3MBEA

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
184
structure length
184
Chain Sequence
DIEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 184
sequence length 184
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3mbeA01
5HHQB 2CO7B 4WFFE 4KQ4L 2GT9A 1U8IA 1XEDA 3ZTJH 1JTPA 1S7TA 3WN5A 2EE6A 5DHVH 2OX5A 4LMQI 4CBPA 1IAKB 5HHVL 4ODHH 3SDAB 1KG0A 3ARGB 2BMKB 4KTDL 4ZO7A 1G6RH 4H26B 5BJTB 5MEPA 4R7NB 4Y2DC 1UKQA 1NC4A 2DQTL 2RJMA 4DN4H 2CXKA 4U2YA 4NKIH 3CJJA 5IUSA 4QHKJ 5I1KH 2OZ4L 3HMWL 4XB8A 3RNKA 1U92A 4HCRL 1G1CA 4HWBH 4MAYD 4MCYB 3RRQA 5H37H 5EIVA 5D7KD 4EI6B 1RUML 4WFED 4E41D 5DJ0A 1FFQA 2B1AL 3ESVF 5FV2A 4LCUB 3CFEA 2D7QA 3MLXL 1OWWA 3QUYA 4YAQA 5B3JF 3HC0B 4ALAH 4I0PA 1N3NA 4XAWL 3WUZA 3WNMA 5ACLA 3V5DA 5HYSB 4FQ1L 4XHJD 3BUTA 3D3VE 3A6CH 2J88H 3LEVL 2B20A 4GMTH 2XZAL 3MXVL 1IC5L 5GGUA 1IKNC 5FYJU 4IRSD 4UNVA 1BREA 2EDEA 2E6PA 3CAFA 1NBVH 5CGTA 4PJDE 4YEEA 3K81A 4QHMA 2IH3B 4R2GC 1I7RA 1QO3A 5FUZH 4YFLF 3LHPH 4I2XA 4M7LL 2VL5A 1RFDH 2B5IB 5J57B 4PR5A 2J6EL 5E4EC 4RNRB 1QRNE 2QBWA 1JZ3A 1U8OB 4HZLA 3VH8B 1T1YA 1YEDA 5I66A 5GRVL 5C0DB 2FATH 1SJHA 5JW3H 1BWMA 4XRCB 3DMMD 3O6KL 3OG4B 4O2EB 3OXSA 1H3TA 5F71A 3HI1A 4XC3H 3ZTNL 1LP9B 2BSTB 4RIRB 3ULVH 4P3CH 3WFEH 3OXRB 4XTRC 4ZAKC 3CDCA 2YUWA 2HT2D 3BE1L 1NMAH 1T20B 4ODUB 4OF8A 3S37H 3MO1B 5BRZD 1MF2L 4FQJH 4Z7QF 5IEHA 4U05A 3QA3A 2HRLA 1OF2A 3TBYA 3DVNB 4PGZA 3SPVB 2AJSL 1MCIA 2IANA 4YZFF 2C3GA 1LDPH 4FN0A 2YPLB 4P2QD 3JV4A 1NGWB 1EHAA 2Q76B 4CKVX 5F9WB 1NDMB 2EDFA 4JFYB 4HKJA 3DXAA 4JKMA 3ARBC 2DBLH 2L7JA 1C12A 3IDXH 4NJ9L 2W65B 5EU7E 2YUXA 3BZFA 1F4YL 1WEJL 1INQA 1KULA 1BQSA 4TSBH 5IB3A 1R5WA 4CNIA 1CR9L 2HFGL 1U93B 1ND0B 4AY0A 2VQ1B 5E70A 2N56A 4YFLI 25C8H 2GT9B 3GRWH 1S7TB 3PWVA 3WN5B 5C0EB 4DGVH 3OR7B 2P5WB 4JY5L 4PBVC 4XAKE 1YQVH 4P4KC 3SCMD 1MFEL 4N0CD 3QUXD 4XPBL 1UM4L 5JDSA 5T5FH 3C09B 2EDDA 5MEPB 1H3VA 1AXSA 1T3FA 4TUOA 2IPTH 3QO0B 5J6HA 5FO9B 1VPOL 1RZ7L 5B39G 5M7QA 1FV1B 2X2YA 2KH2B 4FFWD 1TCMA 2VL4A 5H2BA 5H37G 4L3EA 3ARRA 4TVPH 1J18A 2XPGA 4K7FA 3ARZA 3QCVH 3SE4C 4G3YH 3W11D 5E6IA 5FA3A 1LO4H 2YK1H 1UZ6F 1DBAL 2B4CH 4FOMA 1XF3B 1UM6H 3B9KA 1JNLL 3H7LA 2IAMD 3QUYB 5M94B 4I0PB 1N3NB 2BFVH 3V5KA 1KTKE 1TFHA 3V5DB 3RUGF 4F37F 1BVLA 2UZXB 4O58L 4NPYB 2F15A 3S36L 5C2BL 1HHGA 4LLQA 5KW9L 2VITB 1LEGA 3VXMD 1MLBA 3ZL4H 4K3HA 1LEKB 2B2XL 3CFBB 5INDA 3MNZA 1EAPA 4L9LA 2GEEA 2AJXH 4GAFB 1QBMH 1YEEH 2XT1B 5IR1B 1RZJL 4ZFOB 5GS0C 1UENA 1JGVH 4I8DA 1QD0A 1T22B 2YD6A 3ZSSA 2EXYD 4I2XB 3EFDL 5D2NC 3T65B 4PR5B 4QOKA 2AK4D 4LSUL 5D1XD 3NA9L 4BQ9A 4OBRA 1K2DA 2FX7H 5FGRA 1SJHB 4LSQH 5D5MA 4M1DH 1H8OA 2EDTA 1LP9E 2VUYA 2Z31B 4K8RL 3OXSB 1I1YA 1G7HB 3HI1B 3LMJH 4N5ED 2P45B 2CRIA 1AD9A 2VLJD 5CSGA 3OKKA 1KCSH 1CFSB 4HJ0D 4AM0B 1CZ8H 5GJSH 5EG6C 4YHLL 1I3VA 5C09A 4APQC 2XN9B 4XNXH 1QKZH 1JPSL 1OB1A 3BIBX 3BPLC 3TP4A 5DJDB 4W6WB 5IEHB 2X6MA 3RVWC 5IROA 4ZTOH 3QA3B 3WKNA 4A6YH 3OWEA 1OF2B 3HZVB 5B4MD 3DOSA 5IMLA 2QEJA 4OT1H 3DVGB 2YPLE 2IANB 3NCMA 4XMPL 3GBMH 3WLBA 3D85D 3RDTC 3L3OA 1DQDH 1A4KB 3OAYK 4UU9A 5IB2A 1A6TA 4P2CG 4OQTA 5B8CB 2H32B 1G7MA 1HH6A 3QDAA 1AFVL 1CGTA 1IC4L 1P9MA 4YX2H 5JA9A 3K7UA 4AK1A 2YOCA 2JCCB 5H94B 4LPYA 4WO4C 4JM2A 3MNVA 1INQB 5IB3B 2YR3A 4LNVA 3UTSA 3B9AA 1BZ7A 2X4PA 3SHSA 4X6FA 4TNVF 3LEXA 4HHAB 3SDCC 1U41A 1B3JA 1HN1A 5TH2A 4WNQA 2DLGA 2R9HC 2P5WE 2D7NA 3MMEB 3PWVB 2VSDA 1RZFH 3BKCL 4KKCD 5B38G 4GW4A 5CD3B 4UINL 1QOKA 5JDSB 1UCBL 3FAXA 4QRQA 1AXSB 1T3FB 4YDIL 4K7PY 3ULVC 2GI7A 1CLZH 3EO0A 4BFBD 1XR8B 5EN2A 1SVZA 2ESVD 1EERB 5EA0H 5H2BB 1CXLA 4L3EB 2A74B 1T7VA 1R3LB 2XNAA 4KJYB 5GSRB 1MCNA 5BV7L 2XPGB 3D18A 5LCVH 5I1CH 4MMZC 5HGDA 4N1HB 3TLRA 4G6MH 3D2UD 4WU5B 3I3DA 4Y5VC 5FA3B 35C8H 1P2CB 4C54A 5SWSA 3L1OH 4XNUL 2VZTA 3IFNL 3BXNA 4OM1H 4OCWL 3B9KB 3HR5A 4UDUB 3IJSA 3SQOH 1G7PA 2G75A 1FRGL 4RMRA 5LKNA 4FS0A 5EUOF 3PDGA 2JB5L 2P24A 4JKWA 1HHGB 4LLQB 4QXUH 4JPVH 1LVEA 4HDIB 1MLBB 1NH6A 4L4TA 1NSNH 1CIUA 1EAPB 5LGHH 1DBKH 4L8BA 4FFZH 5ICYB 1HIML 5JO5A 3E6FA 3M1BB 5DURD 2DM4A 4HWEH 2I60L 5GGTL 1TJIL 4I2XE 3MLPA 3GUTA 3QIBD 4P9ML 3ALWA 3HI6L 2P8LB 3MA7A 4IRJC 3QUZC 5C7XL 1R0AH 3J7HA 3KJ6L 3ZDYE 2NPLX 4PY8I 1D3CA 1OP3K 1JHLH 1BAFL 3D0VA 2C9AA 1K2DB 5DDHA 3GSNL 5KZCB 1U6AL 5C0CB 3REVA 4XPHL 5EO1A 3WNPA 2P5EA 1Q38A 4BQBA 3MLUH 5J12C 1I1YB 2NY0C 1KIRA 2N4IA 4JFXB 2R15A 4C83A 2YA2A 3CIQA 5KSAD 5C2UB 1KN2H 3EOYG 1F90L 1UA6H 2XN9E 2PYEB 2Q8AH 4FQXD 5C09B 2R4SL 4Z5RB 4PJXB 4ODVL 4MGXA 5BVJB 3KYOA 4U6XB 4Y2DD 3RJQB 4XXDB 5E8NA 2IANE 4L8DB 1OVZA 4PJCF 1NJ9A 1T6WA 1A6ZA 1T5XA 3P0YL 1D9KC 2B4CC 3L3OB 2ENYA 4UU9B 2BVPB 2K7PA 2VXSH 4D8PA 5KTEL 3QPXL 1I8MB 1I8IA 1TPXC 1MNUH 4NQXA 2Y5TA 1MRFH 2K3TA 2JCCE 3EGSA 2GW5A 3B9VA 1KENH 4ZXBC 2F58H 4L29A 2ADFH 2EIDA 1TQCB 1OQXA 1RJLA 4H20H 2IPUK 3OPZH 4JM2B 4XPGL 1FGNH 3GSWA 3MNVB 4M7KH 1TZHA 1EZVY 3U1SL 1YPZB 3NFNB 3SE9H 3ARFD 4XP4H 4MJ2A 1MIML 4N8VA 3UTSB 4J8RA 1BZ7B 1RVFH 4LARL 3LEXB 1Z9SA 1LHZA 4LRIA 4RFOL 5TH2B 4FXGA 4WNQB 5EIQA 1ES0A 4HC1L 4R2GD 1U8KB 4JM4H 5DC9B 