3MBEB

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
184
structure length
178
Chain Sequence
b'RHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSRHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 178
sequence length 184
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3mbeB01
4M7LL 4I2XA 5HDLA 3QNXB 1TFHA 4K94H 3CZJA 3V9FA 5BV7C 1B90A 3C8DA 3V6ZB 4NQDE 4U6HB 2UZYB 4MB4A 1UM4L 1OOAA 1QSEA 4U4BA 2ADFH 3RGVD 3HPJA 3MLSL 5BVPL 4UT6H 4Y4HC 4HUWB 3DV4B 2FBOJ 2GY5A 2W38A 5MEQB 3SQBA 5DJCB 2EKJA 3P4NB 2DBLH 5IIEB 2X44D 4Y4FC 1FAIL 5HXMA 4NFCA 1GGBL 2KPNA 1J0ZA 4AEEA 4N8PA 3UO1L 1Z0NA 4UB0L 5DVMA 1QSEE 1LE9B 4PJXE 5EULV 3GMMA 3JVGA 2DQGH 4JZJC 1J8HD 2ZCHH 3LDBC 4QTHA 1I4FA 1I8MA 3QXVA 2VXUH 1AKJD 3R06B 5CJQH 4PRPD 3ILPA 1MI5A 2AXHA 3UTTB 4N0CD 1ZLVH 5HHXL 2I9TB 1U95A 4HIXH 3SY0A 2VDLH 2JCCE 5KTEL 1I85C 4JRXA 3FQUA 4PJBF 3HNTH 2F53D 5F6HI 3BMWA 4XT1C 4ISVA 2NX5A 1IRAY 4TYUA 1JVKA 2XA3A 3FT4A 1P4LB 4D3CH 3NFPA 2CXKA 2FEDD 1ZEAH 2PKDA 3FB5A 1RIHH 1YEEL 1CGXA 3MJ9L 4M9PA 3SE8H 4F2MB 2BVYA 3RZCB 4PGDA 4JKWA 4IMLB 4PY7B 5J1AB 1RJYB 3SCMB 5E9DB 2I60H 4N0FB 4LCCC 3O3BB 4F7EB 1HEZB 3GIVA 1OAYL 4FQXC 4ZUUA 2YPLB 1FO0A 5ILTH 5K59E 1KULA 2E6PA 2C3WA 4TRPL 2OJEB 1FYTE 4ALAL 1ZMYA 1DBML 4RGNB 5CBEB 1M7DB 3DSFL 5T5NG 4CJ1A 5DHVH 3O2DL 2LE9A 3TIDB 5KG9B 2VWEE 2R2HB 2XOTA 1GZPB 5GPRA 3D2UB 2B1AH 5I17B 3C9NB 1LK2B 2XRAL 1ES0B 1PAMA 2C3GA 1NAMB 4WI4A 4NRXB 1QYGL 4HFWA 4EOWL 5J13C 3NCFB 3JV4B 4NN5C 3BPOB 1KN4L 2NY3B 2LVEA 2D31A 5GRUH 4ZQKA 3S36H 3GMQA 3PNWB 1AO7A 3GJFA 4NJ9H 4Y5YB 3W9EA 2VLJE 4BZ1L 3BQUB 5JUEH 1RMFH 4W70A 4OLUL 1ZT1A 1BZ9B 4X9BA 3ARGB 3ARTA 3LKRA 1MIEH 2ADGA 3I84A 3U83A 4OI7A 4QRPA 3L3OA 5DRZA 4JY6A 1AO7E 5IG7B 1ZHBB 3KXFA 2B5IC 1FCCA 3O6KL 1GC1H 2IPUK 1CFBA 4E41A 5D7JB 2XKUA 3UPAA 2OTUB 4JREB 1I7UA 4MDIA 2W9EL 1TTGA 4XAKD 3W9DA 1DQML 5TDOB 3ZKNC 5CEZL 3GNMH 3T2OA 3KJ4C 4JFDA 4WI2A 5D9SA 5IWLC 5TPWH 1GGYA 3BKMH 5FO7B 3T1WA 2WBJA 3QNZA 4W6XB 1I8LC 3I9GL 4IOIA 3RWHA 3TBWB 2WNGA 4OLVH 5F96L 3RPIA 5DRXA 1P6AB 4CU6A 5E6IC 2F19L 4KVNL 2DM4A 1J8HB 3TF7C 1GGCH 1X6LA 1A4KA 3QDGE 2WP3O 2PW1B 3FRPG 1C5BL 2F74A 3O3DA 1MCDA 3HR6A 3TO4C 4Y1AE 4P59L 5BS0D 1WBZA 1RURL 1BOYA 3GSQB 4LLQB 4XPFH 1XIWA 3VMNA 2CLRB 2V2TB 3NCEB 4KI5C 5FHAL 5SWZA 1OP5K 5DJAA 3ZHLA 4H5SA 4JFZH 4ZUWB 1JYXA 2BP3A 3QUYD 2F54B 1HCFX 4KVCH 3IDMB 3B43A 3CFIC 1T83A 3QO1A 1KJVB 4ZO7A 1PDKA 2ZSWA 4PJGB 3MV8A 1XGRA 2P47B 4WEBL 4A2MA 5HYSB 4EDWH 1ZVSA 2JIXA 4NO2B 5CSBA 1VPOH 2IG2H 2DWDA 3ZT7A 5C7XL 1LQSR 2M2DA 5FHBL 3MNWA 3EYVA 2VUOA 1U8NB 2FL5A 3DUHA 1UXWA 3N1QC 3IVKB 4NO0D 4NC1C 1K6QH 3N9GL 3QRGH 4PLJD 4J4PA 4ODBD 3BT2H 4E5XB 2X4SB 1K85A 1XZ0B 4NKMA 1BFSA 5I6XC 5I1IH 3MNZA 4PREA 5F3HA 1U3HD 3G08B 1G9EA 4GRMB 3DV6B 5T1KA 1AFVH 4JN1L 3BKJH 2MCPH 4ODHH 3WNPA 2FRGP 4F7TA 1XMWA 1NCBH 5H94A 4BSVA 3RNQA 1B0RB 3SGJA 4O5LH 4HWNA 1TCMA 4I5BB 1YEDB 2X4TA 5FGCB 4OD2B 5D1XB 5DDHB 1KLFA 2X2YA 5D7LD 2FCBA 1DEEB 1KJMA 3F7VA 1FFPA 3ARDD 1Q9WB 5DHVB 2FWOB 2APFA 3CDGA 4OCYH 5KS9A 4NOFA 3RL1B 1CK0L 4RDQF 3OKDA 1DQJA 2QBWA 5JPMA 1RU9L 3D3VD 4KI1A 5HYQA 4G6KL 2F15A 1Q8MA 5F7EH 5K9JL 1OTUC 1F02I 3WCYA 5D6CA 1NUGA 4POUB 5EO9B 3SOBH 4B41A 1FGVL 4RAHA 4JVPA 4TSCL 3D87B 4NM4L 4X9GA 5BVJA 3CH8A 3F65A 3IFOA 4LLDB 5CJ5A 3VA6A 4BQCA 1KLUB 1LO2L 4MVBC 1PEWA 1MLCA 4W6YB 3CVHA 4B0MM 4ZDHA 4OT1L 3WJJA 2F8VA 2VDMH 3BIBX 5DVOA 2A38A 3BH9A 2X89A 5E00A 3B83A 4PJ8D 2Y1VA 3NIFF 5C07A 2DM3A 1FVEB 4PG9A 3QCUH 5FK9B 5A16B 3SE4A 3ZMRA 2ZUQB 1E27B 2X4UB 3P3YA 1MRDL 5FECB 1QBML 3DPBA 1LP9A 2YWYA 2ID5A 2BY0A 4BSWA 4EVNB 1P7QD 1HNFA 1YMMA 3FZUC 4Q9CA 1IGCL 4KC3B 3TIEA 5AEAA 5I1JH 4JPVL 3WXWH 3OHXA 5LXGH 3NABL 3NIGF 4JKMA 3ILQD 4X7EC 2G5BB 4XH2B 3X3FH 3MCKB 1QOKA 4JZOA 5JXED 1I7ZB 5TDNA 5ICYA 3RA7L 4S1QH 4K3JH 3BWAA 3LV3A 4U6XA 1G6RL 3CFDA 3SDCC 1OAZL 3LZFL 2ATKA 5E8NB 4YAQA 1LEGA 4M1DL 1MVUA 2BNRB 3I6GA 2CUHA 3SE3A 3ROLA 4X6BA 1OM3H 3BPLC 2GK2A 3ZE0E 3CDFA 2IPKA 3L3KA 3NGBB 1NL0L 5DJZB 3MX0A 3VGAC 4W68A 1D5XA 5A3IC 4YWGH 1XAUA 4PJEF 4F33B 3RI5F 5HSFA 1YEIH 5DQJA 3OAUH 1AHWC 2J4WL 2EZ0C 4K07A 1FZJB 2ZOKB 1BAFH 1G7LA 3TZVC 1S7VA 3R1GL 2AJSH 5IVXB 1UWGH 3KPSE 3CVIL 1U3HB 3FQRB 2CDFA 1PJ9A 1JGVL 1F6FB 4N9GB 1VA9A 1IL1A 5L8LB 1HHHB 4NQCD 4PP1C 1P1ZA 5IQ9A 1YPZA 4WHTB 4BFIA 5IF0B 3UMTA 1HYSD 1OW0A 3QIUD 1AD9B 4JDVA 4HT1L 4KDVA 1Q9LB 2K7PA 4OLZH 1TJHL 2VXSH 3SDXE 3FO9A 3HR5A 2BVQA 4KZEL 1JMZA 1L0QA 1V3JA 1IZKA 2I5YH 1FZKA 4X8JA 1MJ8L 3QDMB 2OP4H 5HDOA 3HZKA 4C56E 5MEND 1S9KC 1YPZE 4KKBC 3KNBA 5IFHH 2VMFA 1YEFL 3S5LG 1NEUA 2OJZL 4V1DA 3C2SA 2AEQL 1A3RH 2BVEA 1AR2A 4Y16B 1J9CT 3D3VB 3TYGL 3RWIB 4X5LA 1LVEA 3P0VH 1DBKL 4LBEB 4LPYA 3WUWB 3VRJA 2Z4QA 3GMRA 3O9WB 5I8EA 1YECL 2DN7A 1CLOH 4JFXB 4V1DE 3QI9C 4J3OC 