3MBEB

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
184
structure length
178
Chain Sequence
RHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 178
sequence length 184
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3mbeB01
2GYSA 4F9LC 1P7QA 5MEQA 1CLYH 3VXMD 4QHMA 2NY1C 5J11C 4D9QD 1A6VH 3TBTA 1T7VA 2YN5A 5ENWB 2F54E 5IROC 3RTQA 2CQVA 5H37G 5E08H 1CGUA 1CI5A 1F4XH 4PRPD 3A67H 1CD0A 3RVVC 3U83A 4GRMB 1XCQA 3WLBA 3SDAD 1O7SA 2FNBA 4EQ2A 3CVIL 3FT2B 2DKUA 1WZ1L 4WY7H 4OV6F 4XNYH 3QEGL 1BVZA 1QSED 4ZYKB 2OZ4H 5ITBH 4KJWD 2IBZX 5CWSA 3QIWD 5FYKL 3JWOC 1MPAL 4M93B 1JV5B 1WAAF 1Z5LB 1I3UA 1XGRA 3UJIH 1YMMB 4JQIH 4GKNA 4ZNEA 4DQOH 4RA0C 1CE6A 4QRPB 1A6UH 1FC1A 1QKZH 1TMCB 5IWLC 3LS4H 2AEQL 2HVJB 3ARFC 5J12C 2XQYK 2ATPB 3BDYH 1C08A 4DCQB 1RJLB 5I76B 3VD3A 1CD8A 5IF0B 3TEUA 4Q9QH 1HQ4A 5KVEH 4J6RL 5E03A 4PJ7F 3DV4B 4ZQKA 1AJ7L 2VXUH 2H2SD 3NPZB 1CQKA 4RISL 3V7AE 4YC2C 5JA8B 1SJHB 5I8CB 2NY7H 4TQEH 3X3FH 3MNVA 1G9NL 3X17A 5EU4A 1UB6A 5C07E 1YQ2A 4JREB 3WIIH 2Q20A 2GIYA 4YAQB 2V7HB 1TVHA 3DXAD 2R23A 3HC0A 5HHVL 4FRWA 1KCVH 3P9LB 1P7KA 5EIQA 4YFLF 3O41B 3X12B 3QXTA 4C58B 2JB5L 4ZFOA 2YK1L 2EKJA 3CFCL 4KDTA 5HI4D 3QJFA 2HJFB 2H26B 2OR9H 5FCUL 3VXSB 1WFTA 4G80B 5IB2A 1N5YL 3LPWA 1VACA 4MJ5B 1E4KA 5E2VH 4Z7UA 4TN9A 4L4JA 5D5MB 5B39A 3GJEA 1BFVH 3R06B 1LVEA 3CFKA 1JTPA 4HH9B 3LPGA 3BZDA 1R6VA 4MAYD 3ARYA 4MZ3A 3PABB 2HRLA 1YMME 4QRPE 2ZCHH 4KTEL 1IKNC 5D7IF 1EZVX 1FPTH 3RWIB 4GG6A 3C9NB 4YHIA 3LKPB 4JM4H 3T65A 3WLWC 1ZLWH 4LASL 2VIRB 4KHTL 5T1DL 1I9RH 3RAJH 3NIGE 2Q8BL 2F19L 3OAYH 5D7JC 5D1XD 3T77B 4IRJB 5DMYA 3OTTA 1MVUB 4N8CL 2FGWH 4NM4L 3KXFA 5I1HH 1JHKL 2F58H 4PJEF 1BBDL 1I7UA 1KCLA 3H9SD 3P30L 4R96B 1GGTA 4M93C 5F7KC 4HX1B 5DJAA 1CDIA 4MX7A 3QDMD 2Z8WC 1S7SB 4FABL 1JMZA 1VFMA 4WV1B 2JIXB 2ZOLB 3ABZA 3WE6A 1LNUB 2EH7L 5E08L 3C09B 4MVBD 3AY4C 2V7NA 3ROOA 5HDOA 4JRXB 3QUXB 5AYUL 3VXSE 1TQBC 3BKML 5T5FH 3K8MA 3TA3B 1U3HC 1NGQL 2F5BL 2J7LA 5D5ME 4HD9A 4H1LG 3PQYA 3HE7A 2EICA 4HIIB 5E8EB 4GKZA 1OTUD 3JWDL 5A2LH 4LPWA 4JREC 3MRLB 1MI5D 1NLDL 2OLDA 3LKOB 4IHOA 4HZLB 1E27B 1JZ8A 4U1IB 4PJHF 3LS5L 3QIBA 1WWWX 4ODVH 3EYOA 4DZBA 2IPKA 1N64H 1KCUL 2H1PL 3QEUA 4OFIA 5T5NF 5TH2B 1BVLA 2RGSA 1RZIA 1KGCE 4IDJL 3QEHA 5SWZB 1NCNA 3ULVC 3F12A 5J6GB 4PJBA 3UTSA 3T2PA 3IFLH 2CDFB 4JLRB 4N8PA 4P5TB 3KPLA 5D7LB 4E41D 1JGVL 5DLML 4GXVH 4I18B 2R1WA 4HFUL 3L9RA 2EEBA 1G9MH 4X6FB 1YN7B 2MKLC 3ARXA 2X44D 4PB0L 5FXCH 1V3MA 5K9OA 5JXAL 1TZIA 3AFLA 4MD5A 1H3GA 3EYUL 4D3CH 3JTSB 3CDGB 5IV2B 1UVQA 4JRXE 2WBJD 1I1YA 3TT3H 3GSNB 5BRZD 3GRWA 1OSPH 4O2FB 2HFEA 4QRTB 5ITFB 4H1LA 4OGXL 5CP3A 4P3DA 4XPTL 3KJ6L 1MJ7H 4YGVB 2GT9B 1MJ8L 3RQ3A 5JOPE 2NY6C 3PV6A 2DQHH 2W9EH 2F9BT 4UTBL 1HHGB 5SWSA 5I8KH 2A77H 4ZUSA 1IRAY 1MLCA 3MOBL 3UCRA 1PEZA 1PYWB 3TYGH 3MUHL 2B7DT 3QWRA 4KAQH 1BD2A 4YDJB 4ORZC 2R2HA 2ZCHL 3QUXC 1HKLL 1I4FB 3C5ZC 2VYRE 4XBGB 5FK9A 4Q9CA 1EGJL 5SWZE 3FQNA 2W9LA 5J0BA 3I6LD 4BZ2H 2YD9A 2XZCH 4CU6A 4LIQL 3TYFB 3I6KA 2DTSA 1W0YT 3H9ZA 2UWEF 1VADA 1KJVB 5D7LE 3NZHH 4JKMA 3QI9D 4JFDA 4LCUB 4LSRL 5F97E 2X4SB 3PWPA 1ZS8B 4FP8H 4M1GH 5EBWA 5EU3B 1MCFA 5F1KC 3L7FB 4YHNA 1JJUA 3UTTB 3B9KB 5DJYA 1JUFB 3PGCB 3I6GA 3EYFB 3IDIB 3O11B 1KC5L 5J1AB 3AM8A 4LLVA 5DRXB 4U49A 2XNAB 4Z7WF 1FSKC 4H88L 2VQUA 2VDKL 4HS3B 1JGEB 3CFDB 1Q9WB 2XWTA 3L3HB 4GO6B 1SYSA 1FZKB 3MBEB 5A2FA 2NY3C 1DLHB 4FQHA 4I18C 4J3WA 3SE4A 3TO2B 1ETZA 3RUGF 1BIIA 3FB5B 2XN9A 3LSOA 3RGVC 4NHCL 2XPGB 5FYJH 4FFWD 3D3VD 1CVSC 3SOBL 2AK1L 1N8ZB 1YEEH 3GKWL 2BX5A 4BFBD 1CYGA 1B0RA 3ZL4H 3QQ4B 2DQIL 5JIPA 2WV3A 1P9MC 4WNQB 4Y5YA 4K3DH 3DURB 3FFCB 4NQCD 1IAIL 1PG7X 5EN2A 4HGKC 4J12A 1KULA 4NSKB 1U8MB 1QEWB 4HV8B 2JJSC 5DVKA 3P0VL 4P9HL 3ZT5A 1MNUH 1KYOK 1DUZA 5HYQB 3BW9B 1CD1A 4PJFF 4OUUA 3O6KL 3UTTE 5C0JB 4MA8H 3PF2A 3BE1L 5AWNL 1HNGA 3ZLQC 1UKTA 2V17H 4OCXH 1AGEA 2O61B 5A2KH 3SDCB 2BVUA 4D3CL 4L4VB 3PGFL 5INCA 5DEZA 3I50H 1ZVHA 5EOQL 5F9WC 4PGEB 5I1GH 2FJGB 2N7BA 2ADIA 3IJSB 5EZJA 5I17B 3BVNB 4ZODA 2CIKA 1HKFA 1F4WH 3CVHH 2VTFA 2F53A 4PRDB 4R2GD 4Y1AD 1UG9A 2GAZA 2APWA 5C6WH 4UMGA 2AJYH 1B6UA 3DSNA 4MNQD 4N8VB 1U8KB 4QT5B 2B2XL 3MLYL 4AL8L 2P45B 3RVXC 2P5WB 3IFOB 5FO7A 1OAZL 3MFFA 5D71H 2IFFL 3RWFA 3FFCE 3AXLB 5D72L 5IR1B 2F74A 2VL4A 1A14H 3TZVB 4OCWH 1BAFL 3MBEC 1XMWA 1KFAH 3T2NH 4WO4C 4N90D 4HK3N 3H7BA 1X4XA 5DZOA 5FUZH 4NJ9H 3HPLA 3NMEA 5DGRA 2X4QB 2GSGA 3JV4A 3VGAB 1TTGA 4NHUA 2V2TB 3NBNA 5C0IA 1Z3GL 3S88L 4XGZA 1GL4B 1HOCB 3FQWA 3MRGB 4L4VE 5C0RL 4KKCD 4S1QL 2ZSWA 4X4ZA 2LVCA 4ZAKB 4NO2A 4LLMA 1X5AA 3P0YL 5DQDL 4B7IA 4XP9L 1DBAL 1NGZB 5LWYL 4WTWA 4X99B 3MLUL 5TQ0L 3QULB 1IAOB 1QBML 4XB8A 3O6ML 2GSIB 1HH9B 3B9DA 5BZWB 1N3NA 2NY1D 4M9OA 5GGRY 1IC5L 3CLEH 4APQA 5DGQA 1O0VA 2YC1B 1CIDA 4PRNA 5H94A 4FXLA 3QFJA 4EBQL 2OI9C 5KZCB 1N0XH 4HDIB 2OZ4A 3ZKXC 2D0GA 2P5WE 3EIFA 4YIQA 3CXDL 1CT8A 5JHLL 4UQ2B 4NRYB 1T0MA 5KSVA 2I9LB 2ZSVB 4IJ3C 4OCRH 3V52L 2XICA 4AIOA 3IU3B 3MRDA 3MLZH 3ES6B 1YN6A 4S2SA 4C55A 4M6OH 4WFGE 5C0AB 1IM9D 3GSOA 1UACH 2YEZB 5FYLE 5DZNA 3PP4L 