4Y5XA 2JB6A 3AVEA 3L9RB 2W0FB 4NQVA 3CDGA 2HG5B 2WQ8A 2FWOA 2FO4A 2PO6C 4QRQB 4X8JA 5CKGA 2ZZUT 4BKLA 5CIPA 4PLKD 5IB4A 3EO0B 3FO1B 5DD0H 15C8H 3BO8B 3ELAT 4PY7A 3QWOA 4JN1H 3BZDA 2AJZA 3CLEL 4RDQF 1U3HD 2D7TH 2OR8A 5HGDB 5IB5B 3UTPE 3Q6FA 5I19H 1BX2A 4ZAKD 4ENED 5GGQH 3LQZB 2BNQD 3BRGC 1BJ1J 3HZKB 1UWEL 1JGLL 5FUOL 5SWSB 5CJXA 1XH3A 3Q6GH 1ZHLB 2YD5A 5E8DH 3CLFH 5E4IA 4N0YL 1REIA 4JKPL 3IJSB 4NKOB 3FOLB 3QIWD 4G7VL 2G75B 3F58L 3T0ED 2FCBA 5GJTL 3O9WA 2NY4B 4LDOB 4LLMA 5ITFB 4HLJA 1TJHH 1KPUA 1OAXH 3WMSA 4L4TB 4HK3J 2DIBA 3LSOB 3CDYA 5TQ0L 1S78C 3S4SG 3SDXF 4L8BB 1VEOA 4PTUA 4O2CB 1EUTA 3E6FB 1VKXA 4IM8A 4G9DA 1XAUA 3O6LH 3HC4L 4ODSL 3SDDB 5EU6A 4OLXL 1ORSB 3MLTA 2O5YH 1T7WA 3CC5B 3BRFA 5JPNA 5CZKA 4QHKI 2YSSB 4L1DA 1BFVH 1LO3L 1IGYA 3H9SD 3WIIL 4QT5A 4KROC 5C0CE 3D0VB 2EYTB 3PHOA 4WI2A 4NOBA 3BH8A 3RX5A 5F7YC 1OT2A 3WO4C 3REVB 5EO1B 4R90L 5I8CA 2P5EB 2J4WH 4C83B 2F74A 5I16B 4X6DF 1C5DA 3RGVA 2PYEE 4FP8L 4PRBB 1JPGA 1BLNB 4NCC2 4PJXE 5JXED 1MSPA 3AMKA 5FYJD 3HNVL 2H3NA 4LVNB 1NMBL 1QBLH 4NZUL 3MZGB 4CU7A 3FO0L 5C0BB 3RVTD 1EMTL 5GRWA 3DSFH 1CL7L 2CUMA 3IKCB 3TNMA 4XNYL 3MODL 4D8PB 1MFCL 2V9RA 1J1OL 4PJ9A 4K7PL 4X4MA 3DBXB 4NQXB 5FYKL 3AAZA 3RWIA 2Y5TB 5JORA 2J1KA 3IDYC 4YK4C 4L29B 1CS6A 5JPMA 4HBCL 1JTOA 1YPZE 4QHLB 2F9BT 4OGXH 4PJFB 4NZRH 1UWGL 5ACMA 3VFGL 3UTSE 3L3JA 2SEBA 1V3JA 5DMJB 4N8VB 2YD1A 4J8RB 5J1TC 3HI5H 3QZWA 1N5AB 4KMQA 5EFIA 4H5SB 4M02A 5GZOD 3PV6B 4FXGB 1TQBC 2DJSA 3QDHA 1BZQK 5C07B 3VFPA 5JTWA 3GGWA 1CVRA 5CLTA 5GS0D 3BDBA 4Y5XB 1MQ8A 3CVHB 1A9BB 2FNBA 4NHCH 3ET9F 4NQVB 4H0IA 3CDGB 1HINH 2I07B 2FO4B 2KKQA 3TA3A 1S7SA 2ZUWA 3GMLB 5CIPB 5MEQB 2OTUA 1CT8A 2M2DA 1DP0A 3VE0B 4PY7B 1ORQA 4UUJA 3N1QC 2AKRA 3ZO0A 3U6RB 5T3ZH 2Q8BL 3S35L 2AW2A 3MXWH 3Q6FB 2EEAA 3V4PL 4M62L 3N9GL 5SWSE 3UX9B 3THML 4APQD 5FUCE 4NQDA 3LY6A 4JG1H 1JK8B 2AK1L 1FVDA 2XV6B 3C60A 4OI8A 3RVWD 2FYYA 1MRDH 4OUUA 1A02N 2DDQL 3PQYD 1X5AA 3M17B 3MV9D 3WNNA 1UQSA 3O9WB 4LLMB 5J89A 1JGDB 1TCRA 1UVQA 4JRXD 2XICA 4Y16A 4CRPA 1KFAH 3S88H 3B5HA 2QTEA 3NIDE 3FONB 3O2VL 4PTUB 4CW1A 4EN3D 1DQQA 1VKXB 3QFJA 1GGIH 1CU4H 4G9DB 2A73A 4TRPH 4K2UL 5EU6B 3T3PE 1J8HD 4X5XA 1FFRA 2WMPA 5ISZD 5GGRY 1IGYB 4GRLD 5E8PA 1F2XK 3PHOB 3SBWA 1S5IH 1QHOA 1A3QA 5KANG 5T1MA 3TV3H 2BCKA 5KSBA 5T5NG 2Q3AA 5I8CB 2R9HD 4F2MB 3V0VA 1OGAD 2F74B 5A16A 3O6MH 5DVMA 3ARQA 3OJDA 4NN7B 4WFFD 4BSWB 3MRNB 5I8EA 2IALA 4QKXB 3CZFB 1FJ1A 3H0TA 4AEIH 1RZGB 1S7RB 5JOPE 2ZG3A 4HXAL 5CEZE 3QEGL 5C0BE 4MA8L 3QPQD 4NFDA 2VDRH 5EZOH 3SY0B 2BP3A 3BD4A 5DQ9A 5SV4A 1PGRB 1T1XA 2QHLA 3TNMB 5BOZG 5E2TH 3D39A 3PP4L 3ZT6A 4P23C 1ACYH 5EZIL 1KJVB 4YBLC 1YEJL 3L3IB 3RA7L 2GK0A 2XKUA 5AYUH 1NC2A 5HVHB 2OL3H 1RIVL 3AAZB 4KDVA 3VRJA 5JORB 5HDQL 1Y6NR 1YEFL 4YFEA 1YECL 4JO1L 2BY0A 2NY5C 4PJFE 5J9PA 2R56L 3WD5L 4DOHB 5F9JA 3C5JA 4NQCB 5IVZA 2SEBB 3BP4A 1WGOA 2XY1A 3SKMA 2IF7A 1E4XH 5CZXC 1J7VR 2NLJA 2XA3A 3C2AL 4AEHH 5D7IB 2AGJH 4HS3A 3IGAB 5F7WC 2OI9B 1HSBA 3PGDA 1W72L 3C08H 2WBJA 5C07E 3HNTL 4GG6A 2XA8H 3QYCA 1GC1L 4LPCA 3VFPB 3BDYL 4JO4H 3GGWB 1P4BL 1HYRC 1YEHL 3ULVF 3NCBB 3VGDA 4FQPA 4IRJD 3CXDH 4LQFL 2ZUUA 5GISH 3VMOA 4JHBA 3TA3B 3MRFB 3NFSH 1S7SB 1JFQH 4HIXL 3O8XD 3RTQD 1CT8B 1AI1H 4U6VL 1QRND 2VMFA 1MI5A 2CH8A 4UUJB 4DEPC 1TXKA 1HXYB 3WKMH 3KPMA 1ZWIA 2AKRB 3BT2L 4O51A 3PWPE 4JFHD 3DROB 3TCXA 1NCAL 3MRCA 4GQ9H 3QT2A 4ZMAT 4PJAA 4ONHB 3UTZB 2DTML 4HLZH 4NQDB 1AGFB 3WNKA 4EQ2A 5E6IC 4QRPD 2R29L 1BFOB 5E94A 5D7JC 1FSKC 3PABA 3UPCA 4K23L 3ROOB 2O93L 4R3SB 3PL6D 4PRIA 3TBWB 4RMSA 2NR6D 4WVRA 3UYPA 4OM0L 5EBWB 1D9KD 2AV1A 2I5YL 4MZ2A 4Y19A 2W38A 1CGYA 3NPSB 5DGQA 5HGHA 5IJVB 1TCRB 4Y16B 5FECB 1M71A 4XXCA 3E8UH 1JRHH 5DLMH 3I75A 5DQDH 4NNPL 1NBYA 4KZEL 4L9LC 4PS4L 3R8BB 4WFGD 4X5XB 2ZKHL 2HP4A 4HS6A 4Y1AA 1A0QL 4NZTL 4N9OB 1QG3A 6CGTA 1Z6JT 5E8PB 1GGBL 1FNSH 1OAKL 1TJGL 3MRQB 5J0BA 1ZGLM 5LQBH 4U1KB 3DX9A 2EC8A 4ZUSA 5KSBB 1MJ8L 2M1KA 4YEFA 2GFBA 1FCCA 4NM8H 1WAAE 3D9AH 3QXWA 5DD6A 4K9EL 3W0WB 1J1XH 5A16B 3OJDB 4Q97A 1J86A 1TIUA 1NCDH 5I8EB 3KNBB 3SE8H 1HDMA 2W1NA 1G9NL 1MHEA 5I71C 3H0TB 4L5FL 3HPLA 4PB9L 3V95A 3I84A 5C86A 2A6JB 5K9QG 5J11B 2OXHA 4O2FB 3TYGL 4XAKD 4CU6A 1MVFA 3WIHA 3MYJA 4DKEH 4G8GD 3EJYC 5IROC 5F1NB 1T1XB 2VLLA 4YC2B 3C6SA 1LMKA 3O4OC 3T77B 4JVUA 1D6EA 5CBEB 1ZSDB 3X3GH 1IAIM 5FGBC 1DQLH 1NC2B 4L3CA 4LRNH 2CKBA 3VRJB 4V1DA 1H9VA 2FIRT 5HYQB 3HLAB 3JV5A 3VCLB 1YEKL 3K8MA 4K07A 4WJ5A 4HIIA 4DOHE 4NQCE 3SGKC 4PGBA 4I3SH 3D87B 3V2AR 2ZCHH 1ZS8B 2LQRA 5D7IE 4UT6H 1CF8L 1PG7H 2QR0B 2NLJB 2P4AB 2DQCH 3NIGF 2RBLA 3OR6B 4EQ3A 4D0CA 2N7BA 4JFOB 5F3BB 4LCWD 1OAZH 4K3EH 4GG6B 3STBA 1K3ZA 3C8HA 1I1CA 4RGOL 2WNGA 2DLFL 3BAEL 2AXJA 5F7HA 4F15C 4DVRH 3WHXA 3QI9C 3BP7A 1B2WL 4LGPB 5A2FA 5CP7A 2NZ9C 3CNKA 1AGDA 1MCSA 2D31B 4UBDD 2WBWB 5EZLB 3ULUL 1MFNA 1MI5B 1GJIA 3KPMB 1KELH 1XGUB 4HLZG 3WSQL 1FVEA 1GGCL 4U1JB 4LVHC 3MRCB 1BJ8A 3NH7H 5E1AA 2UWEA 1JF1A 2DYPA 4NQDE 4PJAB 5D8JL 1FYHB 4IIQA 2WUBH 5FO8A 3UMTA 4F8TA 1LK2B 4KRMB 5EZJB 4OFPA 4ZDHA 1NFDF 2DI9A 4PRIB 3TGXA 1BWWA 