3MBEB

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
184
structure length
178
Chain Sequence
RHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 178
sequence length 184
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3mbeB01
1BOYA 2CO7B 3O3EA 5CEXA 3C09B 4HT1H 1W72A 1U3YA 3MBXL 5BO1L 1AP2A 5D72H 3QRFM 2CRZA 1HKLH 4ZPVB 4J3WA 3CC5A 3WDIA 3LIZL 5MHSD 3KNBB 4ZO8A 1D3CA 5MHSE 1A7OH 5LCVH 4GO6B 1X5LA 2R1XA 3VXQA 4PGEA 2BSED 1EGJA 3GGWA 1LE5A 3OKOB 3PHQA 2R4SL 5I8EA 3OSKA 1JF5A 2MQCA 3HHRB 4Y1AB 5I2IA 2VDML 3K4DA 1OTUC 1M7IA 5EA0H 3RWJB 4FABL 3AMLA 1ZHNA 3FQTA 2EIDA 3N85L 3WIHH 3AM8C 3FRUB 3UZVB 1J11A 5CLTA 3MGAA 3I6LE 3IFPB 1ZAGA 2XZCL 5DD6B 2D2OA 1FFQA 5EO1B 3BDBA 4O5LH 3ARFB 4H1LB 1U8PB 4JB9H 5D5ME 3IETB 4M9PA 3BVNB 2XKUA 4ZFFA 2NY3C 1OSZA 3NA4A 1Z3GH 4YX2H 4U1NB 3IDMA 3AVEA 1A7RL 3FB5B 1CXFA 2YPLD 1DEEA 5D7KE 3SE3C 1TDQA 5F7DB 2O61B 4FZEL 2VRAA 3HAEB 2PYEA 2VKWA 3UJTL 2YPLE 3VXSB 2CDFA 3FQUA 3WO4B 1M7DB 3OKLA 5JOFA 1XT5A 5F9JA 3MA7A 1T21B 3O4LD 4WJ5B 1X5AA 1E4WH 3EFDL 4DZ8A 3VGGA 5IVOA 1FDLL 5A3ID 4CW1A 1IEBB 4Y4HA 5KG9B 3PGCA 3RA7H 1UKQA 4K9EC 1O7SA 3GSQA 3MV01 5F89A 3UYPA 5I71C 5DI8A 3ZYOA 1OP5K 2EE3A 3ZTNL 5TPWL 1RZ7H 2R8SL 1LVEA 3RDTB 3R06B 1HDMB 3QZWG 5CP7B 4U6XA 4DCQB 4WEBH 1VB9A 1A7PH 4WO4A 1QLRA 3JWDL 3ZDXF 2K1MA 4JO2L 1L7IL 5C0DA 3RL1A 1CDBA 3AC0A 3O41B 4ZFOA 5CP3H 1UB5B 5T5FL 1QQDB 2DTMH 1WBYA 2VDQH 2DQGL 4MS8C 2P24A 4HZLA 1Q94A 5GS1A 5GJTH 2FJFB 3BQUA 1U92B 4K2UH 4CDGC 2QADC 1Y18A 2VIRB 4KTYA 1VPOH 2R0WL 4FMKA 4RWYL 4HPOH 1WFTA 1EBPA 2X4SB 5C08E 4LVEA 3REWA 3TA3A 3D69B 1PYWB 4RRPA 2VXTL 2EEDA 3SDDC 3SDAD 3S3JA 5DS8B 1UQSB 1FSKC 1H9VA 4U1MA 4FQJL 1A3QA 5L6YL 1UCTA 3LQZB 2IEPA 3NFSL 4LEXH 2EDKA 3R1GL 2P5EA 1KLGB 3WHXA 3IVKB 2R2EA 5KVGH 2J2ZA 1TZHA 1FO0A 1I85C 4N8VB 5CJOH 3QEUA 1CZ8H 5JQ6H 3VG9C 2C7UB 3QCUH 5HYQB 1Q9OB 4TTDC 4MB4A 3GBML 4RFOL 4PJ5B 1NLDL 5IJVA 3IS1X 1QBLH 4HIHB 3U7YH 3DX9A 4M3KB 4M1CD 1OAZH 3FQNB 1ZSDA 4X7TA 3HTLX 4P9HH 5D93B 5C3TA 2VSDA 1F58H 2YD7A 1L6XA 1DUYB 1G9NH 4H20H 5EZOH 1T0NB 5KSBB 3IAQA 4HXAL 4PJFE 3B6SA 1XGTA 3LZFH 3D85A 1HSBA 4X6CE 1KLFA 1S7RB 2Q86A 1NMCC 3ZTJG 1B4RA 4L8DB 1XF2B 3UZEA 2YPVL 3VJ6A 2X9WA 1AIFA 2P42B 1IGMH 5FA3A 1YNTA 3QDMB 5IMMA 1JNLH 1N6QH 4MDIB 3IAPA 1U93B 1SYVB 5DHYA 3EYSL 5B21A 5TQ0L 3ARBC 3BI9X 3ULUD 5I73B 5JPMB 3GSWB 2VR9A 4OCYL 2XTJC 3UPCA 1LEKA 5LGKA 4OD3L 4O2FA 5JHDB 1AGEA 3MOAL 4W68A 1T2XA 3RWDA 5EUOE 3FO2A 4M7LL 4OSUL 1I9JL 4EI5A 3E3QE 1EBAA 3BZEB 2HLFC 3ARDD 5E9DA 4G8IA 4L9DA 3VXMD 1MWAH 2R0KH 1C12A 3DUHA 1F4WL 4WFHD 3DNKA 3KXFE 1NGPL 2ILLA 1HH6B 4PJXA 3RVXC 4ZFGH 4XC1H 2EH8H 3U48A 1I8MB 2LVCA 2YD5A 3VXME 3PHOA 4HWZA 3QUXD 5ESVA 4WFHE 2DQUH 2VDRL 4QGTA 2B0SL 2D31B 4L8BB 1S7QA 1AR1C 5FHAL 3DVIA 4X7SH 1MJ7H 3O3AA 2D7MA 1NBVL 4PY8I 5E0QA 4KROB 1CICD 3CLEH 3AREB 2GHWB 3QG6A 4PG2C 4OV5B 4P23B 1MCKA 1RZGA 3MCG1 1U8JB 4I4WA 3WBDA 2QHLA 3GIVA 2P8LA 4RISL 5DRXB 4G6FD 2WWKT 1AFVL 4H5SA 1WTGT 3S4SG 4WI7A 4OTXL 2IADB 3CIQA 3IXTA 3H3PH 2A9MH 4WUUB 3TYGH 3VD5A 5T1DL 2AQ2A 3NIFF 4WV1A 3ZT5A 3F7PC 3L3KA 4PJCF 4NQDB 3TN0B 3BRGC 4L9LC 2CR6A 3LCYA 1S9XB 4G6AC 4CRPA 5CGYC 2ZUQC 1R3KB 3GSXB 4OD1L 4NN7B 1WVZA 5FHBL 3JV0A 3TH4T 2EH7L 3T3ME 3BKJL 2AERT 2FZ3B 2EIEA 2HVKA 1X6NA 4OFYD 3JZ7A 4JHBA 5DJ2B 4QXWA 3PL6B 3LY6A 2EE6A 3BH9A 1GIGH 4M8VA 3WUWA 1R5WA 2DYPA 2ED9A 1XR9A 4I3RL 3MRNA 3U82B 1A3RH 3HC4H 3U9PH 3C2AH 5D2LA 2ADGB 4OLVL 1GPOL 5EC2A 4HIEA 2D9CA 3QFJA 3MBEC 5D1QA 2HT4C 5F7UA 25C8L 3QUYB 3VFTB 1MFDL 1RULL 1H8OA 4PRIE 2YUZA 1JE6A 4KUCF 3QNYB 3S5LA 4EKXA 2PN5A 2CIKB 5IVXF 3GB7B 4XPTH 5IMKB 5I1AB 5EBMB 4FQPA 1FZJA 3D3VD 4BK5A 4N0UB 4KK6D 1U3ZA 3H9YA 4NCC1 3MGTB 1I7UB 1A1MB 3FCTA 1YPZE 1QSFA 3QXAB 1J10A 4S0TD 4PJEF 1D5MA 1XGRB 1FNLA 5T1LA 4S1QL 1DQJB 4YHOH 1MCPL 4WVRA 1A7OL 5JORA 1BVKA 2HFGH 4Y19B 2WSKA 1JF1B 5C0IB 3MTRA 4E0RB 2M8XA 4NCC2 4PJBE 4HLJA 4B41A 4Z0BH 5F7LB 5HD8C 4Z0XB 5EA0L 4HUKB 4F7TB 1RUPH 2LABA 5DTFA 3BMVA 3CZFB 5EWIL 3U30B 2NY0B 1G7MB 2VDPH 1QD0A 3UZQA 2F8VA 1OAUH 1JIBA 4L1HA 4O5LL 3KYNB 4Y5XB 2OL3A 4JB9L 1XFPA 1NDMB 5EN2A 4NQXA 2X4PB 1X5FA 4TVPE 2WZPD 5DRNA 4N68A 5HGHA 4DKFH 4PYGA 4IOFD 1AGFB 2EICA 1NGZB 1Z3GL 3SGKC 4IIQB 4I3SH 4YX2L 1LO5B 3KPSD 4NM4L 1FRGH 5LXGL 1MCEA 4KK5D 5GRXG 2JJSA 2ENSA 3T1FA 3KPSE 3UTTE 1JTPA 2W91A 1UB6A 4DW2L 5EOCJ 5TQ2H 3HFMH 5FKPB 5ICYB 4GW4B 5IFAH 4ZPTA 5FCSH 3MJ6A 5E2VL 2J1KA 1TJHH 3WJLC 3ARGD 4GMSH 1FHGA 4IM8A 2P8MA 1E4WL 4XPHL 2A74A 2CK0H 4GKNB 3K8KA 4RBPH 3MCLH 3MLWL 1P9MC 5DQJB 1T7WA 3RA7L 3S96B 2IWGA 2FYYB 1WT5C 5TE4H 2GSGB 4JVWA 3AS0A 5EOQH 2XPGB 3SPVB 4Q9BA 1KPVA 5B3JF 1ZTXL 2R69H 1UXSB 1LDSA 4NKMA 2F8XC 2AXFB 2UY6A 5E6ID 4WEBL 5D71H 1FYTA 3K74B 4O2EA 4JJ5A 1ZT4A 4FQXD 4KKLC 4HCRH 2DQTH 1CDUA 2CKBB 4LHUB 4NHCL 1S7VB 1U3HD 1GGTA 4ORGB 1VGKB 4M00A 1FZMB 1XGQA 4Y4FD 1MAKA 3JTSA 3ZE2F 1PG7H 5HI5C 2H32H 4TVPL 4GQ9H 4UIMB 3PWNA 4E42A 5C0FB 2V7NA 5GJTL 3RJQB 1FV1B 3LB6D 3PIQA 4RIRA 5AYUH 2P43B 3BPCB 3D2UA 4HQQH 4P48A 5KSAC 4MNQE 4P5TB 3OWEA 3C8KA 3OAZK 4JKMA 5D7LA 3QEGH 3UPRB 3MJ7A 