA 3ESAA 1VBNA 4X60A 1B1AA 4QM7A 3HBMA 3LGSA 1U0GA 4HH0A 3C3XA 4O3MA 1OASA 3ZHUA 5IBCA 3UO8B 4BNHA 4BEJA 1J7JA 4MHTA 4UU7A 4DSTA 2BUCA 1HL3A 4GU5A 2WD8A 3OHMA 4PPGA 5CM2Z 1G9XA 3EMBA 2RB4A 2RB5A 3BFPA 4B5KA 4YONB 3BXOA 3OBIA 4DLRA 4EGFA 4BKUA 3QWZA 3FYUB 4H08A 5JJ5A 1XZAA 1J33A 2FW6A 1RI3A 1KGSA 1Y3BE 1NNSA 3CWQA 4FR5A 3EC7A 5T3YA 2AFVA 3A0UA 4EYEA 2R44A 3IILA 3QKSA 3TZKA 3WSWA 1SHLA 3H0KA 3PUJA 1C4OA 4Y1RB 3HY3A 1CQWA 2IKQA 4NMMA 1KEEA 3E3AA 3WRYC 2GJ9A 3HR7A 4S1PA 3P4XA 1ZWKA 1BH6A 1PR5A 5AI6A 3P71T 1C0KA 1XFDA 4JENA 3KLOA 3ZY6A 1DB3A 1WZ2A 4LSWA 1I9CA 1L6RA 2F64A 2J3JA 5ESDA 2C4KA 4BVJA 4BWYA 1QSGA 2FDRA 4S1OA 4OI0A 4IGKA 3MN1A 2DU8A 2V0GA 4RNCA 4LI0A 2DRIA 1B3BA 4R4JA 4TUYA 1WUJS 5BV2P 3VOBA 3NYWA 4BJ3A 1P3Y1 2B6NA 2IYWA 2V6BA 5EMHA 1OXBB 1SUBA 1H0HA 1JDSA 3G8CA 4B80A 1EK2A 3MM4A 4LX8A 5BXYA 3VNSA 1QZ3A 1ORTA 1ETHA 1YBVA 4TMVA 2QQ5A 3KU1A 5AJXA 5IJAA 3NDPA 1L7MA 4PXYA 1RWKA 1KRWA 3AB3A 3CUVA 4OJMX 4ND8B 2D5IA 5K0NA 1EE9A 3ZX5A 3FVTA 4H27A 3NNDA 3GHHA 1EUDB 1UR5A 1ZXLA 3C8HA 3V1TC 4Y2UA 1ND6A 4CKEB 3R77A 2CYAA 2Q27A 1HKHA 4P3OA 1DWQA 1M1ZA 5JCXA 4P5PA 4JX9A 1IZ8A 1G6Q1 1VGRA 4Y6GB 4CQLB 2Q6VA 3W5CA 4N0QA 2VJLA 5B4UA 5KTRA 2R85A 1JG3A 1ZDMA 3JAWB 5A02A 5J2UA 3F6BX 2JARA 4YDSA 4TM7A 1EPUA 4Q7JB 4V03A 1M2VB 2OKGA 3HZRA 4BNFA 3TNLA 4RZUA 1YS2X 2IQ5A 1ZC1A 4KE6A 1CNEA 4BGVA 3SYRA 3WNCA 5KC9A 3GRRA 1PCXA 3L8MA 4EDFA 4D25A 4HFMA 3BTUA 1NXTA 3HHPA 2Q1TA 1G20E 1MDBA 2WZCA 2G71A 1RYMA 3BIXA 3CMCO 1W5EA 4HY3A 1E1CB 1C7ZA 4WDQA 1TQ2A 1Y42X 2I6FA 4QFCA 4Y6RA 3T7RA 2P91A 4C7BA 3BAFA 3I37X 2QLTA 1P0FA 3AU9A 5AOCA 2OSVA 4KU4A 2QSYA 2ODWA 2RH5A 1HH4A 4RD0A 3R7BA 3VOAA 1E9SA 3ANMA 4MUXA 4WPGA 2C3PA 5CVTA 1JP7A 3QKTA 2WF7A 4D57A 4YCSA 3RVKA 5IU6A 5KEIA 1ATZA 4XVQA 1LQUA 1B14A 4YN3A 3CUKA 1AK2A 1PNRA 3E7FA 2BF4A 2PX2A 3SBXA 4C2BA 5GVRA 2Q5HA 3ZNNA 2GO1A 4Q3EA 2X2OA 2HBQA 2NO9A 3PYXA 4ND1A 5A9TA 2BD0A 1ZONA 4DHEA 2HPZA 4PGHA 4O3FA 1H0SA 4DYDA 1T2AA 5F33A 5CCEA 2RKOA 4JXKA 4P2BA 2AG5A 2BMAA 3GDFA 3ZDAA 3PFCA 1PP4A 2ZITA 1CY1A 1FUYB 4CJXA 4E5KA 1DJMA 4PEVA 1NRIA 1O03A 5FPQA 5TGDA 1CLEA 4J8PA 2Q2OA 3TQOA 2PYZA 1T4CA 3UXEA 1QU2A 3SJBA 4GYJA 3VC2A 1SQFA 2A92A 2OHIA 2P41A 1TT7A 2CZCA 5BNZA 3ZI4A 5DTMA 3FOBA 2VO1A 3H8VA 3NXKA 4L5JA 2O3UA 1LDNA 2G63A 1S1MA 2OV8A 2ONZA 