5JZ7C 3S36L 2LQRA 1XF3A 4LBEA 4HHAB 5C7XH 3EO9L 2APVA 4P3WA 3T0DA 2F54D 3O9WB 5DUMH 1T1YA 5DMKB 2QLVB 4RCAA 2XKNB 2B1AL 4QWWC 1QBLH 4C83B 4BSWB 3OKNA 4MA8L 5MEPA 3ULUD 4OZGE 4JPIA 4OF6A 4M62H 2MSPA 4LKCB 2EH8H 1PZ5A 1RK1B 3TZVC 5IQ9B 3F6LA 2PUQT 3SKOB 4Y4HC 1HILA 5CGYC 3F5WB 3QUYD 4DKAA 5IB4B 2VERN 3TO4A 5I1AB 3I50L 3CAFA 3SKJL 2WK2A 5BS0B 3UZEA 3MOAH 5GRJL 4AEHH 4X9HA 1NGPL 4RMRA 3IXAA 4E5XB 4JG0L 1P4BH 1T2XA 3E8UL 4O2EB 1JF5A 3GSRB 4ZOBA 1SEBA 4LPXA 1LK3H 3GSVB 4U7MA 4KKNA 1A3QA 5IB1A 4S0SD 2YD2A 1ZSDA 4X6CB 3BGMA 5E99L 3WNMA 5ID1B 2NZIA 1RIHL 2VAAA 1CFQA 4K71B 4QRRA 1JGLH 4KK5C 4M1CC 4XBPB 4ZAKC 5DD3H 2V5MA 1RV6X 1NKRA 3BIBX 3GFUA 3BH8B 3DX8A 3I3DA 3U7WH 1INQA 3LEYH 5C6TL 4LVHB 5C0AE 2Q8AH 5D6DC 3MPCA 2BZDA 2VLRB 4OBRA 5KG9B 3EDEA 1YUHB 2HG5B 1EGJA 1F13A 3QNXB 4U7KA 3VXUB 2ICEA 3OKKA 1MCPL 4AEIH 3VWJB 4RSVA 3VD5A 4HMCA 3QRFM 4I5BA 1VDGA 4KROC 3U1SL 4M5YH 5J06A 1LDPL 1UKQA 5T5NG 3BGFB 2ATKB 2QADB 4MSWB 5JDJA 5TE7H 2Q7YB 3WLWD 3SDYH 5B3JE 5C8JB 4JQXC 4L5FH 5FF6B 3WDIA 3EYQC 1M05A 4PJEA 4TOYH 3H6JA 5BJTA 3O8XB 3RNKB 2Y36H 5JIHA 3BWUC 5BS0E 2P49B 3OGCA 5CSZB 5TE4H 1J8KA 5DURB 3RU8L 3VI4F 3VFRA 4P2QA 3UTPE 3PXHA 1DE4B 2Z8SA 1BX2B 3O9WC 4GRWH 4KRNA 4U1NB 1H8OA 5EC2A 5I1LA 4OD3L 3STZB 3BUTA 4JKPL 1YMHB 3SKNA 4QRPD 1MCWM 1MCCA 3PHQB 1C5BL 4RGNE 1U8LB 2IBBA 5DC4B 5F9JB 3LY6A 5DHYA 1UM5H 4PJAB 3W2DH 5GGUB 5DJXB 5F3BB 4QOKE 2G75A 5HYSB 4AEFA 1WISA 3IJHA 5E6IB 5IMKB 5HJ3B 5CLWA 1KJMA 2VLRE 4H8WH 1UYWH 2IPTH 1JZ7A 2PETA 4ZUWB 4XHQA 3DX7B 4PJHA 4O02H 3VXUE 1XR9A 4OD1H 1IZJA 3REVB 4X4YB 3BPOB 2Y6SD 4AM0B 1PLGH 1AR1C 2BVEA 3UO1H 5DD5L 1RHFA 4Y5VB 4IIQA 1A47A 2EDHA 3WXVH 4GQ9H 4OZHF 4RGNC 1OOAA 4K71C 4PRHD 1UGNA 4P2RB 4A6YH 4F3FA 4ZUTA 3OF6D 4X6EB 4JKLA 3VXSD 1P6AB 4NJAH 1NBYB 3LH2H 3DBXA 5FA4A 1YA5A 5CSBA 5I6XB 2IH3B 5C2BH 3QQ3A 5D6CA 1RZKH 4X83A 4UIKL 4KZDL 3G5ZB 5E2WH 32C2A 3NCJL 3VWJC 3JV6B 3QDJB 4XZUA 4DZBB 4U1LA 1BZ7B 1YNTA 1CU4L 1P7QB 2GTWA 5MEQB 1P4BL 4YHZH 3CFJA 3IB4A 3TBTB 3GK8L 5KVFL 2AV1A 2YMXL 1U3YA 3RTQB 4DZ8A 4MJIA 4MXVF 2ITCB 2F8XC 1FNGA 5CIPA 1DFBL 3RIAK 2XFXB 1XCQB 3WLBB 4IRSB 4IRJD 4WEBL 5DVLA 4O4YL 4XNZB 3JZ7A 3MBXH 5B3NA 4FZEL 3NIFE 4CW1A 2RJMA 2LU4A 5D1QA 4MGXA 5CWSB 1NC2A 4JHBA 4P3CH 4LSQH 4YDIL 3IGAA 5DD6A 3OKDA 2JIXD 4JPVH 4OF7A 3MNZA 4M5YL 3DVIA 3L5XH 3RY5A 4P2RE 1AH1A 4GKNB 1ZKAA 1CE6B 4JRXD 3OAUL 3QUXD 2Y5TA 1C08B 1NGXB 2NY4C 4M5ZH 4QGTA 3QEQA 5E6IC 4KQ3H 3TA3D 4LEOA 1HQ4B 2RAMA 2DDQL 1E6OL 3ZHDA 2RFXA 1J88A 4ZQKB 4MCYB 4JQVC 3D69A 4GRLC 1CTNA 3G6DH 3OAZK 4GW5A 1EEQA 3QDJE 2WSKA 5JOPD 3BPOC 1EA9C 3Q6GL 1F00I 4Y8DC 3MNVB 2BY3A 2FEEL 5DRZA 5EU4B 1LEGA 2DQTH 4Y5VC 2P43B 2H2PD 1FG2A 1UB6B 1LILA 2HP4A 1RZJH 3QO0A 4HC1H 3HC0B 2R23B 5EZOH 4C54A 4OQTH 3RVTC 3IXTA 1EAJA 4JFZH 5SWZD 1WIPA 2ARJQ 3FAXA 2BDNL 4PBWD 4QNPF 2DL9A 3LD8B 5ICZA 2YUZA 3QJFB 3RUGA 1MFBH 4ZOAA 4P5TD 3TBYB 4PS4L 5D7LD 2EDQA 1VACB 3VFNA 4BM7A 3SO5A 4JDVA 1CXLA 5KW9H 4UT7H 1RSFA 3UTZA 3DLQR 4OD1L 5B39B 2VWEE 3GJEB 2G60H 4HKJA 4PLKD 2DBJA 4PRIA 1FLRL 5I71B 1DANT 1HQRA 1D5IH 1OGTA 1IGTB 1VKXA 4HIXH 3T65B 3DI2B 5AG8A 4UQ3A 4NZJA 3C2AH 4ODSH 1ZANL 4XNZC 4AENA 5DJCA 5F7EH 4GH7B 2OL3H 3ARPA 4LCCA 5J8OA 3D0LA 4GSDH 2A9NH 3KXFB 3INUL 2D9QB 1FORH 4XVTL 3WXWL 3TV3L 1F4YH 1I7UB 8FABA 2HVKA 3HLAA 1ZE3C 4MX7B 4OLEA 4P5MA 1CZ8L 3CMOH 2JJTA 4TUJA 3ZO0A 1S7UA 4ZUUB 4XT1C 3WE6B 1TJHH 4TSBL 3LPFA 3ROOB 4K2UL 4CNIA 1CFSA 2NW2A 1NKOA 1CIUA 4TVPL 1C7TA 2Z92A 3X3GH 2V6HA 3MV8B 3QNZB 4JR9L 4S1DD 5A40E 4POZC 5IB5A 3PQYB 3HE7B 1QSFA 1CL7H 2QQLH 5A2IH 3UTTD 3B9KD 4GKZB 3VXTB 2AW2A 5E2UH 2CDEA 1WC7A 5KSAB 2ZJSL 1RZ8A 4IHOB 4LSQL 5D70H 3MYJA 3C5JA 5DDHA 1GAFH 2VMFA 3CC5A 1KXVC 3QIBB 1QP1A 4G6AD 1CXFA 2IPKB 3LHPH 3MRKA 1JYNA 3U0WH 4GG6E 4G8FB 3QEUB 5IMOA 1A3RL 5MHSE 4XBEH 3ARDA 1BVLB 4KDTC 1RZIB 1IEBB 4PB9H 3QJHA 3ILQD 3HAEH 4YDLC 5IJVB 5JR1H 3MBED 3MLTB 3QXDA 3THMH 35C8L 3F12B 1WZKA 1E4KC 4PJBB 1MQKL 3DUSA 3KXFE 4JCLA 3KPLB 2C4XA 1INDL 3SKMB 5IBTL 3DRQA 1NAKH 5ETUA 3A0OA 1E4XI 1TZIB 3ARQA 4Y4KC 4MD5B 4G43A 3LKNA 3VFVA 5I19H 1UVQB 1IFHL 3FFCD 4FZ8L 5TE6L 2YS4A 4J4PA 3C60A 4YHLL 4MWFA 4GXUN 2BVYA 3HNVH 4NZRL 2ZUQC 1H0DA 4U6HA 1OGAA 3FKUS 1CBVL 1K3IA 2BERA 2HFEB 4H1LB 4XI5C 3O6LL 1L7TH 4P3DB 4WI8A 3CFBB 1Q94A 3M17A 3B2UC 3PQYE 4OLVL 3BYYA 1JZ5A 3EZ8A 2YUVA 1QA9A 3EDJA 4BZ1H 1B4JL 3PV6B 4NKOA 1FYTA 1ZT7B 4K8RH 5KTEL 1S7TB 3STLA 5SWSB 4GBXC 3FRPG 4ZUSB 5IMLB 1MLCB 2MCPL 1D5BA 3MLWH 3SDCD 3QO1A 1MFNA 1LE5B 1YNKH 4L4VD 1U92A 1BD2B 1DBJH 3ZE2E 4DJMA 5FCSH 4MMZC 5FK9B 2LVEA 2DLIA 3HI5L 3ELAT 1FFRA 3FQNB 4RMWA 1AE6H 3DIFA 5F6HJ 1OY3B 2FX9H 3VG0L 5ABDE 4PJBE 3UTSE 1L9MA 3FOMA 5JZ7D 3PWJA 2ZKHH 3I6KB 1AGDA 5TF0A 5GGTL 1VADB 1R5WA 3HE7C 4JFDB 4HFWA 4YXHH 5F7DA 3PWPB 1A64A 1ROWA 1QBBA 1R24B 4YHNB 2BRRH 4G6JH 4MNHB 4U1GC 3MR9B 2VQ1B 4JY6B 2P5WD 5TQ2L 3QIBC 1H3WM 4H0IA 4F58L 4F8TA 4DUVA 5J1SC 1FL5A 3I6GB 2DMCA 1XFPA 1IGML 3BISA 5HD8C 1UWXK 3TZVD 4LLVB 1MJJA 4JPKH 1IAKB 5CGYD 4DGIL 3ET9F 3BFOA 3ZYIA 1DBBL 4KHXH 4WFGD 1I7ZA 2XWTB 5FYLD 3HC3L 3VXRB 