5EU6A 5CFHA 2KH2B 5K9OA 4S2SA 1FNHA 3SKOA 1CGXA 3P4OB 2Z31C 1F6LL 3QQ3B 4LEXL 4XZUA 3PABA 2FEEI 2VWEC 1WWAX 3VW3H 3MRRA 1S5HB 4F33B 2XNAA 4YDLB 4U1KB 4HBCL 3BN9C 4ZG1A 5GRVK 2XA3A 4X6EA 2E9IA 4F3FA 5FO9A 4MGXA 1JF6A 4NN5B 2E7BA 3QCUL 2AK4B 4PV8A 4OT1L 3RX5A 4PRBA 1DN0B 1JUFA 2XFXB 4R4BA 4P2QD 1QBLL 4QY8B 3U7YL 1CDCA 4EQ2A 1U8IB 4XNQB 1MRDH 1OAZL 4PD4J 4NZDA 2X4RA 1ED3B 3IFLL 5E2UL 3PNWA 2AJUH 4P2QE 4P9HL 5BZWB 1F58L 1LK2B 1YYLH 3VFSA 1MVFA 1EMTH 1G9NL 3LEVH 3MRIB 3B9KA 4H20L 4ZSOA 5EZOL 3TJEL 4PUBH 1EHNA 1TQCB 5HI3C 5DD5H 5J13B 4FP8L 4GBXC 1NC2A 5IUSA 3FFCB 1H3WM 4PJ8A 1DE4B 1G7IA 4NGHH 2AEPH 1I1AC 2N4IA 5I18H 2D3VA 3QRGL 2OR8A 4N0RA 1JNLL 3CPLA 4PJCB 4GG8A 3ARQA 5ENWB 4GS7C 3BPNB 1JGEB 4Y2DB 5CSGA 2NXYD 2YWZA 5BV7L 4MJ2A 3OX8A 3T2PA 1BOGB 2OJEA 3QH3B 1B9ZA 1HWGB 4R3SA 4JQVA 3F58H 2G9HA 3SDXF 1KGCE 2Z92A 3O4OC 2YPKA 3TYFA 4C56A 3OKNA 3KHQA 3GJFH 1CXIA 4XP4H 2DBLH 1MWAL 2R0KL 2YSSB 3LDBB 3MR9B 2Q20A 3IDUA 5A1AA 4ZFGL 4XC1L 3TBWB 1I4FA 4PRDB 3FQXB 2DQUL 1JVKA 1A7NH 4JDTH 4NBYB 4WFED 3BE1H 3X12A 4CAGA 5BZDA 1ORSB 1IAII 2X05A 1E6OL 3CLEL 1KTKE 2IH3A 3GUTB 5E1AB 5LGJA 3QWRA 4NNYB 3FQWB 5IVXB 2AJZA 4PGDB 4N8CH 3SKNA 2YA0A 1LO2H 3RUGF 3O6LH 2UYLB 4TOYL 3SE4C 4CADA 1VFMA 5DJCA 2IH1B 3QYCA 1TTGA 3BP6A 3ARTA 5I6XB 4M62H 1YEKH 4G9FD 3DTXB 2QSCH 3H3PL 3TYGL 1IARB 3WNLA 4G9FE 1V3LA 4PJEB 4X98A 1LP9A 4F15C 5E2WH 3VFRB 4JFDA 5L8KB 3QEQA 4X6FA 2XN9A 4U1HA 2G5BB 2P7TA 3IDYC 4U1JA 5SWZB 1ORQB 3UXFA 1S7TB 2AJVH 2C26A 3P73A 4OIBA 1WAAA 1I7RA 2VL5A 1QYGL 3CSYB 1GIGL 3FT3B 3K46A 2ZPKL 3VXUB 4OF5A 3W11C 1SJXA 2N1KA 1NKRA 3QPQC 4Y1AD 5IR1A 1FZOB 3HC4L 3U9PL 1GC1C 2BX5A 4I2XB 5IW6A 4Y1AE 2G75A 4IDJH 1HHHB 3H0TA 4ZOBA 5DEGB 3I02A 2Q3AA 2KDGA 1TMCB 4IRZL 2HKHL 4M48L 1UJTA 2ARJQ 4PJ7E 4QXGL 2FX8L 5E00B 2E8ZA 3VFGL 3ARFD 4OM1L 2A77H 15C8H 4HAGA 1KACB 2R9HC 2XRAH 3WN5A 4RSVA 5GSVB 4XCCL 3IDGA 4GXVL 1OB1A 1DCLA 5D96C 3HB3D 2D0GA 1ACYL 3SY0A 3QXDA 1A7QH 5FA4A 5HHNA 5JXAL 4QOKE 4IBLT 4LMQI 5KVFL 2GJ6A 2X70B 4HWBH 5GZOC 2JELH 4ODHL 3VXSD 1J8HB 1ZA3A 4FA8A 1EJOH 4PV9B 2R2CA 4JPVH 1JZ8A 1X4XA 2VABA 1AKJA 4GAJH 3ARSA 2HFGL 1K5NB 3BEVA 1HHIB 5SX4H 3DMMA 3VA6A 2LTQC 3RX8A 4KXZH 4QGYA 4Z0BL 2HKFH 1N4XH 3FAWA 1BJ8A 2B5IC 3GNMH 4G8EA 1GAFH 3UTQA 4R9HA 1AO7B 5EZLB 3RDTD 1KFAL 4PLOB 1EAPB 4KJQD 1TVHA 1TJIH 4JPIB 2WBWB 5DYOA 2VDPL 4NRYB 4OCXL 1SEBA 4KTEH 3EDEA 4PB9L 5FGRA 2YD8A 1OAUL 5FEBA 2Z4QB 5IHUL 3F65A 5D7JC 5EIVA 3MOBH 4KQ3H 1RD6A 3ARZA 4O2CB 1D5IH 5HBBA 3DXAA 4P3DB 3OR6B 3TJHD 4DKFL 3F7RA 3MXWL 2W1NA 2H2PC 4UOW0 5DVOA 4I3SL 2IAMD 2X10A 4N1CA 3WXVL 1FRGL 5J1SC 2VQTA 1MF2L 3K81A 4JO3H 4PG9B 5BMFL 3CU7A 1MVUB 2ATPB 1GZPA 3KPNB 1KN4H 5TQ2L 5DJYB 2E5EA 5JMRA 5EO9B 1NQBA 2OR7A 1WCQA 1XIWA 4UUJB 1DANT 1V3MA 5LBSL 3PP3K 2XG5A 4GMSL 4JEGB 2I26N 4U3HA 1Z6JT 4MB3A 2J8UF 2CK0L 2XZAH 5DJZB 3SGJC 4RDQF 1KEGH 4E5XB 1FVDB 2NXZC 5FDYA 4ZUWB 5TE4L 1P4LA 2VAAB 1MY5A 1BM3H 5CJBA 4G7YH 3SOBH 4ELKA 1IGJA 1CLYH 2E6JA 2R69L 5SWSD 3WHE1 1CFTA 2NW2A 4PJ5D 1N7MH 4L4VE 1EFXA 1YEJH 1RY7B 1TZGH 5SWSE 4KUZL 4PJ5E 4HG4K 5CBEB 3IAGC 4JLRA 5KVDH 3DUSA 2Z35B 2XY1A 2EECA 1A1OB 4OZHF 1P7KA 5CWSA 1PG7L 4GQ9L 2OTPA 4MAYB 4WTXA 5EU5A 1BIIB 4IOIB 4XVUD 3V4PL 3C5SB 4JGJA 4HQQL 5GGRA 4JANB 1MIEH 1YQ2A 5I8CA 3QDMD 3UJIL 1OW0A 4X80H 1GGUA 4NQEE 4AIXA 4PJDF 1QSEA 5INCA 3QDME 1U91A 3N1GC 4P3CH 3MRQB 4K55A 3SDXB 5JHDD 5T33H 5J7CC 3MC0A 3IDJA 5JHDE 1NH6A 5C0RL 2IGFH 2X5PA 2BCKA 1HYSD 1HINH 3W5NA 5B4MC 4X5WA 1AI1H 2NY2B 4L8CA 3QT2A 1KJ2H 1H3TA 3AY4A 1QUNA 4YBLB 2NY4B 4CKVX 1CIUA 1BVLB 2GCYB 4M3JA 1WBXA 1P2CA 2AJUL 4WEUD 1YYLL 5HDBE 1EMTL 3LEVL 4KROD 3U36B 1T1ZA 4LLMB 2V9TA 4UDUA 3AGVA 4PUBL 3ARED 1CXLA 5ICXA 3RUGB 4MX7B 1IGYB 1NLBH 4P23D 4WFFD 5CCKH 2YUWA 5J1TC 2JKXA 5J1AA 2ZOLB 1HILA 4LGRB 4KKNA 3CVHA 2AEPL 1ZLWH 4YHYB 3QFDA 1FE8H 4WFFE 2AJSL 1H15A 1M6OB 2NLJA 5HYSG 5DVLA 1NJ9B 4WUUD 5C70A 3KPOB 5L9DL 3VXPA 4J23A 3LKRB 1AD0B 4ZOAA 3GK8H 3RI5K 4NQDD 1ACZA 3UDWC 4X4YA 5I17B 1AQDA 3QDJA 1EUUA 4M93C 3F58L 2CLVA 3BPOC 2WBJA 5D1ZC 4OCRH 3DHMA 4EDWH 4CMMA 3N1PC 4GRLA 4K7PY 4MJ5A 1KLUB 3E8UH 2CLZA 4XP4L 1MPAH 3PL6D 2CR3A 1KG0B 2BVOB 5CIPA 4E41B 2XT1B 4CVWA 1U2HA 4BSVA 4R0LB 4UILL 3ZMRA 4JDZB 3S88H 1F3JA 4JDTL 4F7EA 5ITBL 5F9WB 1E0OB 3BE1L 2NY1B 5ETUB 1JPGB 4KJPD 3W0WA 4U49A 1QLFB 1ADQA 4WWKA 2DIAA 2ZJSH 4HUVB 1YEIH 3VRJB 1RSFA 5F7WC 3T2QA 2F54B 2OK0L 2E6PA 4YDIH 3FT4B 4N8CL 5F7EH 5C0BB 3UTZA 1J88A 5JW5A 5IQ7H 1LO2L 5BCAA 1FAIH 3VWKB 5IWLC 5C07B 3MREA 3IFNH 4YPGA 1TNNA 4MA8H 9CGTA 4BUGA 2F74B 5FO8B 3H9SD 2MQ3A 3QULA 2H9GB 4M62L 1YEKL 2QSCL 2ZWLT 3QCVH 2FSEB 5I19H 1KB5B 3VXOB 3H9SE 4HK3N 3O45A 5D7IF 1BEYL 4LCUA 4N0UE 3OKMB 1CGTA 3RZCA 5E2WL 4TSCH 4ONHA 1UYWH 4XMPH 5IFHH 4X0KA 1MRCL 4Z5RA 5INDA 5HPMA 4MQXD 1MSPA 2F9BT 2DL9A 5CUSH 3OF6A 1F4YL 5EC1A 3DVGA 5JMOC 4WW2A 1BZ7B 3VDAA 1SYSA 2AJVL 4QRSA 4Y19D 3RVVD 4FNLH 4JQXC 3QUMA 3O3EB 3ULUH 1IKNA 1BD2B 3QHZL 3BHBA 4RBPK 1N6VA 3VXRE 5JHLH 1Q0YH 1AP2B 5K9JH 4Y19E 4HJ0D 4QRPE 3MLYH 5GGSY 1BZQK 1CFSB 1TLKA 4Q9RH 1N3NA 3AXLA 3KWWA 