1MHPA 3HA7A 4DT1A 1PFQA 2AKYA 5JAMA 1E3QA 3M8KA 4XUEA 3WIDA 3WS7A 3OJLA 4QU9A 3IL2A 2KPOA 4CM7A 3O21A 5JFOA 1HFEL 2YFYA 2WVGA 1R4MB 3R24A 4EGSA 4RMNA 2JAXA 5EEHA 4TZTA 4FM9A 3M89A 5KAMA 1EVZA 3T0IA 5IWAB 1BSVA 1G8KA 3PCTA 4ZA2A 3U7RA 1ZD1A 1IBMB 5DHPA 4EKEA 4E09A 1II9A 3VPSA 2JLBA 1TM5E 4P98A 3ZH2A 1QRTA 3O82A 4JJFA 3S4YA 3P19A 5AM3A 3W3AD 4QYSA 1DOAA 5FO1A 4EMBA 3RI3A 4GMHA 1U3FA 5E3IA 1ISFA 2VP6A 4RABA 4F11A 3F97A 2O54A 1Y8QB 4RHUA 1TYAE 4TYMA 3A2NA 3PXBA 1KO7A 1CVRA 2G9VA 3EIHA 2P2YA 4JK3A 4X44A 2C9BA 4M21A 1FYDA 4KDLA 2EKPA 4BVBA 4RACA 4AVYA 4LF8B 2UXCB 5GJCA 3ULKA 1F8GA 4L8GA 2NQ8A 2ZVQX 1KP9A 3KQUA 4XI9A 2EIHA 1U8XX 1XV5A 2IYEA 4JBLA 3TLGB 3SHVA 2A4KA 2L19A 3FPSA 4MLDA 1L5NA 4Z54A 4YRCA 4NCKA 3U4DA 1DQZA 2QLMA 3JTEA 1VCNA 2JGJA 3LFUA 3UXYA 3W9SA 5IM4A 3IYLW 3SZ3A 2PX6A 5ALIA 5A4MS 3FMPB 4ND7A 1EIWA 2VF7A 4DUGA 3K70B 1DAOA 1KK0A 1UPAA 2Q49A 3KAPA 4N4AA 2O07A 1SG9A 4C0WA 4D41A 1ZIPA 2P1ZA 3DTVA 5CVCA 2WF5A 5F9FA 3HKDB 1EVLA 4V3BA 1AZWA 4Q05A 2HJRA 4RU1A 2PSDA 5JW6A 4YPVA 4MYRA 3KQNA 1VE9A 1B00A 2BR4A 2EP8A 1WX1A 2ORWA 4O4LB 2VIIA 2YQ5A 4L0QA 3ZS8A 5ALFA 4EKDA 2WT4A 4OSOA 2RGEA 4C06A 5GLFA 3P27A 4ZVOA 2HHLA 2WDPA 5FNVB 1Y9DA 1QRDA 4ZMSA 1UOOA 4KHZA 4MPRA 1G4HA 3VR4H 5IRCD 2ZZKA 4PE5B 4Q3DA 4YRAA 4M0DA 4N7BA 5TV2A 3H87A 3JALB 2JGRA 5TSDA 5F7XA 4CUKA 1F6WA 4JEHA 2JLQA 3QEMB 1T2VA 5JBNA 3HGMA 1J9EA 4QXRA 3SBOA 1XMIA 1E1LA 4PLCA 4WCFA 3W2TA 4C6HA 2AS0A 1U1DA 2PL9A 4URXR 3U61B 3LNTA 5AIBA 3E15A 3RS8A 4RM2A 3S29A 2PUCA 3TSZA 3PX7A 2X7HA 3NHAA 3EIFA 2RGAA 4IM7A 1JDPA 5EERA 5LQKA 1DWUA 1NSYA 5EIFA 4GKAA 2HNKA 2WUEA 1RLOA 2CBGA 4WY8A 1ZD2P 2H59A 2IHUA 5FHQA 4X1YA 4BO1A 1KK2A 1FVFA 3N8DA 3DMHA 2VHCA 2YIDA 3DBOB 3N8NA 1KAQA 4FVTA 1N2BA 3UPUA 1D2AA 1PFUA 2IYXA 2OHHA 2QSUA 2O7SA 4GYKA 4RAOA 4M9SA 3W2IA 3HQ4O 5EWLA 4WY5A 4WHMA 1MOZA 3BWEA 3DEAA 3GWZA 3N59A 3CPHA 2LCQA 3GGGA 3QLTA 3ZLVA 4DGQA 1D5CA 3NTVA 1DO0A 3QSGA 4QPNA 1W48A 4LJ8A 4CG0A 1I9GA 1R6VA 6Q21A 3KR2A 2EBUA 2J1LA 4QUKA 2PR2A 4DG8A 4BZPA 4WK4B 3HN2A 3AR7A 3DULA 5BR1A 1C3OB 4G07A 3GLGB 4EP1A 2CNKA 3GA7A 1N75A 1C4WA 1YCDA 5EP1A 4BNTA 3OTWA 4QICA 5B6PA 2JI6A 2IP1A 2NVWA 3EF0A 4F97A 2YH2A 3TZHA 3AESA 1X42A 2NZXA 4FDVA 3B6KA 2HZ7A 3I01M 4FCWA 4DR6B 3VOSA 3SC2B 4AN0A 1ZESA 1RM0A 3F3KA 1QRUA 3MT7A 3HA2A 