2ORBH 5EPMA 1KPRA 1IE5A 3UBXB 2P5WB 4M7LH 2I07A 5I1EL 3VXSB 4PB9L 1K2DB 3MLTA 4F7MA 3NFSL 2ARJB 2GCYB 5CJ8A 2R0LH 2FHBA 1NCNA 1ZLUH 5FM4A 2ZJSL 1U8PB 4A6YA 1CFQB 5AUMB 4NFBA 4AMKL 2GFBB 1C5CL 1N3NA 1KCVL 2DJ4A 4P4KA 3CFEB 3LKNA 2A74A 1JUFB 4S1SL 1JWSB 3WSQH 2G75A 5B8CA 5DVKA 4IJ3C 3PHOA 3DXAB 4OBSA 4ZXBB 1YJDL 1ZA6A 3MXWL 3S96A 3JWDC 4HIEB 3S35L 3U4EB 5KVDL 1DL7L 2VWEC 1U2CA 1JHLH 1BIIA 1IQWL 3FTGA 3WE6A 4F7CB 2HJFA 1ROWA 1OAQL 4M6MH 3ZDXE 2PO6C 3NIDE 4KHTL 5GISL 3TCLB 3QIBD 4MJ6A 3QYCA 2BCKB 3WFBL 4PJDB 1FNHA 1R6VA 4S2SA 1A7OH 4BZ2L 1KNOB 4D9QE 3GJEB 4FG6C 1QSFD 1S7WB 2R1WB 4YPGA 1F2XK 4GUPA 3V0WH 1T0MB 4F37F 1MCFA 2KH2B 3BVNA 1HSBB 1KC5H 2YD9A 4U0QB 3UJIL 3U0PB 4X98A 3UXFA 5IVZA 2P5EA 1SEQL 1NH6A 4OB5H 3O4LA 3BHBB 2OL3A 5E8OA 4ENEC 3WIHH 4U3CA 3TPUB 1EVUA 4NN7B 4BZYA 1I9RL 1N4XL 1OAYH 3O3EA 5JDSA 1QQDB 3TPKA 3K1KC 4WJ5B 3EDEA 5DMJB 2O93L 3VW3H 2RJMA 1NGWA 3MA9L 3MNVB 2YSSA 3UTQB 4X6DE 5CP7A 1C08B 2OZ4A 1KELL 4DKEL 5E94A 5F7FA 3T09A 4OTXH 4PJAF 4Y19D 4DCQA 3QHFL 5IB1A 4OFIA 1XR9A 4XNYL 3UTPD 4PJIF 4L3EA 5HYJA 4GSDL 4Y0GA 2DYPA 1KN4H 1OLZA 2HT3C 1A6VH 4I9WE 2QSQA 4CW1B 4XVSL 3KLAA 4MAUL 4FZEH 5SX4I 5CEXB 1JYWA 1FN4A 3CFBA 1XEDA 2A9NL 4P23D 5DEFA 1CICA 1I1AA 1NCDH 5IJVB 4LK4A 4J12A 2ED8A 1CVRA 1E4WL 2YD3A 1A7RH 4L8DA 5C8JB 4OV5B 1MCNA 4KKCD 4XMLH 3CZFA 5JHDB 1E6JL 3TH3T 3NZ8A 1JN6B 1IGYA 4WW2A 5LCVL 4P3WA 4XC3H 3VMOA 2Y5EA 1A6WL 4P2RA 2VITA 1QUNA 3FN3A 4BK4A 2NTFA 1HQ4A 4MGXA 1M7IB 1F8TL 3EGSA 1OARL 4H1LH 1EJ6A 5DFVD 3QH3B 4YBLB 1TVBA 1RHHB 4G7YL 2RCSH 2I9LB 5C71A 1G7QA 4G6JH 1TETL 3DVGA 3ULUD 3OKYA 5E2TH 3NAAL 1BWMA 2E3VA 1AGDB 3HE6C 5IB4B 2PXYA 1YYMH 4NBZB 3I9GH 1T83C 5E7FA 2GT9A 5F96H 3PGCB 3KYAA 2D7NA 4TUOB 4EI6B 1AE6L 5GRJL 5GRYA 3GI9L 4KVNH 3LEXB 3TBYA 4LVNB 5ID0B 5IW1B 1I3VA 5B4MC 5C09E 4WI3A 3CSYB 4WUKH 4BQBA 4I13B 3QISA 4EQ2A 1A9EB 2PYED 5HHME 3EIFA 4UDUB 1RK0B 3C6SA 2VDOL 1LO5A 3MLRL 5LGKA 1JHTB 4G6FD 1NC2D 1U0QA 1XF3A 5F89A 3HC3H 3MRPB 5GIRA 2A2QT 2EH8H 3FFCA 4Z0XB 6CGTA 5GS2D 3W2DL 5DR5L 4AT6B 2ADJA 4XCNA 2Y36H 4PS4H 3E6HA 1ZGLB 4DAGL 4Y5VB 5FOBA 4R9HA 3TH4T 4BYHA 3MLVH 1VGKB 4OM0H 3BISA 3FAWA 4QTIL 5ADOL 1U41A 3RUGA 2AABH 5D1ZD 1SBBA 3PWPA 1S3KL 3U0WL 3OXSB 1NDGB 4JCMA 4TSBL 1MOEA 2ZPKL 4I0PA 3L9RA 1DQQA 4EI5A 2GYSA 4NZUH 4OLXH 2AS5M 3O41A 1T80A 3PP3H 4HGWB 4NQEE 1KXTB 3KPLA 2QQQA 1FNGA 4OZGA 5L7XL 3PWPE 3WIFB 5BCAA 3CLEH 2PN5A 2EH7H 2P8LB 3JXAA 3L6FB 4JG1H 5I76A 5JQHC 3DX7B 2Q7YB 1IEHA 2A0LC 1FV1A 1WZLA 1SEBB 1CGWA 4CVUA 4LIQH 2P43B 2AJYH 4H8WC 3G6DL 1IAKA 1WAAE 5D96B 2CO7B 3LS5L 5E70A 4TVPL 4ZFOL 2WZPD 5FA4B 1S9YB 2J88H 4KTYA 4WWKB 5CD5D 3OWEA 1BF2A 1JK8A 1JBJA 5E56A 3MV7E 1A6AA 3T77A 5HPMA 4NNXA 5C0AB 4LCIH 1F5WA 1AGCB 2QJDA 3BN9D 2Q20A 3SDXF 4XP4L 3OTTA 1DUYB 1BZ7A 1CK0H 1VACB 2CDEB 3QDJD 4NBXB 1VCAA 3VI3E 5I1HH 3WLBA 3UTOA 4POZC 2F8OA 2GK0B 5TQ0H 2FD6L 1BHGA 1KIQA 4PBVC 2J8HA 4OZ4B 2XTJB 3EDFA 2R8SH 4CADA 3O8XC 1XCTA 4KHXH 4UINH 1WBYA 2BZDA 1OGTA 1TZHB 1XGQB 4LQFL 3OAZK 5DD3H 3U46B 3LIZL 2AJUL 2VDRL 1NKRA 5B38B 2XN9D 2LABA 4HBCH 5EFIA 1S7XB 5C0GB 1VFOA 1LO2H 3LQAC 4QCIA 3TO2B 1QRNA 2ESVE 3EO0B 4FQHB 2HLAA 4K23L 4NHCH 4OF5A 2NY6C 2OR7A 2HN7A 4N90E 4YHKH 1WBXB 4BKLB 3B8YA 3RVXD 4MJIB 4H1LB 1UC6A 4W81A 1OCWL 1TQBC 2BY3A 3LQZA 4LVOB 4HUUA 4Y4KC 1K5NB 4MSWA 4WNQA 1S78C 3LHPH 4IRJA 1JPTH 4HKBA 3T0VA 3U0TA 1NCCH 1U93B 2DQDH 3S88H 4X7FC 5C0DB 1IGML 2VSCA 4FNLL 1NC2B 3X3GL 3MLUH 4XBEL 5I66B 3AU1B 1NMBH 3EOTL 1FG2B 1ULVA 1ZV5A 4G8GD 4QXTB 1IGTB 3PWVB 4GKSA 1RZ8A 1FFOA 4RWHA 2Q86A 3IB4A 1YY8A 4HGMA 4PJ7E 5D7IB 4J6RL 1YC8A 4R97C 4NUGH 3RA7H 4NJAL 4HC1L 2DQIL 4PRHB 2EXYD 3QFJB 3SKJL 1T1WA 2E9IA 4F8QA 3S4SA 1WGOA 1MJ7H 2HWZH 2BHYA 1F6LL 4L4VD 5H37H 2R4SL 4OFDA 1UWXK 4KWUA 1XGTA 1X4XA 2PTTA 2YZ1A 4JJHA 5FYJH 1G7JB 5J9PB 4LF3B 2RQ8A 2BVPB 5GGTA 4KK8C 4KUZL 1DN0B 4FFYH 5HDQH 4P2QD 4HQQL 1RUML 5JQ6H 2HVJA 1MLBB 2UV3A 2BX5A 5ERWA 5I2IA 3HNVL 4JFFB 4L4TA 1J1PL 4H25B 3V4PH 5IB2B 4S1RH 3GSXA 4OAWB 1CLYL 1YQVL 3MSPA 4XPBH 3MYJA 1UM5L 4PJ5A 5HGBA 3VFUA 3D39A 3QZWG 5IHZA 3FT2A 5B3JE 2J3SA 4FQ2H 1HNGA 4X7TA 4PJAB 3GGWA 1QSVA 2G60H 2FJHA 3IXTA 4MNQD 4PJ5E 1EAJA 3CFKB 4WO4B 4GBXB 4P4KC 1H3PH 2DAVA 5CZVH 4GG6E 4JDZB 3E8UL 1WZ1L 2EEAA 5JORA 1Z2KA 1OGAD 5BQ7A 1YYLH 4PFEA 1KLGA 1LE5A 3O4OB 3GMOB 2Y4SA 1HE7A 3I02A 4K2UL 3VXTA 2OR9L 3A6CL 5L9DH 5IMLB 1NQBA 1KJ2H 3IDNB 5EH1A 4WV1C 5D2NE 3MBED 3BP4A 3WFDL 3I2CH 4Z7VF 1CIDA 1BIHA 1KPUA 4P5TD 3Q5YA 3UX9B 4Z78A 2BXYA 4X4ZA 3RY6C 1CL7L 4NQXA 5I15H 2DTMH 1LHZA 2IANB 4YIQA 1YNKL 3CK0L 4HS3B 4LLMB 3QXAB 3K2UH 3EO9H 2MQ0A 2Z31D 4LCUB 5E0QA 5EO0B 2VR4A 4CUCA 2C7UA 5ACLA 1C5CH 1HHIB 1HH6B 3QUMH 5FF6A 5E8PA 3HZYA 1F58L 2WUCL 3T3ME 1T5XA 4GG8A 3T1FB 1RUAL 5EUOF 2YA0A 3MROB 4KRNA 5ESVB 