3HMXH 5TF1L 1E4XI 3RZWA 2N7AA 4PGEB 1J0HA 4HUXA 2ESVB 1LE5B 1NGYA 1P4IH 2NY0D 5IT2H 1WITA 5A3IC 3PHQB 1U8HA 4YEFA 1NFDF 2X4OA 2GITB 4HUMB 5I8EB 5JW4Q 4FFYH 3Q1SH 4OFIA 1H5BC 4C57C 5I2IB 4RFNC 1IFHH 4IRSD 4EVNA 1I3RA 2A77L 15C8L 4M61B 2XRAL 5A43C 1KPRB 1G7PA 4LCCA 2FX9H 1IGFH 1X7QA 1BREA 4X8JB 1DEDA 5TH2A 3UPAA 1H3XA 5B38G 2AJ3A 3CFDA 3SO5A 1LQSR 4L8SB 5DJXA 1A7QL 4LSRH 5LGHL 1G7QA 3G6JE 4P2RA 3QUKB 1U8NA 3RNKB 4R4ND 4OIAA 4HWBL 3EFFA 2JELL 3OAYK 4R7NA 5E56A 4BA8A 1MQKL 3HRPA 4XT1C 1YC8A 3FB6A 4JY6B 3IB4A 2J8UB 1OAQH 4NO0A 2VLRA 4ZFFB 4JPVL 2OBGA 4LCIH 3N1MC 2K7QA 5IB4A 3IDMB 4GAJL 3L5WA 2EDFA 4RGND 5CHNA 5FYJH 3BDYH 4K7FA 4NO3A 4RGMC 2PYEB 4RGNE 4ESKA 1MELA 3F6IA 4S1SH 5FGBA 1RURH 5F72S 4EN3D 3FQUB 4TNVF 2HKFL 1N4XL 3VI4F 1IM3A 3GNML 4MVBD 1GAFL 2DLTA 3SDAC 5JOFB 2DWDA 1BBDH 1YUHB 2UWEF 1T04B 4OIIH 5F9JB 5LJYH 4X4MA 1TJIL 1F4XH 4DZ8B 4NC1E 4NO5A 4M8QA 4Y4HB 3UEZA 3GSQB 1QHOA 4LHUD 1BHGA 5DI8B 2VNCA 4RZCA 3MOBL 3MYJB 1BPVA 3GHBH 1CGWA 1D5IL 2Z8RA 4NUJB 1RK1B 1VSCA 1XCTA 2H2SD 3VA2C 4PGJA 3E6FA 3F12A 1EVTC 3K8MA 1KPUB 1A5FH 4N9GA 5C0ND 1CCZA 1VDGA 4JO3L 3WKMH 5CGMA 4ZUVA 4UQ2B 1D6VL 1F3RB 4LLWB 4M1CC 4PJDB 5C0DB 4NJ9H 1KN4L 3LN5A 4KY1H 1U8LA 5ITFA 3MRHA 2Y36H 4LDLB 3VFNA 2BVYA 4Z7UA 4KJYB 1RZ8B 5I1DA 1U8OA 5GS1B 3T09A 1VEPA 2H45A 3BQUB 1PKQE 5D9SA 4DKEH 4F57L 1XGYL 3EYQD 4Y88A 1Y18B 1N0XH 2XZAL 5T5NF 3OHXA 3OAUH 1BWMA 2EYRB 3MRKA 4R96A 4UV7L 1NFKA 3TA3B 4ETQA 4NNPL 4WUKH 1HXMB 5F96L 1LE9A 1YEFL 5HHMB 3ULUC 4OI8A 1JZ4A 4F7MB 2CH8A 2AK4D 4U1MB 2VB5A 1MCOL 1RJZA 1N7ML 3SE8L 1YEJL 4I0KA 5FYLD 3E3QC 2R2EB 3UTSB 1DN2A 1DQDH 5KSUB 1WZKA 1SY6H 1NSNH 4U6VH 2HJFB 5FYLE 5C8JA 1FO0B 4AEFA 1JPTH 3MCKA 2HRPL 3DIFA 3MUGA 3ARDC 1NEZA 3OKYA 2YBRA 4LP4A 1DBBH 2AW2A 4OV6F 1BAFH 3O6FB 4PJHE 3FFCD 3MROA 4GAYA 2Z8WC 5FGCE 2ZG2A 3QUXC 5FECA 1X6LA 1FNGB 4LSSH 3CFBB 3FFCE 5FM5O 2JIXB 3GDBA 4R4FH 1K9TA 1CICC 4WHYG 1T0PB 3RWEA 3B6SB 3EYVB 4Y2DD 1EDQA 4P3CL 4QTIH 1HSBB 3N9GH 4GRMA 3QAZB 5I8OL 1N5YH 3G5YB 4HUUA 1J7VR 3IRPX 1DR9A 5H35A 2GTZB 1UVQA 1I1FA 4WY7H 2A83A 4M5YH 4F2MA 3AU1A 4OZIA 1HINL 5ICZA 1AI1L 1IAOA 1CGSH 4OZ4B 5DEZA 4TSBH 4AT6A 3RWFA 3TM6A 5DF0A 4AQ1B 4JKLA 5I30L 5FB8B 3RWDB 1T22B 3HR6A 4EI5B 4W6XB 3HI1A 3QJFA 2B8OT 3AM8A 4KUCD 3EO0A 3V0WH 1UC6A 1D9KA 4BKLB 4G8IB 1WISA 3IDIA 2IALB 3R8QA 4NRXA 5E8EB 5F1IA 4D3CL 5CCKL 1DBKH 3UJJH 3PHOB 2EXWD 4PJAE 5FDWA 5ESVB 5IVXE 1IL1A 2QEJA 1G7LA 1JNJA 2XV6B 4K3DH 2VLKA 3C6SA 4H1LG 1WGOA 3O3AB 1ZT1A 5D7IB 1NL0H 3HR5A 3T8XA 4QHMA 4NT6A 1RZKH 2HTLD 1KJMB 4HC1H 1WCBA 1SVZA 3TCLA 2HJLB 2X40A 3GK8L 4P4RA 5F7MC 3GSNH 2XG4A 2PXYA 5IESL 4I4WB 4JN1H 1QRNE 2P8LB 4HPYH 2BRRH 4PJEE 1S9YB 1P5VA 3HAEG 3G5ZB 3IXTB 4OCRL 3SDDB 5I0DA 1HZHH 4EDWL 5EBLA 4KK6C 5SWZD 2EZ0D 3E8UL 4ODXB 3S36H 1FNEB 3G6AB 3DROA 3L3KB 2DQFA 4KVNH 1CU4H 4HWEH 1JN6A 3LSOA 1EO8H 1YN6B 1JL8A 3PV6A 3VXUD 3S88L 1NPUA 2OI9C 2IANA 2HVKB 2ADJA 1DZBA 1OGAB 3T0EE 1AXSB 1NUDA 2YXMA 4P2OB 2ZUWA 1NFDB 2L4OA 4EOWH 2ZJSL 3OB0H 2VITB 1IC7L 3KR3H 3D0LB 1N5AA 1YEIL 4IS6B 1V3JA 3FN3A 1CK0L 1H3PH 5J06A 4YDIL 3QDGE 2A6IB 1XR9B 1FAIL 5L0QC 1MLBA 2OM5A 3MRNB 1IMHC 1JK8A 2Y5EA 3IFNL 4F7CA 5MEQA 3WFDL 4MA8L 4AMKH 1OL0A 4N5UA 4MA3B 5GRJL 5D1QB 4YDKL 3QCVL 5FM5M 3ISWA 3I9GL 4LL9A 3CCHB 1DQQA 4OUUA 5SX5K 4BSWB 2HLAA 4ZQKA 1X5IA 4WTWA 2FECL 4TSCL 1UCBL 1UYWL 5EOCL 4D94A 5DURB 5FYJU 4ODBD 5I9QC 4J8RB 5CJQH 1BFTA 2IFFH 2J6EL 3MRJA 3KGRA 4IOFC 2OP4H 5ANMA 2Q3ZA 5FYJE 3WFHB 4I77H 2GIYA 1P5UA 1WZ1H 3FCTB 4KK5C 1QFWM 4HD9A 1I85A 4U1GC 1Q0YL 3ORJA 5K9JL 2XICA 3VGAB 2UWEB 1D5MB 4QRQA 1LP9F 4A6YL 4MQ7B 4N8VG 4Q9RL 3D18A 4MJIA 4DK6A 1AO7D 1I1YA 3HMXL 1K4CB 2EE2A 3ARGC 4ELME 1S9VA 5JORB 1CIDA 1AO7E 4KWUA 4RMWA 1P4IL 5IT2L 1HNFA 2OS7A 3VI3F 1IT9L 5FM8A 3WIHA 1A6AA 2VZUA 4U4BA 5E8NB 5A16B 3DX7A 3Q1SL 4M1DH 1IFHL 3A0OA 5DZNA 3C5JA 3QIUA 4G7VH 2CLRB 2VR5A 1LO3H 4NKOB 4NQSA 2FX9L 2V17H 1IGFL 4FN0A 3RKDD 4XNUL 5DTFB 3NTCH 4QHUB 3T77B 3GSRA 4UDTA 5E6IC 1JHKH 3DOSA 5DFWH 2A73A 4LSRL 5C0CA 1REIA 3KLDA 1CDJA 2GY7B 3UYRH 1ODAA 4FQXC 4OF6A 3GJEB 4G42A 1U3HC 2BHUA 5I76A 5EN2B 4NQXB 1IGTA 5HHOB 5HGHB 1OAQL 4Y4FC 5JXEA 1E6JH 4WHYH 3NCJL 2O5XH 4Y0GA 1MFAH 4LRNH 3RY4A 1EX0A 2VDLH 3L3IB 3C2SA 2Q7YA 5FYJL 3LB6C 5BJTA 5HVHC 1JRHH 3BDYL 5BRZE 3G5VB 5D2NE 2XWJB 3M17B 3SKUD 5IK3B 3TBTA 4S1SL 2X4NA 3WYRA 4MXVF 1A6TA 3NN8A 1W2KT 4ZPTB 2ITDA 4WU7B 2Y06H 1MI5A 1WEJH 3ROLB 4OIIL 3LVEA 4L3EB 1MHEA 2MKWA 3SEPA 2RAMA 1F4XL 2VLJB 2FBOJ 1F2XK 5DZOA 4OZGF 4Z78B 1NBYB 2BXZA 4UT9L 3KDMB 4PG2A 5TGBA 2Z0BA 1NKOA 1JPST 1ZHBA 3GHBL 3O3DB 3IJSB 4R7DB 2H41A 4LVHC 4O4YL 5K59F 1ETZB 4PRPB 4NKMB 5CP3A 2QV2A 1XF5B 3N1FC 4LBEB 4K8RL 1OPGL 1A5FL 3B9VA 4NYLA 4F7PA 1YMHA 1ZT4B 3WKML 1HE7A 3CLFH 5J9PB 2DLFL 4NJ9L 1AJ7L 4GXUN 4KY1L 4JZNA 3GO1L 4HMEA 5JW4M 4GG6F 2B39A 1OTSD 4NKQB 2Y36L 1PQZA 2IQAA 4L9LA 5IVZA 3C5ZA 1I3GL 4G5ZH 4P4KB 4XNXH 4V2CB 3U6RB 3D2UB 3F7QA 3OAUL 3S35L 5JZ7D 4MDJA 1DQLH 5DR5H 4LLAA 3V4UH 3MYZA 3MJ7B 3T0WA 1KTDA 4WUKL 4Z7WF 4S2SB 1I75A 3SKOB 1ZVYA 2NXYC 5EZJB 4M43H 2NY4D 2HWZH 