3KFLA 2I78A 4JVMA 1X1CA 2E49A 2V98A 2FPSA 5C3MA 5IJ0A 5DHFA 4KYTA 5IDYA 3U3RA 5JNSA 2ZBQA 3RJZA 1KZ6A 5C51B 1HDIA 1IHDA 3TFOA 3SWWA 4G5YA 4RQBA 1RYNA 4CKWB 1UFOA 5BQ3A 2R86A 1RXCA 4E2ZA 3WZ2A 3ZJ4A 3THWA 3FVQA 2GJ4A 5D1NA 4JFAA 4L3OA 3DZCA 4XE5A 3EVBA 1O2DA 4HNGA 1NJGA 2C04A 1T3TA 1K63A 3EDOA 4I6EA 4M83A 2Z58A 4AF6A 2HQOA 5K8VA 4IP0A 2VDKB 1WU7A 1JIJA 2ACWA 3BB3A 2PX5A 3LSYA 3GCXA 1RD4A 1EA7A 3MTQA 2A6PA 4EFMA 1IUNA 4TOIA 1MV5A 3WYDA 3QQ7A 7ADHA 3JQ9A 4NIMA 1I4EB 3KLNA 3E1KA 2KYRA 1ZCJA 2QLJA 4KGXA 3AR4A 1I32A 2J33A 3KSRA 1EEHA 5AKIA 1EUCB 4P4UA 2CJFA 2GNPA 4EY6A 5IZCC 2O8NA 2B3DA 4NBTA 2VLIA 2E7ZA 4N3GA 2PKRA 3AYXB 3CWZA 2YYYA 2BE9A 4WINA 3ZTWA 1L7QA 2E48A 3QVUA 2ZYIA 2AC2A 1OTYA 1FMCA 2EZ9A 2F90A 2FZLA 2XT6A 3KYCB 1H9CA 2EIXA 1AHHA 3MTDA 3HWSA 1YVRA 5JQGB 3SNHA 3AKEA 2ALJA 2D1SA 2FY8A 1TTPB 3VPDA 4BQFA 821PA 2O19A 2B8TA 4KE9A 4Z0HO 1PQPA 2IHTA 3ZWCA 4YGYA 5BR8B 1X7ZB 2AE1A 4EBBA 2FV8A 5FUBA 4I1SA 4JB0A 3AERA 1C0LA 1X13A 3GFTA 3FPAA 2H1HA 1E3WB 2JS7A 5KQRA 4HBZA 1K86A 3ZGNA 3L4EA 1H2XA 1BXRB 2R7KA 3K9NA 4GICA 3WWDA 5B57C 2L69A 1SAYA 3ESCA 1DEKA 1I4OA 3MT8A 4QA9A 3HNPA 5H4HA 4J3JA 4ESHA 1H65A 3JVEA 4E33A 3BH7A 3EXFB 4U7JA 4K9MA 4C21A 4QU8A 4EKGA 5KWSA 2LIVA 3U7GA 3DEZA 4AF8A 1GAWA 2CLHB 4XPIB 1G16A 4HH4A 1T9GS 2DLNA 5AMXA 3EY4A 1DGQA 3NIWA 4CDMA 4OIFA 1AKYA 1SFRA 1E3TA 5CM9C 4WZBA 5K3CA 4LQLA 1E0SA 4PAOA 1NIJA 1Y1SA 3E2MA 3ZHYA 2OT3B 3EZ7A 3LV8A 1VE6A 3NBMA 5DN6D 1Y8RB 1NW3A 3LTNC 4AJ4A 2GN8A 2I4TA 3F3SA 3SHQA 4K26A 3VNQA 3TF5A 3OX4A 5IS2A 2HRDA 5FADA 2VJPA 4BVGA 4YRTA 1TKCA 3REFA 1AQJA 2QMOA 4QZVA 5TVKA 5JXGA 2GVDC 4MWTA 3IEPA 3JQPA 3H9GA 3KKZA 4X45A 5AXBA 1Z6TA 3S40A 1EFPB 4G01B 4EJMA 1HG0A 3KR9A 1P4RA 1SCDA 1Q0TA 1X3LA 4NDZA 3WDLA 4MDEA 1EUQA 2EX1A 2QTLA 4NMHA 2WJ4A 5TDHA 2GFAA 4QTZA 5E2IA 4YUYA 4UHHA 1WKCA 2BR5A 2HKIA 4ATNA 3S1AA 4RHFA 4BDSA 4DQUA 4K3UA 3GP8A 2VPXA 2P79A 1FNBA 1SOUA 2P75A 1P72A 4MQ4A 5EIBC 1ZA1A 5CW1A 3UWDA 2NACA 5J5AA 4BZQA 2BGWA 1X39A 5EP2A 4M37A 3SEQA 1T25A 2FK8A 5LB2A 1AC5A 1WD5A 4RIHA 1W1WA 4LHWA 1II8A 4ENWA 1ZRHA 2CK3D 4G84A 4EABA 4ZT3A 1KZ7B 2Y2UA 1K5PA 3DAGA 2WV9A 3LX4A 2ENUA 2A88A 1JKMA 5HDQA 5K3AA 4UTPA 3AILA 2QAJA 3ESBA 2Y9PB 2HMTA 3IGFA 5ALEA 4ZDKA 3CZQA 1SRRA 5DHQA 4P0PB 4TTQA 2HIMA 4QTUB 1W8DA 4QTXA 2DY1A 5D00A 