1YJDH 1UM4L 2Z8VC 1SYSB 2PYEA 4XP1H 1DQQA 3MRNA 3OXSA 3VI3E 2P46B 4HUWA 1IAMA 3ZE1F 3FRPA 4FQHB 4PG2A 1C5CL 5IVZA 4YHKL 1OAUH 4HLJA 3QG7L 1DLFH 1ETZB 1YY9C 5SWSE 2XN9B 3LSOB 4KQ4H 2AJUL 5GGVY 5CINH 1OM3H 4RAUA 1BD2E 1H8NA 4KK5D 5IFHH 4ZAKD 5FM5O 1D5MA 1B0RB 4UT9H 3WFHA 3BRFA 3N9GH 2VL5B 3L5JA 5F7UA 4Y5YB 1VFBA 1X9QA 5HBBA 4CN1A 1DJSA 4UNVA 2NXYC 2DBLL 5EN2B 2P1YA 3OKOA 5DJ8A 2A9MH 4LARH 1SYVA 1F3DH 1R3IH 4X8XA 3VDCA 1J0HA 4JFDE 3F62A 2A1WL 5IW6A 3PWPE 3QB7C 4UV7L 1OPGL 4KKLC 1DUZB 1IQDA 2EE6A 1JZ3A 1CD1B 4ETQA 5E70A 5KZCD 1JPST 1FIGH 2DQEL 4Q9BA 5AYQA 1IT9H 1U91A 4Y89A 2E27H 1AGEB 1MELA 5CUSH 2N7AA 1FHGA 1I85A 3FFDA 2IAND 2WP3T 3RWDA 5INCB 5C0AD 3VXRE 1TLKA 1KJ2L 1XR8A 5I18L 1YECH 3MLRL 2EO1A 3L5HA 2ADIB 3K4DA 5DJ6A 5EZJB 2XI9A 2CIKB 1F6AA 1S5IH 3O9WD 4NQSB 3QDGA 2XN9E 2GAZB 2P8MA 1I3VA 2E3VA 4PYGA 3UDWA 3DMMB 1KCSL 2PCPA 4K7FB 1MUJA 3G5XA 1I7RA 4NZDA 5FYKE 3AM8C 2FD6H 3O3DA 3MFFB 4R4ND 5FO7B 1KNOB 5F1SA 4RQQA 3RWFB 1ZA3A 3HE6A 5BS0D 4WW1B 2ICCA 3LKSB 5FA3A 1UZ6F 4G7VL 4Z9KB 5FKPA 4HPYL 1J11A 3GSQA 4YHOH 4NKMA 5DHVH 3K4ZA 3SE4C 3UTPD 4L3CA 2UVFA 4OZHA 5IESL 25C8H 3ROLB 3HPLB 3HI6H 4JRWA 2M1KA 3MLPA 3NTCL 3JV4B 5L9DH 2BVQA 2VDNL 2NY0C 4R7DB 3OR6A 4NHUB 3SGJA 1MF2L 4OCYH 2FL5A 2NX5A 5I2IA 4LGSB 4XGZB 1WTLA 1SM3L 3ZDXF 4HIJA 3RL1A 2ZSWB 3WFEL 5LXGH 3U2SB 1MFAH 4XMKL 4LLMB 4G9FA 1JBJA 2Z8RA 2WM0A 2DIAA 4RWHA 1RUKH 3I3BA 3QPQD 3TCLB 4NQTA 3VXUD 3NA9H 3VWJD 4M6NH 3MFGB 3EYVB 1JRHL 2F53E 4XB7A 3KJ4C 1RUQH 3MCG1 4UB0L 5C0GA 4APQB 4PRNB 5H94B 3IDMB 4ZFGH 2IQ9L 2QADD 3CX5J 4OM0L 1G9NC 4ODTL 2AJXH 2HH0L 4URTB 1M7IA 4ZTOH 1CT8B 5CINL 3HR6A 1T0MB 2D7OA 1EERB 4R26L 5F9DC 2KQNA 3O8XD 3C6LA 5IFHL 4UT9L 4YHMH 5EWIL 3WL9B 3QP3A 2EE9A 3KYNA 5EO0B 4S2SB 3GDBA 1UJTA 3GSOB 5JO5B 1NMBL 2WWMD 4LCIL 1D9KA 1XF3B 2R0LH 4LBEB 1PG7H 4H25A 1AD9A 5K9QG 1S9YA 3BEWA 3RIAF 3VFGH 4XNUH 1T6VN 4JKWA 3TP4A 5D7KD 1BQLH 3BPCA 4LOUC 2OP4H 4D8PA 4V2CB 1AQDA 4PJ7B 4IBLT 5MEPB 4ZUVA 3BD5A 4OJFH 4X5XA 3WO4B 2A6JA 2ICWI 4JPIB 5FO8A 3RNQA 2FR4A 5I1CH 5HXMA 4HWZA 4B7LA 5KJRH 1PZ5B 2X09A 4Y88A 4CUCA 3CZJA 3HC4H 5D7SH 4M8QA 4K3JH 3TO4B 4R0LB 5E2TH 1S3KL 5CJQH 1FL6A 4OZ4A 3BRGC 4OKVA 1AR2A 1GIGH 3RA7H 1UFUA 2HKHL 4JDTH 4KTDL 1SEBB 3WFCL 1HINH 1MRCL 4LPUA 1LO4H 3LEVL 4P2RD 1FH5H 4BFIA 4DVBB 1ZSDB 3BGMB 5HHPB 3L5WB 2X6MA 3EAKA 1RD6A 4X7TA 5MI0B 4QRRB 1AD0A 1KPRA 3V95A 3HB3D 1E6JL 3LQZA 4FQXA 4XPAH 4NO0A 3RWGA 3QRGH 4TSCH 3H3KA 1INQB 2VSDA 1IEAA 2VZSA 3CXHK 4G7YH 4JFYA 1CGWA 3OAZH 3QDJD 1ORQA 3N85L 1P7QD 5L2KA 4FQIH 3S37L 2ICEB 3P3YA 2IAMA 3OKKB 3QHFH 5LBSH 5D7IB 4APQC 1TQCC 4X7CC 3UJJL 1Q72L 4EKXA 3LN4A 4I5BB 4OAWA 3RTQD 5GGTA 4F15C 5EPMA 1JCKA 3MRRB 5IG7A 5FHAL 4J3VA 1N4XH 2ZOKA 3VXOA 1IQWH 4IRSD 4FQLH 5FIEA 5I1EH 3WN5B 3CPLA 2LU7A 2VABA 4JFXA 4OLXL 4PJEB 4ZOCA 2PXYB 4NBZB 4XX1G 2ZG2A 5BJTB 3DX9B 5J89A 4ONFH 1ZLSH 5LCVL 1MREH 3OGCB 1OWRM 1QFWH 5T3XD 3R1GH 1KF9B 4L29A 2KPNA 3VFRB 4P2QB 3BKJL 1IE5A 2P5EB 1U8JB 2EYSB 1MFCH 3WNOA 1ZVYA 2IALA 5GIRA 5E94A 2G5BA 4CMMA 1HYSD 1OAQH 5EC2B 5I1LB 5ADOL 2F8VA 4BYHA 2W0LA 3RL2A 1W0WA 3SKNB 1A1MA 4FXGB 5I0DA 2DQCL 2HTKD 3WO4C 4QRRE 4R4FL 1T22A 4LNRA 5DHYB 4Q7DA 5DWUH 4BH7A 2X2YA 2IPUK 3W11C 2G75B 5HPMB 3IJHB 1NC4A 2IQAA 3BESR 1A5FH 4I3SL 1AIFA 3QWOA 4OM1L 1GGBL 2MKWA 3S96A 4WFHE 1V3JA 4PJHB 1XR9B 4PLNC 1RZFL 3P4NA 5DTFB 4LIQE 3GIZH 3FO9A 2I5YL 4Q9RL 1WQVT 3ZMRA 4EI6A 3MX0A 1F90H 4MXQC 3PWNA 2W38A 5J7CC 2XQBL 5JW4Q 1EO5A 3MV9A 4F3FB 3E0GA 4LLAA 1YYMH 4ZUTB 4PJEE 1DQLL 4JN1H 3DBXB 1S9VA 2VUOA 2ZCKL 4HKXA 5FA4B 4TUOA 3JWNC 4HGMA 4CGTA 4D0DA 3QQ3B 5D6CB 2D7PA 1TPXB 2GY5A 4XPHL 1CGYA 2QQNL 3SDDD 4WW2A 3X14A 4P2QE 2EDRA 2OK0L 15C8H 1M7XA 2E8ZA 2P5EE 2AJVL 32C2B 1P6FA 2BY1A 4XZUB 4K23H 3O2DL 4U1LB 3PP3K 1YNTB 3ARZA 1IC7H 2AGJL 3CFJB 5C1MB 4GLRI 4MLIA 2AV1B 4Y2DA 4GT7A 1MOEA 4HWEL 3QIUA 4WHDA 4KY1H 1FNGB 1T5WA 4GFTB 1WBZA 4JHWL 5HVHB 2B39A 4DTGH 4MHHG 4HKBA 4ZTPL 3O0RH 2OTPA 4RBPK 4JM2F 3MGOA 2VLLA 1T21B 1B88A 3ZKQD 4PJHE 1NDMA 1NAMH 4CW1B 1L0YA 5I1JL 5D1QB 1JPFB 3O3EA 4OGAD 2BOBA 1NC2B 4Y19A 1ADQL 1Q0YL 3F7QA 1UJ3C 3IGAB 5DD6B 5L8KB 3MNZB 4RRPG 2YBRA 5HHXL 1GC1L 3VWKA 5CJXA 2FHBA 3L3KA 4MJ4A 1JYWA 2Y5TB 1FNEA 2UWEB 2Q86B 2WINA 4P23B 3QEQB 3MV8D 1G7LA 4OZFG 1NUDA 3AROA 3BIAX 5C0EA 1JWMA 5FYJU 4J3UA 2RFXB 3PQYD 3HE7D 5TFSL 4OCSH 3CSYA 1FO0L 4GW5B 1MREL 2UZIL 1QFWL 1T7WA 2C4FU 3TBSA 2L0DA 2XZQH 2W0KA 2JELL 3BHBA 2Y4SA 3SDXF 5KSAD 1LEGB 1F6LL 4PJ9A 5CJOH 4WWKA 3H2WA 4IIQC 1FG2B 1NUFA 1J1XH 4P9HC 1OAXL 3QIBD 2EDLA 4Z7WB 3JWOH 3QO0B 1EX0A 2Q3AA 5I16A 4PV9A 1H9VA 4OSUL 4FQ2L 1MHPH 3S3PA 1MIMH 3S3SA 1QLFA 5DA0B 1RFDH 1TJGL 3NFNA 4P4KA 4OCNC 3ZKMC 5EOCH 3RUGB 4LPYA 3MCLH 3PG2A 5JPMA 1TPXC 5AEAA 3IVKA 4U6TA 3LRSB 1A5FL 1FZJB 1MCBA 2NCMA 1A1NA 5DK0A 5C0ND 3MLXL 5GJSL 4X7SL 1XGPA 3V4UL 4RRPA 1QRNA 4HKJB 3UTQA 4PRIB 1U8HB 4NT6B 4IMLA 3MLSH 1MLBA 1HQRB 2A73A 1UWXH 3EJYC 5GJTL 5D8JH 1CD9B 3WFBH 4L8BB 3WUZA 3OSKA 1GGIL 1OGTB 4EUPG 4OZFA 2EZ0D 2R4RL 5DK2A 1I3RA 3QEQE 5EU6B 4LRNL 3B3IA 2FWOA 4UQ3B 2Z9TA 1FFNA 4AENB 4PJFB 