3PABB 2AXGB 4QRRB 3MRRB 2MMXA 4ISVB 1TFHA 3IJYA 3MBEA 1SY6L 2VDNH 3DURB 1UEYA 3QJHB 1JPTL 4JFQB 2NW3B 3ZKXC 5FO9B 5I8KH 2JB6B 3ECBB 3NACH 1BAFL 4GW5B 3IJHA 4PYHA 4PV8B 5JR1H 3MLVH 1TETH 1A22B 4ONFL 3RUGE 4OZFB 1C16A 1OY3B 1VADB 4X6DE 3MV9A 2X4RB 5GS2H 2EKJA 3PNWB 5MI0C 1M71A 4R4FL 2EKSB 4ZSOB 5EG6C 3V5HB 1L0YA 3OKEA 2PW2B 2GYSA 2RJMA 5KS9A 1IZKA 3V5KB 4Y5YB 1NC2B 1N5YL 1T03H 3VMNA 1DUZA 2FO4A 1OLLA 4QRUB 3TPKA 1JGDB 4BUHA 1PW3A 4WY7L 1U8KB 4M5YL 4WDIB 3HUJA 3P9LA 3AB0B 4LCYA 4JFXA 1CGSL 3BFOA 4HIXH 4G8FB 4TSBL 4PJIF 3GMQB 3C09C 5E03A 4LSDA 1IE5A 5TDOA 3OG4B 4E41D 4AL8H 2IPTL 2BNQA 4DN3L 1MWAA 2YD2A 5IMOB 5IQ9A 4KHXH 2G9HB 3TYFB 2NY1D 3CFIC 2BOCB 1D5ZA 1CVRA 1T5XB 1DBAH 1RZJH 3SQBA 2YKLH 4G8GB 3ZYZA 3V0WL 1HWHB 1A6WL 3QA3A 5GGUB 3LRSA 4J7RA 5T3ZH 2Q76B 5C9JB 2OQJA 3FB8A 5F9OH 1I4FB 4JY5L 5DJAA 4ZDHA 3VWKD 1FL3B 5C07D 1FNSH 1S8DB 4NRZA 3V6OA 2VZOA 1RVFL 5DZLA 3DHJA 1RI8A 2FH6A 3ZHKA 1D5BA 4U6HB 2DQDL 3SGKA 1UZ6F 1NL0L 1RZKL 2IH3B 3P77A 5LGJB 5BVPL 2R23B 4LSUH 2JLLA 1XZ0A 5GGVH 5F71A 3MV8B 1JV5B 3WKNA 4OUOA 1JI1A 3QNXA 4JN1L 4XBGA 3RNQA 1U42A 5DJCB 2V2XB 2BRRL 5F8QC 3ARFC 4Z7VF 3BP6B 4N0FA 1S7UA 5HJ3A 5D4QA 1QA9A 1N6UA 4BFIA 4QHNA 1INQB 4J3SA 3HB3C 5L8LB 3S36L 1YEGL 4V2BA 5HYJB 4PGCA 4X98B 5ISZA 4KVNL 1CU4L 1LP9B 1N8ZA 1WT5A 3O2DL 3KYMB 3QEQB 4WU5B 4MAUH 2XN9B 1CFBA 4GOSA 2Y7QB 3ZL4L 1R24A 2E7MA 4GKOA 3U0WL 3U4BH 3WE6A 4U1JB 1IJ9A 2FL5B 4JDVB 2NY6B 1LO4H 2ZUYA 3ZT6A 3KR3L 5I1GH 2C1PA 2ESVD 1H3PL 3M45A 4AEIH 3BJLA 4PD4K 1CL7I 5ACMA 4ZNCD 2I9LB 4ORZC 4NZRH 4XCYB 3QZWA 4LHUG 4HKZA 3U0PA 2BSSA 4HHAA 5FYKD 4AG4H 3RDTC 1OP3H 3HPJA 3MNWB 4KJQC 4Q7DA 1JP5A 1DQMH 1H0DA 5FYKE 4PREA 4EDXA 3Q2CA 5HTSA 5E7FA 3WDJA 1Q9WB 3A6CH 1HXYA 1TTFA 5L88L 4M6MH 3LRHA 3T08A 3DX8B 2IFFL 1BFVH 3B9AA 3TJHC 1BF8A 1INDH 2IJ0C 2OP4L 35C8H 2IAMC 3QXDB 5DEFB 3UYOD 5HHNB 3CH1B 4FQ2H 5EO0A 4GMTH 2PYED 2MCG1 4JRXB 1E27A 2PYEE 2B4CH 3VFPA 2LE9A 5BS0B 2BSRA 5TFSH 4OZGB 1CE6A 3U46A 4MNGB 2RIKA 1Z0NA 2GJZB 2VABB 4GKZA 3LQAC 3RAJH 3RGVA 3BEVB 4Y4HD 4UTBL 2H6PA 3B4NA 4IHOA 1RZJC 1S3KH 4X6BB 1EGJL 4M1DL 4N9OB 3VFWB 2FH8A 4G7VL 1T5WA 1YNLH 4GBXA 3UTQB 1G1YA 1VCAA 1FCGA 1LO3L 4JO1H 2V17L 3VXNA 1YN7A 5LKNA 1R0AH 3JWOL 4JRYB 2JK5A 4YC2C 2X4QB 1I1AA 1P7QA 5JDJA 1R5IA 2ICWI 1JHKL 4GG6B 1DLHA 3UYRL 4CNIA 4M6OH 3BD5A 5D93C 4I0PA 3PHSA 3KHOA 4OD2B 4YDJA 2OZ4A 5DQ9B 1HK6A 4OGYH 2VISA 5GHWL 1E6JL 3BZDA 3HZYB 3V9FA 3HZKB 2VC2L 2O5XL 2DQHH 3BQUD 4ZO7A 1MFAL 4LRNL 1DBJL 2VDLL 4XVUC 2DMBA 1JRHL 3AROA 1MJUL 1RUAL 3W5MA 2OMBA 5K9KB 3QBTB 1J87A 3LN9A 4LSQL 3TA3D 4KRMB 1R3HB 5I73C 5KZCD 1WEJL 2J4WH 4MQSB 1CTOA 5AZEH 2V2TA 4ETYA 2ZCLH 2YUVA 3UTSD 1BFOB 5F6HI 2P44B 1KXQE 1HQRB 2BRQA 2P5EE 3UTSE 3UP1A 3VG0H 1HYSC 3JV4B 2DMCA 4LCWB 4LEOA 4HCRA 2QQLH 3WFBL 1TQBB 3O6FD 3ULVH 3VFMA 3Q6GL 4JQIH 1CFTB 2BERA 1I8LC 5SWQA 4QCIB 4JFZL 3SDYH 2H32A 3NFNA 2JIXD 3DYOA 3CLFL 1AHWA 5B39B 1T80A 2HVJA 4KROC 5IOPB 3AREC 1QR1B 4OBSA 4ZO6A 3GSUB 5LAXA 5IEHA 2BC4A 3D85D 4P23C 3TZVA 5GSRB 4XP9H 5EU3A 3S4SA 3VH8B 4ZS6D 1T66D 2WUBH 5EU5B 5HHPA 4XNXL 2LVEA 5JLZA 5A2IH 4OLZH 1QO3A 5GGRB 3HLAA 5FOBA 1URLA 4QHLA 1XH3A 4X9IA 4XMKL 5DR5L 5D5MF 4PJIB 5GGTH 5C0JB 5INCB 3W2DH 1U91B 1H3UA 3IF1A 4HV8B 1VA9A 2OSLB 4ENED 4Y8DC 1NCCH 4Z7UF 5DJ8A 4TRPH 4JFYB 4NN7C 3MLXH 1EA9C 3TWCH 4EI5D 1AGBB 2VDNL 2ZCHL 2B5IB 1PJ9A 2CDEA 2BCKB 1MAJA 1VEMA 2V2WB 2Z93B 5E9DD 4X5WB 2H3NB 3OB0K 1E4KA 4XMLH 1HKFA 5BVJB 3NACL 2PYFA 3PL6C 5E9DE 2W60A 3LEXA 3MLVL 4JG0L 3U83A 5GGSB 4ZUSA 1IAIM 1RV6X 2CGRH 4UINH 3L3GB 3NABH 3GMNA 4PJXE 2QQNL 5GRWA 4HFUH 4UT6H 4D8PA 4Y16A 1P2CB 2F5BH 3UMTA 3DGGB 4JFFA 4KJPC 2CKBH 2W9LA 4J1UA 5GIRB 4ALAH 5ICXB 4JKPH 3A6BH 3RX7A 1HH9B 3MX0A 2DDQH 1M4KA 4Z7VB 1T03L 4DJMA 4P59H 1HILB 1JWUA 3QIWA 1JZ3A 1MCRA 3ZDYF 4FFWD 3RRQA 4U3XA 4D0BA 3ELAT 3NA9H 1JWMB 4HH9A 3VD3A 4Q97A 1QKZH 4W4OC 5DC0A 2KQMA 5ADOH 1MHPL 4PJGA 5I16A 4HIXL 5E24E 4X4XB 4NSKB 1SVCP 4POYA 3OBAA 3GJFA 4DKDC 4U2YA 4UBDD 2W9DH 2O26U 3U7WL 1YDPB 4F37K 4MQXC 1YEEH 1KB9J 5KSVB 3PDOB 1P7HL 2OTWA 5DHVB 1DBAL 1OGAD 4CMMB 1K3ZA 5E5MB 1EO5A 1IEAA 1FYHB 1U58A 4P2OD 2CLZB 4D0CB 3RWGB 3RVVC 1KELH 2GT9A 1Q9LA 3NZ8A 3BZ4B 3DX6A 5D7JA 4JN2A 1FNSL 2XKSA 3PGFL 4H8WL 4HJ0C 3B2UD 5CAYB 5DGRA 3QFJD 3FT2A 5D1QD 5ADPH 3BWAA 4U6YB 5D2LE 5ELIA 1TPXB 2ADFH 3T4AA 1LEGB 3QFJE 3U30C 3RU8H 2NY0C 4LSUL 2XYCA 4BZ1H 1EEQA 5GGVL 3ES6A 3EKCA 3UTPE 5DURD 4L29A 1J5OH 4YPGB 4QXTB 3SO3B 4KMLB 1OAYH 4IRSC 4Y5XC 3CFCH 1QR4A 3QULB 1M7XA 4I5BA 1MH5B 3MRLA 5C09A 2ZSVB 4PJFF 4XXDA 2DWEA 4X6CF 3V6ZA 3ZSTA 4BH8B 2BOBB 3HZMA 4LCUB 4XNMB 3RZCB 1DP0A 5DD1H 5MEOA 2ATKB 5C0AA 4R4NC 1VEOA 1B0GB 1G0DA 3OPZH 5EU4B 4OLUH 1QSFE 5EC1B 3QXVA 1Z9MA 3U4BL 4PR5B 3HCVA 1I9RL 3DECA 3ZKMD 3QEHB 3L6FB 1IM9B 5I1GL 2BDNL 1C08A 1T2QH 4RGNC 3GKZA 3RL2A 3VRIB 1VFBA 4AEIL 4WI6A 1GGIH 1VGEL 4FG6D 5FUOH 4M6AA 4ODVL 4U7KA 1ZLSL 4LIQH 5EUOF 1A9BA 4NZRL 1I7TA 4EN3C 3QDHA 4ODSH 4QHKJ 2B20A 4MVBC 1T20B 3KWWB 1J0KA 2J3SA 2AI0L 4XGZB 4HF5H 2I07A 4GAGH 4HUXB 5J0BA 3TBSB 1OD7A 4BFEA 3BT2H 1KIQA 2XWBA 