1BJTA 4F3NA 1VECA 1M1NA 4M1TA 3SU8A 1I4WA 4DA6A 1ZOLA 4XWYA 2ZYGA 4OI2A 2ZVPX 1VMDA 4QIHA 5F2OA 2Q8QA 4HRVA 4NVRA 2I6UA 3UJNA 1PR2A 3F6SA 1UJNA 3D2LA 3DWEX 1CC1S 1OMOA 1PWHA 1UZAA 2QVGA 2HD4A 5J59A 3I30X 4CT4B 1TT5B 4G5HA 3ELBA 2JLZA 2ORYA 2C2YA 2WABA 1E58A 4HWTA 5AK0A 1NDHA 2W4IA 2QRQA 4B45A 1UKAA 2PT6A 3RC3A 2XNKA 3D8BA 3IEUA 1HETA 3AP2A 3U1VA 4LNAA 1JQ3A 1VDMA 3M6XA 1HYGA 3QQ8A 1Y48E 3NYQA 3QVTA 4CMIA 4J76A 4BUZA 1QV6A 1JJ7A 1XVUA 3HB1A 4BJ5A 3P96A 3CW8X 1LLQA 4HB4A 4BQIA 1PQUA 3IO5A 1DX4A 4O33A 5AVZA 1HTWA 4ROTA 4OYRA 1PUIA 4UULA 1Z18A 4W6ZA 3WQRA 4NWIA 2VATA 2HT1A 1ZKMA 1NJFA 4M4SA 3U7QA 1VMKA 3MC1A 4HDQB 1U1IA 2D59A 2E4XA 5IASA 2XUAA 2H63A 3UXMA 1P7VA 3EPPA 1CR4A 4M8SA 2CVFA 1UM8A 1FFGA 1Z0ZA 3FLEA 3NBYC 3GLRA 3MINA 3NTLA 4LZWA 5CT9A 1JQDA 3U4HA 3VPFA 4MVWA 4WFIA 5IFKA 2YJ3A 1VJRA 4IJUA 3IEKA 5J43A 2QK4A 2H4ZA 4LF5B 1NUQA 1WR8A 3BXGA 2WFMA 3SXUB 3T4EA 3UB4A 1X7WA 4RJKA 4ID3A 1PGJA 5F1KA 4AX4A 5IXJA 3DBHB 2DLDA 2J9ZB 2WVHA 4TUYF 3T1OA 1S2NA 2HDOA 2NSHA 2PSSA 4DEYA 3DUFB 5LMZA 2CYBA 1QBGA 1TU4A 5AJWA 3HCPA 4OX9B 3E35A 1CYEA 3KQYA 5A03A 2Y9MB 4DIEA 4UNQA 2ONKA 3G5TA 1H3FA 2ESRA 3C39A 2VAWA 2LW7A 3PC3A 1XQ6A 2BZ1A 1EE1A 1SXJE 3DC7A 4HMPA 4P5DA 4LYEA 2HCBA 2VT7A 4Q37A 3LUJA 3UKDA 3ETHA 4F93B 4CLOB 5KMGA 1G2PA 2UZ4A 3I12A 2Y1KA 2W6QA 3CN9A 4CV3A 2RGNA 3AUSA 3DVSX 3H0CA 2GZ2A 3N0WA 3L01A 1ZK0A 2VTBA 1FU8A 3R3WA 4PZ9A 4QUJA 2BSQA 4OI4A 4TV9B 3ZDYB 4G24A 1GDHA 1YVDA 5HSGA 3OQHA 4IUCS 2OXFA 3HI4A 2HDWA 1RQRA 3NDIA 4YQEA 1QGAA 5C31A 1E1RA 3TMKA 3WA6A 121PA 1J24A 4EHAA 4YMVA 1YONA 4YACA 2ZYRA 2IZ5A 5CT4A 5C8YF 2XBMA 4XRRA 1J0BA 1D2HA 2CB9A 3TJMA 4HNVA 4GNKA 1T4BA 1MNQA 1GPH1 3UENA 4Z51A 2EHJA 5KC8A 1PVOA 1BX0A 2BGRA 3A6JA 4XB1A 5A4IS 3M4NA 4QPZA 4HX2A 3SVLA 4B5LA 3I2YX 2FJPA 4TS3A 3WLFA 2FYTA 2PKQP 4R98A 4AZTA 4PYIA 3WP0A 5B36A 3H2HA 1XP8A 4UEQA 5KX5F 3IPCA 5B6CA 2B83A 1YUNA 3UATA 1TLLA 4NESA 4Q9DA 1VSUA 1JLHA 2YHAA 1VPTA 3Q2KA 1OWLA 4C0KA 1IUPA 1F0NA 2X42A 3KE8A 1YQEA 1B2LA 1Z5VA 2ZATA 2CXTA 3OA0A 1UJ5A 1Y1PA 3B1KA 4NU0A 5I48A 4EUNA 3SVZA 1NVFA 3IIJA 4P53A 2CXHA 3C8UA 1QTNA 3GLFB 4C2TA 4LC1A 3RS3A 4F7DA 3AEUA 3DP9A 8AT1A 5LOVA 4R1TA 3NHMA 4M0MA 4RPLA 5DASA 3GGDA 2VNSA 2ODNA 3HDHA 5CLGA 4PYQA 1Z6PA 2OBFA 2A1UA 2VNHA 3ZIDA 1OFUX 1XL0A 4B43A 1XT6A 2P7IA 