3LN4A 3QUXD 3P77A 4X6CE 4HIIB 4Z7NE 1MHHB 2R2BA 1I3GL 2YR3A 3QCTL 1ND0A 3VWJA 5BZWA 2NR6C 5TDPB 3STBA 3UTSE 1CT8A 1BQHA 4G8GB 4U6HA 1ZT4B 4CAGA 4Z76B 2CK2A 1U92B 5IFAL 2JELH 3ESUF 3DV4A 3G9AB 4G7VH 5MEQA 1UB6B 4MLSA 3P4NA 4MQSB 3VI4F 1TQCC 4OI9A 1VEOA 4LLYA 1LGVA 4UNVA 1RIUH 4LRIC 4WWID 4JJ5B 4Y5XA 4L4VB 4GAGH 1QPXA 2AI0L 2DMCA 1G9MC 1TENA 3VWKD 3MODL 4HG4K 5IQ7L 2P42B 1CICC 3R8BB 2NQCA 1UVQA 4JDTH 1UXSB 3G04A 4FQQA 5SX5H 3BZEA 4G43A 1I9RH 5EIVA 2A6JA 5HD8D 5JZ7D 3DSNA 5D72H 2CIKB 4P2QB 3HFML 1K3IA 3TVMD 2H2SC 3MA7A 1CFVH 3HG1D 3ESVF 4HXAH 5T3XL 1IGJB 3CMGA 1JYNA 4WW2C 2XNAB 1TCRB 1FAKT 1GVIA 1F11A 1OLLA 4JY5L 2WSKA 1K8IA 4YGVB 2R2CA 5KSAD 4MNHB 1NANI 4HEME 1KEGL 1CU4H 2QQLH 3EJYC 5D1QD 3RU8L 4EBQH 4GSDH 4ZUTB 1MHPL 4PY7A 2MPAH 5J1AA 3DWTA 3SCMA 4RAUA 4F7EA 4XMKH 1WAAF 1HEZA 3F7YB 4ELME 3WDIA 4FFVC 4NQVA 5DJYA 3U82B 2YPLA 5DK0A 3OQ3B 1D9KA 5LQBH 4MMXC 4POYA 1OGAB 4N9OB 3DMMD 1M7DA 3BD5A 1B0GB 5JR1L 3BZ4B 1SY6L 4IRZH 2X70A 3TIDA 2FH8A 3I3BA 3F6IA 5LCVH 3D2UA 1CBVL 3PGFL 4ZFZB 1WQVT 3C9NA 4PJFF 1R5WB 3KWWB 2R69H 1ES0A 2VLKB 4L1HA 3FQNA 5DJDB 3MBXL 1ZHNB 2LTQB 2BRRL 2A73B 5FXCH 1SYVB 3NCJH 2H3NA 1YEJL 5F93C 4XCYB 3S8WA 4HKZA 2YWZA 5ALCL 3WHXB 3HRZA 3DX9B 3E0GA 1BWWA 3T0AA 3QUZA 5FUZH 3WNMA 1PSKL 2EO9A 1LO4H 3W0WD 2JB5L 1JTTA 2GAZB 1CF8H 5JA9A 2Q3ZA 4P5MB 4JQVC 4LHJB 4MB3A 3IU4H 4UT9L 1ZHBA 5H35A 1NLDL 4G8IA 2BVUA 1AE6H 1S5HA 4GRWF 3C60B 1XF4B 3QEGH 1QTYT 4O2EB 5CP3A 1WUNT 1CN4A 3SGDH 2VQTA 2DQFA 4D8PB 4EI5C 5BV7H 1X44A 3HN3A 5E2VH 3T4YB 3UZEA 3L5WB 1NFIA 1GGIH 5TDOA 4XXCC 1U3YA 3H3BC 3B2UC 4NQTA 3F62A 3FQWB 3Q3GA 3RGVA 4XNZC 3VRLE 1MQ8A 4HJJH 2IAMD 5C0RL 4DGIH 1MFCL 3BDYL 3W2DH 2GY7B 3QUMB 3O6FC 5E8DL 3C5ZD 3BP6A 4NP4L 4UV7L 1LO3L 1T6WA 3G6JE 4OLWL 5D2LE 5HGAA 1KSRA 4M02A 4WU7B 3KPRB 2SEBB 1VEPA 2XQYG 2EDEA 5F1OB 1J8HA 3JWDL 3QO0A 1U8MB 2PW1A 5FA3A 1CXKA 2E27H 1AKJA 3IKCB 1FO0L 4UIKH 1F2QA 1IC5L 5EZOL 2VZSA 2P24B 3GSQA 1VADB 3TESA 2WINB 2JJUA 2Q8AL 2CLRA 2H26A 3V5DB 3TVMB 4Z8FL 4U1HB 2F53A 4DOHE 4PRPE 5KSBB 4AENA 5ID1A 1P2CA 1X5YA 2FB4H 4N8VG 4ETYA 1CFSA 3IDMA 5CJBA 1KJVA 3WD5L 2C4FU 2H1PH 1L6XA 4U6YA 3BD3A 4XVJL 4PJGA 4YHZL 2PYFB 2YD6A 2OMBA 2BDNL 3QULB 4PTUB 4RNRA 1QACA 2JJSC 3T8XA 5HYSA 3OJVC 4TUJB 5TE7L 1XGPB 4JRYD 2WANA 5T1MB 1ZTXH 3DGGA 4FMKA 4YR6A 3P0GB 2HFFB 1VERA 3HLAB 4LCWE 1U8NA 1JGEA 3TN0C 3KLDA 3IVKA 1OL0A 1FL6B 5I74B 3FRUB 4WI5A 4EN3D 3A6OA 3L3GB 5KVEL 1IAII 4BQ8A 4XNQB 2XZQH 2AV1A 4E0RA 4GXVL 2WUBH 3D9AL 5C3LD 4GG6F 1I9IL 1A9BB 1KTRL 3V2AR 1TVHB 4MCYA 4CDHA 2YD8A 1E4XL 4O9HL 4U2ZA 1JV5B 3N85H 4M03A 3K4DA 5IBUB 4KRPB 1YEDA 1FE8L 1T7ZA 5D1XA 5DDHA 3RIFF 3W0WB 3QQ4A 3WEXB 1PYWB 3HI6L 1A7QL 1FP5A 3AXLA 1Q9WA 2EO1A 1PG7L 3HMWL 4M93B 5TGBB 4K23H 1CTOA 3BKCH 3F12B 3CDCA 4JO1H 5TE4H 3JTSA 1AJ7L 2DQTH 1OCWH 2XQBH 5I9QB 3OPZL 5INCA 2NY1C 1S8DB 4RDQG 1UM6L 5C6TH 1JPFB 3ARYA 5MI0B 4YE4L 3DYOA 1JF1A 3GBNH 1A1NA 1LEKA 1CGTA 3T3MF 3QQNA 1FIGH 2E7HA 4B7LA 1T2XA 2EC9U 5I8KH 5FYKL 1NMAH 4LNRB 5EUOB 2FH6A 3IFNL 3T65A 3BO8B 3KYNB 4X6CF 5CZKA 1DJSA 1N6VA 3VG9B 2D03H 3RAJH 5JPNA 3V7AE 2M26A 4V2BA 4G8FB 3HC0A 4KKLC 4RZCB 2NLJB 3AS2A 5FUOH 3SKJH 5DT1L 3INUL 5DQ9B 4YHIA 4RIRB 4LAJH 2XKNB 5BV7B 4JQXA 4N0UA 5IMMA 5FDYA 2AJXH 5FYLL 4KQ4H 2R4SH 4YDJB 5EC2A 3T0EE 1JHKL 5A16A 4ESKA 4U1GC 1HN1A 1E27A 2X4UA 1HSAA 5FECA 4Y4HB 3QWRD 1N5AA 2E9BA 1S9XB 1F4AA 4NDMA 4Y4FB 4GOSA 3LKOB 3LN5B 4HQQH 3SKMB 4LSSL 5C3TA 5BS0E 5J12B 3PG2A 5LGJA 1J1XL 3QUYA 4LKXB 3LDBB 2JLLA 3A67H 3GBML 4JFPA 1J1PH 2KZ1B 4LVHC 5IOPB 1T1YB 2PTVA 8CGTA 3TO4D 3P0YL 2BNRA 3ARVA 2OR8A 1JGLL 4UZGA 2NW3A 3CFJB 1EBAA 4RMUA 1JF5A 2H9GA 4KI5D 4MMZC 4F33A 2ZCLL 1D5MA 1FL3B 2C1OB 1RZJL 2V7HB 3IXAA 3D0LA 1IFHL 5F1IB 2FATH 2OQJB 2Q3AA 3O0RL 4NO0A 3RX8A 2Z8VC 4I4WA 1AC6A 1FZJA 2ZOKA 3D18A 4RFNB 4B7IA 3WJLA 3DVNB 1Q0XL 5L2JB 4CMMA 1H3TA 1A3LL 1U3HA 1TLKA 4L3AA 3A6CH 4X4ME 1JFQL 5CD3A 3A6BL 4LCCB 4IDJH 2C9AA 5F9JA 3TJEL 4FQIH 3VWJC 1MRFH 4FQXB 1MAJA 2YRZA 5IF0A 4N0YH 2ZUYA 3KPQB 1H3GA 4NT6A 4PJ9C 1AD9A 1UKQA 3DX8B 5BJTB 3H9SD 2BNQE 2IJ0C 5T3ZE 5IB5B 3BIKB 3HZVB 3EYQC 5F9OH 4LU5L 3CVHL 5D7LA 3P9MA 3DUUB 1A6UL 4DZ8A 1TITA 4OLEA 4YDVB 5KN5B 1S5IL 4OCRL 4JVWA 3PP4L 4MDJA 1D3CA 5J13B 4DUXA 1J0HA 4JHAH 5I0DA 4IDLA 5F1SA 3D3VA 4PD4K 5E2UL 2Z35A 5D7LE 2BJMH 4MAYD 4LBEA 4PBXA 5DUPL 1YY9C 2P45B 3LKQB 4H0IA 3O9WA 3RNKB 4X6EA 1MRCL 4LSRL 1RZIA 4G80B 4G9FD 4MNGE 1D6VL 4FQCH 2NPLX 4LHQB 3ECBB 3MLYH 5L6YL 2ZSVA 3VFSB 3S6CA 3X17A 1JNLH 4X8XA 1TZGH 3KYOA 2RR3A 1U8PA 1CG9B 2OXHA 5AUMA 4XXDA 2DQEL 1A0QL 1FG9C 4V2CB 3H7BA 3D85D 1OTUD 2AP2A 4XP5L 1WTGT 3T2NL 4ONHB 3PQYE 4IHOB 3H42H 2CUIA 5CKGA 3PV7A 3V7MA 4PJ8A 4NN6C 4QRRE 4UT7H 2A83A 2GKIA 5EWIH 3Q1SH 5F7KC 3OKKB 4ODTH 1ZS8B 5EOQL 4YHNA 4UTAH 1D9KC 