3NZHH 5JIIA 3A6CL 4ODWA 3K4AA 3KLAA 5HHOD 5HSFA 4LCCB 1BFVL 1G9MH 4HWBA 2H2SC 4NKIH 3ME0A 5CBAB 2AJ3B 4JM4H 2BNRA 3GKWH 1KC5H 3STLA 1HIMH 2VDKL 1KJ3H 5C0NC 1QRKA 1SJVA 4FQ2L 3T0DA 2DM7A 4Z8FL 2ICWB 3AAZB 2P46B 4XTRD 3JUZA 1D7FA 4PP2A 4R7NB 3RY5A 5AZ2H 4X4ZA 4NZJA 3FB6B 2QQQA 3LS5L 4LVOB 3WNKA 2B4CL 2Q8AL 3B5TA 5CJXA 1JCKA 4L3ED 2FJHA 3CNKA 4FQ1H 3EYQC 3CK0H 3JBG7 3RAJL 4C59B 5DUBB 3OR7A 3MNVA 3PP4H 1J86A 4YDLC 5FK9A 1HQ4A 2AXJA 1S3KL 4Q6IB 2LAAA 3PJSA 2BNUA 4Q9QH 5K33A 2OXHA 2G5RA 4K23L 2EO9A 4NN5C 1VKXA 3T04D 2PTTA 4PRPD 1R0AL 2HYMA 2N7BA 1CQYA 3D39A 1YEHL 5FO7A 3V4VH 4Y5VC 5EU7E 4M8QB 2HMID 3BP4A 3PDGA 4QYOA 1Z5LA 3BOVA 3V7AE 4M6OL 1FYTE 1F97A 4J6RH 1T3FA 4MCZB 4OGYL 1ZEAL 2OR9L 4N0YL 5HY9A 5EH1A 4D0DA 3UDWA 2ZOKB 4L4TA 3NPSB 3RGHA 1RIHH 4HKBB 2HG5A 2JJVA 2OL3L 2D7NA 4HJGB 5E8OA 1YEDB 4P4KD 4R26L 2IQ9H 4HGKC 3SQOH 5D5MB 3D2UD 3VCLB 4TYUA 2NR6D 3REVA 8FABB 3EGSB 1HEZB 1U8LB 2X44D 4GKSA 2FJGA 5EU6D 3BPNC 4Z7UB 5JA8B 4Y2DC 1U8OB 5D7LE 1KYOJ 2J4WL 5EU6E 3VMOA 3ULSB 3WEXB 4WW1A 2CKNA 1YPZF 1V7NH 3TNNA 2PO6B 4K94L 4JM2F 5JQHC 3RWHB 5MP6H 5H2BA 5E94A 3L7FB 1JMXA 3VG0L 1DANU 4NCDA 3HRZB 3LDBC 3ULVL 5IGXL 4JQIL 4N1HB 1RJZB 5I1CH 4Q0XH 4Y4KA 4PJBF 4X9HA 4OF3A 3SDYL 4RFNB 3MV7A 4CBPA 4OFDA 4PY7A 3FO0H 3MCKB 4CMHC 4NO2A 5TDPA 3PWUB 4L5FH 1IILE 3DIFB 1K4DB 3BUYB 5DDHB 2YBRB 1PSKH 3IFOA 3P4LA 4JFEA 3P3YA 3HI6H 1LDPH 4ZSOE 1NC2D 5DJ6A 2CUIA 4XP9L 3KYOA 3MROB 2WLYA 2EXWC 2WUBL 1X5KA 4M7JH 4OLZL 3SDCA 5DJ0B 4JAMB 2M26A 5I6XC 1PZ5B 2QKIA 4UQ3A 4U0QB 1PLGH 2EDHA 2HTLC 2XKNA 3PGDB 4JQXA 3RWEB 1T1XA 3U4EA 3QCTH 2UVFA 5CEZD 5EIIB 5C08B 1NCCL 4YHZH 3G04B 4RGMB 4TRPL 2XXCB 1KJ2A 5CEZE 1NDGA 4F2MB 2Y9RT 2BMKB 3SGEI 43C9B 4IRJA 4HIJB 4C56D 4WNQB 4C55A 3O4LA 3VFUB 2FHCA 4G8GD 2XOTA 4PRNB 5HPOA 5CD5D 4DUVA 1ZVHA 2R4RL 3CVIH 2EZ0C 4FXKA 4C56E 4U1LA 4G9DA 4XMLL 3G08B 1H5BA 3RWFB 5B22A 1FFNA 1MFCL 2CGRL 3EBAA 3DBXA 4HUWA 1I1CA 2C1OB 2X7LA 1L9MA 1FNFA 1ONQA 4HFUL 4UT6L 5BOPA 3HI1B 3QJFB 2F5BL 5MERB 3LH2L 2NPLX 4AH2B 4I18B 4NQVA 1OP3K 4ALAL 3DWTA 2AJXH 4EUPH 4JKPL 1KIRA 3IS0X 3B8YA 4NRXB 2DDQL 4HAFA 3MV8D 2GY5A 1JMZA 4P59L 2JCCA 2ZCKH 4C83A 1XCQA 2AGJH 1IL1B 1NGXB 1MUJA 3QHFH 4XH2B 3FOLA 4PJFB 1RPQA 4KDTC 4YR6B 4X6CB 4AIOA 3T8XB 3NA9L 5H94A 1S9WA 1QKZL 4LK4A 1JGUL 1P69B 5JOEA 4MCYB 2HTKD 5K9QI 1VFOA 2DTSA 3BKMH 3LKSB 4RDQG 4LPCA 2PXYB 4S1RH 1KCSH 2M2DA 3QNZB 1UACH 3TIDB 4JFDD 3QEQD 5DK0A 2W9DL 2XN9D 4GRWB 3SDAA 1LP9E 2V5RA 4JFDE 3QEQE 1N59B 5DMKA 2XN9E 2IMNA 2DQEL 2NY6D 4EI6A 3TBYB 5DMGD 2WINB 3DROB 3V2AR 1KELL 3L5JA 2NYYD 2DQFB 5IBUB 1JN6B 3SCMA 4PTUB 5IMLB 1D6EB 1GL4B 1WC7B 1MJ8H 4YQXH 5KTEL 3S6CA 1FJ1B 43CAA 4UAOB 1T1WB 5J11B 2F53A 2LFGA 1UXWA 2UUDK 2VJXA 3KXFB 5CIPH 4Z76A 3LN4A 1FAKT 3MNZA 3HG1B 5ADPL 1MCQA 2FRGP 1EH9A 1CDGA 2ADFL 4U7MA 1NGWA 1X3DA 2BVQA 4MD5B 1WJ3A 3RU8L 5C2BL 2IBGA 3MODH 1JK8B 1Y0LA 1INEL 1OAYL 1KJVA 1HHGB 1BQUA 4D2NA 2R0LH 1G7JA 5E4EC 1LNUA 2XACC 3RKDC 1D5XB 3CFJA 4ZAKA 4OUUB 1NANI 4G6FB 3CFEA 2GEEA 1AXIB 2GJ6D 1FL5A 3EO9H 4JRXD 4KQ4H 4ZYKB 4K3EH 3STBA 1EXUB 3RTQA 3M1BB 4QKXB 4OLUL 5GISH 3WJJC 4AEHH 1J0YA 2GJ6E 2YHGA 3MRJB 3WFCL 3QI9B 3GM8A 2FBJL 1T2QL 1L0XA 3FQRB 5DFVD 3GI9H 3HMXA 1E4JA 3DRTA 2ERJB 2DS4A 2GK2A 5FUOL 2AS5M 4UZGA 3A67L 3QUMH 3GSVB 3PWPA 3TT3H 1QNZH 3D18B 1BQHB 1ZHKA 5JW3L 1J05B 3QUXA 4P46A 4Y7MA 1C5DB 2FWOB 4GAGL 1F8TH 1FFRA 1TXKA 5L2KA 4AM0B 4LLDA 1WIPA 5IHZB 2C3GA 1XGPA 1ZGLA 2DD8L 5IJKC 1CICA 1AGCA 3MUHL 4KHTL 4PRIB 3X3FH 4M7ZB 4EZMA 1A14H 1G9ML 1Z0MA 4MJ6B 4NKIL 2W0FB 1Q9KA 3DXAE 3NFPB 1KB5H 4JM4L 4KU1A 5DLML 1Y6NR 3W39A 3GKWL 1CLZH 1KJ3L 4GJTB 4F8QA 1KBGH 4B53A 3VFVB 1YJDH 5IHLB 3PF2A 2QR0B 1TJGL 3BGFC 4HW6A 5I76B 2C3VA 5AZ2L 3GMMB 1OTSC 4ZTPH 1T7ZA 1YPZB 3MLSH 2RGSA 3RI5F 4JM2B 4F58H 2YOCA 1Q38A 3CK0L 3V6BR 1BLNA 1BQSA 3V6FA 3PP4L 5JZ7C 2EEBA 5K93A 3TBTB 1YNKH 2EDTA 3KPMA 3NN8B 5F21B 5J3HD 4Q9QL 5DGQA 4QXUH 3HE7B 1MI5B 1NFIB 3RP1A 4XRCA 4YZFE 4PJBB 3LKNB 1MEXH 4R2GB 5T3XD 1MHEB 1G84A 2NY4C 4HK0A 1EFXD 1MCDA 3GMLB 2EYTA 5BW7C 3T65A 2R2HB 5T3XE 5C1MB 2EDRA 3ESVF 5C6PB 4HKXA 1OAXL 4YHNA 5JNYA 1CFVH 1JZ6A 1F5WA 2NNAA 4J6RL 3TBVA 1NGQH 3F8UB 1MCNA 4MLIA 2VQUA 1RIHL 4WHTA 1MFEH 3ARPA 3FN9A 2IQ9L 3QWOA 4WHDA 4PJ7F 3SQOL 4CU6A 5HYSA 2CRIA 1LO0H 4NNXA 5FF6A 2IF7A 4R97B 5ALCH 3D3VA 3T3PE 3NCEB 3O9WA 4Z7QE 4XWOD 1FQ9C 3FFDA 1QSED 5IVZB 3C5ZB 4LSVH 4Y8AA 3KPSB 3UTTB 3M8OL 1QSEE 1HOCB 3KPLB 4U1GB 1T0MA 2NX5A 3WS3A 5AAWA 4FQHB 4MDJB 2B1AH 5MP6L 5AAMA 3LRGA 3C60B 1ZS8B 1HCFX 1I8KB 5IB1B 1A9EA 2O5ZH 2DOCA 1AXTL 3F7YB 1YZZA 4CN6A 4PS4L 4P5MA 1SY6A 3QUZA 5DSCA 1G0YR 2XQYK 2NTFB 1JZ5A 3C9NA 5I1CL 4ZODA 4Q0XL 4JZJA 4R0LC 2JJTA 3IJYB 5F9WC 2PETA 2NY1C 4HJJH 4L5FL 4DTGL 3DI2B 2L0DA 2PNDA 1PSKL 4GUPB 5DA0B 1SJEB 5E6IB 3WD5H 4OKVA 2ZG1A 1K2DA 3HI6L 3P0VH 1JI2A 1ZVSB 1S7WA 3U0TB 1XGUB 4PTTA 4FQXB 3VWKC 4K7PX 1KT2A 4NJAH 2MOVA 4NFBA 1JNHA 4AENA 3UO1H 2YEZA 2FDBP 1JWSA 4LLQB 5AWNH 2AAVA 4YBQD 2EDNA 1PLGL 3BEWA 3CXHJ 4ODUA 3QCTL 4MNQB 3H9HB 1BECA 2NY5H 4G43B 3QIBA 4YHZL 3C6LA 1ZLVK 1LD9B 3RWCA 