2FKNA 4GOLD 3FH0A 4L85A 1CLUA 4AQ7A 3D0RA 3R8CA 1XTUA 1P29A 3O4GA 3QOFA 5M29A 2FPMA 2J6CA 3V4PB 1EHIA 2LDXA 2QYHA 4K6OA 1J0DA 2BEJA 1VDZA 1R0BA 2H54A 2XNDD 4Q82A 4RM3A 1RI1A 3OCCA 3R9WA 3DV9A 3GT7A 3SIPA 2QT9A 4QBIA 3GGSA 3ZDRA 5AM5A 5KI6A 3Q3GE 4D0NA 2I1LA 3S2IA 4DDKA 1ESEA 1F2TA 3OMLA 3TKAA 1PUJA 4P83A 4M6WB 4BRZA 5BV7A 2F1KA 4LMAA 1OGIA 2VQSA 2XNHA 4JT4A 1SUPA 2JAUA 2X6TA 3AM4A 4A1FA 4YRGA 5JPCA 3B7PA 1CU1A 1VLLA 1WBJB 2A5YB 4II3A 5K8JB 4B8ZA 3S8YA 3E8XA 2O8FB 1SG6A 4ENQA 4DLKA 3PC2A 1MJ5A 4KSBA 3B52X 4MQFA 2ZIAA 1EAYA 5K4GA 4LWZA 2HFJA 2YMMA 5F12A 4W5HA 1Z17A 1O58A 4NEHB 3RPEA 3KJEA 3UGQA 4MHOA 1ILEA 1BJRE 1L5YA 4CTOA 3W06A 4ONEA 4DLZA 1Y1LA 3RJMA 1HYQA 3WGKA 7AT1A 4AMYA 5IN5A 4FLEA 1X1AA 2BEVA 3RHFA 1E2KA 3HCDA 3O26A 1K6MA 1HT3A 1PLLA 2IXGA 3EF1A 4JU9A 3PLRA 4NU5A 1PNQA 4MRNA 1Z7BA 3ADPA 3BD7A 3QWAA 2WSMA 1M34B 1YC2A 3TR0A 4CWAA 4LZZA 1CUCA 2JIDA 3HKEA 3WGMA 2FPXA 4MAFA 3QA9A 1T5BA 4R41A 3PD1A 1NBMD 2GGSA 2H4XA 2J0SA 3A3PA 1U3VA 1YGPA 2J5XA 3HXKA 2L18A 3GW8A 5FI3A 3ICQB 3PC6A 2GXQA 2VT2A 4FFPA 1G9SA 4O1IA 1AO0A 1QYIA 3ASUA 2FX2A 2ZI4A 5IM4F 1Q0HA 1CY0A 3FMFA 3D0OA 4ZRMA 3DE3X 3QELA 2NZJA 2Q7DA 3RSOA 3VPBA 4OG2A 1NMYA 3OZIA 1UMCB 2WF9A 4B79A 4E11A 4FC6A 1MFZA 1ULAA 3HZHA 4O8ZA 5CDSA 4NP6A 1JDJA 1UBRS 2G08A 5DHTA 5FDFA 5HGJA 2R4QA 2YINC 3V48A 4RELA 3ZWWA 3PRKE 4D9MA 1T1GA 2OAP1 4ZYYA 2GHTA 2X8JB 3EARA 4XJVA 3FTFA 1TL7C 2L17A 3BF8A 3LKZA 3EX7C 3PXEA 2X3UA 3A2KA 3FMIA 3O9VA 3QVXA 5BSUA 1V37A 2WTNA 4A5SA 2NZWA 1VCOA 5JXIA 1VG9B 2CKDA 2GEKA 1YRLA 3C7DB 3WZLA 3FLBA 2BT4A 3NV7A 3AR2A 2WICA 1K6JA 2QL7A 1MC5A 1XU4A 2CEKA 3EQ7A 3PCRB 5CJPA 3K0SA 3E48A 5LXTA 1V5WA 3VH3A 7GPBA 1Q7RA 2XXBA 4BFYA 3BMNA 1EP9A 1RAIA 2RHCA 2QTHA 2WTAA 5EZ5A 3S27A 1VL1A 3WHPA 2I2BA 4FMBB 1MU0A 3HUDA 4LDPA 4MV4A 4QWWA 3HS3A 4WJKB 4C0XA 3LXXA 4OHBA 1UF9A 3RSZA 3WBJA 2DPLA 3A1CA 3B2QA 2J3IA 2NSLA 2X3FA 4DR4B 4LF9B 2NZVG 1US8A 3OM0A 5CFLA 2IOFA 3MWDB 3EXEA 2Z95A 1Y7TA 3C4JA 3X3HA 2ZYHA 3JVUA 5ALWA 2EWMA 3IQXA 3TL2A 3KT6A 5BURA 3AVYA 4QO8A 5F9MA 3SE7A 1YV9A 1CRWG 2PUBA 2BHNA 3P52A 3R8FA 4CFSA 1L7PA 2DBYA 5KYWA 5DNEA 1BGVA 3QOWA 1TJ3A 1FSSA 1OI2A 4R9NA 4ZOLF 1FS4A 3RUFA 2QUHA 1ODTC 2KJQA 4QGGA 1R8QA 1HBJA 1UMDA 1JAZA 3EODA 4RJ2A 4C7MA 4MHSA 2IJGX 5H8WA 4E30A 5FJJA 2AJCA 4LDRA 1YAHA 