1JGDB 3KDMA 3DHMA 5IUSA 3V5KA 1BIHA 4OLUH 3D0LB 2D0HA 4PFEA 4JHAH 2BNQA 5D1QC 4ODXA 2VXSH 1G6VK 5SWSD 5K9JL 4HG4K 2CRZA 3HHRB 5I15H 4ZPTA 8FABB 1CF8H 4U3CA 3IKCA 1UH2A 2HVKB 1HHJB 2BMKA 4OFDA 3PJSA 2R9HC 3KS0H 3QWRD 3VFMA 3VMNA 3SY0A 2EECA 1X3DA 4TUJB 3MJGX 1B3JA 3CVHB 5GGVH 3MJ9H 1PSKH 4DWHA 4XAWH 1S7UB 1CICA 3ZTJG 2FECL 4N1EA 4J23A 4NUGL 3RUGE 1P84J 2NW2B 4M7KH 4KZEL 2Z92B 4G42A 1G7MA 3UYPA 3O0RL 4KPHH 2VXVH 3PWPD 4F7TA 5TDOA 2WUBH 1YEFH 2WIIA 3WMSA 1QSFB 2ED7A 3EDFA 3L3DA 4LFHD 4PRIE 4DAGL 2CDEB 4EUPA 2ADJB 3IDUA 4JFFA 3I85A 3BP5B 3C5JB 2QQKH 3V6FA 3CC5B 3L1OH 1EDQA 5DYOB 3MRKB 4BK4A 1CDBA 5I74B 5IMOB 3ARDB 3TIDA 4X6BA 3AAZB 2BFVL 3V5HA 3VXRD 3WYRA 4HF5H 4YFLI 1FV1A 2VLJA 3QXDB 1MAML 2R2EA 4Q6IA 3DUSB 5J57B 4KGLA 1MJUH 2XN9D 4FQ1L 5I30L 5HI5D 5C0FA 1K2DA 2DQUH 1LO2L 2Z93A 3DRQB 3FN0H 1S5HB 3IDGA 1U58A 2AJSH 2CKBL 1RJCA 3FO1A 2CXKA 3W81A 3QH3A 3VFVB 3NCMA 5IJKA 5ISZA 2DB8A 5CBEA 1QLEL 3D18A 4FTVA 3ULVF 4U6HB 5ALCH 4LCCC 3WHE0 4OI9A 4YUEH 3GO1L 4N9GA 4LVEA 4R9HA 1EPFA 1NFDA 5CAYB 4EEEA 4NKIL 1Q94B 2WWKO 3EFDL 3M17B 5GGSY 1QSFE 5LAXA 1NCCH 1QA9B 4NKOB 4QRQA 2LTQC 2I24N 1X5IA 1GOGA 2DIBA 2Y7QA 3IFNH 4PPTA 5JQ6L 3BN9C 3FQUA 2JJTC 1BJMA 1SMOA 1D5BB 4MD0A 3QO1B 4W70A 2NLJA 2HKFH 5GRWA 1U92B 1T2QH 4E0RA 2Q76B 1GRWA 3ARUA 2YPVL 2I27N 5E8OA 4MA7H 1LGVA 3LZFH 1TCRA 3DIFB 2PTVA 3QXUA 2BCKB 5B8CC 1AXSA 2X4OB 2YOCA 2GY7B 3PWJB 3H9YA 1AGDB 5HHQB 1WZMA 1R5WB 3GMNA 5ILTH 4HFWB 4RZCA 5F7DB 3NFSL 3DMMD 5C08A 3MCKA 3C5SA 3RX7A 2B8OT 4NQXA 5I15L 2RCSH 3DWTA 1N6QL 1MIEL 1AGCA 2C1PA 3FO0H 3HG1A 4RFNB 3CK0H 4BK5A 3O2DA 4PD4K 4EI5A 5I74C 1FL5B 1I1AD 4NRXA 3ARDC 2YD3A 3SHSA 5HPOA 5CJ5A 5GGVL 4OGYH 1Y6KR 4QTIH 1MJJB 4D9LL 1BLNA 5M95B 4XP6H 1F58L 1T66C 4NZTH 4N68A 3OL2A 1I7ZB 3LRGA 5AAMA 5BMFL 1DQQB 3MRNB 3OXSB 3TVMB 3FZUD 4HUWB 1DQDL 4KI5C 5J4MA 1NCAH 4KRPC 1GGCL 4KMQA 5IVZB 1DBKH 1TJIL 5EU5A 3FHAA 5FOBA 5DUBA 4BA8A 3TBVA 4NM8L 3CMGA 2XWJB 3U79A 1FL3B 1ADQA 1DQMH 4J4PC 3C60C 4W6XB 1B0GB 1CGXA 3WFHB 4I48A 1Q1JH 3FB7A 3HZYA 2Z31A 3GI8H 4XWGL 1BFOA 5HHMB 1R3HB 3OKOB 1Z9SA 1SYVB 2GKIA 5IQ7H 4POYA 3ARVA 4XNMA 4APQD 2R0WL 5IW6B 2HFGL 3BN3B 2VH5L 1IQDB 5JW5A 2VRAA 4M7JH 4ETQB 4E42B 1FO0A 1XGYH 2CK0H 1S7VB 1U91B 1KLGA 2YWYA 1JNHA 3UC0L 2AKRB 3FFDB 3QQ9D 4Y4FB 2VOTA 2BHUA 2Y06L 3RWDB 1KB5L 5C86A 4TTDD 1H3VA 2PYEE 3GHEL 1CLOL 1I9JL 4YDVB 5F89A 2YSSA 3K80A 1R0AL 1A4JA 1IGFL 4HIEA 5DJ6B 4U3HA 1C16A 5HDQH 1F6AB 2GQHA 2HLAA 3ULVL 1HHHA 2E6QA 3KWWA 3QDGB 2R1XA 1G84A 3A6OA 4LHJB 1RHHA 2C1OB 4RFNC 2VDPH 3EKCA 2PCPB 1HWHB 1I7RB 3IFNL 2R0KL 2H9GA 5GHWH 3C87A 5HDLA 4DGYH 3W11D 1EAPA 3O3DB 5KANI 4ZOEA 6FABL 4RQQB 3TO4D 3HE6B 5HHME 1IM3A 2Y72A 4HJGA 5D9SA 5E00A 1P1ZA 1A6ZA 5FA3B 4AT6A 4OFYA 3B9AA 4OLWH 5E2JA 5FKPB 4CL7A 4ZXBC 1YEKL 3GSQB 4NKMB 4PG2C 4L3CB 1LO5A 4OZHB 2J8OA 2W65B 3M07A 4HXAL 4MXQD 5JW3L 2BVQB 3S34L 1FLTX 5CZVH 3VDAA 2HN7B 2V5SA 4QRRD 2NX5B 3FO0L 4JKKA 4KDWA 5DD1L 3MMEA 4O5LH 4KUCF 1J0YA 4PUBH 3VI4E 4HIJB 3UAJD 5E1HB 3RL1B 5HYIA 4ALAL 1NUGA 1V3LA 2NW3A 3MO1A 4G9FB 3WSQL 4AG4H 1CGSL 1YPZF 2FZ3B 4WFHD 4G6FB 1MVFA 1OP9A 4S0TD 1FFOA 5CZKA 1U3JA 3QDGE 2VLKA 1NCAL 3TLRA 5C0GB 3FQTA 3DI3B 1DBKL 4XP5H 4WHYG 4Z5RB 4P2OA 5LGKA 1IMHC 2CLVB 2KBGA 3GMLA 4JM2A 4G3YL 1KEMH 1M7IB 5E8DL 2YA1A 3WNPA 2PXYD 3RJQB 1NCUA 3C6LB 1I8KA 4JY5L 4F9LA 4GAGH 1LO3H 4CDGC 2DLEA 2C3XA 5IROA 4P2QD 2P5ED 3BYTA 3MRMB 3HCVA 4XCEA 2QHRH 4PY8J 3MUY1 4OZHE 3P0GB 1D9KB 3PP3H 1SBSH 3O2WL 1AD9B 1KSRA 1S9YB 1JNNL 2BSTA 3ALXA 3BEWB 1SEQH 5C0CA 1H3PL 3UDWC 5L7XL 5FV1L 1GPOL 4DFHA 1AHWC 1FE8H 1OARH 2NX5E 3BPCB 4QHUA 4D8PB 4U6YB 1AQDB 1GGYA 1RUML 2GK2A 3OZ9L 1L9NA 4X5XB 1F4AA 2UV3A 3KLSA 4KRMB 4RBPH 3RNQB 2CKBA 2FR4B 4HWZB 4G9FE 2A83A 4PJ5A 3SDXA 4LP5A 4M8QB 1NLBL 2BJML 1S7XA 1DR9A 2OJZH 1FRGL 1OQXA 5F7MC 3RPKA 2E7CA 2CXGA 4OZ4B 4OKVB 2VDLH 1ES0A 3ARFA 3HS0A 3IDJA 3SKUD 3SGJC 3PWUA 3SO3B 4JO2L 1IC4L 4KJPC 4ERSL 1A7RL 4AY0A 1FNAA 4BFIB 4K55A 5FGSA 3ALPA 1KCRH 1OW0A 3HNSL 3MYZA 4X7TB 4AH2A 1AD0B 3ZKNC 1KPRB 3LQZB 3DHJA 4FQXB 1T5XB 2N4IA 1MHCA 5GS0L 4NO0B 5KVGH 1EJ6A 3MTRA 3ZDYE 1NCWH 1MHHA 1IEAB 2DQJH 3W9EA 2K7PA 4JFYB 4FXKA 1DVFC 2FATL 1ORQB 3MRPA 4PGCA 4PY8I 4F2MA 5FYLH 4UNUA 1RU9H 5DQ9A 3RJDA 5L2KB 5AZEH 2IAMB 4GMTH 3UZVB 4JN2A 1WFNA 2HJKB 3ETBF 4Q58C 3FAWA 2D03L 3LN4B 4OAWB 4JB9H 4AYFA 5EPMB 3EJYD 3MODL 4XC3L 2ZOKB 1X6NA 4OZGF 2X1XR 3AREA 3KYOB 3QUKA 2MFNA 3C6LC 3OB0K 5CEZL 5D96B 2OR7A 3GSXA 3CPLB 2VABB 4JFXB 2MQ3A 4L1HA 5CGTA 1P2CA 2PW2A 3I9GH 3C8DA 2NXZC 3CUPA 5D1QD 3GNMH 5EUKA 2XXCB 1IKNA 1NC2D 2A6DA 4KKAD 4FFYL 4S1RH 2X89A 1FNLA 5E94B 2G5BB 5D2NB 4CMMB 4QNPE 2Z35B 2BSSA 3D2UA 3VA6A 1MCJA 5D7JA 3RL2B 1W0WB 1A7PH 1A1MB 4JVPA 2BOCA 4HZAA 4L9DA 5IBLD 4HXBL 4P23D 1FDLH 1T22B 3QEQD 4P46C 4LNRB 5IP4A 1U8QA 4BH7B 5F1NB 2PW1A 3QXVA 4G9DB 2OR8A 1XH3A 1TZGL 2AEPH 2IQAB 2M8XA 1UQSA 3EO1A 1AIFB 1J7VR 3CFEA 3N1GC 1EO8H 5L2KE 3S96B 1DQTA 5CILL 4WWID 5GRZA 3S3JA 4NQVA 3P4NB 1SBSL 2YD7A 5DMGD 3F7PC 1Q0XH 3ZZ1A 4EI6B 1BZQK 4LEXH 1SEQL 3PWNB 5DUPH 4GW4A 4LVOB 3LB6C 2OQJA 