3GSQA 3KPSB 4CDGC 4ZD3H 5FDYA 3AREC 2NY6C 4LF3A 2AV1B 4RBPH 5LAXA 5HGHB 1X4XA 2P8MB 5T33L 3WFCH 2YPLD 4NJAH 5IGXL 1N4XH 3VXOA 1NBYB 3CFKA 2BNRB 3MR9A 3K46A 3WFBL 1MCPL 3DUUA 1F58H 4JQVA 2Y07L 1EEZA 4MNQB 1V3MA 5JIIA 4HS6B 1AD0A 4Y1AB 5E9DB 1RUKL 4CMMA 3RWJB 4IOIA 3VWKB 1KJ2L 4O5LH 5KSBE 5JMRA 4MQSB 4KQ3H 2BVTA 3CSGA 2CLVA 3H9HB 4UT7H 1VACA 3DX9B 4ZUSB 2IPKB 4HKZB 3W0WE 3MJ6A 1MFBL 3FHAA 2OZ4A 2ZUXA 4HCRA 1B88A 2HFEA 3FQWA 3G6JA 2C3WA 5JW4N 4LPWA 4F33B 5I76B 1CG9A 1HDMB 4AMKH 1EFQA 1MCRA 3HPLB 5LXGH 3QQ9D 4M6NL 3MYJB 4LPUA 4K3JH 1A6WH 3TT1H 1JN6A 3JUZA 4RBPK 1JVKA 3SGEH 2ADJA 1YY8B 1NC4D 2OLDA 3KPQA 5HPMA 3O11B 1D6EB 1T83C 5CP3H 3DX6A 2UZIL 1BD2A 4HF5H 4U1HA 1MCHA 3G5VA 5D6CB 1ZLVK 4V1DB 3RU8L 1D5ZA 1A3LH 2VDOL 3MBXL 4NN6C 5CILL 3K4ZA 1B9ZA 4HIIB 3RVVC 4W81A 2A77L 3QUYD 4PGBB 4EI5C 4I0PD 3D25A 3E2HC 4LPVA 5CZVH 3VG9B 1I4FB 1F00I 3ZYZA 4XGZB 5KVDH 3BVNA 3L6FA 3KR3H 2ARJA 3EYVA 1Z3GH 5TFSH 3OKDA 4G8FB 3GKWH 4I13B 4LOUD 3MRBA 3C8DA 4MWFB 4NWTL 3OV6A 3RBSA 3RWCB 1OTTD 3UJIH 4HPOL 2E3VA 3MGTA 5I1IL 4JB9H 3WHXB 4PGCA 3CFDB 3BP7B 4YHPA 4JKLA 5GHWH 4XCCH 1J0JA 4M6AA 4Z7UB 3SOBH 1MI5E 1AGDB 3WE6B 3CPLA 1A7PH 2KQMA 3GHBH 4OF0A 4P2RB 1UG9A 1LILA 3AY4A 4M43H 5CJOL 1FVEB 4WGWB 3HUJA 2R0KL 4PJAE 1FNFA 4KI5C 4BQCA 1SJEA 4HMDA 5E1AB 4Z0BL 3GJEB 1JF1B 4R4NC 5TQ2H 1XGYH 4XI5C 1C1EL 5FO8B 4XP9L 1NGPH 3U0WL 5JOFB 4ZTPL 3QNYA 4PRIE 3EOTH 3KPSE 4M1CC 2RCSL 5C6WH 1AO7A 5DTFA 2DD8L 4G43A 1UWXH 2MFNA 4MD0B 3V7AG 2IAND 4IRZL 4U0QB 5DD1H 5LAXB 4TULL 3G6DL 4UQ2A 1CLOL 2BNRE 3QZWG 3ZE1F 1KGCD 2EDWA 3VXOB 5C0FA 3O41A 1BFSA 4MNQE 4HBQA 1JE6A 3P11H 4L4VB 2EEDA 3PJSA 4Y1AE 4IHOA 5E9DE 3ARVA 4M6OH 3IS0X 3DHMA 1T04A 4F7CB 5E99H 1AD0B 4GT7A 1R3HA 5CZXD 5DHXB 1W0VA 3GSRA 2DQDL 3AB0C 2CDEA 2HT3C 4JGJA 2J2ZA 2CLVB 2DTSA 1CD8A 1D6VH 3EZJB 4G7YH 4RA0C 3MRMB 4JFEB 3BEVB 2HFEB 1OTUC 3BD3A 2NNAA 5I75B 2J8UA 2KUTA 4BH7A 3P40A 3RGVC 5F7EH 5IFAL 2Y36L 4P5TA 3VXSE 5HHOE 5BMFL 4O02L 4YXKH 4Z78A 4HEME 3DO3A 5EOQH 3GNMH 1LK3L 5TDOB 2D4FA 2C3VA 1KIPB 1JN6B 1UWXK 2I9TB 5ESQA 1NGQL 1AJ7H 1WIOA 4YWGH 1G6VK 3QXUA 1PG7X 5I17B 5HI3D 5HPMB 4L3ED 4UIKL 2HYMA 3DX6B 1WIPA 4GLRI 4U1HB 4KK5C 4V1DE 2DF3A 3G5VB 4PJ9C 1NANI 2ED8A 4AH2A 5T3XD 1D5ZB 5F6HJ 2HFTA 1J87A 2R8SL 3CMOL 1I3GH 1SEQH 3V6OE 3B9KD 1CVSC 3D25B 4LFHD 2KL6A 1JF5A 4ELMA 4HIJA 4M5YL 3VRIA 3JUYA 4TQEH 2AJYH 3BVNB 4PUBL 1U91B 2ARJB 1RHHA 3OKDB 3T2OA 5AWNL 2IFFL 4GMSH 3HAEH 3RZCB 3MRBB 4HAFA 1VADA 5E8EA 2FB4L 1OARL 5DI8A 5DXWA 1NLBL 5MERA 3W39A 2F8VA 5T5NF 4NC1C 3CVIL 4PGCB 3MQIA 4Z7UE 3BQUB 4YHPB 1S7VA 3VRLE 1A6VL 4P2RE 3O3BA 4QOKD 5I1AA 3HR6A 1PYWA 2VWEE 4OKDA 2DM7A 1TITA 2DIJA 1EGJH 5KZCD 5C0CD 1CE6B 1NUFA 3VXRA 4ODHL 3HNSH 1B0RB 1WWCA 1G6RL 3TPUA 1C5CH 1ZHKB 3C5ZB 4AEEA 2X9XA 4OZGA 4WU7A 5C09D 3W9DA 2O26U 3KYAA 3C60C 5EUKB 4XPTH 3S9DB 4PJ7A 4CMHB 4DN4L 5J13C 4NKIL 4C56A 1MHHA 3K8LA 2CKBH 5I1KL 5DJAB 1QUNA 4H8WH 4HWBL 5FOJA 3RX8A 3TBTB 5I1LA 5F6IB 4UQ2B 2ED9A 4XNQA 3U0PA 3DGGB 4WFHE 1KLFA 1EX0A 2AXGA 3O41B 4L4VE 3BYYA 3HZYB 1RUAH 1JWMA 4ALAL 2FEDD 1T80A 3PJSB 3VFUA 4LVOC 5A2KH 4JM2D 3A6CL 2J88L 1J12A 2CDGB 3F7VB 2Z92B 5DK2A 4GMTL 4HKBB 3MFGB 5D5MF 5EBMB 3RZWA 1KEMH 2CDEB 2HLFD 1HCFX 4BK4A 3UTSD 3MRHA 2G5BA 1NBVL 1P69B 2J5LC 3TZVB 4JFEE 5I1HH 3T3ME 4UMGA 5F7DA 4H0HB 5FUZL 5KSUA 3LHPL 1DBMH 2NNAB 3IJHA 2J8UB 2DWEA 3FB5A 3QAZC 1RFDL 1X5ZA 4R0LB 1GCFA 2VDQH 4KKNA 5D70H 2GQHA 5DZNA 5JHDB 2R23A 2YN3A 4QXTA 4NO3A 2FATL 5HJ3B 4M1GH 1OPGH 2M26A 2C3VB 5JW3L 3H3BC 2EDQA 4RFNC 5ESQB 4GS7C 4XC3L 3S34H 3DTXA 3ULVL 1QP1A 4OZHA 4P3CL 1RHFA 3WFEL 4WW2A 3VWJA 4MDIA 2WUCH 5EO0A 1NMAL 1EUUA 4N5UA 4KPHH 3S37L 1R24B 1HWGB 3QRFM 5F3HA 4FQJL 5GGTA 3RWEA 4HV8B 3REWA 3PWLB 2FR4A 5SWSD 2QQQA 2CDFA 4H1LA 5D93B 4ZPVB 1RJCA 5EO9A 3R8QA 1HCVA 3U9PH 1BOGB 1JNHA 3PDOA 2NY6D 1N2RA 1KCRL 1LDPL 2WSKA 3HAEG 4P46A 4NKMB 3GSNA 4ISVA 2VUOA 3AXLB 3HRZB 2BVOB 2VZUA 3BIAX 4L4TD 1JPTL 2UUDH 1F6AA 2DBLL 2X44D 1FFNA 2WBJC 1VADB 2CMRH 3VGEA 1AE6H 1HI6A 4OBSA 4TSBL 1LO5A 2DQTH 3UTTA 1EEUA 4JY6A 5F9DC 5L8JB 4HJGB 5AZ2L 1S7VB 4PG2A 1TLKA 4PJ5A 1IEAB 3O3BB 2E6JA 1FNGB 25C8L 4X7FC 5CKAA 3FO2B 4YUEH 4DGVL 4OD2B 1AGBA 2P5ED 3C6LC 1CGUA 1BF8A 2VN4A 5IHZA 1YQVL 4LU5H 2B39A 5EIIA 3RPKA 3S3PA 5T5FL 5EU5B 3TPUB 4UILH 2IPTL 5AZEH 5JLZA 4HXBH 4S1QH 4C4KO 4Y4FA 2EYSA 5JOPD 3LD8B 4WWKA 5CEZD 3WFHA 2A9NH 4TVPL 2C3XA 2VZSA 1V8HA 1MHHB 3FFDA 3ORJA 4G3YL 3GI8H 5SX4H 1LO4L 2YK1L 4XPFH 1JGEB 3HS0A 2B4CL 2ZUSA 4HC1A 4XXCC 4PGDA 1UM6L 4N68A 3TVMB 2Y25A 5IWLC 3FT4B 1K5NA 2BFVL 3IDMA 3RVVD 5KG9B 4D9RE 3UDWC 1MWAB 4TUKH 3MTRA 5A3ID 3BWUC 5MENA 1E0OB 5DK2B 2HRPH 2VR5A 5ACZA 3ZL4L 4HIEA 4PJBF 5FKPA 4BSJA 1FNAA 2YUZA 3MRHB 2G5BB 5FK9B 4Z77B 1MQKH 5HI5D 4F7PB 2AJXL 1QBML 1KLGA 1YEEL 4AIZA 1MF2H 3DVFA 2J8UE 4I18C 5CUSH 5KSUB 1JGVL 5F96H 1BF2A 3IJHB 2HAZA 5FOBA 2DWEB 4HWZA 2A83A 3ARDB 5JHDE 3WXWH 1CE1H 5CMAA 4QXTB 2FX7L 4NO3B 4WY7H 4LSQL 4GG8A 4BSVA 1QSZA 4M1DL 4YQXH 1X5HA 1WT5C 4CU8A 3B5TA 4J4PA 4ESKA 3QNXB 3LMJL 5HD8C 5DZOA 1HHIA 1KCSL 3VWJB 4MDIB 5F7MC 2X09A 