5A4JA 3BHNA 2PZAA 2IFTA 1B6SA 2ATVA 2R00C 3I04M 3K7EA 3QPCA 4OTZA 3JQAD 3HYCA 2M6LA 3TJRA 4C0AC 2PE5A 3U4MA 4XJSA 3CKMA 2NU9B 4HAXA 1NXWA 3MXTA 2IIBA 2ZIUB 3ONVA 4PXSA 3KJIA 4R0NA 2Q3LA 4ZOQI 1TW2A 4WDRA 3A14A 1K7EB 4D5GA 1V9SA 3DOFA 1I2AA 3S99A 5GVSA 2WAYA 1QYXA 4GOOD 4HNRA 4JB8A 3X0DA 1XPUA 2ICAA 4DV7B 2DT5A 3EPHA 2WZDA 3NI2A 3CCFA 2PUJA 4OB8A 1OI3A 4K8OA 3ENKA 3M4ZA 2P9BA 4C14A 1JQLB 4YR7A 4JV5B 2PR7A 4UFOA 3OCWA 3EIOA 3T9EA 5J4VA 3DEJA 2IV7A 2O8CA 3VGPA 5D6YA 2A78A 4NF2A 3EXAA 1PJCA 5L3QB 3KEGA 3U40A 5DRTA 2O0LA 2W70A 3TW6A 1QPGA 1HT0A 2VSQA 5CP8A 5DGDA 5A5DA 3AUJB 1CDOA 3T94A 2IOQA 3C97A 2AG8A 3C3BA 2O3RA 2IDJA 4OP3A 3F3YA 1PI3A 3R7AA 2X1MA 5ALHA 1CUZA 2SCUA 2YWEA 1DSSG 2Q62A 5B53A 2O8BB 1Q1QA 1TDJA 1G3MA 1BVUA 1PT8A 3L1VA 2TYSB 5C7OO 4HRXA 1A9ZA 5IBQA 3K53A 3D1JA 2GMWA 2GLTA 4G89A 1JF8A 5KJEA 3PE4A 3DZIA 1Z38A 3EPKA 1BDMA 3QHQA 2CHUA 5GZ6A 2EL7A 3FDZB 4O4HB 2LRHA 1AKNA 4UOEA 1JAIA 1YR2A 2PVSA 2C1XA 5G40A 3E4CA 1X7GA 2GZ1A 3NWJA 1FXWA 1E2DA 4OMDA 1M5RA 1U8AA 4RV0A 4WSOA 3WOHA 2XR1A 1XMPA 1MB0A 1T5SA 1YNSA 1W52X 2GK7A 4DMCA 1T10A 1XKQA 4WKGA 4DZZA 2JCXA 2BI7A 4AS1A 1P0CA 4WKPA 3N0TA 3C8ZA 1NONA 2QW8A 4JC5A 5FPHA 4YXWD 3CLSD 2HRZA 2XIQA 1H9AA 4PXAA 4BMSA 1CZOA 2Z4RA 4PHCA 2XRZA 4ZJUA 3HL4A 5EKDA 3HNRA 2ZIXA 2Y4NA 3MAJA 5DEIA 3WA7A 2DX7A 3SMQA 3G9UA 2C2ZA 1LPNA 2H5EA 3SF8A 2XNDA 1A2BA 1KYIA 3QENA 2K87A 1MOSA 2H0RA 1A0OA 2VBCA 4MVYA 2DETA 3HYTA 3T3GA 2LXNA 2E55A 1QHXA 3NB0A 5HXAA 4KYIB 1V5FA 4TRMA 5GOTA 2PD6A 4ZO7A 2C5AA 2DTXA 2YN2A 3FB4A 1ZUNB 3K32A 3UWMA 1AMOA 2AWOA 4U7TB 5JCOC 4QWMA 3C4QA 4IEEA 5BUQA 1RRCA 1A8UA 2CN1A 1NQXA 4EAAA 1WDTA 1G98A 1T4DA 4U2BA 1QIHA 1RPJA 1MIOA 1ZK4A 2P35A 3P9RA 5FTMA 4I5DA 1BHSA 3JYPA 1O57A 3OFVA 3CF0A 1MQAA 5IUJC 4BWVA 4LGVA 5CK4A 3IAEA 3L5OA 4IMRA 4JLVA 4OBWA 4A8HA 1EBFA 5DXJA 1Z4MA 3GRUA 1Z9BA 1N6LA 1Y34E 3I39X 2X0EA 3HE3A 3BJIC 2P9HA 3N74A 4X1OA 3ZC3A 2AUTA 3Q88A 2ZG6A 3ESXA 4I1IA 3VR3A 3TW4A 3W9YA 1CYDA 1IXKA 4UHDA 4OHFA 5C1OA 5TXGA 2SKCA 4B3CA 2QJOA 4ZVKA 1NBMA 2UKDA 4K05A 5L95A 1QYDA 3IKMB 1M6VB 1RWBA 1V1RA 4IIJB 4P34A 4OLHA 4Q7MB 4UQLA 2EF0A 2HJVA 3E05A 3MRTA 4WH0A 3DO8A 1Y4SA 5CX4A 1XZ8A 2WAXA 3PENA 1KTVA 4PFSA 4BNJA 2H52A 2DKNA 1L5HB 1OF1A 2RI1A 3DLCA 4UHBA 3EISA 5TARA 3MJSA 2DXIA 3FDJA 1IQUA 2XUDA 