3AB0B 4PIRF 2IG2L 4W4OC 4NNXA 4HWNA 3MV9B 3DNKA 2QSVA 2B0SH 1T1WA 3U36A 5FYJD 1BQSA 4FQXC 3TF7C 2ZPKH 4HCRH 3TH4T 1T6WA 4YQXL 1S9VB 4HKXB 4TUOB 3QCTH 2GJ6A 1FZMA 3KLDA 5ESAB 1U41A 3X14B 1KB5A 2GCYA 5EORH 4QTHA 2IAMC 4U1SA 1UENA 4DW2H 3LMJL 2I60H 3SJVA 1RULL 5D2NE 4LAQH 2M26A 3ARWA 1D6VL 5DR5L 1QFHA 5DD0H 4Y2DB 3VG9C 5EU6D 4BJLA 1IGYA 1X4ZA 3TESA 3PWVA 4XP4L 1WBZB 3HRZB 4HKBB 2P7TA 1U8OA 4NZUH 5FV2A 3GBML 2VLLB 1NDMB 3NABH 1ZEAH 4Z8FL 3N1FC 3O3EB 2BOBB 2FCBA 1AI1H 1DEEB 2RIKA 4L4TA 4LLQA 4Y19B 3SE3A 1IBGH 1W8OA 3U7YH 4ELMA 2VR9A 4JO4L 2YBRB 2G2RA 3MV9E 3HPJB 1NL0L 1UWGH 3TWCH 4OZIF 1D5XB 5EC1A 1WEJL 5E5MA 3SGDH 1G7LB 1QSVA 2HFTA 4GW1A 5GGRB 1YNLH 3BWAA 3KYAA 2JJVA 3IAGC 5C0EB 1AP2A 4UILL 3MJ8A 3GMQB 5EFIA 3GHBL 1QSFD 4NDMA 2IH1A 3BHBB 1YEIH 3C5ZA 3LN5B 5K33A 4R8WH 1MRFH 4PJ9B 4B5EA 2X9YA 4WWKB 1PDKA 1KIPA 3AB0C 4OLZH 1C1EH 4HQQL 4BFGA 1KIQA 3FOLA 1XT5A 4ONGL 2NY2B 3ARDD 4N0YH 5I16B 5E0QA 2P8LA 1FFPA 4PV9B 1VENA 3RKPA 2LU3A 1KLFA 1T66D 3NOIA 3VGHA 4JANA 4NYLA 1QLFB 5D2LF 3NFNB 1IZKA 3NAAH 4P4KB 1FVCA 1T4KA 5JPMB 3IVKB 2EDNA 3MOQA 4OD2A 4XPFL 4WW2C 1A1NB 2EIZA 5DK0B 4LSTH 3VRJA 1EO8L 3O3AA 4OLYH 2X1WL 1XGPB 4Y19E 4IOFC 1VPOL 2QR0A 4LSVH 1JN6A 1QRNB 4YXLH 3VGEA 1CFTA 1KBGL 1MLBB 2D7QA 3QIUC 5DK3A 2XXMB 3X11B 2EDXA 3HUJF 5HVGB 3RVWC 4DKFH 2A73B 1RIVL 5MP6L 3V8OA 3CU1A 3KPTA 1PKOA 1MWAH 4OF8A 3DVNA 4OZFB 1ZGLA 5DK2B 1I3RB 4KJQC 3BSZL 3B3IB 2FWOB 3TCXA 4HWUA 1FFNB 1HI6A 4NFDA 3BMVA 4LP4A 5JXEC 1CG9A 3V7MA 1V7MH 3QNYA 5C0BD 1J1OH 4L9LB 2BNQB 2DICA 5GSRA 1NMAL 1XF5B 1P9MA 1UCTA 4ZPTB 1RAMA 2E6PA 3ARGA 3IKCB 3MNWA 5EBLA 3B83A 2DLFH 2XKUA 3VGGA 1X5GA 4ACPA 3PJSB 3VFMB 2R69H 3RDTB 3PIQB 3SY0B 4EN3C 3OXRB 2O5YH 3KPRA 2JJSA 5CJXC 3VWKC 1DUYB 4LCYA 1IGJA 4X8JA 3ZE1E 5IW1A 4N0CD 1CICB 1RZ7H 3CCHA 5FGBA 1ED3A 4P9MH 1KN4L 5GRVL 5JIKA 1X7QA 4G42B 5EZIL 1G7MB 2ORBH 1RMFL 3QHZH 1RVFH 5ADPH 1M4KA 4GS7C 5DZLA 4F7TB 5MEOA 5TDOB 1RURL 2E8YA 2WIIB 1JF1A 3DYPA 4ODHL 5F7NC 1QRNE 4PJ9C 4M7LT 2BNRB 2V5TA 1BFTA 2KL6A 2I07A 5CP7B 4EUPB 2EXYC 4JFFB 5DHVB 2MPAH 2EXWD 1TETH 4LGPB 2HT2D 3W5NA 5T1MA 4DN4L 5IGXL 3BQUA 4QHLB 4XNQB 4YBLB 1R3LA 1MHEB 3TIDB 4X98A 4X6BB 3I02A 3QXAA 3V5HB 2CH8A 2BVTA 4G6MH 4PP2A 3TVMD 1FV1B 2VLJB 1KYOJ 5DT1H 4RFOL 2R2EB 2BNQE 4LSSH 4Q6IB 4U7SA 1NSNL 4N0UA 1CN4A 4IRZL 4I13B 1W2KT 1W0VB 4HK3J 3PNWA 3HZKA 5KSUA 1K2DB 3Q2CA 3IDNA 2PKDA 3MV7A 4X9IA 2Z93B 4J3OC 3QZWG 2C3VA 3IDGB 5H37H 1U58B 2XRAH 4M43L 4NKDA 3BX7C 1ZT1A 5GGQH 3FO1B 1AY1H 4WO4A 4JVWA 5BVPH 1YPZA 4YXKL 5ISZB 5HHMD 4TNVF 1JHLL 1A7QL 2JF1A 3QCUL 3D18B 4FTVB 4P4RA 3MRIA 2FGZA 4U1HA 4BKLA 2L4OA 4Z7UF 4D2NA 4N9GB 4FQCH 2EE3A 4I0CC 5EBMB 2XWBB 5L8JB 4JO1L 1TNMA 4Z95H 1KJ3H 5LAXB 1BGXH 2FX8H 1IL1A 2BNRE 4QRQB 4HIHA 4TUKH 3HFMH 4OLYL 1JTOA 3C8KB 3K1DA 4BUGA 2Y7QB 4JFFE 3CJJA 4K7PY 2DQGL 3FQUB 3UPRB 4GG6F 4MD0B 3U0TB 2NLJB 4Y4FD 1MFEL 3UROR 4JGUA 4NNPL 3WJLC 4E0RB 1ZXQA 2CIIA 3QUZC 1FNSH 3RPIA 2VLJE 1TCRB 1LD9A 2J12B 1AXSB 4HUVA 3LQAH 3QDGD 3GMNB 4RZCB 1B6DA 1CL7I 1J9CT 3QZWA 5FUCE 4TRPL 3ZDXE 3Q0HA 5C08B 1A3LH 3MCKB 3C5SB 5E4EC 3EOTL 4NQXB 3TFKC 1JPSL 5I66A 2C1PB 2F15A 4X5WA 2ILLA 3BO8B 3E6HA 5ALBH 2ENYA 1XGTA 3OJ2C 9CGTA 5IT2H 4EI5B 4M48H 4ENEC 1URLA 3KPNA 3HE6D 4NRXB 5ISZE 3TBWB 5L6YL 1MCOH 1NFIA 4PJCA 4WI9A 3KLAB 4HBCH 4FTVE 4HS8H 3CGTA 3P77A 4AMKH 3EOBA 3BZEA 1YY8A 5F70A 1LEKB 4Q6IC 1ZHKB 5HYJA 1VGEH 4MJ6A 1A8JH 1AXIB 2XG5A 2AXJA 3ORJA 5DRWA 5EU5B 5TF1H 1I8IA 1LO0H 2NX5D 5DUBB 4JEGB 3OG4B 5F6IB 4LU5L 4WEMB 5I9QB 3GMPB 3I2CL 1KXTB 3ECBB 1H5BA 5IJKC 3ZE2F 5FHBL 5IVOA 3TT1H 5JMOC 4G9FD 4UTAL 3MRHA 5TPWH 2YKLL 2Z31B 3QUML 4X80H 2APFA 1XCTA 1BFOB 4G6FD 3KR3L 1S8DA 5D1ZC 4FQQA 4J3TA 4XNXL 4BQ9A 5I75B 3BKYL 4KK9C 4PGBA 4XNMB 4O9HL 2COQA 1FGNH 5C08E 1QNZH 5JW5B 4C4KO 3OX8A 4WUKL 1JNJA 1MEXL 2MWCA 5HI3C 3HG1E 3T4AA 2WUCH 1TFHA 2DKMA 3VA2C 1QR1A 3V4PH 1ZVSB 1KLGB 3C6LD 3MJ7A 4EXKA 5DF0A 3IU4H 3T3MF 3N0PB 2ZG3A 3HMWL 4ODUA 4QXUH 3VXMA 4L8CA 5E7FA 1K4DA 3GRWH 1D9KD 4UIMA 1KCKA 5HY9A 2VXQL 4H1LH 4K94L 5CP3H 5F89B 3CLFH 1A4JB 4HIEB 1C16B 1CS6A 4KJYA 3F6IA 4JQXA 2CGRL 5A3IC 1HHHB 3KWWB 5I1KH 2R1XB 4QXGH 1RHHB 3GEWB 1RJYA 4EI5C 3OB0H 4NCC1 1QSEA 4LVNB 5HDBF 5IEHA 3IETA 3VFOA 1EAPB 4CMHC 4YHPB 4TPRL 1D5ZA 3QIWA 5K59F 8CGTA 5CZXC 4S1SL 1IM3B 4HJGB 5EU7E 5E00B 3T0WA 3HZVA 1P1ZB 1A6ZB 2R4SH 3MA9H 3UJTH 2XZAH 4HULB 1J10A 2K7QA 5AZ2L 4HCRA 4U1KB 4B53A 3HMXL 5DC9B 1GZPA 3S4SG 2WW8A 4BH8B 2HFFB 2R15A 4XRCB 2H8PB 1ZLVK 2F5AH 5DO2C 2H3NA 5IM7A 3MRCA 1S7WA 2YRLA 5I1IH 3MMEB 4R97C 4NO0D 3BP6B 1KIRA 2X4NA 2Z31C 3S8WA 1CDJA 2D31A 1WK0A 5EU7C 2NW3B 3MO1B 5L2KD 5I75C 5FGRA 5GISL 2ITDA 3B9VA 4OTXL 1FFOB 3CVIH 3CSGA 1GJIA 1WZ1H 5H8DA 1RK0A 4HUXA 4LGRB 5EUOA 4PP1C 3FQTB 3QEGH 4JFQB 4KTYA 5FDWA 4PRBB 2FO4A 4QF1A 4P2OB 3O6FC 4O2CA 4LPTA 2P4AB 1NAMB 2FIKA 4JM2B 3GMLB 4JRYA 3BAEL 3WIHH 4FS0A 5FYKH 1MPAH 2DMBA 1FYHB 4TVSa 4IM8A 5J11B 3RZWA 3V0WL 1U6AL 2AEQH 3HRPA 3S4SA 4XCEB 4KVNL 1J0IA 4J6RH 4OZIA 1L6XA 2BSTB 2K9UA 3OR7A 5C0CB 1AJ7H 4ZFFA 4RISH 1J0KA 3E3QE 4JJHA 5D1XA 4QHUB 