1MCHA 3BYYA 5CEYB 4TN9A 4U6VL 5L88H 1P7QA 3FCTB 5ACZB 1YUHA 3TCLA 5E6ZA 4PJDA 2EDHA 3V0VA 2B2XL 5E6IB 3WL9B 1CYGA 4XHJC 5SWSD 3GJEA 2V2WB 4OZIA 2BSRB 1S7WA 2R1WA 3TO4B 4DJMA 4L8CB 1DSFH 3MLXL 4OM1L 1CL7I 5DUBB 2WP3T 3BPNC 2ZNWA 1F90L 4P5KB 3RDTC 4M7KH 1A7PH 1Z3GH 2QLVB 3QUZC 4H0GA 4RFOH 1VKXA 1G9NC 1IILE 4M1CC 4L9LA 2R0WL 1MHCB 1Z9LA 3GMLB 2X9YA 5EC1B 2VXTL 4OUUA 5AWNH 2B0SL 4K3EL 4QXUH 1QQDA 1XF5A 4M43L 5TE6L 1MQKL 3SDCD 2LQRA 3MNVA 2OMNA 1TXKA 1NGXB 1QHOA 2ENSA 1C08A 3PWUA 4HIHB 1GAFL 4XCFL 1H0DA 5JDJA 1BD2E 3ME0A 1SM3L 3PGFH 1D5BB 1FZOA 3REWA 5DWUL 4NQCA 4LNVA 3RVUC 5ADPH 3MBXH 5JW4Q 4XWGL 3SJVB 2J8UB 2CIIB 3T4AB 3QIUA 3RL2A 4HKXB 4CW1A 1T5WA 2XWBA 2LAGB 3RGVC 1Q9OB 4MXWL 2EDDA 3RWDA 1DBBL 2EZ0D 3PXHA 4NQCE 3TNMA 3U6RA 2DQJH 5I6XB 5I1DA 4XPTL 3FRPA 3PDOA 1C5DA 4YQXH 5C8JA 4JPKH 3KPOA 1QKZL 1KENL 4PP1D 5DJ2A 1SVCP 1T20B 4CN4A 1JN6A 3EFDH 3MLWL 1HIML 1EIBA 3WKML 5MENE 4J3UA 1OVZA 4Z7UB 4JFQB 4LARH 4NRZB 4N0CC 1RK1B 4ODSH 1M7IA 3LSOB 3VE0B 4NBYB 3QH3A 3MRMA 1IBGH 1BJ1J 2H6PB 4HG4J 4O2CB 3CSPA 4JR9H 4PV8B 1U8IB 2F5AH 1P7HL 4MA7H 3MPCA 2OXGA 2HAZA 3O6ML 2EYSB 3HZMB 1BM3L 5C0RH 3F6LA 3BDYH 2Z92B 4KK5C 5EU6B 1U8OB 3PGCA 4WGVB 4TUOA 1DR9A 1KTLB 2OL3L 2ITDB 5DTFB 4X80L 3JWDH 4F58H 4M7JL 2UUDH 3MRGA 4MD0B 1UQSA 3CSYA 3FMGL 3G5ZB 5IP4A 3TA3C 1BFOA 4HWBA 4HCRL 1RK0A 4XPAL 4QRTA 1W0WB 2OZ4L 5EDXA 3NA4A 4HV8A 4PJCE 3QIBA 3GMPA 1PY9A 5DVNA 4Z8FH 3TYFA 1CD1B 5ESQB 3MRPA 3BUYB 4OFKA 5HGGS 3K8MA 3JWOC 5F3BB 5TF1L 1IAIM 3NACH 4GRLD 5KOMC 43C9B 1QSFA 5FO8A 2IPUG 1CFNB 5FO9A 4Y5VA 3GJFH 3DYPA 3WD5H 1NEZB 1VGKA 4U1KB 1G9ML 4APQB 3W5MA 1KBGH 3MUZ1 4NKDB 5DZNA 3ARWA 2BDNH 2EECA 4I8DA 5CILL 4ZTPL 5EZJB 1WWAX 1BECA 4XI5D 1V7ML 3NMEA 4HGWA 3HNSL 4FG6D 3SDCB 3FQTB 3WIFA 1IGIH 5FV1L 4XPHH 4ZPVA 3VFOB 1JGDB 3L6FA 5EBMA 1FSKB 2Q7YA 3MRLB 5C70A 4Y19A 5KS9F 3BPLB 2ILLA 4GXVH 1IZJA 3VGAB 3U9PH 1NGPH 2EDFA 4ENED 3HAEG 1A6ZA 3U9UB 4D2NA 1KCLA 5C0BB 3OKNB 3WIHA 1E28A 2AGJH 4NWUL 5FA4A 4Y19E 1AHWB 1NBZB 1EFXD 2C3VA 4P23A 4WWKA 1AGFA 3HUJE 4UOW0 3TZVB 1PKQE 4NQDB 2P1YA 1IC7L 3T0EC 4WVRA 1DFBH 3CAFA 4R4BB 5FGRA 3VG0L 5CEZD 3IDGA 2WMPA 1R5IB 4LEXL 4E42B 1B6UA 1DTUA 5T5FL 1HKLL 2RB8A 2APBA 4Z7WA 4JGUA 4GAJH 1AC0A 4I2XB 2I27N 4JQXC 4OJFL 5F7MC 2HT3D 3O6LL 4I3GA 4WU5B 3ZTNH 3BMVA 1MCOL 1QSEB 4PJXB 4KPHL 2YKLH 3U7YH 5D7KD 4AYFA 3A0OA 4KMTL 2GHWB 4PPTA 3WYRA 3QDGD 4MD4A 3V0AC 1YEKH 3IGAA 4Y1AD 1N64L 1BOGB 3RZWA 3Q0HA 5EORL 1LP9F 4WFEE 3IFNH 4K55A 2OTPA 3TBTA 3QUYC 1XGQA 3LEVL 4GMSH 4XMPH 1I8MB 5DRWB 5I73C 5F7LB 3MRDA 5B38A 1IAMA 4GQ9L 3HCVB 2R0KL 3ILPB 4QHLB 1S7XA 1MI5B 5C0GA 1CXHA 1E4JA 4KK6D 1EDQA 3IDYC 4UU9A 4AH2A 4FQHA 2HKHL 3N1GC 4ETQB 3MOBL 4KGJA 1U95B 3ARED 5HHOD 3QI9B 4NIKB 3ULUE 1WBXA 4BKLA 3SY0B 3T3PE 3INUH 3ZKMD 1O5DT 2IQ9H 1T2QL 4RMSA 1SHMA 2R4RL 5J8OA 1NC4D 4R0LA 3L3HA 5FYLH 3EYUL 4ISVB 2LU4A 1NGYA 2I25N 1JHKH 1QNZL 3KVQA 4KTEL 3HE6D 5KZCD 3MGAA 5C0DA 5EIIA 2EDNA 3IAGC 1NC2A 5I66A 4NCC1 4YC2C 5CFHA 4P9HC 1PY4A 2I26N 3OXRA 3VXUD 5IM7B 4XVUC 2PYEE 2W0KA 1LD9A 1E4XI 4BFBD 1FYTB 5D7IA 3QXDB 4IJ3B 3UDWC 1NFDA 3GBMH 3G6AB 2B4CL 4TNWK 3I3DA 5B4MD 3Q6FB 3GIVB 2DQUH 4ZUUB 3QG7L 3PL6C 5D93C 4H0HB 4TUKL 3ZTJG 2PO6B 3OJ2C 4L8BA 5IEKA 3V79C 3S5LA 1CDIA 4K3DH 2UVFA 4QWWD 4BJLA 4ONGH 4Z7QF 1ZLWK 5EBGA 1KF9B 2FGWL 2ZCLH 3ARDC 2MSPA 3BZFB 2VLJB 4PGCA 2BVPA 2UWEE 1CIUA 1GCFA 1DN0A 4PJHE 1BBDH 2ZKHL 4JB9H 3V4UH 4UQ3B 3GMQB 1AO7B 1MCPL 3GJFB 1Q0XH 3AC0A 4H25A 3W9EB 4UV4H 4H8WH 4M5YL 1QR4A 1U3JA 1UCBL 4JHWH 2J8OA 3ARFC 3QXWA 1ZT1B 4OZFG 2D9CA 4YEFA 2ADGB 1RY7B 3L3OB 3MUGA 5DRZB 4JY6B 1S9VA 4EUPG 1ORSB 1CCZA 1EFXB 2G9HB 5IBTL 4HUMB 3I75A 3BKYL 1QFWL 1GPOL 3I6LE 1FNSL 3WHE0 4HBQA 2CKBL 3BSZH 2A0LD 4RMVA 1I7UB 3V95A 4JDZA 3TH2T 3WXVH 1H8SA 4HPYH 2HFGH 5IMKA 5E4IA 3GIZH 3CDYA 4PJ8C 3WS6A 1BQLH 4QLRA 4R3SA 5E2UH 3QDAA 4R26L 5IMLA 2AVGA 3IDNA 5DUPH 4L3CB 3KR3H 4PRAB 4HHAB 3RY5A 1MRCH 3QDGB 5LBSL 3IFLL 3RWHB 2VXQH 5F7DB 3QDJE 3E1F1 2CR3A 4Y1AB 5HDBF 3RPIB 4X5WB 4U7KA 5DD0H 1NGQH 1X5FA 4PGZA 5DRXB 3ILQC 2OK0H 3OSKA 2YD2A 3LH2H 5JXEC 3CIQA 3FN9A 3QBTB 4YEEA 2VR9A 4DKFL 4YUEL 3LQAH 2F74B 4R90L 3O3DB 3QXAA 2XN9A 3ARBD 3VXMD 1HHIA 1WBZB 4L8SC 5BW7C 4X7SL 1PVHA 1RFDH 2VLRD 3N1MC 3SDDC 4LAQL 1CXLA 3LN9A 2FR4A 5HVFB 1O0VA 3JV5A 4ZNEE 1RIVL 3T1FA 1OP5H 3MROA 1PD6A 2XN9E 2DD8H 4HS8L 4H5SB 3VU2A 2L7UA 3MUJA 4PRID 3U1SL 4HIIA 5DI8B 1MHHA 5DMKA 4KJPC 3V6FA 3QO1B 5C9KA 4JFED 4G8GA 1ZT4A 3MCLH 1U92A 3I50L 2EIZA 5HGDA 2NW2B 3MV8B 1V05A 3OX8A 2B2XH 1DVFC 2JIXB 1UB6A 4EXKA 4I48A 1LO0L 1SJVA 4JN2A 4OD1L 2DWDB 2NY5C 5EB9A 1JRHL 3MFGB 3U4BH 4ZAKC 1EEUA 3KPSD 3MLXH 3MNWB 1MIML 3EYVB 1HYSC 3KLHD 2FL5B 2DIAA 4JJ5A 4L4VA 5E99L 5IROA 5DFWH 2NY4B 1T89A 3SN6N 1EHNA 1F4WL 3QHZH 3KDMB 1HZHH 3D1MC 