3HC3H 1JPSH 1YYML 3QDJD 3VRLE 5ECJE 4XAKE 5BV7B 2WBJD 1LMKA 3ARGA 4MD0B 3D48R 4PGBB 3QDJE 4JPKH 4YNYA 5IIEB 3ESUF 1SQ2N 3TVMB 2VMFA 4WI8A 2R1YB 1LGVA 4EIZC 2UVEA 4GW1A 3TF7C 4KH2A 1XF4B 4FQIH 1ZK9A 4NQCB 5E8PA 2MWCA 5EBWA 3I2CH 5ALBH 3ZE1F 5E99L 5ACZA 1M05A 3W0WD 2FEEL 4ACPA 1V5JA 4O51A 3QR2A 1A0QH 5D1XA 4JCLA 3LRSB 3W0WE 4PLJD 4P2QB 4P57A 4ZDHB 2FR4B 4HC1A 3GHEL 5CILL 5DK2B 1DLFH 2AGJL 4JZOA 4Z77A 2KL6A 2WK2A 5E08H 3GSNA 3QHFL 4Y4FA 3IU3A 5IV2A 4RX4D 4XVTH 1A2YA 5B38A 2DM4A 4U1SA 1UZ8A 3CVHL 1OD9A 3F7VB 5T5NG 2GSIA 4I3GA 2QL1A 4XCNA 1JPFB 3BKML 4L8SC 4S1RL 3RZCD 1EIBA 2PCPA 4XBGB 4ZTOH 3CAFA 2Z8SA 2ZUSA 5KVMC 4N0FB 4Y89A 3OF6D 1QA9B 4C58B 1R3LA 3DO7A 5F3HB 2HH0H 5GGQH 1KULA 2W0LA 4LPYA 4XX1E 1IM9D 4YHKH 4DGIH 4MSWA 2GFBA 2G60L 1CR9H 2X89D 1V8HA 3FOMB 4POUB 4YQXL 3MRGB 4K9EH 3EOAA 1AE6H 4U0RB 4XB7A 1I8IA 4HS3A 1ZLUK 5HGAB 3RIAK 3H7BA 5DMYA 4Y4HC 3MRCB 5HHQB 3VFOB 1OGTA 5IEKA 3TNMB 5MI0B 3WL9B 2DQCH 1NUNB 3L3JA 3FONA 5HDBF 4C54A 2R0LL 2AP2A 2SEBB 1H0DB 3VWJB 4PREB 2X1WL 4NHUA 4P2RD 32C2B 3L3DB 2FATH 5DJDA 1TTUA 1O0VA 3EO9L 4P2RE 1K8IB 4K3EL 4KVCH 3MRPA 2EIZA 3EZJB 5A2KH 3QSKB 5GS0L 3X14A 5GISL 4DAGH 4NO0D 1S7SB 1U6AH 5GS1C 4M5ZH 3BQUC 2VLRE 2GUOB 4G6JH 3GI9L 3KPPB 3QG7H 4IOSD 4OGXH 3MGOA 2EDWA 1LEIA 1CS6A 2IPUK 3PWVB 3TA3C 3QUML 4NZTH 1IAKA 4DKAA 1QNZL 1ZHLA 4Z18A 4UT7H 1TVDA 1ES0A 4LKXA 1F8TL 3L9RA 4K07A 5IG7B 1G6RB 2GK0A 1ZA6A 2IPKA 4H26B 1BVZA 2H6PB 2UZIL 4OZFG 4HFWA 4X4ME 4IHOB 1OWRM 3PV7A 4QT5B 4FTVA 5F1KC 3I6LD 4HS8H 2C3WA 3X3FL 1GSMA 4PJ7B 4YHML 3UX9B 3BIAX 3O6FC 4LAQH 3VXNB 4YK4B 6FABL 1R5IB 1QLEH 2ZUTA 1CLZL 5F88B 3BRFA 1HHJA 1E4XH 1W0WA 1E28B 1KBGL 5E2JA 3CX2A 1YJDL 4I0PB 5GXBB 2CUMA 4N90E 4XPGH 2AV7B 1IKFL 4XP5L 2W65B 1UWXK 3OKKB 4TVSa 5D7KD 1UJ3A 4QOKB 4ZTPL 4KJWD 1RQ5A 3LMJH 1K8DA 3QAZC 4GLRI 4YAQB 3EHBD 3HNVL 4ZPVA 4Z7UE 1T66C 4ZS6C 1QP1A 4D9QE 3V5DB 1ZANH 2PO6D 3KNBA 1Q8MA 5B3NA 2R29H 3P0GB 3THMH 2VZ1A 4G6MH 5JIPA 3GZKA 1QFWI 1YNKL 1KIUA 2V5TA 5IF0B 3VE0A 4LQFL 2HFEB 4QXUL 1J0JA 4KGJA 5D6DA 5F44A 4ENEC 1FVEA 1MEXL 2DQJH 2RB8A 2XIDA 3DETD 1R5VA 3FB7B 3RWJA 4QF1B 5FUCE 3TO4A 4F9PA 4EI5C 3FRUA 1DTUA 5I74B 1CFVL 3BP7B 1FGVH 1F4AA 3IFPA 4X8XA 4NQTA 5DD6A 3TH3T 1MFEL 4PLKD 1EEUA 5EO1A 2V6HA 2ZSWA 4OCSH 4ZUTB 4YFDB 3ARFA 2J5LB 1U8PA 4H1LA 3SBWA 4JG1H 2H32B 3IETA 3BVNA 3ZDYE 3BH8A 4QWWD 1FC1A 1MCHA 3P0YL 3UAJD 4U1NA 3OGOE 1OQXA 3FB5A 1UM4H 3EOTH 1YC7A 3BKCL 5F7DA 4LSVL 1Z2KA 2O61A 1K6QH 3TZVB 2IAMB 5EU3B 5F8RC 5C08D 3S4SB 4WCYH 3VXSA 3G6JF 2DQIH 3MOQA 1M7DA 1P6FA 2AV1B 4Y2OA 5FOBB 3HPLA 4RGOL 4QHLB 1MHCB 2B1AL 4FFWC 1B4JL 2O5ZL 3G6DH 4WJ5A 1A3LH 5ID0A 2VH5L 1IEBA 4BZ2H 4OZIE 1KN2H 5I1LB 4YEEA 4MXWL 2ARJB 4WHCA 5DRWA 4HEME 4UBDC 4NN6C 3SJVA 5DRZB 1FPTH 1NCTA 5JPNB 2BSTA 3MQIA 2LAGB 3R06A 1HDMA 5CP7A 2CDEB 2FX7H 1KCVH 4DCQA 4L4VB 5KANI 1RIUH 1D9KD 2FNBA 4P2OC 4YGVA 5SWSB 3EO1B 4YC2B 4JHZA 2YS4A 1KTLB 4BFGA 3BZFB 3P0VL 2J8HA 3JTTB 1ZWIA 3O41A 7FABH 4XCFH 2BJML 5T1MB 4P9ML 1U8QB 4NJAL 1ROWA 1MCLA 1QQDA 4D8PB 3B2UC 2VLKD 5AWNL 2FJFA 1U92A 5D1QC 4OF0A 2VIRA 2VLKE 1TZIB 2PXYD 3W9EB 2X4SA 5CD3B 3NPZB 2NY5L 3BXNA 4HH8A 1OHQA 5C0GB 4NQEB 3D69A 4RFEB 4WENB 1U8MB 1PYWA 1JPSL 3KG5A 2HP4A 1UKTA 4KRPD 1UQSA 1MJJB 2ZUXA 3G9VA 2ED8A 4GRWE 1P53A 4JPKL 1OT1A 1NMBH 4KRLB 5EPMA 1YQVH 4KI5D 1KLGA 3IVKA 3NAAH 4NUGL 1IQDB 4KI5E 4N8VA 2YD3A 3EDFA 2HJKA 1CXEA 4FQIL 3VGAC 1GGCL 1T6VN 2HT3D 2C7UA 4MZ3A 1Q9OA 3KXFD 1I7ZA 2IAND 2OTWB 3MRFB 5IM7B 3HG1D 4PJ5A 1U58B 5I0ZA 4HIHA 1A0QL 3HI5H 2IANE 2EYSA 3ZKMC 1JGLH 3HG1E 3P9WB 3FQNA 1N2RB 1AGDB 2QSVA 3KPTA 3S97C 4FG6C 3WNPA 1I9IH 2VXUH 1FFOA 1DLFL 2DRUA 4HS6B 4PJ9B 4OZFH 5KSBA 5H8DA 2C4XA 2PTVA 4H88H 3NMEA 3FT2B 4JHAH 2EDXA 1S7RA 2YUXA 4WIQA 5DD3L 2PF6A 4L8DA 1XF2A 2ZP0T 3INUH 1B2WL 4PJHF 1IGIH 1FH5H 4WEMB 3KYKL 5I15H 2H8PB 4IMLA 5EOTB 4MDIA 3HNTH 4ZTOL 4L29B 1U93A 1SYVA 3ILQD 4P0DA 4JO4L 4V1DA 3QI9D 1AY1L 3HC0A 3D87B 1J1PL 5GGQL 1OARL 2HT2D 4JHWH 3V52H 5EIQA 5ANME 1OQOA 3BZEA 3DRQA 5LG1A 4XTRC 3U9UB 5C0AB 2WP3O 4YWGH 1QFPA 5JW4R 4K9EL 5DMJB 4ERSL 2BVEA 2RQ8A 1AE6L 1HH6A 1I8LA 1T6WA 3HCVB 3D0VA 5F1NB 4MJIE 5IB3A 1OOAA 4J4PD 4L8BA 2B1HL 4YO0B 5FUZH 4CJ1A 3AREA 3VD4A 3BWUC 2CJUH 1SMOA 5B39G 3QIUD 4PRID 2VTFA 4GXUM 4P23A 1XF3B 1U8JA 2YK1H 1F90H 3CU1A 4X9FA 5EU7C 4HDIB 5DRXA 3E0GA 5DD0L 2WLZA 4G6KH 4PP1D 3FMGL 3VH8G 4PJAF 2HMIC 2IADA 3IKCB 5IKCA 4WUUA 1Q0XL 5C0CE 3H9SB 4UI2A 2JTDA 3QHTC 4KVCL 1HHKA 1UKSA 4NQDA 3TN0A 5JXED 1A47A 1U6AL 4UOW1 4XHQA 4UU9B 4JM2D 4TUOA 1R3KA 2XTJE 3GSXA 3EDJA 2L7UA 4P4KC 2BNRB 4HT1L 2F19H 1K85A 5D72L 5HVFB 3O8XB 2DKUA 1PAMA 2FZ3A 5C6TH 1HKLL 1KB9K 4MWFB 2NR6C 3BDXA 2V5SA 5CJ8A 1A6ZB 4PP2B 3RJDA 4NZTL 3PL6A 1BX2B 2V5MA 2X4UB 3HE7D 4X99A 3VXRB 1MI5D 2NQCA 5LCVL 2GAZA 3QQ4B 4R2GD 4J3OC 4QRPB 1MI5E 2ADGA 1A4KB 4RNRB 1RJLB 5TF0A 3P4MB 3QUYA 2VR4A 3VFTA 1ULVA 5EULV 1R3IH 3GFUA 2NTSP 3WIHL 4QNPE 1EEYB 2CIKA 1BZ9A 5HHXH 4H25A 3GB7A 3SKMA 4TVPD 5IMKA 1B0WA 4QYOB 5I1AA 5EBMA 4IRSB 5DO2D 3HZVB 1T7XA 1RJYB 5FIEA 3MGTA 1I7UA 1A1MA 1NBQA 5CGTA 3ALXA 