3H8NA 5DXWA 1EVTC 1G9NH 2ENSA 1GHFL 3RWEA 3FJTA 5GGSA 2X1PA 3ULSA 2Z91B 2CKBB 3OKEB 2A83B 4PJ5B 5K9KA 1RUPL 3SDXB 2I9TA 3FMGL 1A6PA 2YA0A 2NYYC 1OWWA 2ESVD 2YUWA 3TN0D 2JB5H 2YK1H 3CFCH 4RNRA 2CPCA 4UAOB 5FCUH 1ES0B 3ARFB 2W0FA 1MRDL 3HS0B 3VJ6A 1N5YH 1QFUL 5J13B 3PWUB 4XH2B 5I1KL 3MV9D 4IOSD 1V8HA 3E3QC 1CFNA 5D2LA 3P73A 4MA3A 4M6AA 4RWYL 4XXDA 4Z7NF 4KMTL 4S10A 1SVCP 4YC2B 2YXFA 3QBTB 1QPPA 2AK4A 2PNDA 3EOAB 3CH1B 3ESVF 1RI8A 2ARJB 1T7XA 1MI5A 1MHHB 4KTEH 4IS6A 4DGVL 4UDUB 3L3OA 1MWAA 3MRPB 4PGCB 4LASH 3HUJA 4KHTH 5DQ9B 3DYMA 5T1DH 1VEMA 1BJ1J 2X4UA 2Q8BH 5LGJA 2F19H 5C0CE 1QR4A 1TVBA 5HSFA 4P2OC 4Y2DD 4N8CH 2BY0A 4KKBC 4NM4H 2CRYA 4JM2C 3TJEL 1QVOA 1JHKH 5BO1L 2WNGA 4K8RD 1BBDH 3P30H 1N7ML 1ONQA 3AREB 3QUKB 2C5DC 3VFUA 4E41A 3IDXL 3GSXB 1NCBL 1H8SA 4PJ5E 3SDXE 4FABH 4OGZA 5C07B 3ULUL 2D2OA 3KYMA 3V0VA 4KUZL 1P2CB 3ZE0E 3A6CL 1N0LA 2FIRT 4HWBL 3CUPB 1U95A 2EH7H 3QPXL 5CEYB 3VU2A 5EUKB 1SMAA 4YPGA 5HYFA 1A6WL 2OX5A 4Y19D 3AMKA 5AYUH 5F96L 2A6DB 3BKMH 2D0FA 3FRUA 3MACL 4F33A 4I3RL 2LFGA 3ARBC 1YQVL 2W9DL 1NGQH 1TCMA 1T1XA 2F5BH 3D2UB 5D7JB 2NY5L 4YPJA 1EMTL 2AABL 2WLZA 3JWDH 1JPTL 1NEUA 4XMPL 1U8QB 1DL7L 3P9MB 1NLDH 3WIHL 2PW1B 2WMPA 1XH3B 4R90L 3LS5H 4GG8B 1PJ9A 3BZ4A 3EO1B 4GXUM 1KCUH 2H1PH 3CFEB 5J3HC 4UAOC 5EIVA 2CR3A 3OQ3B 4IDJH 4WWKD 1JFQL 1T80A 5J13C 3L3GA 3CDYA 3VD7A 1C12A 1CXKA 1TQBB 1KPUA 3BP4A 2NY2D 1KTLA 4R4BB 4GW4B 4JE4B 2OQJB 1U3HB 1JGVH 5DLMH 4NNXB 4X6DF 1OW0C 4HFUH 3UBXI 3U36B 3FQXA 4P4KD 4PB0H 5J9PA 4NQDA 5JXAH 2QSCL 5GS3A 1IGIH 3DX6A 3EYUH 1DBML 4QXTA 2GJ6B 4WI2A 1FZMB 4FFZL 5IIEA 4NFCA 1KB5B 1HEZB 2GCYB 4QTHB 1QRND 3SJVB 2DM7A 4H5SA 2QSQA 1UWEL 4OGXH 1YZZA 4XPTH 2DF3A 4NUJA 1T1ZB 3KJ6H 4LNVA 5BZDB 4HLZG 2FX7L 1MJ8H 2CO6B 3K4AA 5INDA 4Y5XC 2BSRA 3AREC 3BP7B 1G7IA 2YR3A 2DWDA 1ZWIA 4UTBH 1IGYB 1A9BA 5KN5B 3PWVB 4TNWK 2VJXA 1EEZA 3MOBH 2P7TB 1U8OB 1OP5K 4MQ7A 2BNQD 4GKSA 5DEGA 3D3VA 1BQUA 4Y4KA 1HKLH 3DYOA 1EGJH 1R3JA 3VFTB 1W8NA 4LLQB 3RDTD 4LIQH 4V1DA 4NO3A 2J4WL 1I8LC 4FQJL 3HMXA 4Q0XL 3SQBA 4LSRH 2G2RB 1CICD 3IT8D 1VSCA 2D3VA 1TIUA 1W72L 3VD9A 4PJXA 5EC1B 1PQZA 5I1DA 2NY6B 5C6PB 4YZFF 4JCMA 3DTXB 2DTML 4GBXA 4GW1B 1BF8A 2GJ6E 3BWAB 5EDXA 4PLJC 2NNAA 1AP2B 5L0QB 4LMQE 4XVJL 1FVEA 1KC5H 3MJ8B 1A2YA 4ONHB 4GMSH 4NDMB 1MFDL 5C0DA 4H88H 2BNRD 3SJVE 4QY8A 3ZSSA 5EOTA 3W9DA 2VDKH 4XWOD 3IFPB 2BVPB 3C5ZB 4YWGL 5A16B 3D85B 4HEME 4JG1L 2EDWA 3ULVE 3DECA 3D25A 1LE9B 3RBSA 2DJSA 4JGMA 2AJ3A 2XIDA 3FOLB 5ESVA 5LQBL 1FAIH 2O5ZL 1FFPB 2XTJC 4NHCH 4NRZB 2VLJD 1OAKL 3SOBH 4NYLB 2AK1H 4JHZA 4U6XA 4MNQA 1FVCB 1T4KB 3GKWH 3DO7B 2DQIH 3G9VA 3H3PL 5LGHL 2HT4C 1BREA 3VRJB 1IAIH 2W60A 3O3AB 5C09A 1A7OL 2ARWA 4L4TE 4M61A 2QR0B 1JN6B 1FSKB 1U8IA 3UTOA 2HTLD 4P57B 2FB4L 1CFTB 4ELME 4RGMB 3P0VH 3K8KA 4P9HH 2J8UF 3VRIA 5ISZD 4JZOB 5TDNB 2NY3B 3O6KH 4OB5L 4FTVD 4NPYA 1L7IH 1ZGLB 3T0AA 3WEXA 2SEBB 3KLHC 3BE1H 5AWNH 4JVUA 2FHFA 4DKDC 4JDZA 4NC1E 4M1DL 3RGVB 3WS3B 1HI6B 3FTGA 1NGYA 1CG9B 1IGIL 4YNYA 2C4FT 3SQOL 4NN6C 3PGFH 1DN0A 5GSRB 2DM2A 1NMCC 5JMRA 5HI3D 3BOVA 1DZBA 1NBVL 3NH7L 5EOQH 3SE3C 1G9EA 3ARGB 5EBLB 1I9EA 4XCCL 4F7EA 3MRBB 3V79C 3I75A 5HGDA 1K8IA 2X1QA 5DFVC 3FT4B 5FM4A 3WS6A 5CEXA 5CCKL 1IGJB 3C6SA 4X8JB 2EDDA 4XMLL 2DWEA 4EVNA 5IW1B 3DVGA 3GSUA 2VDML 5CIPH 1ED3B 2KZWA 5DEFA 2B2XH 1X7QB 3MLYH 4NC1C 4AL8H 4AQOA 4KVCL 5L0QC 1T03L 1BFSA 1E4WL 1NJ9A 2PN5A 1S78D 4AJ0A 4MAUL 1OAZH 3FB6A 4EDWL 2IFFH 5GRUL 2WIMA 5C08D 5MEOB 5D72H 5FFLA 4CRPA 2YZ1A 3S37X 1JF1B 1GVIA 1BAFH 3TH2T 2PO6C 5F1IA 3KS0J 2I07B 4EI5D 5F9WB 1ZA6B 2ZG1A 5JNYB 1J1PL 5T1MB 3BQUB 4K3EL 1R3LB 2DM4A 4X98B 3IKKA 5IK3A 1Z3GH 4BELD 1FNFA 3S88H 4PP2B 1QZ1A 3GSNL 5J6HB 3CX5K 5C0RH 4S1QH 4Z7VA 4N0UB 1WBYA 2P8PA 1HHIA 1CLZL 3P0YH 4GMSL 5DQDH 4UT6L 3BGAA 1JWSA 4HWBA 4XP9H 1DBAH 1FCCA 3PNWB 3HZKB 5KSUB 5LWYH 3IDNB 3MV7B 5FUOL 1BMGA 3MLUH 4RGMC 4WI7A 5TQ0H 2C3VB 1QBMH 1BM3L 3EOYG 3HNTH 3O6MH 2A2QT 4ZS7L 3KPRE 1ZT1B 1J05A 3KYKL 4WO4B 1FBIL 1IC5H 1YPZB 2Z31D 1WV7T 2Y07L 5HGHA 3RP1A 1EEYA 1NCTA 3ME0A 1FAIL 4D0BA 1HIML 2CJUL 4K7PL 3U4EA 1I7TA 1SY6L 1WICA 4MQSB 1KG0A 4EBQH 2A74B 3U6RA 4MDIB 2EDEA 3ZYOA 5DJ2A 3CXDH 4RFEA 4U1HB 2QKIA 4BKLB 4UBDD 5JHLH 3UYRL 3WIHA 3ZTNL 3V52H 4UINL 2MHAA 1KTDA 1MCKA 1ZLVH 2QHLA 3ARGC 4R3SA 4HIHB 2FBJL 1B2WL 2NTFA 5JIIA 3PP4H 3IAPA 43CAA 3S36H 4J8RA 1F6FB 4GKOA 1KTKE 4LLYA 3EO9H 1WCQA 3N1MC 5FGBC 5F7WC 2CIIB 3RPIB 1GH7A 4K9EL 2B1AH 1L7IL 4M03A 5DVMA 1LHZA 3DGGA 1CXIA 5CEZE 1X4YA 1LD9B 7FABL 4PBXA 2OI9B 3AMLA 1Z9MA 3ZKXB 5GS0C 4N0UE 4GRMA 3WUWB 4YDKL 1J8HA 2JE8A 4HUKB 1JNLL 2NQCA 4IJ3B 4KGJA 1MCEA 3MV7E 5GZOC 3SKJH 1ULVA 3HKFA 5GZNC 3KPMA 3P2TA 5GRJH 7CGTA 4X5WB 1OTTD 3E6HB 5EO1A 3D39A 1XGTB 1NGPH 2DLTA 4YBHA 1F11B 1YPZE 2DL2A 3BQUC 4JG0H 3RVUD 5CS7A 2P48B 1JWUB 1SVZA 3E8UH 1CFVL 3QA3A 5DHXB 5EULV 3JXAA 3CD4A 4DN3L 4KK8D 3P77B 3EOBB 3BZEB 5E99H 2NYYD 2PR4L 2DYPD 2H32A 1RIHH 2IGFL 1CDUA 1N2RA 2ATPA 4YO0A 4MJ6B 1RJLA 1QLRA 1DCLA 4MLSA 1NH6A 2VZTA 5C6TH 4Q6YA 5DRWB 2M2DA 1RPQA 1ZK9A 3B5TA 4Y4HB 4NGHL 1MSPA 1SJHA 