3MNZB 4PREB 5F3HB 4OF6A 4XCEB 4K8RL 1KEMH 5T1KB 1RPQA 5HYFA 1MFAL 1UKSA 1RD6A 4P2QA 4F7TB 4J8RA 4C56D 1RZKL 1ZANL 5AYUH 4OGXL 2XNAA 5H94B 1TCRA 4BSVB 4XVTL 1F13A 4HF5L 1FNLA 4NO3B 4NZRL 2X4TB 4ZYKA 4PD4J 4JKKA 1JPGA 3HI5L 1KJMB 4FFWD 4HK3J 3SKNB 2X4RA 1FFPB 3F7VB 3QIWD 5I1GH 4MXVE 3KAAA 5E8EA 3ARPA 1OAKH 2A9ML 4KK8D 2CJUL 1V7NL 1GHFH 4A6YH 3OKDB 4TTDD 1DQJB 5JPMB 3RIAK 1ZLSL 4G6MH 1LILA 3JUYA 3O2VL 5HYQB 3JV6A 4MNQA 5BRZE 2MOVA 4NKIH 3KJ6H 2VSDA 4AIOA 3WNOA 4TVSa 5CJOL 2EXWD 2VLLB 3D25A 1OGAA 1NLBL 4I18C 4P9MH 2M1KA 3HUJF 1MCCA 3ZL4H 1B0GA 1X4ZA 2DQHL 1S7UA 3CUPA 5BMFL 5IKCA 3MACL 1HIMH 4R4FL 1KV3A 3IKKA 4YBHA 5DJDA 5BVJB 2IGFL 2A73A 35C8L 3MBEA 1MJUL 1INDL 2EDTA 3LMJH 1EAPA 3F58L 3H0TA 3KPPA 4OZHE 1GSMA 1MLCB 1VFUA 3DX9A 3MC0A 3SDAC 1XGUB 4ZD3L 4DN4L 3PWJA 4ZDHB 1P4BL 4QT5A 3KYKL 5E00B 3BH9B 1K4CA 1T21A 3HPLA 4U1MB 2IFFL 2Z31A 5C07B 1BM3H 4P5MA 5T1DL 4EEEA 3ZKSD 2VDNH 4NO5A 5D8JL 1ZLVK 1FFRA 1F6AA 3D48R 3PF2A 2E8ZA 1LP9B 2W91A 1QLRB 5T1LB 1OSZA 3AS1A 4RCAA 1KJ2A 1FDLH 4BSWB 3GK8L 1A5FL 1YMMB 2GJ6E 4EIGB 5FM8A 2YEZB 3UJTH 1XF4A 3UTTE 3IYLW 3O8XB 3T2PA 3MV9E 4OQ1A 1FLTX 1V3KA 1CR9L 3QUXA 3RUGF 4JZOB 1IM9B 5TDNB 5ICYB 3L5WA 1DEDA 1CGSL 1XGYH 3BWAB 3LV3B 5FYKU 4XPAH 3CFDB 2QQKH 2ATKB 4TSAL 1J12A 5FKPA 4M5ZL 3B6SA 3I6GB 3T2QA 3P9WB 3FQWA 3VFWB 2NY6B 4X4YB 4AEIH 1MAKA 3FO0L 1YA5A 3D0VB 2NZIA 3JV0A 4OZGF 3L3KB 1TQBB 4Y4KB 4M6OL 4PY8J 1N0XL 4WU7A 5A2LH 4Z95L 3U7WH 2WAHA 1YEGH 4OKVB 8FABB 4XNUL 1G9MH 4DKDC 2PR4L 4MB5A 4WTWA 4HUVA 1AQDB 5IK3B 1U8MA 5E9DE 4P23C 2E9WA 5KSVB 5JW4M 1S7VB 1RJCA 4YXHL 3ET9F 5CILH 1HINH 4I9WD 5JOFA 2V5TA 2P24A 2YD1A 2CDFB 1V7MH 1JTOA 4P46D 5F7NC 3V5DA 4RGNE 5ACMA 3TVMA 1WZKA 3HNSH 4B53A 4KKCC 3HG1A 2V5SA 5KSBA 3EBAA 1YPZB 2ATPA 4BFIB 1NAML 2W9LA 4JDVB 2BY1A 2VTFA 5KSAA 4GXUM 3RPKA 2AXJA 3HR5B 1JZ2A 5DFVC 3SBWA 1FL5B 4OV6F 1FZKB 5D1QA 1GRWA 3HZKB 4PTUA 4V1DB 4JQIL 3ULUC 2X9XA 3IETA 3QA3B 2B8OT 2MWCA 5T1MA 5GS0L 5IHLB 5DF0A 1DLFH 1MCEA 4CU8A 2D4FA 3EDKA 4G5ZL 4RGOL 3DI3B 2HFFA 2DLFH 3IDXL 3DI2B 2JJVA 3VRJB 4RWYH 1OTSD 2Z4QB 4AIXA 1QFOA 3VG0H 3RVTC 4ONFL 3DMMA 5T5FH 1FL6A 5CLTA 3GRWA 5EPMB 4OF8A 1KPRB 2YK1L 3FOMA 3L3GA 4NNYB 4LSPL 3S34H 4XBPA 4XNQA 1ADQH 1YEHL 1K3ZA 4OF0A 4LSDA 4BH7B 1E6OL 2NYYD 4Y8DC 3UROR 1L7IL 1GH7A 3OB8A 1CGVA 1Q72L 3P11H 1ZWIB 3WFCL 1PLGH 4TOYL 4D9RD 2YXMA 3MGOB 4A6YB 3CU7A 4G3YH 1JV5A 3OV6A 4FFVD 4LDEB 1N3NB 3MREA 5C09D 4P4KB 1UT9A 5IGXH 4YXKL 4ZOCA 4G9DA 2G75B 4XNMA 5MEOA 5DJ6A 3EOBA 4KY1L 3W0WA 2NMSA 3L7EA 4XPGL 3WEXA 1NAKH 5F9WC 4O51B 1ZA6B 4FQLL 3S96B 2XPGA 4IBLT 3WFHB 4FA8A 1TJIL 2R0KH 4DQOL 3FTGB 3R0MA 1LEIB 4Q9QL 3U79A 4WV1B 5MEPB 2HJFB 4K94L 4JKLA 5D1ZC 3GBLA 3GHBH 3CMOH 2ADFL 4UT6L 5HI4D 2K1MA 1S8DA 3SQOH 3QHTC 4KQ3H 2EE9A 2DL2A 1SMOA 2PCPA 4S2SB 2DBLL 3BZDA 3N06B 3VFNB 3ZDZF 2DI9A 1A14H 4DVRH 2VZ3A 3CXHK 4GUPB 3BO8A 2DQGL 5L2KD 2ZCHL 3BVNB 3BAEL 3L3IA 2F54E 2IAMA 2JF1A 4NQED 5CZXD 4OKDA 2VXUL 4X98B 3C5ZA 5IVZB 2L7JA 3QWQB 1ETZA 3O4LB 4X6DB 4QF1A 2BXZA 2B20A 4YHLH 5E8OB 1JNNH 5CINL 1CVSC 2APVA 3R4DA 3O3EB 4HIXL 2VDLL 1OPGH 4X9FA 1X5GA 1TJGH 4Z0BL 4TUKH 3HNTL 1NGWB 3U30C 2YSSB 4QOKD 4YDJA 5CP7B 4CN6A 3FT3A 2NXYD 3K8KA 5E94B 2ICCA 1WSST 4Y4HA 5IB1B 4TVPD 2NY7L 1RIHL 4XGZB 4Y4FA 1TQCB 4L3EB 3DIFA 3LKOA 1BMGA 5FCUL 5FUCE 5HYJB 1PW3A 1T66D 4FFZH 1F4YH 4X7CC 2HFEA 2DYPB 4M48H 1WFNA 5HVWA 4RA3A 4JZJA 1N0LA 1FN4B 1VFAB 3GSNA 3CFBB 1P5UA 3MYZA 5DEFB 5IOPA 1CICB 2UZIH 2WBWB 3TT1H 5ILTL 4RQQA 3STLA 1SQ2N 3ELAT 2ICEB 4L8DB 3CFJA 5B39G 4Q0XH 2P48B 2ICWI 1I85A 5FGCE 4JRYA 3I3EA 3CZFB 3VFMA 5HGHB 4WW2B 5E08H 1H3VA 2B1HH 2B1AL 5J1TC 4XTRD 5T33H 2OQJA 3EGSB 3P4OB 2XQYK 2XI9A 3TBVB 4HK0A 5CGMA 4EN3A 1ZT7A 5GRUL 5DD5H 2GJJA 3S36L 1TVBB 5ISZD 4NJ9L 3GSRA 3QNYB 2FO1A 1KUMA 5I1KH 1KIRB 5JUEL 1RMFL 4N90D 5IB3B 4YHPB 1J0JA 1EEZB 3ULVE 4WHYH 1MIEL 4MJ5A 3MLPA 3KPQA 3PDGA 4IRSD 1TDQA 2AJZA 5HHMB 2QADD 3TN0D 1N6QL 3BIKA 1IC1A 5HHNB 1IARB 1GC1L 2JJTC 1JF6A 3E3QE 3AFLA 2GUOA 3DUUA 4JM4H 5EZIH 4JPWH 4YUEH 5KN5A 1D6EB 2EXYC 1ORQA 2KQNA 2COQA 3C6SB 4P57A 3GNML 1P9MC 1CXFA 1PX3A 2VDKH 3MRFA 3UYRH 4QHKJ 1MFEL 2IPTH 4F9LA 3B9KC 1OB1A 5E5MB 1AGBB 1XF3B 5TPWL 1JNJA 5GIRB 5GS1A 1T89C 2AK1H 5GGTH 1II4E 4QNPF 2RHEA 3RWJB 2APTA 1X5IA 3MUY1 2R23A 4FXKA 2ADJB 4OLVL 5D70H 5FAAA 4XCNB 3E6HB 2AAVA 2QV2A 1N5YH 1OHQA 2NY2C 3VD7A 2DI8A 1B88A 2ZUUA 2YPVH 1GGCL 1EEYA 4KDWA 4NQEB 3I50H 1JJUA 4JFYB 1VFBA 3PWPB 4WCYL 3FFDB 3ARQA 5GRVL 1W72A 4LLVA 1LO0H 3AMKA 4PJBE 4YDKH 3G5VB 4I0PB 2CMRH 3L9RB 1NCUA 4OCMC 4XPFL 4EI5B 4ONHA 4WI8A 3O41B 2GJZB 3MLZL 1JZ4A 3KPLB 1QFWI 1T04B 3E2HB 1NMCC 3ALXA 1BEYH 1KACB 5JOPE 5A2JH 4JFZL 5IWLA 4NUJA 5I76B 2OM5A 4XNZB 4P4RA 1D5ZA 3GO1H 2CK0H 3QWRA 1F4WH 1FV1B 1T03H 2WIIA 3VDCA 3O6FB 