4KI5D 1CZ8L 5GJSL 1E6JH 4R4ND 5IMMA 1A2YB 4M9OA 1QKZL 4UAOC 4B53A 5F3HB 3P9MA 5GRVK 4U1IA 2FR4B 4H1LB 1F45A 2XQBH 4H8WC 4RMUA 4MB3A 5HYFA 5JDJA 4P99A 4OT1L 1JNHB 1E4XI 2XG5A 3H2WA 4N0UA 4YDVA 3DYOA 3RKPA 3KLHD 1MFDH 1DQDL 4B41A 2YA0A 3VI4F 4P46B 3O3AA 3O9WD 5I30H 4ZS6C 3GSNB 4ISVB 5B21A 2HT4D 1BOYA 4BK5A 1LO2H 4DKDC 5D96B 4YX2L 1ZVSA 1F6AB 1A1NA 1DE4A 2ORBH 4U3HA 4P9HC 1IQWH 3BIKA 3DIFB 3P4NB 3ILQC 5EU6D 1LO5B 3U46A 3QDMB 1B6DA 3UTTB 4JY6B 2E8ZA 1KJMA 4JJHA 4G6AC 3VMPA 1Q72L 1JV5A 5C9KA 1OTSD 2YC1A 1NGZB 2P7TB 4PJ5B 4MMXC 3F65A 4KI5F 1OQOA 2BOBA 4KXZH 1OW0C 3M45A 5F1IB 5H8DA 2E7LA 1RZFL 1QSEB 1TZIA 5JUEH 5IHZB 3FB7A 3RGVD 2NXYC 3OJVC 3AM8C 3S36H 4IIQC 1CN4A 4YPGB 1X6LA 1Q9LA 4BH8B 2X7LA 3GM8A 5JLZB 1CLZL 2GKIA 1QEWA 4WRLA 5EA0L 1MCCA 3HG1B 3MX0A 3WFHB 1J9CT 3K4DA 1RAMA 3DRQB 3QULB 1KXQE 1I1AA 5LCVL 5I1CL 4OLWH 3FFDB 5ICXB 4G6ML 2X4QA 1JRHI 1YN7A 3O2DA 1E27A 4KK5D 1U8LA 35C8L 4Z0XA 3HS0B 2VIRA 4PJ9D 5J56B 3L1OL 3IS1X 5DUMH 1I9IH 5EPMA 4OM1L 4PGDB 3KJ4B 5HHXH 3ZE2F 5L2KB 3SQOL 1GRWA 3IDMB 4Q6IC 4HGWA 5MENB 2EZ0C 4QXUL 4JPVL 3KYNA 1WC7B 2Y06H 4HIEB 3RVXC 5C1MB 2CQVA 2H2SC 5DS8B 5DRXB 1NSNL 1T66D 1G7QB 1DBKL 2Q7YA 5LGHL 4EBQL 3F7RA 4FFZL 1NEZA 5DJCA 3D48R 3RWHB 3U4EB 3SKOA 4RWYL 4HWEL 3JZ7A 3N50A 4UB0L 2WBKA 2E7MA 1UKTA 4R9HA 2FLRT 1XIWC 4NCDA 2EYRA 3RNQB 3GJFA 4P4RA 4F80A 3CCHA 3MOQA 1R0AL 4YFDB 4B0MM 1JHLL 1DVFA 2D2OA 3RY4A 5D1ZA 4LPTA 3T04D 2VRAA 3OF6A 3TA3D 3UAJC 3KDMA 3MLUL 1M7IB 4ORGA 3G5XA 1KN2L 3FRPA 1UA6L 1X5IA 3MRIA 3L5XH 5DHYA 2JLLA 3NTCH 4LKXA 2XYCA 4U1IB 2B1HH 1X5YA 1JWUB 4NQDD 4JGMA 5GSVA 3C60D 4XCYA 2DQUL 5DQJA 1YUHA 5F1SA 3FT3A 2VXSL 4KAQH 3LEYH 3VI3E 4P3DA 3O3AB 4CN1A 1RD6A 1MNUL 4KRPB 1MRFL 4Q9RH 1A7NH 5IJKC 1ZVSB 4G5ZL 4Y16D 1KENL 1CICC 2F58L 2ADFL 1DE4B 4H20L 3B6SA 3OPZL 4OIBA 3MUGB 1FGNL 4M7KL 3SEPA 3QFJD 4JREC 3QDME 3UTTE 4GQPH 3SE9L 3U46B 4K71C 4XP4L 4Y8AA 4PJ5E 1Q9OA 2VAJA 1RVFL 5AAWA 2YC1B 1KEGH 1QVOA 3VU2A 3F5WB 5KBNC 5JQHC 1OLZA 4PRHB 5F6HI 1RPQA 1QSEE 2BOBB 4ZSOB 3QWQB 1JWSA 5ESVA 4JM4L 2NW3A 3W2DH 4U1GC 2P8PA 1EHLH 1E28A 1TZIB 3W0WD 3AY4C 3FB7B 4EXPX 5IIEB 5IV2B 2A2QT 2JJTC 3ARSA 5GZND 4PRNB 1Z0MA 3D69B 1QEWB 2X4SB 2VC2H 5DD0L 3HG1E 15C8L 4NBYB 3T1WA 1SEBA 4JN1L 5E2JA 2Z31C 3RPIA 2ICES 4RISH 2D7TL 4Q2ZB 4UOJA 4ACPA 4E5XA 4HMEA 5I19L 5HHPA 3D39D 5GGQL 1W72A 3OJ2C 1ZTXH 3KS0J 4Z0XB 5C0RH 4XNMA 4NBZB 1C7SA 1NC2D 3BWAA 3Q6GL 1BHGA 5L2KE 3HMXH 5E8DL 3CLFL 5ABDE 4OI7A 1EJ6A 4OJFH 3IFPA 5I0ZA 1PVHA 1TVHA 3DETC 2F54A 3FQRB 4MS8D 5MENE 4XBEH 5JZ7C 3T2NH 3ZYOA 5AUMB 2C7UB 1TJHL 2NY2B 1OAXL 1MREH 1PW3A 3QEUA 2X4OA 3TNNA 1WK0A 2Q7YB 5HYJA 1NEZB 4JZJA 3SKOB 2WBJD 3O6LL 2W60A 4RAVA 4D0BA 1B0GA 3L5HA 3S5LG 4ZS7H 4OZIA 2O5YL 2QHRH 1EFXA 2EYRB 4P4RB 1BFVL 4WI9A 3UZVB 3VFRB 3P0YH 4U1SA 4PTTB 1GZQB 2EXWD 4MAYB 4P5TC 5E95B 3BMWA 4UV7H 1DVFB 4E41B 4PP2A 5D1ZB 1R5VA 4Q6YA 3LS5H 2LU3A 1IM3B 2J4WL 4NRXB 1NBZA 3G5XB 1MI5D 1S7QA 3I02A 2W9DH 4F3FB 3MRIB 2VE6A 4ZPTA 1QBLL 2MCPH 4LKXB 3SJVB 1EPFA 3QHZH 1XGTA 4HGKC 3FN0H 4NSKA 4XCYB 3DSFL 5CEXB 1H15A 4M4PA 2YPKB 1HWHB 4UV4H 3FT3B 4PRID 1SM3H 3LPWA 3R06A 5K59E 5KS9A 4GG6F 2ATPA 4Y19D 2BDNH 2WIMA 4Z7OE 1QNZH 3FFCA 3IAPA 4XWOD 5IHBA 4K8RC 5DJ2A 5C9JB 2IQ9H 1JYVA 1L6ZA 1U8MA 3B6SB 1SJXA 3KPOA 4NZRL 1J05B 4LLWB 3I3BA 2MQ3A 5BOPA 2YEZB 3BZ4A 1DEEA 3S36X 3VGGA 3MUY1 4DUWA 1G1YA 1Q9OB 3HI5L 4Y1AD 4PRHE 4V2BA 1QVOB 2J8HA 3PNWB 3HE6B 4ZSOE 3ZKMD 4BUGA 5BRZB 3VWKD 5I8KH 3S3SA 3NIFF 1RIHH 1JWSB 1KACB 5ESVB 2NW3B 1FDLH 1XF5A 2P8PB 1LD9A 4NHCL 3O3EA 1HINL 1YQ2A 4M7ZB 2NY1B 5DVOA 4P2QB 5I73C 4U6TA 4DCQA 1WFNA 2VOTA 3DX8A 4XMLH 1F3JA 3RGHA 2FECI 4P5KB 1DEDA 3CVHH 5TF1H 1OAYH 2EDHA 4WI6A 2VB5A 5HD8D 1IILE 1MLCA 4RCAA 5DC0A 5T3ZL 2YUVA 1F13A 1H3PH 1CBVH 3MXWL 5C6PB 2PXYB 5HHPB 5B3JE 4P2OA 1W72B 3K2UH 5E00A 1QFHA 1BQHB 4XNMB 3QXDA 1T0MA 1UGNA 3HE7A 4MSWB 3RUGB 1B4JH 1MRDL 2LTQB 4Q9CA 4V1DD 5TE7H 3SN6N 3WDIA 1TVHB 2F54B 2MHAB 2OCFD 3WV0A 4NO0A 4TTDD 3BH9A 5FV1L 3SGJC 1N59A 4Y4HA 4OFDA 4FG6C 5DT1H 3QEUB 1KB5B 4KDWA 1KFAL 3S88L 1LDSA 2D7OA 2OR7A 3B43A 2C4FT 5HYJB 4ETQA 1KTRL 4JHAH 2V7NB 4X6BB 5GGRA 4EVNB 1GGIL 1CU4L 1QFWI 2W60B 2X4UB 4D0BB 4TRPL 1B0GB 2X1QA 5BV7C 1HQ4B 5C92A 4YXLH 5IF0A 3ILQD 3MC0A 4HUWB 5IBTH 1CFQB 3BP6B 4U1SB 1ZA3B 4WFEE 3OKOA 4E41E 1YY9D 2QQNH 3MODH 1LEIA 1S5IL 1MFCH 4PP2B 4I5BB 1MCQA 1ODAA 3TV3L 1X5GA 1R5VB 2WK2A 1ZHBB 3U9UB 2XOTA 4POYA 4P2RD 1NBZB 1FO0L 1PFCA 3O6ML 4FFYH 1F02I 4J3TA 4Z7QE 1BBDH 3Q1SL 4KVCL 1H3GA 3H3PL 4WW2C 2GTZB 4AEIL 5TDPB 2NXYD 3SJVE 4WDIA 4ZPTB 5I74B 2DYPD 4PJCA 4YZFE 3GMPA 4IJ3C 4M00A 4Y5YA 3WIFA 5EZOL 5D7LA 2FJFA 2Z93B 3O2DH 1MHPH 1H15B 2XWBA 1ACYL 4PRAB 1KJ2A 4YHYB 4P57B 1SMAA 5AYUL 2ATPB 3CH8A 4OI9A 4PJGA 2OL3L 2P44B 2AK4B 2AP2A 4JFQB 4URTB 2VISA 3H6JA 1U8MB 4F7TB 1SBSH 3KPOB 1U8HA 4MXWH 2HJFA 1L4IA 4AEHL 3RVXD 5BRZE 2H2SD 3VGAB 3MRPA 2AGJL 4JPIA 3QEHB 4OLZH 3WFZA 3C08L 5I9QB 3FTGB 2NY3C 3WL9A 2DM2A 4GUPA 4WI4A 4JO4L 4D3CH 2UWEF 5CEYB 4MA1C 1FHGA 2EDYA 1F97A 3T08A 3DV4A 1LD9B 4D9LH 1CXKA 4P2QE 1QSVA 3D85B 3MV8A 