3S5LB 4XPBL 1MCPH 1N59A 5IVXA 2X70B 3G04A 3U1SH 3MRHB 4NBYB 1B0WA 1LDPH 4YAQA 1WUNT 4G8GA 1KLUA 1XCTB 1AO7A 2EIDA 1G0YR 3GGWA 1W72A 3FCTA 3CFIC 4KI5F 4L8SA 5CBAA 3T3PF 2EC9U 3O41A 4PRHA 2XA8L 4PGBB 4X9FA 3HN3A 3OF6A 4OZGB 2HJFA 2H26A 4JO3L 2JK5B 4P2OD 3OX8B 1FJ1A 4KKBD 4JM2D 2OMNA 2YPLA 3RU8H 3T4AB 5DSCB 1PVHA 2PYFA 5F3HA 2VUYA 4CKVX 1I3GL 3HNTL 3MJ7B 4PJCE 3R06A 1AFVL 1XF4A 4OD3H 5F9OL 4JKPH 3PABA 4MB5A 4ODUB 3VXMB 4KROB 4L8CB 1C5BH 1F02I 1K4DB 4YEEA 3BKCL 1F8TL 5HYJE 12E8L 3H0TA 5HY9B 3RWIA 5BQ7A 3CZFA 1AXTL 4ODWB 3RVVD 3R8BB 2BY2A 1G6RL 2XKSA 3Q1SL 43C9A 2EDOA 5IFAL 4KJYB 3PXJA 5C0CD 4U4BA 1MVUA 3PDGA 4LQFL 3W39A 3E2HC 3MA7A 1RJYB 1OAYL 1BECA 4R96A 5IEHB 3IETB 1LP9F 4PJ5D 3CXHJ 5DD5H 1FFQA 4NWUL 2NMSA 1D5ZB 3CU7A 3Q48A 2JIXA 3HZVB 4PG9A 4AIZA 1WZLA 5A2JH 5HTSA 1I9IL 3ARFD 1TTUA 1S9KC 4X6DA 3QR2A 3S35L 2QV2A 5DRNA 1CDHA 4NN7B 3TA3A 4UIKH 4KZDH 3QXWA 2DQDL 1EH9A 2H3NB 5IM7B 1H5BC 3NCJH 4G8EB 4PJIF 4PY7A 5E8EA 1CU4H 4ISVA 1K6QL 2B1HL 4LRIA 4GAFB 2Q3ZA 3MRLA 5F8QC 1KIRB 1SJVA 3L3JA 3VXME 4U1IA 3GK8H 5KVFH 2HWZL 2J6EL 2YMXH 5JTWA 1C5DB 4TTGA 4JFHE 2JKXA 1DFBH 4RGNB 2ITDB 2ZNWA 4MQXC 4HUUA 5I8EB 4I9WE 4LHUG 4WEBH 4O4YH 4F57L 1UM6L 2LABA 4HS6A 4QOKB 4HUXB 5J6GA 4FZEH 3GUTB 2CDFA 2FO4B 4QF1B 3M8OL 1KN2L 1FN4A 2FIKB 4JRYB 1XIWA 4XVSL 1SHMA 1YYLL 5IB3B 4YDIH 5C07D 4RMTA 1HZHL 4OFVA 3JTSA 4XCYB 1OLLA 3CDGA 3OAUH 3C2SA 4Q74A 3HZMB 1NCDL 3S4SB 5DVOA 4Q2ZA 2FHCA 2DDQH 3GSNA 1E6OH 4OZIB 1CFBA 3D2UD 4KK6C 2X7LA 5D7JD 3VMPA 4TNWF 4A2LA 4ZFFB 1TVDA 4YGVA 3Q6GH 4UNTA 5JHDA 1SJEB 1HHGA 3CSPA 3KPQA 5GGSB 4OIIL 5FECA 3QIWC 1OP5H 3ULSB 2W0PA 3LQMA 4EJ1C 1YMMD 4PLJD 2ERJC 1UXWA 1UJ3A 3BD4A 3MJ6A 4LHUA 1E4XL 3WFDL 3BDXA 1SY6A 3OPZL 1K4CB 2BDNH 1I4FA 3R4DA 1U0QA 2AI0L 2JB6A 3NIDF 5EUOE 2W0FB 4NN7C 1R5VA 1YEGL 2NY4B 4PS4H 3VFSA 1K3ZA 1U3HD 2CRMA 1Z6JT 4ELKB 2R56L 1CFNB 4XPGL 5D2LB 4LCUA 3RWJA 3N50A 2H2SC 4JRYE 4MA3B 2UY6A 2MQCA 1VEPA 4GRLB 5EU3A 2EDTA 2J88L 1FLRH 2AK4B 4CBPA 2GJ6D 5ELIA 1CR9L 1ZHLA 2YPKA 4W4NA 3UMTA 1G7HB 4MD4B 3EYFA 1BF2A 4IS6B 2A6IA 3L3OB 2HT4D 1MCNA 1MWAB 4BQ8A 2XNAA 2J8UA 3HUJB 1X6LA 5CD5C 1ZANH 4OZIE 1OT1A 4HS3A 1JGEA 3CFDA 1Q9WA 4N0FA 3T8XB 5LGJB 3L3HA 5HI4C 3ULVD 1TVBB 2R0ZL 3P4MA 5FAAA 1P84K 4P2YA 3EYSL 3INUH 4XVTH 1QVOB 1OQOA 1DLHA 3MXWL 3TV3H 3WXWH 3OG6B 4EOWL 3KGRA 1P4IL 1ONQB 4RAHA 3VFUB 4QHMB 1CZ8H 2MQ0A 3KYMB 1EHLL 3SPVA 1N8ZA 3V0VB 4FNLL 4N8VG 4XC1L 1U95B 4UI2A 4YPGB 4TSBH 4K2UH 1KGCD 1YEHL 3DURA 1CVRA 1INEL 4TVPH 3FRUB 3D6GA 3LAFA 1WBXA 1U8MA 5D2LE 5D1XC 1T1XB 4JR9H 4WHCA 5DFVD 3K74B 5FEBA 2NY6D 5CJBA 2H41A 1Z0MA 3U4BL 1NPUA 1NBZA 1MCWW 2AK4E 4LDEB 5IBUB 2ZJSH 3ZDYF 2HLFC 4DUWA 1IILE 2CMRL 1MI5E 1G7PA 1XGRB 3BZ4B 3QCVL 2O61A 4QRUA 1H3TA 4W6WB 4NO5A 1A3RH 5I73B 3HUJE 3LN9A 4UU9A 3C5ZD 4YR6A 3D85D 3F7YA 4MVBC 2EKSA 3VD4A 3L3GB 35C8H 1BOYA 3NA4A 1MQKH 1C12B 4G8IA 1KPUB 3BP4B 3SBWC 3U48A 1KTLB 5I17A 2QSTA 5KAQG 3RWHA 4TULL 1INDH 1RUAL 5IBTH 3FQXB 1OTUC 1DDHA 5J9PB 4NQDB 4N8VA 2VLME 4QT5A 4P5KA 3K1KC 4WFFE 1AC0A 1IVLA 3DX6B 1TVHB 4LKXA 4PJGF 4QXTB 1A7NL 5E9DA 1IFHH 4FZ8H 4YHLH 1T0NA 5TE6H 4HG4J 5IIEB 4KFZC 1P7KB 1MCLA 1XEDA 4NWTL 4YE4L 1P53A 4NZRH 4ZFOB 1CBVH 3REWA 4H5SB 5T3XL 3O6LH 4YDLB 5IB2B 1G6RA 2YRZA 2NY3D 4OLVH 3K2UL 5INDB 2BSRB 4Z7UB 1B4JH 1G7IB 4MDJA 4MB3A 5C2UB 5KTEH 2R29L 1A9BB 2QEJA 3RGVD 1YEJL 2GW5A 2V2TA 3CFKB 2MCPH 1EEZB 1X5FA 5I8OL 2GI7A 4MQ7B 3L5IA 4ZNEE 4GKSB 5DEGB 4Y4KB 3MRGA 4XHJC 3R0NA 1OCWL 2BHZA 3O4OB 2VISA 3TNMA 4NP4L 4GG6B 3ZHLA 3HI5H 4YHIB 2WBJC 3VG0H 5HGGS 1NGZA 2ZUQB 3GBLA 4V1DB 1KEGL 5FM8A 2WANA 5GGTH 2B20A 1HNFA 1HH9A 5BZWA 2RR3A 2YC1A 3LDBC 1PQZB 4NQDE 4OT1L 5I1DB 5DJAB 5TQ2H 1OL0A 4GBXB 4HDIA 2X4TA 4F58H 5EA0L 2NNAB 1VHPA 1WT5C 4CVXA 5EIIA 4UQ2A 5I73C 1IGMH 1F42A 1FVEB 1F97A 2J6EA 3GI9L 3OJDA 2HMIC 4DGIH 5C0DB 3IU3A 4QY8B 1DBBH 5EOTB 2V7NB 5GZOD 3HC3H 5GZND 3S6CA 2IANA 4AZ8A 1UCBL 1UM4H 1V7NL 3SE8L 3S7GA 1VCAA 2CO7B 1II4E 2PTTA 5B8CA 4Z7UE 1MY5A 1C5CH 2AJ3B 2K1MA 4YHKH 3QI9C 5ANMA 1QD0A 4ZG1A 4YGAB 3QG7H 5T33L 3PWLA 4WCYL 3BD3A 2G5RA 3OJVC 2VZUA 2AJUH 1DSFL 4UOW0 2YWZA 5CEZD 2XKNA 1OF2A 5ICXA 4U6XB 3RVXD 3GJFA 4U1GB 1K5NA 3FQRA 1LDSA 2VDQL 4MS8C 4FMKA 3EYOB 5F1OB 1FGVL 4KUCD 3D9AL 4PTTA 1RK1A 3DSFL 4G6KL 4OF3A 3MV7D 2DBLH 4H20L 3G08A 4K94C 5C09B 4V1DE 4M7LL 3QEHB 5BS0A 1PKQA 1MCQA 1G0XA 1WWBX 2UYLA 2ED8A 4WO4D 5C9JA 3UTSB 2OJEA 5BOZG 2A1WH 4UV7H 2O5XL 1OPGH 4E5XA 4HT1L 4PJXE 4O2EA 1I1RA 2D4DA 2DQEH 2Q1EA 2VB5A 3GSVA 4NPYB 2R1WB 3L9RB 4LCWA 4RGOL 3WEXB 2BHYA 4JDZB 4FFWC 4WW2F 4X6CA 5DJ0A 2R2CA 5K9OB 1BVKA 1NGYB 4GUPA 4ZD3L 3O4OC 3D48R 3B5HA 4YNYB 5BV7L 1DN0B 2VXTL 2GJJA 4LHQB 2Q7NA 1KJ2H 5HYSG 3QSKB 4WU7A 1I1YB 3UXFA 5I18H 5KG9A 3MLRH 2NXYB 1YUHA 2HG5A 3MLVL 4F7EB 4GAYA 3QNXA 2W1NA 3I75B 1K8IB 4HJJL 4RMQA 3PL6A 5CEXB 1I1CA 2ADFL 1O5DT 2DWEB 1T7YA 4EVNB 3SGEH 1OT2A 1KCSH 3GSUB 3SGDI 1ITBB 2ATKA 3I3EA 1NJ9B 1T20A 5C8JA 4OI8A 4LQ1A 5DMIL 3FT3A 5L88L 2R2HB 5KVDL 1FCGA 1IGCL 5C09E 5I0ZA 3O8XA 4DVRH 3A6BL 4G7VH 1LP9A 1T3FA 1CE1H 1QFPA 4HPYH 5CSZA 5F1IB 