5ACZA 1U6AH 2E5EA 4ONOA 4U2YA 2IF7A 1P69B 3MV7B 2CRIA 4U1IA 2K9UA 5FM5M 3VGEA 4EDWL 4XVTH 1H3UA 4WY7H 4Y2OA 1J10A 1VPOL 2IG2L 3EHBD 4U31A 3TO4A 4L8CA 5C08D 1I8IA 5DEGA 1JK8B 4P5TC 3T77B 5DUBA 4C59B 1IEAA 2EDBA 2L0DA 4NNXB 1U8JA 5DJ0A 1TZIB 1K6QL 3QRGL 1KOAA 3BT2L 2IWGA 1FLRH 1BZ7B 4HDIA 3QDME 5I1IL 3GMLA 1MAMH 1HQRB 2AEPH 3WLBB 1AFVL 3WUZA 4LSUH 2MCPL 4ODHL 2Q76A 2KKQA 32C2B 2W0FB 1GXEA 3VD4A 1NCBL 4LSTH 1PFCA 3ARXA 1QD0A 1KIQB 4HUXA 5ECJE 3SHSA 4O5LL 5DVLA 5EU4A 2ESVB 2P44B 5BMFH 5I1CH 1XCTB 4LLAA 4R4FH 1IGFL 1OGTB 2F58H 4EDXB 3P73A 5I16A 2BSED 4KV5F 5D5MA 3RTQD 4F8TA 2P5WE 1INDH 3VXSE 5EFIB 1Z0MA 4RISL 3T4AA 2DB8A 3RKPA 4HKXA 3B3IA 4NCC2 4QCIB 3H9SA 1WWWX 2HN7B 4ZD3H 4QHUB 4DN4H 3VJ6A 1JRHI 3W11C 3UTSD 2FIKA 1XH3B 4KROD 3LQZB 5F7EL 3QT2A 4OCXL 4HUUB 2HJKA 4MSWB 4WNQB 1UFUA 2D2OA 4HKBB 3H9SE 3B5TA 1AXSA 4PJ7B 3LKSA 4ZNCD 1EJOH 1MY7A 3P30L 3DXAE 3SOBL 4Q74A 5DMGC 4MAYA 1R24A 3VWKC 4RX4D 4PJ9D 4NRZA 4GKSB 1I3UA 1RK1A 1FFOB 3C5SA 4G9FA 1YY8B 1FYHB 5JXAL 4N8VA 1ED3B 4NZJA 4KTDH 5INDA 3RGHA 3BPOC 2H6PA 3MJ8B 5FDWA 6FABH 3RI5K 2NY3C 4TSAH 4UI2A 4G42B 1MREH 4KAQH 4PV8A 4QHKI 1T1WB 2V2XA 3C6LC 4Z5RB 2VDML 3S4SB 2UY6A 5F6HJ 3LRHA 3EYOB 3HZMA 5KSAC 2EDWA 1UWXH 4OQTH 3SBWC 2NY1B 3D85A 5D1QC 3S3JA 1U8OA 2PTTB 4W4OC 4Q9RL 2NZ9D 4WFHD 5T3XD 4EIZC 4Z95H 4GFTB 5I1JL 3WXWL 5LXGL 3OB0K 2R56L 4MD0A 2HVJB 5ERWB 3WS3B 1MSPA 3X3FL 2P46B 4ORGA 4PJGF 5CJXC 5E2WH 4FQ1H 4S1QL 4L4TB 1A3QA 4K3JL 3V7AG 4X9HA 2VIRB 3NA9H 1HI6B 3RWFB 4PLNC 2PTUA 1EUUA 3DMMC 1ZE3C 3MYJB 2QSTA 3LRSB 5EOCJ 3CH1A 4PJ5B 5ESQA 1WC7B 3VFUB 3D39B 1JIBA 1OM3L 1D5IH 1C12A 4LEOA 5SWSA 4X7TB 3NCYP 4R2GD 1I7TA 4YWGL 4KRMB 1CFNA 3KPNB 4U1GB 3IXTB 5IW3A 1NEZA 1DCLA 5DQDH 3OAUL 4NKDA 2WQ8A 1G9NH 1DUZA 4Q2ZB 5SWSE 5JORB 3C2AH 1BAFL 3QWOB 1KLGB 1LE5B 1UJTA 4PGBB 1J18A 2AJSL 1UWGL 3VXTB 3I02B 4Q6IA 3CSGA 4G5ZH 4IOSD 3QUKA 4XHJD 2GTWA 5DRNA 2X4PB 4LVHB 3SDCA 4MZ2A 4FQPA 3FQTA 4DUWA 5GSRB 3VH8G 5FM5O 2YN3A 5JMRA 5JLZA 5CP3H 1JGDA 4Z78B 4LSPH 4K7PH 4LHUG 4OLZL 4RGMC 1IC4H 4NQXB 4H20H 3BWUC 2I5YL 3JTTA 2OP4L 4M1CD 4RRPG 1L7TH 2BERA 5C9JA 4FMFA 3BJ91 5CAYB 4PLOB 5IFHL 2C7UB 5C0BA 5KVFH 1PZ5B 1W8OA 5FV2A 1A3RL 1AHWA 5ICXA 5DC9B 2JKXA 1NBZA 5FF6B 3HRPA 5E8PB 2IAMC 3HZYB 3FL7A 3TZVA 3P0VL 4XP9H 4JRXD 1T5XB 3VXRD 5HHPA 1M4KA 4R4BA 2NX5D 1SBSH 5ITBH 3LN4B 4E42A 1CDGA 1S7QA 1TJIH 4I77H 1EA9C 2ORBL 3P77B 4NQSB 4DWHA 4DQOH 2R2BB 2HT2C 1ND0B 1S9WA 5BZWB 4JFHE 2VAAA 3VWJB 2O5YH 1F3JB 1CT8B 1BQHB 5FUCC 4YHOL 3T08A 5GS3A 4LSQL 4WU5A 4F37K 5DA4A 2R0LL 4PJXA 2ENYA 3TJHD 5C0CD 1VHPA 4QRQA 2OSLA 5TFSH 3NIFE 2GITB 4NWTH 3WSQL 3LD8C 1BOGA 3QDHA 5GZND 4LLYB 2AV7A 2G2RA 4DGYH 4OIIL 1OY3B 2JCCA 3BAEH 4Y5XB 1FGNH 5DRWA 1BJ1H 3HB3D 3HCVA 4QHLA 1JHLL 1IM3A 2A77H 1UVQB 4IOFD 2D0FA 2FX9H 3NIGE 4ETQA 3G04B 4FQQB 4M6ML 5CINH 3BZEB 3QI9A 2N56A 3PP3K 4G43B 2A6JB 2VRAA 5M94B 4U1SA 4Z0BH 5HHQB 3MA7B 4PJEA 4L5FH 4UAOC 3LAFA 1J1OH 1A7OL 4ORZC 1F11B 1HH9A 3OKEA 1K8IB 5GRWA 3ULVC 3TEUA 4KK5D 3O45A 2NY7H 4ELMB 4EN3C 3V0WL 4PJEE 3EDDA 4QRPD 3RRQA 3BDBA 5FCUH 5IM7A 3OKOA 3JWOH 1KC5L 4LCWD 1R3HB 2IALA 2UVEA 4M3JA 1FYTA 3OR6A 1Q38A 3KXFD 3QXDA 2MTPA 4NN6B 3U4AA 3K4ZA 1VEMA 2YRPA 4GRLA 4OB5L 3G6AA 1KPVA 4RAUB 3WIHL 3Q6FA 3E3QC 4DN3H 1B4JH 4GAYB 5IVXF 3ZYZA 5AZ2L 4E41D 1N8ZA 4NQVB 3TA3D 5DJYB 4HS6A 5DK0B 1D9KB 4X5XA 2J6EH 4P2OC 5E03A 2VJXA 3VW3L 2PO6A 3PHQA 3VXQA 2DJSA 3UC0H 2XWJB 2IBGA 1FC1A 3V4VL 3ZE1F 1XF2A 2X70B 4JFDD 5C0AE 2O61B 4OTXL 3BZFA 4DZBA 4MQXC 4LLWA 2VLJA 2WBJD 5I30H 5M7QA 3FQNB 1KGCD 4MHHI 3VFTA 2H3NB 1FNEA 1GGTA 4H88H 4PBWD 1MFNA 4HKZB 1A6VL 4DUVA 4UQ3A 5JW5A 3BPNB 3DUSA 4KJYA 2ZUVA 4FZEL 4XZUA 3V52H 4F9LC 3HRZB 3RDTB 2RGSA 4BQ9A 1OQOA 2H8PB 4O4YH 5GS1C 4FP8H 3QUZB 4OBRA 1H5BC 4K9EC 1NCDL 3JWNC 5J57B 4HLZH 3MRJB 2AJ3A 1A7RL 3EOAA 5BO1H 5DLMH 1E4KC 1ORSA 2D7PA 1G6VK 1XIWD 4XMLL 5H35B 1EFXA 5MERA 2G9HA 1N6QH 1U8HA 4G8IB 4XC3L 1S5HB 1RUQL 3QQ9D 5JHLH 2Y25A 5SWZD 4YGAB 3CXHJ 1MCLA 3UYOD 3VRIA 5FYKD 2DQFB 2D7TH 1AI1H 1JGUH 3B2VH 1NFIB 4MJIE 2RCSL 3BGFC 3G6JB 4JKPH 5JIKA 4HWEH 1MFEH 4G6JL 3Q3GB 5CEZE 3RGVB 4BK5A 2VDPH 5E2TL 5KW9H 1OQXA 1QFWM 4L3CA 4R7NA 4PRAA 4HHAA 1YYML 4QXGH 3QDGA 4E9LA 3C08H 2EYTA 3ZLQC 3BP6B 5F7DA 1G0XA 1HHJA 3T0ED 5HGAB 4Y1AA 3VGDA 4CU7A 2V9RA 4X5WA 5T5NF 4KFZC 5D7KE 2C4FT 3TC9A 3FOLA 3QO0B 4J1UA 5FA3B 4DOHB 4WUKL 1AKJB 2BNUA 4PRPB 4WCYH 4PJDF 5GGSA 1IEBB 1WITA 1KCRH 4ERSH 5HHOA 5IT2H 3STZA 1JE6A 1OP3H 2H26B 4GQPH 3MLZH 2CRMA 4Y16C 4JO3H 3HC3L 2F53B 5J06A 2EH8L 2HTKC 1NC4A 1DN2A 3BESR 5SV3A 4U6TA 4AENB 5ID1B 1UACH 2VXVH 3EYSH 1P2CB 5MP6H 3HE6A 5HHOE 4OCSH 5DI8A 1HKFA 4O02H 5JOEA 4LHUD 2Y36L 4PS4L 1CFSB 4P9HH 3CX5K 4NKOA 2BHZA 1K4DA 3MLVL 4OM0L 3VXUA 4U6YB 4JFFE 5KSUA 3LKPB 2AABL 2ARJQ 2NW2A 