3TBSA 4CN4A 3CXDL 3TN0C 5L8LB 3ARPA 4DCQB 1FPTL 3DX8B 1XGRA 5GISL 4NDMA 1F3JB 2LV4A 3NFSL 5T1KA 1JFQL 4LLYA 3O3DA 1A47A 3DNKA 5TE4L 1AI1L 1TVDA 3Q0HA 3KYKH 4UZGA 3UAJD 4PYHA 1UZ6E 4GAGH 4G80A 1MLCB 4Y4FC 1YNTB 1PZ5B 1P4LA 1MHCA 4WWKC 4BFIA 1RJYB 3EOAA 4GQ9L 3ES6A 3LKRB 4OZFH 2LU4A 5E00B 4PREB 3TYFB 3MRKA 3RUGE 1QFPA 3QXDB 1LQSR 2BSRA 4ZUWA 3HE7B 3N1FC 1GYAA 2F54E 5EUOB 3FCTB 1FYTA 1HYSC 2GITA 5CWSB 4NO0B 3U4BH 2QQKH 4UIMB 5EOCH 4I77H 5MHSD 2XTJC 5LGJA 1EAJA 4HUUB 3WUWA 3VGBA 5KAQG 3GJFK 3CX5J 3E8UL 5C0AA 5T1DH 3ULSA 3ZKXB 2VZ3A 5DLML 5DQDL 3G6JF 3IT8D 5GGRB 4HXAH 3FKUS 4RX4A 1KCLA 1JI1A 5FB8A 3MLYH 2W92A 5IF0B 3LKOA 5MEOB 3JWDH 3EDDA 1Q94B 3D2UB 2H6PB 1FNSL 1Q0XH 2H9GA 3RL2B 4FQ2H 3D5OF 5LQBL 2R2BB 4WEUD 4NM8L 3D9AL 1J1XL 5HDQH 1FNLA 5FHBH 2FEEI 2VR4A 4L8SC 1NCDL 1D5MA 3NN8A 4DZBA 1Q1JH 3BKYH 3SE8L 4RGNB 2V5RA 3VFMA 4WDIB 1AH1A 1SBBA 4PJCB 5DRZA 3BW9A 2E27H 3WIFB 4QYOA 1F8TH 5D1QC 4DKEL 3C5ZD 5D7LB 2D0GA 1CDYA 5KOMC 3PWNB 1AHWB 5EU4A 3QIBB 1KJ2B 3X3GL 1J1PH 1X3DA 3QUMH 2AK4E 1XCQA 1YEHH 4JRYA 4LRNL 4MJ4A 4Q7DA 5IT2H 1JNNH 1MY7A 4MX7A 5J7CC 2H2PD 1R3JA 4HUVB 5BXFA 1CQYA 3Q3GA 2Q20A 3IU3B 3PIQA 3PP3H 4IMKC 4YDKH 1HOCA 2VLJE 3DETD 2GAZB 5EBLA 1MFAL 2EDLA 4I3SL 5D71H 1U8HB 2ZCHL 5C8JA 3JWNC 1CGXA 3U2SB 4UT6L 1PG7L 4POUB 3DRTB 4OCYH 3BT2H 4YHNA 4P4KA 2DQCL 2VABA 2NMSA 3IYLW 2Q87A 3QUKB 4I9WD 3F6IA 1CFVH 2FJHA 5E03A 1OAZL 4K3EL 1FL5B 5ESAA 4Y2DB 3HUJF 3WL9B 1IAIH 4GUPB 5ALBH 1CFBA 4NNYB 1AQDB 2R69H 3GMRA 1FCGA 2E7LC 3MV8B 4S2SB 2X4RA 3TBSB 3EFFB 4DVRL 3FRPG 3GSVA 2RHEA 4GBXC 3Q5YA 1NGXA 5T1KB 4LCYA 3F7YA 4P5TD 4OSUL 1T5WA 4LLYB 1XR9A 2DQIH 4XX1E 1S3KH 4HX1A 4OZFG 4LSRH 2NQCA 1KELL 4G80B 3STLA 5DJ8A 5FYLH 1P4LB 5SX4I 4FQQB 4U0RC 3BPNB 3PHQA 3NH7L 4M48H 3VFVA 3ES6B 4XBGA 4MHHI 4KZDH 2ZKHH 2WUBL 5EUOE 1EA9C 1O7VA 2OMNA 5L2JA 1IRAY 4XHQA 2BC4A 1XMWA 1FYTB 2GITB 1MCFA 3QP3A 3AU1B 4JFPA 4ZD3L 4R2GB 1G7LA 3PGFH 2Q6WA 4PRDA 2D03H 2A6DA 3SDXB 4K7PX 3WUWB 1HE7A 3P0VH 3WFCL 1GL4B 5C6TH 4NJAL 5F89A 4DKAA 1UH4A 5C0AB 5E4EB 1N4XL 1CGSH 1Y0LA 3MJ9A 3LKQA 3U82B 1NCCH 4L5FH 5DHVA 4K8RD 2ESVE 3FMGL 1RJZB 4PGEB 1A3RH 1F58L 4NQEA 4W6YB 1G6RA 1KPRA 3LKOB 1PEWA 2NXZD 1LO0H 1HHHA 5DJ6B 4ZAKB 2V9QA 2V7HB 3ZSTA 4O5LL 2F53A 4X6CF 1WICA 4KQ3L 4UT7L 3VFTB 1MCBA 3L7EA 1OSPH 4X6DB 2OI9C 3GMQA 5B39A 3FB8B 3RKDC 2BVEA 3QIWB 4HWBA 5KVEH 3IRZA 1CXHA 1AR1C 4RGNE 4DZBB 5CGYC 4TSAH 4JJ5B 3QDJA 3X12B 5L88H 3RDTA 3QISA 1I8LA 2ERJC 4PJCE 3VXRD 2YD4A 4AMKL 2HKFH 3H42H 5LXGL 2V9TA 4EXKA 3LPGA 3QHFH 5D7LE 2ITDA 3MREA 4IMLB 1U2CA 4K3JL 1A6WL 3TT1L 2YRPA 4R7DA 2PW2A 3ARBB 4ELMF 2GTWB 4PIRF 3DUSB 4WO4A 1C16B 3QRGH 1K8IA 3S35X 3IDIA 4C56D 3LKNB 4HF5L 4XBPA 3H9SB 1IEBA 4NO2A 2BHZA 5E5RB 1A3LL 1R3JB 4H25A 4HUKB 3PIQB 1N6QH 3L3GA 4QRUA 5CZVL 4X9BA 3L3KB 1A5FH 4X9GA 5KVDL 3KR3L 4P4KB 3HHRB 5TFSL 4PG9A 1CD9B 3GSUA 2DMKA 1XZ0A 3OSKA 1B6UA 3GKWL 3T0DA 4X0KA 5E5MA 3LH2H 2NX5A 3FO9B 2YD8A 5BW7A 1KV3A 3MV8E 4M3JA 2X41A 2CPCA 3UJIL 4JQIH 1AC0A 4PV9B 4OZGF 2X4RB 3VXUA 4YXHH 1S7WB 3GSVB 4JB9L 1LWRA 4MNGB 4WUUA 2VLMD 3HB3C 4X80H 3T4YB 4JFZH 5GHWL 1QACA 1NGXB 4XCCL 3ARDD 4I48A 3QXTA 4RZCA 1T5WB 1GPOH 3SOBL 4PV8A 4PJ7F 1XR9B 5E2UH 1A7PL 3GHBL 3FRUA 4HX1B 4ZO9A 1U9KA 3JWOL 4E9LA 3X3FH 1DUYA 3STLB 4M43L 1FAIH 1WWBX 1NQBA 1J0HA 3WFBH 5AEAA 3VFVB 5TQ2L 3VWJD 1XGYL 2APWA 2AV7A 4YHIA 3MV7A 5HGBA 1NGPL 3BGFC 4QLRA 5L2JB 1IT9H 1FYTE 3KVQA 3GZKA 3M8OL 2AABH 2F5AH 3ZKSD 1GC1C 2BC4B 4M03A 5JR1L 5C0NC 1JPFB 2JTDA 4LSPH 1CXEA 1A1OA 4N9GB 3KLAA 3UBXA 5K9OA 4LEXH 3SDXE 2QADC 2Q6WB 4PRDB 3SO3C 3I6GB 1MFBH 3EO1A 5DD1L 3NFPA 5C0AE 3QUZA 2V5MA 5D2NB 4P46D 3IAQA 1ZLUK 3UPAA 5FHAH 5KVMC 1Y0LB 3VG0H 1BVKA 3LQMA 5DHVB 4NFCA 2OS7A 1DBJH 4HPYH 5GS2H 5AG9A 1OP9A 3P11L 5HGGS 3H7BA 4M61A 4NQEB 3QJFB 5C0GA 4ONOA 4JZJC 4AIXA 5HDLA 4M6OL 1G6RB 5E99L 3IDJA 1KPRB 3LRHA 3VDAA 2BNQE 1HHHB 3I6LE 1NDGA 1LE9B 1A6AA 3MRGB 1VFAA 4ZUUA 4X6DE 3P9WB 4APQB 1KTLB 3UTTD 3UEZA 1IGTA 3BPLB 2G9HA 3L7EB 1D6VL 4OZHF 2VO5A 3JV6A 4PJ5D 4WW2F 5CJ5A 1QQDA 3L3HA 4G7YL 5B39B 3L5WB 4LHUG 4B5EA 5DJXB 4OFKA 3UO1H 2X4TB 4MDJB 5IHUH 5DEGA 3QDJB 1QSED 1RMFH 3RDTB 5F7EL 1T0NA 2R1XB 2Y7QB 1R5IA 4JLRA 4YXKL 2FBJH 4JANA 5EOQL 3I2CH 4JRXB 3GNML 3TEUA 2F8OA 1D5XB 4KK9D 3MREB 2MQCA 4R7DB 4ZXBA 1AJ7L 4GXUM 4QWWC 4YWGL 5SWZA 2BHUA 3VFSA 1BIIA 4POZD 4WO4B 1P5UA 4Y4FD 4JO2H 5F72S 4AG4H 5IEKA 2NY7L 4WWKD 3HG1D 4NIKB 3IDIB 3H9SE 1OP5K 1DN0B 2DI7A 5GRJH 4DVBA 2BSSA 4E0RB 1IEBB 2HVKA 4S10A 5DMIH 4QHUA 3SDCB 3I9GH 4I4WA 3X13A 2D0FA 3BHBB 2JK5A 1I3GL 1SEQL 4KY1H 43C9A 4GFTB 4TN9A 5H35A 1OGAB 3RAJH 1GOHA 2HVJA 5IMKA 3GMMA 1OGTB 4JFDA 5FYJE 3SQBA 2OK0H 4AIOA 2EE2A 5MEND 1NL0H 1PJ9A 4PG9B 2ZUVA 4U1LA 1XZ0B 4GMSL 2FSEA 4KUZH 1JBJA 1K4DA 3BN9C 5IBLC 1IFHH 5I6XC 1XGPA 3PDDA 4MNGE 4BQ8A 2LFGA 4R4BA 3ZT5A 4QTIH 4WUUB 1T21A 4Y5VB 3VD7A 2AXFA 4U49A 3V52H 5BZWA 1K8DA 3ROLB 4TOYH 3PF2A 4F9LC 3FRUB 1EGJL 2C4FU 4J3SA 4IOFC 3LIZH 3VXQB 1ITCA 4J4PD 2YMXH 2IBBA 4GW5A 2FIKB 2BVYA 3HNSL 3VD3A 2NYYC 2A6IA 4WHYG 5IVXA 2HA1A 3MV7B 1ZMYA 1C5CL 4NCC1 