1G9EA 3G6JB 4POZD 3C5ZD 1G0XA 2YRPA 3FJTA 3UTTD 1TVBB 3LMJL 2OTUB 3CUPB 3QXAA 2XZZA 4Y5YC 1KCRH 2OZ4H 3QO1B 2FGWH 3K2UH 4HX1B 3DUUB 1B6DA 1XGRA 3ZTJH 1DQJA 2Y07H 3THML 2BY1A 2D7OA 3C60D 1IC5H 3CDYA 1L7TH 3AB0C 1EO7A 4ZUUB 5C0IA 4RGNB 4E0RA 2DQJL 5DFTA 1QPPA 4AJ0A 4Z0XA 5JUEH 1FG2B 2YD6A 4DZBB 4F7TA 4S11A 5CEYA 4YUEH 3MRMA 4EN3B 5CZVH 3FO9B 5CMAA 3CZFA 1LK3H 1RZ7L 1ITCA 5CD5C 1FGVL 3T4YA 1G7MA 5HYFA 4DGYH 3MMEA 5D7SH 4ELMF 1MREH 1MCJA 1A7PL 2E27H 4OCSL 3KYNA 4Y5XA 5T1KB 4Y4KB 4BH7B 1NDMA 2X4PA 4JG1L 4IJ3B 3MV7B 3EJZD 4LASH 3MLUH 4YXLH 1K3IA 1AGFA 1NGZA 1S7XA 4IIQA 1LO5A 5GJSH 1J9CT 2VDOH 2DTML 4MZ2A 4OCNC 2LU3A 2VDQL 3OV6A 3ZDZE 4KAQH 3EOTL 4MNQD 1K6QL 4K2UL 2VQ1B 5L7XH 1VPOL 5GGTA 3STZA 4KC3B 5FKPA 5HYEA 2DQIL 5ICYA 5HVGB 5KS9E 4HPOL 5CJ5A 3SDCB 2WUCH 2M1KA 1B0RB 5F3BB 4XAWH 2X2YA 1A6UH 1PKQB 4UQ3B 1VFAB 3QO0B 4TPRH 1A3LL 2A6KB 2XKNB 4GKNA 3HUJE 3X17A 4I13B 2Y5TA 3U4EB 3DVNB 2HTKC 3TVMD 4OCMC 1KN2L 3S96A 4O00A 2FYYA 1BF2A 2IBZY 5ID1B 2GJJA 2APBA 5CZXD 5KVGL 2GSGA 1PX4A 2BNQD 4NDMA 3D6GA 2XPGA 1NDGB 1FPTL 3SPVA 4NQCD 5CJOL 2YC1A 1UXSA 2BNQE 3IXAB 4B7IA 2AXFA 1GC1H 4K7PH 1CZ8L 1KCVL 1ND0B 4NQCE 5JQ6L 2NY6C 4FXKB 2W92A 4TNWK 5DMGC 1ERNA 2VLLA 5L2JA 3NIDE 2NYYC 2CKBA 4LHUA 4Y5VB 1V7MH 4ORGA 1OM3H 2I60H 1FZMA 3DBXB 3VGHA 3WNNA 3GEWB 4CL7A 4UIMA 1JHTB 1EUTA 3V6OE 4PJHB 5C0FA 3V79C 1EFQA 5FGCB 1FV1A 3LZFL 2EXYD 2WIIB 4P5TA 5I1KH 2BY3A 2DIBA 3QXUA 1A4JA 4D9LH 1CG9A 2KZ1B 5I1HH 4C83B 1XCQB 2NCMA 1IGML 1N6QL 1OTTD 4FXGB 5IW3A 3P4OA 3WN5C 3UBXI 3LS4H 3QQ3A 3O6MH 1KEMH 1KYOK 1NMBL 4OQTH 3LD8C 3TCXA 1YQVL 1S5HA 4F33A 3BP5B 4U1KA 1KGCD 1WIUA 3NAAL 5FXCH 5ISZD 5DK0B 5IFJB 2MKLC 5JDSB 5ISZE 3H7LA 4FZ8H 2VE6A 3L7EB 4APQB 2AK4A 2X4TB 4LGSB 1DN0A 4JGMA 2XFXA 4QTHB 1MY7A 2W38A 1ZGLP 4QY8A 1R6VA 3HI5L 1FBIH 1CDIA 3S37X 1U8IA 1JGLL 2EH8L 4XNQA 1VACA 1ED3A 5DFVC 4GH7B 2VO5A 1LK2A 4AIZB 3MRIA 1I9IL 5DUMH 3G5XB 2P8PB 4PB0H 1RHFA 4X7SL 4CMHB 1MJ7L 4JKWA 2F53B 5HGDB 4H88L 3MNZB 1IZJA 4JHAL 4PJAB 5IVNA 4JFOB 4LSPH 1NGWB 3INUL 1IGIL 2BVQB 1FH5L 3VWJD 1A21A 2XTLA 3RY6C 5JOPD 3PUCA 4PJCA 3CMOH 3HNTL 2RHEA 4X6DF 5ENWA 5JOPE 1SJHB 4Y2DA 2A9ML 5C0EB 3FHQA 1CE1H 3MFFB 3ROOB 1DVFB 2O5YH 1QRNB 1BOGA 3OJDB 3QH3A 4JHWL 3V52L 3CDGB 4ZAKB 5I1JH 1EPFA 1QBMH 2XXMB 1UWEH 4XVJH 5SV3A 2RCSH 1FL5B 3TO2A 4YWGL 4LLUA 3RTQB 2YSSA 5C71A 5F7HA 1QSVA 3MR9A 1OAKH 1GHFH 3O6KH 3MACH 3TBWA 1DL7H 5DHVH 3FQXA 4A6YB 3RPKA 3RGVD 3EDKA 2YMXH 1ORSA 2EC8A 3DRTB 1A3RL 3TT1H 3T0EB 5FUZL 3C2AL 3GMOB 5E1AA 5J3HC 4NNYA 3FQWA 5IVXA 1CBVH 1J8KA 4PGDA 1CI5A 4UV4H 1ZHKB 1I3VA 3QDGB 1TQBC 2YK1L 2UYLA 3FO1A 2IH1A 5L2KB 4OM0H 4G6KL 4JFPB 3TPUB 3MA9H 4LF3A 3WFEH 1ZGLB 3CGTA 4XPTL 1EEZB 4YE4H 4I0PD 2D03H 2AEQH 2HFFB 4PJEA 4LGPB 2B2XH 3R0MA 4QOKD 3VFRA 4TUKH 3MO1B 1Q9KB 4KTDH 1BIHA 4F80A 2W9EH 1G1CA 2F19L 2G5BA 5TE6H 3KLSA 2E3VA 5C6TL 3MLTB 4FQQA 4WGWB 4LDEB 1OW0C 5SWZA 1ORQA 4KPHH 4XWOC 4YHOL 3BMWA 1X44A 1GZQA 1ZT7B 3ILPA 3MBXH 5DXWA 3TLRA 5BO1H 3FT3A 3VXUA 4BZYA 1UM5H 2E7LA 1YY9D 4RAUB 1A02N 3LIZH 3TV3H 3V6FB 4I2XA 2BP3A 4NQUA 4F37F 3OXRA 1S5IH 2AVGA 1C1EH 3Q3GA 5DEGA 4ELMB 1CWVA 1OT2A 1RUPL 3OXSB 4GQPH 5HHXL 1OF2B 4FABH 5GSVA 3MJ8A 1F11B 1QFHA 1FC2D 1JRHI 4XNYH 4ZFZB 5JNYB 3UTOA 2OYPA 4QRTB 5E4EB 4ZXBA 4XPAH 4WHTB 3TZVD 3PWLA 5I75B 4DK3A 1KCRL 2OZ4L 2X70A 2FGWL 1J8HA 2I9TB 3IGAB 3Q5TA 2EEAA 1IGCH 5CSZA 3HFML 2Y07L 2X41A 3HE6A 5IFAL 3O9WB 2V7HA 4LPVA 3RVWD 1A7RH 4YBQC 1L7TL 1TJHL 5AG9A 1HHIA 3BN3B 5B8CB 3P9MA 5KAQF 5BRZB 5D2NB 1A64A 3L3OB 3RIFK 2FD6H 4KGLA 3F6LA 1DJSA 4NKDB 1PG7W 3DVFA 3MCLL 1CD1B 2NX5B 5IBUG 5JUEL 3WS3B 4G80B 3ZE1E 5EZLA 5CZVL 2WBJC 1EAPA 5C3LD 3NCCB 1BBJB 2CDGB 2CSPA 5EOQL 3EFDH 4L4VD 3O2VH 1MOEA 4DGYL 4NRYA 4LRIA 4DN4H 3P4NB 1TCRB 5D71L 4HCRL 5TPWH 1NC4B 2DQTL 4LASL 4P3DA 4YXLL 4Y16D 5E7BA 1C8PA 1AQKH 2A6JB 4OGZA 2CK2A 1FFPA 2L7JA 3BESR 3KS0H 3UCRA 1TPXC 4JFFE 2DLGA 3FTGB 1MVUA 2ATPA 4WTZG 4PLJC 3AS3A 5AYUL 5L7XL 2CMRH 5DJYA 4NQED 2P5WB 1KXVC 3QIWD 5EO9A 3WJJA 2DAVA 2V5YA 3SO3C 3O11B 4LKCA 2WUCL 2YEZB 3BGFB 4UUJA 3BJ91 4N5ED 4XAWL 3QEGL 1UADC 4PBXA 5DVNA 4P5KB 3EJJX 4U1IB 3H3KA 5DJZA 4ODUB 4RWYH 4KKCD 1J1XH 3VW3L 4ZUWA 3RZCC 1HSAB 4N0CD 3S8WA 5BXFB 4PJGE 2VAAA 1WBZB 3B9DA 3CD4A 3KPQB 5L6YH 3ZLQC 4NOFA 5GQBA 1GC1L 4K7PL 3IKKA 4YXHH 5C2UB 1BQHG 5AUMA 4B7LA 3UBXB 1UH4A 1RZIB 1IKNC 2XQBH 3PQYB 4QLRA 5CBEA 4TUJA 1V7ML 1WUNT 1MRDL 4EUPA 2Z35A 3O3BB 1G7HB 4OLYH 2I60L 4PJ9D 1A1OA 5E4IA 4HIIA 4XBPB 4K3GA 4XNZB 5ACZB 1M05B 1I3UA 5HI4D 2Q6WA 3SGDI 1NLDH 2J7LA 5DD5L 4O51B 4MAYA 3IT8D 3WLBB 4KK8D 3U79A 3BO8B 3C5SA 4X6DB 4DVBB 4JANA 5I1KL 4NGHL 2UY7A 4O02H 4DUXA 5I1HL 1JNNH 4W6WB 4Z77B 5I18L 4I48B 5IW1B 2DLEA 4HXAH 1JGVH 5IV2B 2O93L 1A2YB 3GSOB 3CFKA 4MD4B 2PKDA 3LS4L 4OFKA 4LCCC 3SDXA 3O6ML 5C09D 2E9WA 4OQTL 1A8JH 2GSIB 1RK0B 2WQRA 5C09E 3D25B 1HI6B 5F97E 3OTTA 5C0AD 4B0MM 5TQ0H 2X1PA 3GBNH 4OCYH 5D6CB 1O7VA 3HNSH 5C0AE 4LVOC 2DBLL 3OJ2C 5EUKB 2DN7A 1BVLA 1FBIL 2GCYA 3LPFA 3EIFA 1MAMH 3L5HA 4YHLH 3W9DB 1A7NL 2VUOA 3U36A 4LLMA 3K80A 4PB0L 3RUGA 4Q6IC 