3V5KA 4RNRB 3T8XB 3R0NA 2VLME 3IJYB 4YFEA 2X05A 2Y07H 1UZ6F 3DGGB 4YR6B 3WMSA 3U2SB 3TA3B 4NZUL 4OLXL 3VXUE 4ZS7H 1M7XA 2N4IA 1JGEB 5TF0A 4PJAE 4WHDA 1QBAA 3W81A 3CLEL 4J3TA 2EH7L 1CE6A 4JG1L 4PJIE 4LPTA 1P5VA 1OWWA 3KDMA 2AV1B 4XVUD 1YN7B 4E0RB 4LIQL 2Z8SA 2CSPA 2ZCKL 1I1FB 2BNQD 4XCEA 5T3ZD 2AJYL 4MCYB 3P9LA 1FJ1A 5DD1H 1KCSH 2IH3B 5AAMA 1NDMA 1RULH 2MJWA 4MAYC 2UZXB 3PL6D 3RHWF 2J88L 2EC9T 4NO3A 4M8QA 3GM8A 1IGFH 2RFXB 1EHLH 3QQ4B 5J11C 1OAUH 1PEZA 4LCIL 3SKNA 3AXLB 3UZQA 3S35X 3VMPA 3BP5A 4RISH 2V6HA 4GLRH 5D71H 5DSCB 2H32H 1R3JA 4AIZA 2IANE 2Z9TA 3CD4A 2EEBA 5I1HL 1N2RB 2VISA 3JTSB 5INCB 2X09A 4OCXH 4NN7C 4X6FA 5TQ0L 5TQ2H 2VLLA 1JF1B 3H9ZA 1A1NB 1LEKB 3ARFD 4Z9KB 3P30H 2R8SL 1IVLA 3DECA 4KHXL 4UINL 3WO3B 4GT7A 3T65B 5DD3L 3PQYD 4IIQC 5K93A 4BUGA 1M1SA 4IM8A 4QRRD 3QG6B 4HBCL 5JXAH 5JPNB 4DVBA 2BRQA 1HXMA 4AEHH 5TH2B 3HC0B 1RVFH 4NHCL 1A7NL 1XGUA 4YHKL 1H15A 1G84A 2VZUA 2JK5B 4YHIB 4U3HA 3KYMA 4OIAA 4N0UB 5IMMB 4U1MA 3ARBA 4HPOL 3VXMA 3LHPL 1JPTL 5EC2B 2VL5A 4NHUA 5ANME 5BS0B 5CBAB 3DVIA 1NCCL 4XNXH 2DQDL 1HSAB 5GGVH 1WFUA 3S88L 2WW8A 5T1LA 1IKFH 1QLRA 4Q9RH 3SE9H 1N5AB 2CLZA 3MLUL 1NMBL 4NDMB 2YEZA 1RZFH 5DMIH 3E6FB 3ES6B 4U49A 3VXME 4ZSOA 1NCWH 2R56H 1TNMA 3O8XA 4Q6IC 2AJVL 5LGJB 3QUYB 1X9QA 2VLRE 2WM0A 3P4LA 1IM9A 4JG0H 4NUGL 4JFPB 4P2CG 3CNKA 1PQZA 4UDTB 4YBLC 3IDYB 1Z9OA 3MXVH 3VFWA 4ZSOE 3UBXI 4DEPC 4X4YA 3HAEA 4UOJA 3SDDD 2NW3B 1MJ7L 2HWZL 2AXGB 4PRIE 3D0VA 5IBLC 1BVLA 1EERB 5IHUH 2H9GB 3LS4H 2O5ZH 5IESL 4Y4KA 5FYJL 1D5MB 4JFEE 2Y7QB 1KB5H 3KPSA 4A2LA 3IXAB 3DGCR 3D0LB 4OKVA 1BD2D 8FABA 4FFYL 5HDQL 3ZT6A 4KJPD 4NO0B 1AQDA 5CGYD 5IK3A 5JQ6L 5KAQF 2ZNXA 4I4WB 4YC2B 3D18B 3MGTB 5KSVA 4GKZA 3JSSA 3K4AA 2CXGA 3V4PL 4CMMB 2DL9A 2QR0A 4S1RL 1DVFD 1NBYA 3SDXA 5CD3B 2YN5A 4XPBL 5DJXA 4MX7B 3IJHB 4JLRB 5F9JB 1AQKH 4C56A 2VABA 4ZAKD 2H41A 2OX5A 4FQ2L 4F3FA 3G9VA 1XCQB 3PL6B 5D93B 4NT6B 3TV3H 4AY0A 5A2KH 5BZDA 2G60L 2VLKE 4Z7WF 2X7LA 1FL5A 5D7LB 3P9MB 4J23A 5GZOC 3ARDB 3QIWA 3AY4C 2VAJA 4DZ8B 1H3PL 5CZVL 5IJKC 5C0IA 1EEQA 3M8OH 1YYLL 1AXTH 4MDJB 1ZHLB 3QA3A 4JCLA 2Z35B 3ISWA 1HDMA 2BOCB 3EO1A 4GMTH 5L9DL 1FRGL 1KJ2L 1MPAH 2P49B 3K8LA 4X6EB 2FX7H 1RZIB 4K3GA 3ARFB 3I2CL 3PGDA 3X14A 4QHMB 1Q0YH 1C1EL 4NNYA 3DYMA 5EU3B 4Q7DA 4HWBH 5EZLA 4BH7A 4YHOH 5I15L 4LSQH 2DTML 2YUZA 2ZSVB 3PQYB 2AK4E 5GHWH 1ZWIA 1TVDA 2C4XA 3KYOB 3MGOA 4R6UA 3K2UL 2H32B 2P5ED 3EO9L 4XXDB 3X12A 4ZG1A 3H7BB 1EGJA 2HJLA 4HZAA 1F3RB 3DX6A 3QUML 3GSOB 3VFVA 2Z91A 2Z93A 2Y6SD 2VC2L 1G0YR 2P8PB 4PJ8B 4OIIH 4GRLC 2A83B 1FVCB 4O51A 5I75B 3LOWA 4FTVE 3FHAA 3WFHA 3HE7D 1LMKA 3RKDD 4LDLB 2EKSA 3L3JA 4WIQA 5D7IF 1LEIA 1NFDF 4YHNB 4WV1A 5MEPA 1P7QB 5A2FA 1YUHB 1ZHKB 2EDOA 4MA8H 1MUJB 1HXYA 3SDAD 2AEWA 1GZQB 3RY6A 5DK2A 5E5RB 3V0VB 2FGZA 2JELL 4G7VL 4XI5C 4UILH 5MHSD 3AROA 5E1AA 1I1AD 1FFQA 3VFNA 4OZIB 2BSTA 3L5JA 4L8SB 3LPGA 2EEDA 1M6OA 3SDDB 4OZFA 1RIUL 2DMKA 2MFNA 4GAGL 3BFOA 4OSUH 4IEFB 3IU3B 1VKXB 4HAGA 4L9LB 4JM2D 4X6DA 4XP6H 4JDTL 4CMHC 4P2RD 1MCKA 5AZ2H 4OUUB 4RAVA 3FONB 1XF5B 3SPVA 5D72L 5DFTA 4C58B 3RVVD 1KIUA 1CFVL 4HXAL 1H8OA 1UYWH 2VKWA 1CD8A 5EBWA 2XTLA 2FDBP 4LVOC 3PWUB 3V4VH 1AXIB 4JPIA 5DHXB 1H0DB 2MNUA 1FPTH 1BVKB 1CU4L 1FZOB 3QEQD 1EUTA 1P84K 2QQLL 4XGZA 3REWB 4NQCB 2AW2A 5CUSL 2FJGB 4EBQL 3VDBA 1M71A 1OT1A 3QIUB 3RL2B 1KB5B 1T5WB 2MPAL 4LRIA 2XICA 2XWBB 1U8QA 2NXZD 1VFAA 1KT2A 5H2BB 4XMKL 3RWDB 2HVKA 2V5YA 3TNMB 5DXWA 3U6RB 5C2UB 5MENB 5I1DB 1AD0A 5LQBL 1EMTH 3PDOB 1C5DB 3ULUH 2ICEA 3KPOB 5F9DC 2CO6B 2J7LA 5DJ2B 4GW1A 4IRZL 5HGHA 4Z7VE 1RUQH 2R69L 4KK6C 4WFED 2W60A 3P4OA 3NCJL 3AREC 5J6HB 2DDQH 2Q8BH 1UJ3A 3TBVA 1HILA 3ZKMC 3KPMA 3MRMB 3CU1A 3QNYA 3SGKC 3UAJD 5FUZL 3OGCB 1KIRA 1CFTB 1DE4A 1LO4L 5IB3A 4YHPA 1EEZA 5FGSA 1CF8L 2NY0C 5IUSA 4KJWD 1VFMA 2X1OA 5C09A 3IU4L 4H26B 5EUOE 3P4MA 1YQ2A 5GS2H 2FECL 4Z18A 5LG1A 3RVTD 4I18B 1Q9KB 5HHNA 3L1OH 4HD9A 4D9RE 3QEGL 5HI3D 4DW2L 1EO8L 2YMXH 1BX2B 5EA0H 3MRGB 1UQSB 1DQDH 1SVZA 4UBDC 4WO4C 1ADQA 1D6EA 5BV7L 1BFOB 2Z0BA 3IRZA 1F3DJ 1UH4A 5E2VL 1GGIL 2R2EB 5GQBA 4QRTB 5EUKB 4HV8B 3QIBB 3GMPB 4QWWC 2X41A 5E5MA 1AGBA 1FORH 3TYFB 3SDAB 3VI4E 1DBJH 1A8JH 4HJJL 1U8LB 3DLQR 4ZOAA 4DGIL 3RWJA 5ITFA 3VGBA 2F5BH 4BSJA 1MVFA 4PP2B 1QSFB 5FO8B 4JQVA 5FO9B 5AD0A 3GSNL 1C16A 5DC4B 4NQEA 2E27L 4JFYA 5F7UA 4U7MA 4UIKL 1QEWA 3FFDA 1X3DA 3G5VA 4RBPK 4R96A 3T0DA 2D3VA 3S7GA 4MD5A 5L2KE 3ZE2F 3BGMA 2GJZA 4Y2DD 1T04A 4XXCA 4KDTC 4MCZA 4QOKA 1WAAA 4ZPVB 2FB4L 4D0CA 5EBMB 3S3SA 1WEJH 4HIJB 3I85A 3H3PH 3KHQA 4Y19B 2ZCKH 3O6FA 2DIJA 3RIFK 2H1PL 5L8KB 3MV7A 4QOKE 3I6LD 1A6ZB 3K80A 3MJ6A 1E28B 3Q6GH 3GI8H 5C6WH 4TVPE 2C3VB 1ZTXL 4P23B 1AGFB 4PTTA 4QEGA 4GW4A 3MRQA 2MQCA 3Q5TA 5GGQH 3KGRA 3HS0A 4IRJD 2HLFD 5DS8A 4HXBH 3NCCB 