4XPTL 4PBXA 2PNDA 1INEH 2DQGH 2CLZA 5AAMA 3KLAB 5K9OB 3P4OA 2Z91B 3ZHDA 1ZHNA 2CKBL 3GI9H 5F7UA 3EO1B 3IVKB 4X6EA 5D2NE 5DVKA 4H8WL 1ZA6B 4IRJB 4JVWA 4G6KH 4Y4HC 3WS3A 3KXFB 5JIHA 5ITBL 4KRPD 1RUAL 3O6FC 1FE8H 4UQ3A 5C0GB 5J12B 2NY0B 3B8SA 3IDJB 5B38B 3VG9C 1NDGB 3B83A 2NTSP 5SX5H 1A6AB 2R1WA 1VFAB 1KEML 4S1RH 4YGVA 1KCVH 5DEFB 1IGTB 1T2XA 2Z8SA 3IXTB 4QRPB 1N6UA 3P2TA 4GKOA 4AT6B 1IZJA 3TCLA 1QQDB 3L3HB 5I1HL 1MCOH 2P1YA 4KKLC 4NHUB 3QDJE 1DBML 1TETH 2DIAA 1KCUH 1CTNA 1OSZA 1D9KB 5C0IA 1T0NB 3B2UC 1SQ2N 4JRXE 1R5IB 1DLFH 5FYKD 1AY1H 2VDQL 5J1SC 1S7UA 5DSCA 5D70L 3TC9A 1TPXB 2E9IA 3MA9H 1LE5A 2OJZH 2IG2H 4M1GL 3G04A 5TE6H 4DW2H 4Y5YC 4ZXBB 3VFSB 3OKMB 1J8HE 3S34L 4WI5A 3UYOD 5EOTA 5DVLA 4KGJA 5DYOB 2VKXA 2WUCL 1I1AD 3EHBC 4KPHL 4DVBB 3QG6B 4MQ7B 2BSSB 4NNXB 3VXTA 2CJUH 4ZFZA 3U36A 3S4SA 4I4WB 1OGAE 43C9B 3L7FA 4N0FA 3U9PL 5KAQF 1UJ3A 1BPVA 5H35B 4F7MB 4JDTH 2EH7H 5IMKB 5LWYH 1DLHA 3MJ9H 4ZUVA 3IDNB 3K0WA 5HGAA 2VLKA 3DUHA 5HVFB 4ZNEE 2NY2D 4OCXH 3ULVE 1S9XA 2PO6B 3MGOA 2FX9H 2ZJSH 2FSEB 2YKLH 1K4DB 2C3HA 4LKCB 4G8GB 2CMRL 4YHKH 1AE6L 2OM5A 2HJLB 1XGPB 3V9FA 1MIEH 4WUUE 3RL1B 4A6YB 1VEPA 2AXFB 1FGVH 3IJYA 5BZWB 1WZKA 4NBXB 1OAUH 1QFOA 1K8DB 4X5WB 4EKXA 5EU3A 1DVFD 4KU1A 3BKJL 5EWIH 5D1ZD 4YUEL 8FABB 3OF6D 4KKAD 1PEZA 5JMOC 4QO1A 1BGXH 3IKKA 1U3YA 3IB4A 4LU5L 5HY9A 4R4FH 1BJMA 4RA3A 2LE9A 4Q0XH 3NCYP 4LQ1A 1DSFH 4UILL 5I8OH 1NFDB 2H1PH 5AZEL 3FN9A 1ETZB 4LCWB 4HXBL 2HTLC 4S1QL 3SJVD 4Q9QH 2A9NL 1D5BB 2FD6H 4YDLC 3P4OB 1B4RA 2OR9H 3GI8L 3KXFE 4DTGH 2X1PA 3DO7A 4XPFL 4GKNA 3QJHB 4IRSA 2RQ8A 4KROB 4OGYH 5DMGC 1M6OA 3LKPA 5DD3H 2CR3A 1H5BC 3MBEC 2HJKB 2Y1VA 4Z95H 1DFBH 3WO4B 3VW3L 3MLVH 1AGCA 4U6YA 3G6AA 3RVUD 1S9VA 1CL7I 4JFHE 4TUKL 3ABZA 4N1CA 5L8KB 3FQTA 3OJMB 3UTOA 2HRPL 1G0DA 4QRPE 4HH9B 4TVPE 4YGVB 4MD5A 4S1DC 5F70A 1MQKL 1U36A 3EYOA 3V5HA 1MWAH 4O00A 3RWFA 2GUOA 3HE6D 3AS3A 1IM9A 2FH8A 5CUSL 2ITCA 5F96L 1I8KA 4XNZC 4BZ2H 1OSZB 2YS4A 3K80A 5C0IB 1O5DT 1RV6X 4P23A 3PWUB 5IB1A 3WXWL 5DSCB 1CE1L 2LVEA 1KCRH 2NY1D 4ZFOL 4WY7L 2HWZH 4FZEH 3STZA 2EC9U 3WEXB 3GMOA 4YQXL 4JKKA 3IDYB 4YK4B 2HN7A 4WFGE 3LCYA 1JPTH 1I9RH 5EOTB 5BQ7A 4KJWC 4MJIA 3CFJB 2DB8A 2DN7A 5MI0B 3UP1A 2HFFB 2C5DC 4MXVF 1E6JL 3QXAA 4Z7VA 1A7QH 4GW1B 3ZE0F 1IGIH 2PXYD 4LSTH 3L5JA 4CAGA 3LQAH 3CSPA 3TJHC 2R0LH 4ZFZB 4D94A 3MRJA 3ZTJG 3S4SB 3ARUA 2CXGA 2BOCB 2XQBL 3AROA 3OB8A 4JDVB 3G5YA 3NIGE 5AZ2H 1MJ7H 2XIDA 4FMKA 1MFDL 1U8IB 2F54D 5HGAB 4ZUVB 5I30L 4IBLT 5ID1A 3I3EA 2VLKB 1P7KA 1VSCA 4NUGH 1LO2L 1FC2D 1KG0B 3MGOB 1KOAA 4G8GE 1I9EA 2ORBL 5FGSA 5HYJD 1IQWL 1CK0H 5ADOH 4X7EC 2W59A 1KPVA 1RIUH 2W0PA 4WEBL 4LIQH 1NC4B 2Z0BA 1EFXD 3IJYB 3RNKB 1U92B 1WBYA 5EU3B 5D7JA 5DJ0B 3GEWB 5E0QA 1EK3A 4KTEL 3CFEB 4U1MA 5JUEL 1UB6A 4OGAC 4YAQB 5HY9B 5DK3A 3T0WA 1NFDE 2Q3ZA 2EDJA 1VFMA 4NT6A 1U95A 4LCWE 1N7MH 1W2KT 5GGUB 1MUJA 4JZOA 4KHXH 3NGBC 3GK8H 4BJLA 1S8DA 4QWWD 4OLYH 1YYMH 1WUNT 4QRTA 4QHMB 1HH9A 4OLWL 3KPRA 1QBBA 1I7RB 3AS2A 1QO3B 3VXMA 2VL5B 5DUML 1I9IL 1M6OB 3V79C 4X99A 5HHXL 4OZIF 4AL8H 1TZGH 3FFCD 4HZLB 4ZFFA 1T1YB 1YEDB 5I66B 4Y0GA 8CGTA 4JFFA 3TFKD 1NAMA 1G7IA 3EUUA 3V8CA 4B7IA 5D9SA 2Y06L 1CD0A 4XT1C 1A22B 4MD5B 1YC7A 2FL5A 1W0WA 3V5HB 1UJTA 4M8QA 4UNTA 3RWFB 1T03H 2EIZA 1FORH 1IM9B 1WIUA 1YEGH 2PW1A 2ITCB 3ARXA 1I8KB 1DANT 2ZUTA 4D2NA 3TBYB 5CSBA 4P23B 5CD5D 3TO4A 1QLFA 4YBLB 1RZ8A 2IGFH 5FGBA 1I8LC 4D9QE 2VXUH 3JV4B 3G08A 2FGZA 4M5ZH 3STZB 5C3TA 3UCRA 4NWUL 1GOGA 1K4CA 1HKLH 2HN7B 2R0WH 1F4WH 4IOFD 4HKJB 5IW6A 5KS9F 3DXAB 2BY3A 5BQ7B 1NLDH 3MLZH 1C12B 2GJ6A 3Q5TA 4RMTA 3SGKA 2DKSA 3VFOA 5FF6A 3UBXG 1ZOXA 4P5MA 3BZFB 5D2LA 4M8VA 3L5XL 3NTCL 4P2OD 3OKEA 1ROWA 1R5WB 2B1HL 3MRJB 4CNIB 1GXEA 1Q72H 3HE7D 4G8EA 2Z35A 1ZT1A 4KAQL 1X7QA 2H8PA 3LEYL 2VLKE 4NO0D 2ADIA 5ID1B 3P9LA 4Y4HD 1DN2A 1H3UA 4G9FA 2CSPA 4Q9RL 1A7NL 3QI9A 5KOVC 1JUFA 4BYHA 3MV01 1FO0A 3X14A 3ULUD 2E7CA 3OB0H 4TUOB 3TVMC 4QXWA 5J6HB 4DEPB 5BW7C 1LGVA 3QIUC 5E24E 1GAFH 4HJJL 5I15H 3TESA 1HHJA 2PTVA 4FTVA 5FDWA 1IKFH 3D0LA 5JIKA 1HSAA 1KEGL 2E9BA 2KQNA 4XCFH 4K7FB 2N7AA 4YHOH 3JTTA 1WBYB 3MJ7A 5E6IB 4EUPH 1FSKB 1KIUA 1I75A 3SGDI 3W2DL 3GB7A 1EHLL 4KC3B 4ZOCA 2OL3A 2AEWA 4MVBC 3AREA 3V5KB 4EIGB 1BVLB 4U7MA 3MACH 3WJJA 2O5ZH 1U95B 2AI0H 4F8QA 4RGND 1OOAA 3DPBA 3BOVA 1LEGB 3TIEA 1N5YH 1MUJB 1MEXH 2VC2L 4HW6A 1ZT7A 5INDB 1S8DB 4BZ1H 3GBNH 3MNZB 4L9LB 2L4OA 4X83A 4EBQH 1KN4H 5D7LD 4CN6A 2PUQT 1F42A 4QRTB 4RISL 1HH9B 3ZE1E 3KPRB 3ULUF 4WUKH 4RWYH 1WFOA 5GS1A 3JVGA 4UB0H 3HCVA 1ZTXL 5E2VH 3S37X 4ONGH 5C0RL 1FZKA 5C08A 4QXGH 2VLRA 3HMXL 3MYZA 4QOKB 2BX5A 2AEIT 4MNHA 4OJFL 5JNYA 1FG2A 4XBEL 5D5MB 3T2NL 4JFFB 4PJBA 2F8XC 4NYLA 1G7IB 4WTWA 1MREL 1AD9B 3OKKB 4Z9KB 5I71B 4XZUA 4WHTA 2DL2A 3P77A 5J06A 2CGRH 1IBGH 1OB1B 4FQIH 2EIZB 2P48B 4M93C 4ZS7L 3QQ4A 1DL7H 2QHRL 3AUVA 4CADA 2DQUH 3O4OB 5IMLB 3MLSH 4IS6A 3WLBB 1T83A 1U42A 3MV8D 1RZ8B 2YZ8A 3U7AA 3FJTA 5IB2B 3X11A 1A6TB 3NA4A 4KV5F 4UV7L 4PLNC 1KGCE 3T1FA 2EECA 4PJHA 1G7MB 1HH6B 5T1KD 3DXAE 3LS5L 5JQ6H 2AQ1A 1IAMA 1BIHA 4S0TD 