3O92A 2NTNA 4DWVA 4UHKA 5IBRA 1Q7BA 1ISJA 3BKXA 2YW2A 5K2MA 3G0HA 3TRDA 1OC4A 5A62A 1D0VA 1O9HA 1A3CA 3N75A 3H17A 4G86A 1LW6E 4P7BA 2X1LA 4FE7A 3TW8B 5DOVA 1GPKA 2H65A 2NO5A 1JI0A 5K0ZA 5LL6P 1XVVA 2PS3A 4MKIA 5I9MA 3JWPA 4H15A 2R6HA 1LRLA 1Y9EA 2XKAA 2YHIB 2GAJA 1A2KC 2JBAB 1KEPA 4UM5A 2OGZA 3C43A 3GRPA 3REOA 4Z0PA 4KMMA 1DBQA 1VGQA 2NYRA 4ZQFA 3S7TA 1W85A 5CDTA 5JROA 2E37A 5EPOA 3ND6A 2GAOA 3U1TA 3G2OA 5F1YA 1G19A 1N2IA 4AROA 3RH0A 3IAHA 4Z4CA 1BQEA 3PEEA 3QG1A 4ZEVA 1UQRA 4N5DA 4D44A 1M0TA 1PO7A 1QJ4A 2X0DA 5BMVA 4LW8A 4TSKA 3KWLA 2NZ2A 1HEUA 3A6DA 4ZDJA 1D6SA 2XOEA 4M22A 2ZYSA 3S2ZA 1TTQB 4FLMA 4MGIR 4EGAA 1YR8A 5BWCA 1TQDA 3DF9A 1QZZA 4J7AA 4EDHA 2B1JA 3FHOA 2B61A 2OCLA 2AEJA 1TYZA 1XEXB 4JLPA 2DERA 3MS4A 3EZNA 3MIIA 1QTQA 4P84A 1GDDA 2XIJA 5BV0A 1NWHA 2ZBRA 3UKJA 1TCAA 2XGSA 2XWSA 2QQFA 3IP7A 3KJHA 1UKZA 3IUEA 4UCQA 2IC5A 4M2LA 1PVDA 3FUXA 1CUDA 5BPHA 2C58A 2W5UA 1D8TA 3WK7A 1ISGA 5D6OA 4MEBA 2JJ1D 1XDGA 1OV4A 3DL2A 2VZLA 5JMOA 1NU6A 1X3SA 7ABPA 1JXQA 1JSZA 2SHKA 1YBAA 1Z39A 2QTRA 3OWXA 4HOYA 3JQAA 1QVWA 1KEZA 3H4VA 3SZUA 1XLTA 1VLHA 1DWPA 1BVYF 5C1BA 1Q84A 1S4MA 1RZVA 1TEVA 3H04A 1FFXA 3NCTA 3N5KA 4X8HA 4BEVA 4I4CA 4AQYB 2GM5A 1IHPA 3V1YA 3WLEA 1TVKB 3WAGA 2XKJE 1Z7GA 3KQKA 1I36A 3AJRA 4YP5A 5J2TA 2B6HA 4NZNA 3PKZA 3RT1A 1E9DA 1SQSA 4ZPJA 2OOSA 5TGTA 3R74A 2GDZA 2OQ2A 2QN9A 1EGMB 1K8RA 1WSWA 1H1LB 1YRBA 1GGVA 2FG7C 2W6IA 2RG7A 1FK8A 1ORVA 3F9IA 4OEHA 5JNUA 1XLVA 2DFVA 3SCZA 1MIHA 2HQ1A 3OZXA 2NO1A 1TA9A 3FKQA 5I9BA 5JLAA 4ZJYA 1ZPDA 5U1PA 3ZW9A 1V48A 3PR3A 2ETXA 2LZ0A 4ZOCA 3RIXA 2SICE 1Y9ZA 1I01A 2IUEA 3SXJA 5EJIA 4LXXA 4FW8A 4L72A 2BBOA 2PANA 4TQAA 3DZHA 1QGOA 4RD3A 3OJFA 5DHUA 3AUUA 4PGFA 5AK4A 1M2FA 1Z62A 1YQ9A 4PLPA 3AEQA 3E22A 1CB7A 4JJ6A 1W36C 4M1SA 8OHMA 5AVVA 1D4FA 5U4QA 1ZH6A 2OO3A 2LTAA 2MYUA 2X9QA 3NYIA 2V6JA 3U4QA 3CRQA 2HWXA 3MWEB 3QWIA 1UEIA 2QI9C 3D7LA 1TIBA 3HPQA 2C9ZA 1SELA 3BWBA 3HR4A 3PYMA 2I2FA 4BZZA 5LUAA 1C41A 2KS6A 3DXFA 4NLLA 2GN1A 1RKBA 3IJPA 4ZI3A 4ZQEA 3PDJA 1TM4E 1DE0A 4EPWA 2YC2C 3CLVA 3DOCA 4NS4A 4K9KA 3SFZA 4NJEB 4YJDA 1DEHA 1Z0DA 4JNCA 4WBXC 4EHLA 3GGJA 2C8JA 2D0IA 1WZNA 4WFJA 1TMYA 2B7BA 4XGNA 3HHEA 4B09A 3M6UA 3G2JA 1N0HA 3B53X 4HVLA 4Q9JA 4PX9A 2YRXA 4LRTB 2EWWA 2VUTA 4UPDA 4Z9AA 2ZSJA 221PA 1NQUA 3LLVA 