4G5ZL 4PRAA 1TZHA 1H3XA 5IESH 2IC2A 1DE4A 2EIEA 3H3BC 3NTCH 1QYGL 2MMXA 1EJOL 2DD8L 5ERWA 5EBWB 2VDNH 1MF2H 3VXNA 1YMHA 4QO1A 3KHQA 1BEYL 4QWWD 5IK3B 4UUJA 5DJYB 3WKML 4P59L 1SM3H 4PJAA 2R8SL 5GGUA 5F3BA 3WFEH 4PJIA 4XMKH 2P8PB 4QRSA 5FYKU 1HHIB 4LSUL 4Y4HD 5HJ3A 1F3RB 1JWSB 3T3ME 3VMOA 2OS7A 2J8HA 2W07A 4ZUWA 4U6VL 4PJ8A 1JRHH 3V4VH 1J05B 4ZXBA 4UB0H 3BT2L 5AUMA 4NNYA 5HGHB 1EEYB 1BIIB 1FC2D 2IQ9H 2J5LB 3U4EB 4OM0H 1I7TB 3K46A 1KG0B 3U6RB 4ODTH 3ESUF 3F58L 2HH0H 1WJ3A 2NY0B 4L3EA 3VW3L 2DI8A 1T7ZA 3DOSA 1P7HL 4JPWL 3LIZL 3GSWA 4R26H 4X4XA 4M1CD 4GQPH 4Z6AT 5HDBE 5EWIH 2MHAB 1KTDB 4O51A 2NTSP 5F7LB 4R3SB 4LSDA 5K59E 1NMBH 1QO3A 4MXWL 1MAJA 4J8RB 4LCIH 1EK3A 1PEWA 5T3ZL 4LLYB 3WS6C 1J5OL 1OB1A 2KUTA 3PHSA 4KRLB 3AS0A 1BZ7A 1QOKA 4KROD 3CNKA 3GBNL 4OZFH 1KENL 3KJ4B 4OUUB 1QRKA 3KVQA 4JFHD 5EBGA 3MROA 5DFWH 3MREA 5CKAA 3DGGB 2HYMA 1CDCA 3NGBB 4M6MH 5EO9A 4ZNCD 1JGUL 2ITCA 3CIQA 3R0MA 4I9WD 4Z7VE 2XFXA 3ULUE 3EYQD 1BQHG 4IRSA 1J8HB 3G6JF 4U0QB 4KK6D 3EFFA 4WTXA 4LSPL 2VC2L 3CX2A 1GSMA 1S3KH 3KPMB 1X5LA 2WAHA 5EO1B 3D39B 3JUYA 2HKHH 2EDBA 4KTDH 3JVGA 2DN7A 3MUGA 2F53B 2XYCA 2X1OA 3WFCH 1MRCH 3DETC 3QA3B 3LEVH 4Z0BL 5JUEL 5B39G 1EHNA 4RX4A 1CQYA 4OF0A 1J0JA 1AHWA 2H32B 1N2RB 2IADA 3FN9A 2CSPA 1E6JH 4YO0B 1QLRB 1NGXA 3ULUC 1PW3A 3BPNC 4DKEL 1A0QL 1IKFL 1G7QA 2F74B 4UV4L 1ZTXL 3QUYC 4DVRL 1Y0LA 4MCYA 4QEGA 3N85H 1CE1L 4NN5C 3H42L 4EUPH 3S37H 2ICES 4LPCA 1AQKL 3H7BB 1N59B 5IVXB 2V5RA 1AR1D 3UJJH 1Q72H 4ZS6C 2J5LC 3G04B 2NY5C 2GSGB 3LCYA 1JTTA 5FHAH 5HHOA 3SE9L 5E24E 2OTUA 2HRPL 4G8GB 1KLUB 1AO7B 2WQ8A 3MXVL 4JZJC 4RGND 3GGWB 1W72B 1BQHA 3FCTB 5C0IB 2EDKA 1ACYL 4L8SB 5CBAB 2P42B 1CK0L 2ZCLL 5CD5D 4QOKD 1J8HE 4OLXH 2ICWJ 3FQWB 4PRHB 4YX2L 3G5VA 2C26A 4NO2B 2VLRD 4F9PA 3TBYA 5E56A 5LCVH 1FJ1B 1KELL 2YPLB 4JRYD 1JF6A 2Y23A 3D39E 5IHUL 1U36A 2PYFB 3BKJH 4OV5A 1DVFA 5F3HB 4O58L 1WFUA 3SDDA 3ZTJH 3ZYJA 3Q3GA 3TM6A 3V4VL 3O2VL 1N3NB 3T1FA 1JI2A 1XF4B 2FEDC 5ADOH 2E6JA 1TQCB 3MC0A 3RY6A 4GAJL 3UX9B 3NGBC 1KB9J 1NFDF 3QFJB 2DQCH 2Y5EA 4F15B 1VGKA 4R4FH 1OP3K 5ACZA 1IGTA 3H0TB 4YIQB 5BQ7B 2D7TL 3CZFB 1ITCA 1U8NA 43C9B 1V05A 5KSVB 4Z7NE 3N1QC 4I3SH 5FDYA 3MRDB 4OM1H 5H2BA 5DURD 1GGBH 3G9AB 1YN6B 1MH5A 2D7MA 2B4CL 3W39B 3P11L 4WIQA 1RZFH 3MA7B 3ARTA 5IVXE 4ZO6A 1M7DA 4I77L 4OFKA 2I5YH 4Q9RH 2HLFD 2I25N 3BUYA 1CLYL 2XQBH 4G8GE 5GS2H 2XY1A 1AO7E 1CGVA 1T1YB 1A6VL 3B8SA 4PG9B 4AIZB 3OKNB 2UVEA 4ZUUA 4M6ML 1GZQA 4PRHE 1DQLH 5E8NA 1F4XL 2NY4D 3A67L 4P46A 5E6ID 4X6DB 2ZCKH 3TIEA 3OV6A 3L3IA 1U8PA 2VKXA 1J0ZA 3MV8A 5DRNB 2YPLE 1HILB 2DOCA 4XPHH 2QQNH 4WY7L 2OK0H 2A0LC 3ISWA 3QNZA 4XNYL 4GRLD 2AJVH 2ICWA 3L95A 4PY7B 3O2DH 4PJGA 2AK4D 2OZ4L 5ITBL 5LKNA 4ISVB 3VXTA 5IOPA 3IXAB 2Y6SC 4U05A 2AGJH 3L3JB 5E1AA 5KSAA 2EYRA 3QFJE 4HWEH 4L8SC 5IB1B 3UJIL 4G8FA 4UOW1 5DFTA 4JQIL 3RVTD 4W4OA 4DQOL 2VZ1A 4JHWH 2VAAB 1A6UL 1CFQB 1IEBA 1QKZL 3DRTA 4HUUB 3LS4L 4ZTPH 4KU1A 3BDYL 2ZWLT 5IJVA 4HS6B 3MLTA 3ILPA 3OMZA 1WLHA 3DX8B 3X13A 4Q9QL 1EFXA 5KVEL 5E6ZA 4U2YA 4NIKB 3J7HA 1JP5A 5I1JH 1FN4B 4X7EC 2VXUL 4CVWA 3UYOD 3OKYA 1XIWB 1ADQH 1I1FA 1Q0YH 2NY7L 4TQEL 3SKMA 3X3FL 2VLMD 2G9HA 1J18A 1NANH 4WFFD 4WHTA 5HHXH 3WIIL 1GC1H 1EBAA 4IMKA 4XHJD 4FOMA 4LFHG 1KCVL 4M3KB 4X6DE 4Q2ZB 1T04A 1M05B 2LV4A 4NOBA 4IRJC 4M8VA 2X7LB 5GSVA 2OR9L 4H0GA 3CFBA 5TFSH 1FO0H 1JYVA 2UZIH 2DS4A 5E2VL 2JELH 5JHDB 4Z7QF 1U3ZA 1ZT7A 1S7TA 3HR5A 3KPQB 1OAXH 5FECB 1BFVL 5IMLA 4WV1C 1UXWB 1LE5A 1UJ3B 2OCFD 4LHUB 4OSUH 3C09C 2HMID 4FQ2H 1FPTL 4NBXB 1TJGH 4JM4L 3U4AA 2JB6B 1R5VB 3TA3C 1I9RL 3RAJL 3VFSB 2Z0BA 4ZSOA 1KJMB 4KH2A 3RWJB 3MLXH 3TC9A 5GJSH 2FGWL 4POZD 4X7SH 3B4NA 5IFJA 4LRIC 2GJZA 3V4UH 5I1HL 4NQDD 2F58L 3DO3A 3D1MC 1R24A 2X40A 4PYHA 4MNHA 3MR9A 2VQ1A 1JIBA 4JY6A 2H2PC 3SN6N 1ZHLB 2YPKB 1ZT4A 4IIQB 5GJTH 3O4LA 4MS8D 4AIXA 5FGCB 1VFOA 1GGIH 3WNNA 2A6IB 3ZHKA 2BNUA 2R4RH 1N5AA 4LRNH 1IAKA 2J8UB 3BJLA 1AKJA 1WCBA 4N0FB 3ARRA 4XXCA 3VXRA 4YZFE 5T5FL 1T83A 3P4MB 3QISA 4P5TC 1WWCA 1AGFA 3LKRA 2O26U 1D6EA 5JHDE 1XIWC 4WI5A 5K9JH 5GPRA 1KJ2A 4MA1B 2E9WA 4PGJA 2GTWB 4PLKC 2JLLA 4Y4KD 2P47B 4JY4A 1BZ9A 2ZUYA 3SPVB 3T2OA 1VA9A 4DZ8B 4ODVL 4MJIB 5MHSD 2VL5A 4LLDA 4NUGH 2NZ9C 1N64L 1T89A 5CIPB 3UZQA 4V1DD 4KZEH 3L6FA 1WBXB 4XI5D 2XOTA 2VZOA 3KXFD 4OIAA 3B2UD 5JXEA 3IFLL 4Z77A 2OM5A 2B5IB 1NBZB 2IBZY 1JHTA 3DUUA 4GBXD 4GXVL 1RQ5A 4RMSA 4DAGH 1G1CA 5E8PA 2FSEA 1G9ML 3DPBA 4HJ0C 3AS3A 3PGDA 3OKDB 5FGCE 1G7PB 4OF5A 1P5UA 2GITA 1C7SA 4EN3A 4QRUB 5IMMA 2H45A 4NO5B 2IBGA 2J8UE 1JK8A 2BFVH 4UU9B 1QACA 4YR6B 5CHNA 3QQNA 3PE9A 3F7YB 4P48A 5ESQA 2EKSB 5J56B 5IVNA 4LEOB 1MAMH 1TENA 3TT3L 4G8IB 1OSPL 2J2ZA 4FQ1H 2DLHA 5I30H 3D69B 2DI9A 4NQSA 2J1KA 1MJ7L 4S1DC 1ZHNA 5ID0A 3RWHB 2QJDA 1LO2H 3HI1A 3EDKA 2DQHL 3CH8A 2W9EL 3B9KC 5DRZB 1DDHB 3DMMA 4K7FA 3ZE0F 2CKBH 5I8KL 2A77L 4P5KB 4ONOA 2E9IA 4PBVC 4LKXB 4MJIE 5KS9F 5E9DB 1T0NB 4K9EC 1PGRB 3TYGL 3U9PH 4G6AC 5HD8D 1KNOA 4KAQL 5C09D 1I1AA 3IXTB 1QLEH 4WW1A 4WHYH 3BXNA 4TSAH 3GIVA 3ILQC 1KT2A 2DKSA 3GMRA 3LKSA 3REWB 3UTSD 5ICZB 3GO1H