4U6HA 4G5ZH 4P3WA 3B2VH 4PJGF 5HVGB 2GJ6B 4EI5A 4P5MB 2W9DL 4NGHH 3TH3T 3HPJA 1C7TA 2MCPL 4X7CC 3QHZL 5FGCB 3FN0L 2X4PB 4X6FB 4WV1C 4G8EB 4M4RA 3I50H 1QZ1A 1FYTD 5IBUG 4UV4L 3LDBC 2X70A 2ADIB 1SM3L 5DGRA 2B8OT 4N8PA 1NGYA 1I7ZA 4GW4B 4F15B 2BDNL 4G9FB 3QI9B 1QNZL 3EJZC 3WNLA 5DMGD 4PJ8A 2E9JA 5C0AD 2R1YA 2IQ9L 5B22A 2E5EA 4LLVA 1UM5H 1CFNA 4QTHA 4HKXA 4L3EE 5EN2B 4RX4D 1ED3A 4EUPG 4J2XA 1HHJB 4LVHB 2XNAB 4Y89A 2JF1A 3T4AA 3D18B 1CD1A 5T3XE 1HSAB 2FHFA 4XTRD 5I8KL 3UPRA 4YIQA 3MJ7B 3I6LD 1RIHL 2YN5A 4JVPA 4R96A 3BXNB 1FDLL 5A2JH 3HR5B 3P0GB 4HUXA 4KHTH 1G7PB 1U3HA 3AREB 2NY6B 3C8KA 1L0XA 4GXVH 4ZO8A 2XTLA 1AGEA 2QJDA 4FNLH 5TGBA 4XMLL 2P24B 3WLWC 1MJJA 4NQSA 3BX7C 3TF7C 4UTAH 4R8WH 1ZT7B 3CVHL 5TF1L 1Z9OA 1OAYL 4PLJC 4XH2A 1UADC 1YMHA 3V6BR 3T0EA 5JO5B 3ARBD 1H3PL 2DQHH 3IXAA 1CBVL 1DQJA 1WF5A 3K2UL 5ILTH 3GUTB 3HCVB 2ZOLA 4PJEA 1WZLA 4QOKE 3MA7B 4JRYD 2P46B 1B4JL 5SWQA 5D5ME 5TE7L 4JFFE 1NAKH 1J0KA 5BS0A 5DDHB 2D7PA 4XVTH 4PJBB 3U7YH 4NYLB 3B5GA 4GRWF 1KIRB 4AEFA 5I1JH 3BZEA 5DT1L 4GKSA 5CJBA 1XF4A 4P2YA 4M6ML 1RZKH 4EEEA 4YJZL 1CXFA 2OMBA 5C09E 4QF1A 3P77B 4P4KD 4LHJB 4EOWH 1VB9A 4JHAL 2QKIA 2VXQH 5DMKA 2APBA 3KYOB 1JYNA 5A40E 1KNOA 2PCPA 1KB5H 3QQ4B 4YXLL 5I1GH 2ZUQC 5E8NB 1NJ9B 2E7BA 5IBTL 1A6ZB 1T5XB 1PY4A 2R2EA 2PYFA 5E7FA 2QQNL 5FM5M 2YBRA 1I8IB 1BMGA 4YR6A 5A2IH 3KHQA 4LCCA 1PKQA 4DJMA 4NN6B 3TPKA 3EGSB 5DUBA 4XMKH 1QLRA 5BVPH 3NBNA 5HHNA 4FFYL 1BBDL 1PKOA 1RJLB 1Z5LA 4EI5B 3E2HB 1PX3A 3GSWB 1TZHB 3HPJB 2I9LA 1NFIA 5FGCE 5HYEA 5HDBF 3CXHK 4ODXA 1FL3A 3O2DL 1MHPL 4X7TA 4Y8DC 3TM6A 4FRWA 1ES0B 1UJ3C 4NRYA 3DLQR 4LASH 4G9FE 1NGYB 4FABH 1I7ZB 1ZXQA 2O5XH 2PKDA 1C08A 1NCWH 2JB6B 3GSOA 2FZ3A 2FWOB 3V4VH 1NAMH 4X8JB 4LLVB 2OTWA 1SBSL 1CFNB 5DK0A 4BKLB 5IB4B 2WWKT 5C0JA 2BVQA 4NQED 4MXWL 3QWOB 3HC3H 4OLUH 2AJZB 4OQ1A 5F7FA 7FABH 3T4AB 1CD1B 2UYLA 4JR9H 2IQAA 4OLZL 1BX2B 4PP1C 2WAHA 4YIQB 1CLYH 3OL2A 5ANMA 2F53D 2A6KA 4OGZA 4D3CL 1XH3B 4DUXA 5CP3A 4GRMA 5EULV 1FL6A 4D9LL 2GJZA 5FKAA 1CFTA 2W0LA 2JIXA 1AGEB 1CDIA 1VHPA 1DQTA 1FIGH 1ZT4A 1P5VA 5TGBB 5DA4A 3QDJD 3RDTD 1R3KA 1WTGT 4L4TE 4LAQH 1X9QA 3IDGA 1KPUB 4X4XA 3WYRA 1MJJB 3B3IA 3QWRA 3KYKL 2HH0H 3RWGA 4GAGL 2DS4A 1FZMA 3PQYA 4XH2B 4Y88A 1WQVT 2AJ3A 3MV9A 4YDJA 2C1OA 3IXAB 4G42A 2ZCKH 4WO4D 4IOSD 3MLTB 2ZOLB 4NQUA 1AQKL 5ECJE 5JPNB 2X4NA 4QT5B 4IRSC 1P7HL 4EN3A 3OX8A 4PJBE 3BH8B 2P5EE 1F11A 3SDCD 3U4BL 2QQKL 5EOCL 3PV7A 4FHBD 4I77L 1DQMH 3CGTA 1FO0H 1C5DB 4V2CB 3RGVB 5IW1A 3Q1SH 4GRLA 4KWUA 1JPGB 1JYXA 5T1DL 4KVCH 4QF1B 3IFOA 3H3PH 1NEUA 2BY1A 4KK8C 2ARJQ 5F93C 2H3NB 4ONFL 5DMKB 1IAOA 1X6NA 1I3UA 1T4KA 5HI4C 3ULVD 1F4XH 1VESA 4UT9L 1KNOB 2NX5D 3DMMC 3MLYL 1G7JA 3OTTA 4OCMC 4LSSH 5E5UB 3JWDL 3BEWA 5CGMA 2VDMH 3O45A 2R2EB 3F62A 3P4MA 1Q0XL 3VXUD 2R39A 4CVUA 4FQ2L 4LLUA 4PD4K 5HSFA 2YBRB 4WUUD 1IGCL 4PJ9B 1V7NH 4FQLH 4KMTH 3GIVA 1ZVHA 3RWIB 2DQJH 3PUCA 4C57C 2X89A 4RFEA 5FHBL 2VERN 5JPMB 2F19H 2X10A 1Q1JL 3BKYL 3MJ8A 4AYFA 2J8OA 3TT3H 1NFIB 3L3JB 3TO2A 1BZ9A 2E27L 4HG4K 1WFUA 1F8TL 1Q9WA 3MV7D 3VI4E 3QZWB 3MOAH 5IFJA 5EFIB 5EORL 1M05A 4QHNA 1J1PL 4QNPF 2OP4H 3QUML 4KVNH 4FMFA 1AXTH 4IDJH 5INCA 5IT2L 3QUZD 1JNNL 3D3VA 3WS6A 2FZ3B 3KXFD 1FPTH 1A64A 1ADQH 4YDKL 1RZKC 2EEBA 4QRSA 2OTUB 5D71L 5TE4H 4KI5E 2BVQB 1ORQB 1YEIH 3C6LA 1I85C 4PJDA 4FQHA 2NY0D 4TUJA 4OCYL 1UB5A 2VZVA 4DQOH 1Q9KA 4Y4KA 3SCMC 4N0CC 1CFVL 2IQAB 3QUXC 2UY7A 3W81A 3NZHH 1SYSA 2ZPKH 3CXHJ 3O8XA 1IAIL 5JW5A 5ALBL 3C60B 1FVDB 4TVPD 1QA9A 2R69L 2FYYB 3SKNA 4OUUB 5J13B 2CK0H 3GSXA 5FKAB 4HUMB 2DLTA 3GMNA 1N8ZA 1LNUA 1T7YA 3R1GL 2JIXB 5D6DA 2WWMC 4DKFH 1VFUA 1UQSB 1R3KB 2BXZA 2CLRA 2A38A 4X4XB 3W11C 3RY6A 1PDKA 1UVQB 2DQIL 1ZE3C 1S3KL 2YD3A 4LSRL 5IWLA 3M07A 2FJGA 5FYLL 5KN5A 5J1AA 2IAMC 4ZXBD 5SWZD 4CW1B 1DQQB 4YDJB 5EU6E 1K3IA 3QFJB 3ZE2E 4G42B 3UDWA 4M48L 2A73B 4LVOB 4NC0B 2UV3A 4KZDL 1VFBA 3HAEA 2WV3A 3QSKB 4RAUA 2X4NB 5F44A 4WHDA 1JHKH 3JTSA 2J5LB 3OX8B 3INUH 4EDXA 2V2WA 4WIQA 1OM3H 5T1MB 2BCKB 3UTQA 1ZK9A 1UKSA 5ADPH 4FFVC 5JW4Q 4I18A 3PGFL 2D03L 3V0VB 2NCMA 4OV5A 1T7ZA 3U30C 1EDQA 5DRWA 2FX8H 4ETYA 3P0VL 2EXYC 5C6TL 2E6QA 3MLRH 5IW1B 3V8OA 4OFYA 3OKYA 1EGJA 2VXVH 5E1HB 1CGSL 2IALB 3EJZD 1NCCL 1FJ1B 4UNUA 4J3VA 1MH5A 5D1XC 3LKSA 2PO6D 3OHXA 1CDUA 2V17L 1A3RL 1IAOB 3R0MA 3T8XA 4RFNB 1WT5A 5IK3A 4GS7B 3Q5OA 4OFIA 1G7JB 2BY2A 3MRLA 5DQ9B 3ME0A 4PBWD 2VXTH 4M3KB 3LB6C 3O45B 1LO0L 3MRDA 1ZANH 3D39B 3P4MB 1IAKA 4X4ME 3TO4C 3SDAA 3ARGA 1TVBA 2GK0B 2Y4SA 1DUZA 1OSPL 1QTYT 3QNZA 5BJTA 4R7NA 5KVGH 3N0PB 4RFEB 1MCJA 5KVEL 1HHKA 2PR4H 3C87A 1IE5A 3V7AE 4TSAL 5J9PB 5L88L 3AFLA 4RGMC 3UBXI 1MFAH 2HKFL 3H42L 5F9JB 3C5JB 5IVZB 3BP4B 3SKMB 3QHFL 4TNWK 2DBJA 4MCYA 3D6GA 3OKLA 4EI6A 3EBAA 5IFJB 4HS3B 5F88A 3PGDB 1HSBB 1YNLH 2WBJB 1QFWM 1S78D 4LCUA 3QRGL 3S6CA 3HC0A 4FQCH 2IC2A 4JAMA 4NC1E 4FA8A 4JCMA 4BUHA 4P49A 3L5IA 1WLHA 4AENA 1ZLWH 4Z7NF 2QSTA 5L0QC 4YE4H 4KROD 1F5WA 1N6QL 4OSUH 2DICA 4QRSB 1JZ6A 1OW0A 4MZ3A 1FIEA 5IMOA 2IH3A 1A5FL 1PBYA 4QGTA 1ZWIB 4FQHB 4KKCC 1UB5B 4O51B 1Q9KB 4KDTC 