1A8SA 2E4YA 3OAAA 4V0SA 5IH3A 4MPDA 3RT7A 4KMRA 2HW8A 4IIBA 2I03A 3OTGA 2A7QA 4I1RA 1FJXA 1F3OA 3WBBA 2KHZA 3M7IA 2GEFA 4NKRA 2J0UB 2AVDA 3ND7A 2WIFA 4KCGA 4EMTA 5JVDA 5D7NA 1ONPA 4EI8A 3I9V6 1J0CA 3BMQB 3DKRA 1E6CA 3ZU4A 3MHTA 4IEFB 2Q99A 5DLQC 5KSWB 5TPZD 3KS9A 2D4AA 3CTMA 3M2TA 2QPTA 3T3DA 4UU8A 3R3SA 4MB2A 4LDZA 3ZKWA 1GG5A 3T9BA 2FR8C 2UDPA 1YRQA 3CZCA 4GWLA 3TSOA 1B73A 1A7JA 3WMXA 3UT5B 4XIYA 1BCSB 4I55B 3LRPA 2BF7A 5AW2A 2HY7A 1ECGA 2IF0A 5TPWB 3TQSA 3CW9A 4FMCB 4LJLA 5TEWA 3W77A 4ACAA 4AQDA 3PVCA 2RK3A 4QT4A 3NDRA 3OLQA 3ONDA 3GG2A 4BLUA 3CIFA 3TAHA 1V8ZA 1QCDA 4A0QA 4WKBA 3NT2A 4DBVO 1GU1A 4WVFA 4A27A 1NTRA 3EOZA 3E5MA 2ORED 4QATA 2D4HA 4PZUA 1HOXA 5JMPA 3WKAA 4ZCQA 1YZUA 3F0TA 3HFGA 1EAMA 2AXEA 3KV1A 3VO8A 1ETUA 1H6AA 4CIYA 3PEWA 1EFDN 4N41A 3LUCA 2QTBA 4K9SA 3A1SA 4F4CA 1ZN2A 5JHGB 1QP0A 4UAGA 1Y33E 2QL6A 3LL4A 3KD3A 4I50B 4IUDS 4KACA 1ZNYA 1NVEA 3K6SA 4MH0R 3AHJA 1XCJA 1QYWA 2B4RO 2E5WA 1EXMA 4P7JA 4UNRA 5BQPA 1SC3A 3AU8A 4OF4A 5KZMB 3PNOA 1JQEA 1U8TA 1ZITA 1RLUA 3NVKI 1DIHA 1ZX1A 2WKSA 4P3KA 1CRZA 1NVMB 1U1CA 2BTQA 2ZRJA 3EG9B 3GOQA 4NBRA 5ESWA 1YRAA 3FI9A 3CLRD 3Q5DA 1G55A 1EVJA 4BO4A 2ZRLA 1J2JA 1QYRA 1BMFD 6REQA 2ZBGA 2DBZA 4D56A 3DBRB 3TIWA 2Z04A 1JDBC 3GNTA 5IC6A 3RVSA 1TIPA 3TZCA 4TS9A 4LTMA 2HYDA 4EHIA 3AZOA 4B44A 3AF6A 2KY9A 1AZSC 3AVOA 1P8AA 1GCOA 3L2OB 3EXG1 2E0IA 1GY8A 2ZBPA 3O9MA 4B3BA 3ILSA 4ER3A 2WHQA 4EG1A 4X3OA 2HEIA 3PG5A 4DIKA 2IEYA 1XTPA 2TMKA 3BIOA 4MR8A 3O73A 4PTLA 3LLUA 4IS2A 4FXPA 1TZBA 5LXTF 4B4DA 4J29A 5EKXA 1AXRA 1E0AA 3KEMA 3KXLA 1N4DA 1U8YA 2WJJA 1O3YA 3ETEA 1Z29A 4GLOA 4RV9A 1R9GA 3F1LA 4FEEA 1M75A 2WM9B 1U3WA 1DL5A 1PR9A 1INLA 1JYSA 2ZFUA 1LV7A 2UXBB 2EXXA 1VG8A 4U9HS 2WFAA 2YKGA 5CJJA 2Q5OA 2YX1A 4LRWA 1XVLA 1IXRC 2CXNA 3WLOA 4DG5A 5DGTA 1ISMA 4A15A 2IYUA 2XZDA 3EXHA 4DKJA 4DCOA 1R3DA 2G67A 3LT1A 5EG5A 4TYWA 3L9XA 4RGVA 3GJ5A 4OXKA 1NJSA 1LV8A 1JZSA 3UGTA 2QROA 2HUPA 4GUDA 2UU9B 1EBBA 3T34A 2BCGY 3U9LA 1Z5OA 5THXA 1B8UA 4KR0A 3WWZA 1PS0A 2BP7B 2HNBA 3H05A 1PT5A 1XKLA 2AHOA 3V4RA 5FOUA 1FS5A 3IE2A 4G6ZA 4TKUA 4Q1CA 1PV4A 4C4PA 4DB2A 3P4UA 4UUMA 2JJ1A 3NVDA 4MVJP 1WLFA 3L0BA 4F9EA 1ESNA 2B98A 2CVOA 3DNPA 3A1FA 3L0DA 1A50B 1F7VA 5PNTA 4QARA 5IUKC 4IXDA 5FT9A 4E08A 1IY2A 2NVUB 4TTPA 3W1EA 1U6KA 3OQ1A 1XQXA