1F4WH 4MX7A 2MPAH 3S9DB 5A2FA 3GMRB 1WFUA 2ZOLA 1IQWH 1X4ZA 2B0SH 2VLMD 5FHAH 1M6OA 3O6LL 3LEYH 4X7EC 1MCIA 1NBVH 3ARRA 4PJXF 2EDJA 2VLME 1NJ9A 1OGTB 2DL2A 3CMOL 4C4KT 1TENA 3KPOA 4LNRB 3LKRA 1AD0A 4YDVB 3JWDC 5GGRY 4RMSA 2RFXB 3CXHK 4CVZB 1CE1L 3NPSC 5I17A 2O5YL 5IB5A 2W0KA 1AFVH 2BNRD 4ZOEA 4XVJL 3O8XD 3OKDB 1B6UA 2H1PH 3F62A 3OAZH 2BNRE 1X5JA 3KPRA 1KLUA 1KNOA 1OAKL 1GHFL 3O6KL 4NC0B 4KJWC 2BVOA 3MACL 3VXRD 3I3BA 4E41A 5SV4A 4OD1H 5CEXB 4R0LA 2X9YA 3EHBC 2DJSA 4QRPD 4JDZA 1BJ1H 1W72B 2EH7H 2YMXL 2ZUVA 3BKJH 2PO6C 5ETUA 3TT1L 3CC5B 1QLFA 4HUVA 3VRJA 3MLPA 2F54A 4IDJL 3FT4A 4NWTH 5C0BA 2R1XB 4UV4L 4XXCC 3VXQB 2QSTA 4ZOCA 3GGWB 3VWKA 5C07A 1IBGH 3D39D 5IBLD 3DETC 3L9RB 1FCCA 1WWWX 1ZA6B 2F74A 4OLVH 1GPOH 5FO8A 2EDLA 1SHMA 2H9GA 3D39E 3WFEL 1M7IB 2FSEA 3RVUD 4E9LA 4YE4L 1KB5A 1NAMH 1ZHNB 1MFDH 3VXOA 1RULH 3E2HC 3FQTB 5I66A 1P84J 3FKUS 3OKMA 4OGAD 5D2LF 3RFZC 1N26A 3I85A 4CN1A 4PLKC 4L4TE 2W9EL 1WIOA 4QWWC 5FCUH 1BZ7A 1UH3A 1EJOL 3UAJC 4XI5D 1EHXA 2WAHA 2D7TH 1OSZB 3BUTA 1UJ3B 1BD2A 1QFUH 3F5WA 1K8DB 1UM5L 1DEEB 4LAJH 2YN5A 1CFSA 4S1QH 3TV3L 5K9QG 3DJ9A 4NC2B 2CDFB 1S5IL 1MCPH 1C1EL 4KI1A 2D0FA 3OKLB 1MCWW 3VE0B 2ESVA 2EDBA 3MA7B 2GITA 3P30H 1FVEB 5HHVH 4M7KH 1ZOXA 1DDHA 4CW1B 2FHBA 3JUYA 1R5VB 3PGCB 5T1KD 4M61A 4KTEL 1OCWH 4Y4KD 3TO4B 1KPRA 5F89B 3MZTA 3MV7D 1FZKA 4HGWA 2PTUA 4NPYA 4X8JA 4AK1A 4XNYL 4KQ3L 1RJCA 5EWIH 3DO3A 3MV7E 2XI9A 4I18C 1D9KC 4L8SA 4U6XB 2R0ZH 4XPAL 3QUKA 4JFED 4PRHA 2DBJA 3RNKA 4BELD 1PX3A 2ZSWB 4WO4B 1QLRB 2UZXB 4OJFH 5MENA 4JFEE 5MEPA 1F42A 3SDCD 1IGCL 3H6JA 4JY6A 3JXAA 3RL1B 2J8UA 3BH8B 3A6OA 4ZFOB 4UMGA 4M4PA 1YY8A 1CD8A 4NM4H 1WBYB 5LXGH 3MZGB 2P24B 4HZLB 1Q94B 5EFIA 3I75A 3RHWK 2A0LD 2FD6L 4BSJA 4DW2H 2PXYC 1AC6A 2DJUA 1KEGL 2LU7A 4PRAA 3REWB 3HPLB 5E2VH 4KRPC 3GJFK 1YUHA 4IRJD 1T04A 1BM3L 4G7YL 5GRUH 5ID0B 3O2VL 3SOBL 4XPHH 1CLYL 5KZCB 3WS6A 4KI5C 3MLWH 3O4LE 4DN4L 4OZHA 5DRWB 2P5EB 4OCWH 3WHXB 1TZGL 1KTRL 4CU8A 3SJVB 3MYJA 1TZHB 4NUJA 2BSTB 1RK1A 4UAOC 1ZTXH 5KVDL 2HT3C 5J11C 2ZNXA 1AQKL 2BVUA 3QEUB 3ULVF 4YGVB 1KPUA 3ET9F 1CFNA 3SN6N 4UNTA 2EIBA 4UQ2A 3H2WA 4LLWA 4PJDA 5IJVB 1NCNA 4NHCH 1GRWA 3DX9B 1ZWIB 5F70A 2CMRL 1ZSDB 4X7TB 1MIEL 3DYPA 1NBZA 4KJYA 4TVPH 2JCCE 1OWWA 1RZ8A 2XZQH 4X80L 3HKFA 1XGTB 3D85B 5C92A 3C08H 3TIEA 3I6KA 3BKYH 1QOKA 2Q86B 2EYRA 3KYAA 1J1XL 3BXNB 3VJ6B 1XAUA 1WZLA 1AIFB 5T33L 2OX5A 5FA3B 1YNTB 3WMSA 1HXMA 5IMMB 3V8OA 3ILQC 2IGFL 4F7MA 4APQD 1WK0A 1SBBA 4RA0C 5DHYB 3QI9C 4YXHL 1KJ2L 2HT2C 5EPMB 1CDHA 3UTSA 1LEKB 5KSUA 4HBCH 1T2JA 2HJFA 4O2FB 2XQBL 4YGAB 1AGEB 3SCMD 2ERJC 4O58H 2HJKB 3FO2B 4OLYL 2F53D 2COQA 3O6FA 4OT1H 1I7ZB 5E9DB 3EYFA 5CINH 3OB8A 1C12B 2F53E 1F6AA 1NLBL 3EAKA 4PJXB 3SGEH 1FNGA 1HCVA 2EYSB 3CFBA 3HN3A 4J4PC 3IFLH 2JIXA 4HWZB 5E2UH 5GS3A 4J2XA 3S3PA 2Z91A 4O02L 1FE8L 1JNNL 1S7QB 1FFOB 3TJEH 1JGVL 3EYVA 3QIUC 4FP8H 3QG6B 4M7ZC 4NFDA 3G5YA 3SE3A 1DVFD 1QRND 3HA0A 1RZGB 3T0XA 2GTZA 4ZAKD 2VAJA 4PP1C 3GIVB 3QRGH 4IMLB 3HS0A 3QPXH 2AKRA 4H5SB 3S37H 1FVCA 4QEGA 3RTQD 1CF8H 1DSFH 4OZ4A 3GBNL 3PP3H 3HNSL 5BV7H 4V1DB 5JXEC 3HC0B 1GXEA 3ULUE 4WV1B 2YWYA 4I1NB 1MPAL 4JM2C 5FB8A 1MAML 1T22A 4NN6B 2Z9TA 4YHLL 3T0ED 3DRQB 1GYAA 4BKLA 1EZVY 4OLEA 2MCPH 3PWPD 1UG9A 3AUVA 2IALA 5E95B 2MPAL 5E5UB 5E8EA 3HE7C 3ZO0A 3QDGD 3PWPE 4L3AA 3D0VB 4P46D 2OXGA 4JVUA 2R15A 4R2GC 5IB3B 3BH9B 1IQWL 5F7EL 3WUWB 1R5WB 2ZNWA 2DYPB 5IQ7L 5L2KD 5ILTH 3LEYL 4RAHA 5D7IA 2CRYA 4FXLA 5D2LB 1F45A 1P6AB 1E6OH 5L2KE 1KJMA 5EC2B 2HJLA 4HIEB 4OFVA 3QFJB 1F00I 1NCDH 5I19L 3X13A 1CD9B 4TOYH 1S9YA 3S5LB 3G5ZA 1QFOA 4XMPL 5IFHL 3W81A 3SDDA 1KXTB 2H1PL 3OGCA 4BM7A 4R97C 3CX5J 5IKCB 3NCMA 5DO2C 5CUSL 4QO1A 5FYJD 4ODXA 3ZE0F 1FNEA 3G6AA 1FZJB 1VFUA 1HHKB 4POZC 3C5ZC 4YIQA 1U95A 1YN6A 5ABDE 4FNLL 4TUOB 3ULUL 3LQMA 5GZND 5JHLL 1QSFB 5F7KC 5GRVL 4AYFA 3SKJH 1OGAA 1BGXH 2EC9U 1AXSA 3MLYL 5T1LB 4P2OA 3C60C 1NFDA 5CKAA 2BK8A 1NANH 2VITA 3D0LA 3EOBA 4IS6A 4X99B 1QYGH 4NWTL 3GIZH 3L1OH 4OI7A 1BVKB 2GAZB 2VXVH 2ZPKH 2A6IA 5KW9H 1IBGL 4PGZA 3FL7A 1J0ZA 1BMGA 3B5GA 2ZKHH 1MCWM 4FFYL 3BIKA 3N50A 4MA3A 1WAAF 3SE9H 1YECH 1NAML 2Q8BH 3CCHA 4K8RD 4IRZH 2HKHH 1RMFH 4M48H 4PBWD 5FAAA 4KV5E 4BSWA 4GT7A 4QXGH 2FX8H 4P9HC 2K7PA 3GMPA 1BZ9B 1G9NC 1NCAH 4H25B 3T0VA 3VFGH 1GJIA 3E6HA 4OM1H 4J8RA 3SKMB 2H26A 3GI8H 4XCCH 3ARBA 3EJZC 3TEUA 4GXVH 2OL3B 5FCUL 4AQOA 5C7XH 4MQTB 1JYNA 1GH7A 1J1OH 3O9WD 5DRNB 3WFHA 1ACYH 2D7TL 3D3VE 4LCIL 5JXAH 2YR3A 4IMKC 1QFUL 5BRZD 4R8WH 5KVFH 4ODHH 4PY8J 2UWEA 3T1FB 3QXTA 2NX5D 4R90H 1UB6B 2APXA 4MQ7A 4MA1B 1RURL 2DF3A 1K4CA 1NCBH 5BV7C 2NX5E 5L8JB 1BBDL 3TVMC 2P8MB 3QUZD 4KKAD 3P30L 5E8NA 2A74B 5HHVL 4M7KL 5A16A 3MSPA 5CZXC 1NC4D 1OCWL 2P48B 2CLRA 5CEYB 1G6RH 3MRMB 4NKOA 1KFAH 3LKOA 1C5BH 5CMAB 4QHUA 3T77A 2APWA 1KPVB 1MCCA 3T4YB 3MMEB 2R0ZL 4OCXH 2DICA 4PB9H 1FL6A 3RIAF 1FYTB 2J12B 4TQEH 5IHUH 3GJEA 1ZLWK 4O2EB 4JJ5B 4OJFL 2P5WD 3GBLA 3V6OC 2E9JA 1T1YA 5HHOA 4W81A 3FRPG 3BD4A 1CVSC 2P5WE 3MXWH 1S7XB 4H1LH 1PGRB 1XGQB 2AJYH 2WV3A 3JTSB 1UM6H 3WXVH 3L3IA 3PWNB