2ARWA 2XRAL 3PE9A 4HG4J 3AM8A 3BD5A 4LEOA 5I1EH 2KZWA 3LH2L 2LU7A 1U8OA 4LGRB 4MJ6A 5JW5B 3VH8A 5E94B 5C0DA 1I9JH 3PABB 4JCLA 5IVXF 4JQIL 4XRCA 5FYJH 4YXHL 3VFNA 5D4QA 1LP9A 4X80L 3OZ9H 4JFZL 5HHMD 1N26A 3OXRA 3LZFH 4Y19B 1M4KA 5C70A 1GPOL 5F7NC 3WJJC 4ODUA 5E2UL 1M71B 3MO1A 3O3UN 3ARYA 4JE4B 3QFJE 3X3FL 3O4LA 4D9QD 3I75B 5KN5B 5J1AB 1FAIL 2VQUA 4Q6IA 5DC4B 3FMGH 3NCJH 3KGRA 3HAEB 5GS1C 1FG9C 1EV2E 3JVGC 2H45A 1EHXA 2YPLA 2MKLC 2Q76A 1NGWA 1IT9L 4YHZH 2AABL 2F5AL 1NDMA 1GIGH 2Q7NA 2A1WH 2V2WB 4LSPL 4OD3H 1CXIA 3GHEH 4H88H 4LEXL 4Z76A 2GFBB 4I18B 2Q1EA 1XIWA 5DD6B 5GRUH 3BESR 2W65A 1Y6MR 4NN5C 2M8XA 5FHAL 2ICWA 3SKUD 3VG0L 2VLKD 1MHEB 4RMVA 3ZHLA 1DBJL 4HPYL 5GS0H 1U93A 3LKSB 1RQ5A 4I3RL 2BRQA 1ND0A 3T8XB 2VQ1A 5IK3B 4R97C 3MRLB 4WCYH 2EE9A 2EDXA 3D39E 1CTOA 5C0EA 3MRDB 2VLLB 4OZ4A 3OR7A 5KSAC 2CD0A 1JGUH 2P5WA 3C6SB 4FQXC 4UAOB 1TVBB 4PP1D 1DUZB 1U0QA 4L3CB 1JI2A 1WZ1H 1NMCC 3QNZB 2YRZA 1KT2A 2CKBB 3QO0A 1MCWW 1NCTA 5FO9A 1EEQA 3UO1L 1FV1A 1HHKB 5IHUL 4EJ1C 4WJ5B 1RMFL 2WP3O 3MUHL 4BQ6A 2FBJL 3I2CL 3QXVA 5LBSH 3OKLB 5IJKA 4D0CB 3MROA 1EO7A 3WXVH 4GG6E 1CICA 1E4JA 4I0KA 5F88B 1XF3A 5MP6H 4UDTA 4AG4L 4JO2L 3BRDA 4OF6A 2I27N 4JAMB 3BPNC 5GRJL 1Q8MA 3H3KA 2FO1A 4NPYA 3ARFC 4AENB 3VXPA 2VITA 2D9CA 5DMIL 3T2PA 3I9GL 4OD1H 3CFBA 1LEKA 5CP7B 4KY1L 4PJ8C 3RAJL 3BMVA 2GSGA 5IMOB 4LP5A 4XVUC 5IR1A 1TNMA 3NIFE 2W91A 3JWOH 4ZFOA 2OK0L 1VERA 4NFBA 1T22A 1NL0L 3E6HA 2V5YA 1E4KA 2NXYB 4TYUA 2UWEB 3T65A 2DYPB 4LEOB 1SY6H 2JJTA 3FAWA 4IIQB 4KK8D 1L7IH 4KJQC 4KUZL 4MJ6B 4PLKC 5GXBB 5HI4D 1IFHL 3M8OH 1BM3H 5JR1H 1IGJA 4ZDHB 1IM9D 2Z31A 4BFEA 1G7HA 3VFNB 2K7QA 4LCIH 4QTIL 3GSQB 1U3HC 4Y19E 1HEZA 1CFSA 4LF3B 4AM0A 4P23D 3PXJA 4JY4A 3V52L 4ENEC 4JRWA 1RK1A 4TOYL 2VAAA 2XN9A 2Y9RT 5TF0A 5DJDA 1MCEA 1XGQA 3O4LB 3LIZL 1G0XA 1GSMA 1U3ZA 1IL1A 3CFKB 3HZVA 2YMXL 3MR9B 3QIWC 4Q6IB 3DJ9A 4MJ5A 1YYLH 2DWDA 3DXAD 3T0EC 5GPRA 3E3QC 3DUUB 4MJID 3DVGA 1EEZB 1A4KA 1O0VA 3UYRL 4BFGA 4CMMB 1F2QA 5B8CA 4IOIB 2H32A 2XXMB 3QO1A 1T89C 1INEL 2DQGL 1H3XA 1VACB 3VDBA 4Z76B 1K9TA 2JCCA 5H94A 2LAGB 3BUYA 3GI9L 5I0DA 1XIWB 1ZAGA 1Z2KA 1NBQA 3FQWB 3G6JB 4G6KL 4K55A 2ICWB 2VSCA 1CG9B 4NZJA 5E6YA 1O7SA 1FE8L 4HHAA 4PYGA 5HBBA 5DO2C 3MMEA 4X6CA 4OZ4B 3HKFA 1IC1A 2ADJB 3GDBA 1AC6A 5J3HC 5BZDA 3LN5A 3KPQB 5CD3A 3GBLA 2NY7H 4S1RL 5JXEC 2W9EH 1KCVL 2A9MH 1BEYH 4HFUH 1BD2B 4KTYA 1L9MA 1KT2B 5CINH 1MCOL 4LCCC 5E6ID 3CZJA 4Z7VF 5D7JD 1TETL 1XR8A 4JG0H 1KCUL 3RVTC 1RZIA 1KJ3H 2A74A 1DLFL 1R3LA 1AY1L 2WWMD 4KJYA 5GSRA 1U58A 2QSCH 4U7SA 3KPLA 3DYMA 1DZBA 3MA9L 3TJEL 1A7RH 4DWHA 4WU5A 2OJZL 2IG2L 32C2A 3UROR 5TE6L 3L6FB 4DW2L 3EYVB 3MROB 2BRRH 1P2CA 1CICB 3CFCH 4UDTB 2IH1A 1PZUB 1GVIA 1RURH 4UDUA 2GCYA 4Z7WF 4JREB 4D0DA 3NPZB 3KPRD 1FBIH 2KPNA 4K71B 4X98A 2YWYA 1X5KA 1A6PA 2CJUL 3VXPB 3MGTB 4HDIA 3KWWA 2JE8A 1CIDA 4GAJH 2WW8A 5AD0A 3OAYH 5CBAA 4GO6B 3WJLA 4HS8H 1J0ZA 3RJDA 3EYUH 5GZOC 4JQXC 3CPLB 3RP1A 5ICYA 4JDTL 2GSGB 4FFVD 2EH7L 1W8OA 4U1GB 3S5LA 3M1BA 5LWYL 2BXYA 3MJ9L 4K3DL 4JFFD 3V7MA 1FNEA 2UWEE 3ECBA 3E6HB 3HUJB 3N85H 4OCXL 1SJEB 2P8LA 2FX9L 2CK2A 2ZJSL 4I0CC 2YKLL 4YHKL 3UC0H 4OF3A 3QNYB 5C0CA 5T3ZD 2G5RA 2V2TA 1BJ1H 1IGJB 1MIEL 3EJYD 3BKMH 1X4ZA 4JFXA 4ODTH 3LB6D 1AO7B 5DTFB 2AEQH 4G43B 1HEZB 3CSYA 1PY9A 1FGVL 1A14H 4MB5A 4JY4B 3TO4D 1OAUL 2OBGA 2PYEA 1RK1B 3N06B 2VAAB 4PJXA 3O4LE 1QPPA 4Z5RA 3U7WH 1WBZA 4H0GA 5EWIL 5BVJA 1XGQB 4U6XA 5ITBH 3S3JA 1BGXL 4YLQT 5C0FB 4XXDA 1IL1B 4F9PA 1U8NA 5DJYA 4L8DA 4MJ5B 2DWDB 4R4FL 3SGJA 4Q0XL 4IHOB 2GJ6D 4TPRH 5ID0A 1U3JA 1T04B 2AXHA 1DSFL 2BVPA 5I8OL 1I8MA 4ERSH 2H1PL 4J6RH 3TH4T 1H3WM 1R3HB 3S7GA 3QCTH 3FL7A 1W0VB 1MRCL 3GSRB 4KKBC 3QO1B 4HFWA 3VA2C 3OGCA 4Q9QL 4KMLB 4EN3C 2FD6L 5GGSA 2OR9L 5KANI 2B0SH 3BUYB 5IQ7H 3G6JE 5ENWA 4DTGL 1UEYA 5FCUH 1YPZA 4BH7B 3NFNA 2VQTA 3EOBA 1H8NA 4OGYL 5DD3L 4P5TB 4GRLC 4G9FD 4Z78B 5KJRH 3JWOC 3QI9D 1DFBL 4Z95L 4MAUH 3MLVL 4KUCD 1OY3B 2NZ9D 4DGIH 2D7MA 2MPAH 5EB9A 1UXSA 1QHPA 4X6CB 1U8KA 5JW4M 2FHCA 1DDHA 5BZDB 3LN5B 5IHLB 4FTVD 1BD2E 3L9RA 2QLVB 2W0FA 2HG5A 2AS5M 2WANA 1MWAL 2DQEH 4AH2B 3GFUA 2RAMA 3VD5A 3QPQC 2EKJA 1F3RB 3DI2B 4LSDA 5D2LF 3FO1A 4WTZA 1OP3H 5MHSE 4BZ2L 4O4YH 3BO8A 3FN3A 4CJ1A 1RZIB 3HMXA 3SE3A 1U58B 3ARED 3KPLB 5IB5A 1G9EA 4ELMB 4HIJB 2LVCA 2HWZL 4FZEL 3VRIB 32C2B 3LQZA 2XKSA 1V3LA 2ZOKA 1RHHB 3HZKA 5D7SH 1ZHLA 5IKCA 2IH1B 1I9RL 2GCYB 5IESH 4NKOA 1OL0A 3FOLA 5E8EB 4D0DB 4HQQH 5DI8B 2NXZB 1A7QL 4KUCF 5MERB 4X98B 3W39B 1IGIL 4LSTL 5ITFA 3LQAL 4GH7B 2R0LL 1WWAX 2AVGA 3KWWB 1D7FA 2LAAA 2G60H 3MNWA 4MQXC 5AD0B 3LSOA 5C08D 5CBAB 3EYSH 2VLRD 3WS6C 5I1AB 1MJ7L 1PYWB 4O2CA 4WI3A 4XP5H 3S5LB 3BKJH 3HUJE 3SDDA 4TVSa 1ORSA 1FNEB 3ECBB 3VXRB 3CC5A 1KBGH 3TN0A 4NUGL 3ZDZF 5I73B 4OCSL 2R4RH 2YSSA 5CLWA 3A67H 4Y4KC 5L9DH 4XVJH 2EYTA 1IARB 4OZGB 1EO8H 4WU7B 3O8XC 3RTQC 3W9DB 1CK0L 5ADOL 1RIUL 3IFLH 2V2TB 1AO7E 4LIQL 2ZSVA 3MOBH 4OLVH 1OCWH 5D72H 1QFUL 4PJ7B 1X5XA 5I16A 3BPOC 3HRPA 1YMMA 4C56B 5GS3A 3CSYB 5D6DC 4PRBA 5LJYH 1BLNA 5I1LB 2UUDK 3QHTC 2DM3A 5F1KC 1WBZB