3IDGB 3SDYH 1UENA 1TZIA 2W65A 4PJFE 2E9JA 4Z7WB 4TPRH 3GSWA 2XZQL 1DBAH 3TWCH 2WUBL 1U8KA 5KVGH 2KL6A 3ARBC 1HQRA 3BX7C 2IADB 1JWUA 4BUHA 1RZ7H 4WUUE 5I1AA 32C2A 2W0FA 3N85L 3WNNA 5ISZA 4KRLB 4MD4B 4K9EL 1KTDA 3IGAB 3TCXA 4EKXA 2ESVA 4MWFB 2JJSA 3TBTB 2CGRL 2N7BA 1IKNA 4EDXA 1HOCB 4N5EC 1RJZA 4HUNB 4U1NB 3MRDB 4GRWE 1I1CA 5ISZE 5DUMH 3LEYH 1UZ8B 3SGEH 4AH2B 4UU9B 2IEPA 2UYLB 4ZUVA 3BI9X 3TN0A 1SJXA 1W72L 1A7NH 4QHUA 2DM7A 3BKCL 3MR9B 3FO1B 3QAZC 3QJHB 4JO1L 3CX5J 4JE4B 1N59A 1XH3A 5TE4L 2DQTL 2XQBL 4RFEA 3REVA 5C6TL 4R0LB 5IVNA 4HPOH 1W0YT 3GBNL 3L3HB 2PYEB 1NGYB 4HMDA 4PJ7A 2AQ1A 3KLHC 3F5WA 3NCMA 1FIGL 5EIIB 3UTZB 5I8KL 2W92A 4G6FB 3EOYG 1NMAL 3NBNA 1N7MH 1QLEH 3WNKA 3OXRB 3EYFB 1CQYA 2XWTA 4FABH 5KJRL 1WT5A 1LD9B 2R0ZL 2W07A 2AJVH 2D03L 3RAJL 4AM0A 1NFDB 1ED3A 2PF6A 3MJ8A 3GKWH 4G42A 5FUOL 1JZ7A 4ODVH 3BEVA 5FKAB 2FEEL 4Z5RA 4ZOEA 3K3QA 5D1ZB 2CR6A 3FN0H 4M62H 5F1KC 2QKIA 2AJXL 4L8BB 4PJHB 3EYOA 5IEKB 3S5LB 4K8RD 5F21B 1ZLWH 4KQ4L 4XCCH 3B9KD 5KSBF 2V5RA 4MHHG 3D69A 1WISA 2VDQH 2YD5A 4FFWC 5IESH 3W39A 2IH1A 3QIWC 4PGCB 3BDXA 5EOTB 5ENWB 2XG5A 1WTLA 4OCLC 4TTDC 4J2XA 5ELIA 2R29L 1DQLH 2NY2D 1UADC 2F8XC 3WS3A 1TPXC 3A67L 3ZT5A 3IDJA 3D6GA 3OR7A 1JZ5A 2EXWC 2VIRA 4P48A 1HI6A 3RWFA 3TBSA 5JIHA 2BMKB 2FNBA 3S37H 2P7TA 1H8NA 2BFVH 2H2PC 3LRSA 4ZPTA 5BRZD 1L6ZA 1WC7A 3AAZA 3VD3A 5J1SC 1KCKA 3MFFA 2XZCH 3MUGB 1S9VB 3TNNB 1UEMA 4GG6A 1ZSDA 3MV01 3O3AA 4CNIA 1WIOA 3U30B 1JZ8A 1NGZB 3I75B 5C08A 3KPNA 3OBAA 3B9AA 4F57H 5L8JB 2J8UE 4JY4A 2FATL 3BW9B 4R8WH 1YJDC 1T7YA 2KDGA 1IQDA 4Q2ZA 5D2NA 3QWOA 5IMKB 1MWAH 4PGBA 3QDJB 1SJEA 2AXFA 5C08E 4G8EB 1QR1B 4R3SB 2X1QA 4F7PB 4K7PX 1FRGH 2X4PA 4IDJL 4FQIL 1B0WA 1MRFL 2DF3A 4W6WB 5GSRA 2EIBA 4OGAD 4LMQE 4N0YL 1C1EH 2QTEA 5GGUB 5JW3H 3UYPA 2K3TA 1X5HA 4QO1A 5F9OL 5E5UB 2GJ6D 3RTQA 4YZFF 1KJ3H 1KIPA 2XN9B 3UTTD 4U33A 1T0NB 3MV9D 1PZ5A 2QSCH 3K46A 4JHAL 4X6CA 5DHYA 1U9KA 2FR4B 2BJML 3UTSA 2VC2H 4EXPX 4U3XA 3FB6B 25C8H 5DJ8A 3FB7A 4X83A 4NQSA 4FQCL 5DMKB 5C0EB 3V6FB 1F3JA 3BPCB 3MLYL 4U0RC 4PJ9A 3DOSA 3RZCD 4WTZA 1JNLL 1TZGL 1WK0A 2EIZB 5HGDB 1FZMB 3HMXH 3OX8B 4YFDB 3SCMD 4PG2C 4LQ1A 5E9DD 3W11D 4P46C 4S10A 4I48B 3L5HA 4JN2B 3KPTA 3QPXH 2GITA 2YPLD 4ZUSB 3H42L 1A22B 5BOZG 1F4XH 4UT7L 4RGND 1QFUH 5DMGD 5EWIL 3Q1SL 4ODTL 3CLFH 5EBLA 3OF6D 1JI2A 4UTAL 5HPOA 3D2UD 5FIEA 5L88L 4M93C 3BD4A 4ZTOH 1V3LA 1NBVH 1VGEH 1B4RA 1MCBA 4FQJL 5HHQA 4ZFFB 1R3LA 4J8RB 2NY3D 5F8QC 3JBG7 1ZGLM 3FAXA 4M7ZB 3C6LD 5I9QC 4WFHE 5T3XE 2YUVA 1OTSC 3OG6B 5MI0C 1ZA3A 3IFPA 3BQUD 3GRWH 4BM7A 1DSFL 4ZYKB 1UJ3C 3ROOA 3ARGD 4ELMA 1JPGB 2EE3A 1KG0A 5CUSH 4OQTA 1V8HA 2X4RB 2XV6B 3QP3A 4M7KL 1A7PL 5BOPA 1Z3GL 5E8EB 1R3HA 3VA2C 2HG5B 2NYYC 4FZ8H 4RFOL 2DJUA 1JP5A 2QQNL 1HWHB 2V7NA 5BXFA 4WFGD 5EOCH 3JV6B 4GAYA 3M17B 4MNQB 5AWNL 5D7JD 4QXUL 2K7QA 3RVWD 2Y06H 3EJZD 4NM8H 5B21A 3OKLA 5I8CB 1CTNA 1RSFA 2FZ3A 3D25B 4QY8A 3IAPA 3T0WA 3F7QA 2XWJA 3HC4H 2ZP0T 1S7UB 4OZHB 1UGNA 1RI8A 3CUPB 5IKCB 2O61A 1CE1H 1L9NA 4JO4H 2XY1A 3G5XA 4WI7A 3LPWA 4F80A 4ODXA 5DD6A 2FO4A 2XFXB 5ADPL 2WWKT 3MBEB 2AEIT 4I2XE 2C1PA 3VFGH 4P5TB 1EAPB 5CSZA 3H0TB 3KPPB 2WWMD 2ZG1A 3RDTA 1KCUH 1MNUH 2DM2A 4LP5A 4X0KA 5HI4C 2H8PA 5J12C 3PWJB 4QT5B 2DQJL 2E7LA 2GJ6B 1JYVA 3MRJA 1K4CB 1T21B 2BSSA 3HPLB 1MWAB 1AY1H 4YQXL 2Z31B 3F7PC 4YHMH 4JPKL 4LRNH 2VQ1A 3MV9B 4NO5B 1MFBH 1F6AB 3SO5A 3K81A 1OSZB 4NSKB 4XAWH 1KJ2B 5CZXC 3EFDL 3QCVH 4OGYH 3WUWG 5AG9A 3ZO0A 4KUCF 2R1XA 3VXRA 4LARL 1MI5E 4DW2H 1EO8H 4ODSL 4P3CH 3VXOB 3QUXB 2F54D 3BE1H 3UBXG 1IBGL 1WWBX 3RWGA 4JRXE 5LVEA 3G6JA 5D2LA 4RFNC 5FKPB 4JR9L 4XX1G 3VXRE 4PV9A 3B6SB 1AGEB 1G7HA 2NXYC 2NX5E 2F5AL 4JANA 4MA7L 5C0CA 4OF3A 3MRKA 4BQ6A 3P40A 1WLHA 4GJTB 3CCHA 1JPSH 1G0DA 5C2BL 3ULSA 1T66C 2LAAA 5JO5B 4GW5A 3AB0C 3GSNH 5D7SH 5C0CE 3UJJL 2HT2D 4F58L 3QJFB 2FBJL 4HUVB 1P84J 2DLEA 3VWKB 1YC7A 5DYOA 4PRPA 5LGHH 1U2HA 3N0PB 1R0AH 5L0QC 4X4XA 1IEBA 2WLZA 4WENB 5JA8B 5JOFB 3CPLA 1Q94B 5HJ3B 3AM8C 5EN2B 4DGVH 1J8KA 5DK3A 2FJFB 3O11B 4I0CC 4NC2B 3HG1B 3ABZA 5JW4N 2ATPB 3C6LB 3NTCL 3ULVH 3QPQD 3NACL 4XTRC 5IV2A 1U91B 5I19H 5D1XD 4LL9A 5KSAB 1KTKE 4KI5F 2GTZA 5D1QB 1KBGL 4N8CH 3LKPA 4LCWA 7FABH 4J7RA 2ZUWA 1X5JA 3IJYA 3IETB 1IKNC 5FYJU 2X9WA 5A40E 4GXUN 3GHEH 3U2SA 1UA6H 1RZGA 2FECI 3TA3A 5FFLA 4QRPE 3WN5A 3M07A 1AIFA 1EH9A 3QQ3A 4IRSC 4PUBH 3TT3H 2WBKA 2QADC 3KXFE 3ULVD 1I75A 1IGIL 3DMMB 4XPHL 5D5MF 3SGDI 3FOMB 4JRWA 1QZ1A 2J8UF 4N1HB 4XBPB 4CVZA 4E41E 1LDPH 1YN7A 3BRFA 2FSEA 4LP4A 1I1FA 1A4JB 4RMWA 4AK1A 3U9PL 1NGPL 2OI9C 1INEH 2IH3A 5CMAA 3MREB 1F97A 4JFDE 2AGJL 5D6DA 4K9EH 4P2OD 5GJSH 12E8H 1EXUB 4G9DB 4XNMB 5MEOB 1CLZL 2J6EA 5DJ6B 1WT5C 4QGTA 1KGCE 2CGRH 3EOBB 3ZZ1A 2RFXA 3L7EB 1OAXH 2YA2A 4O58L 1DFBL 4Z7UF 4DKAA 4M1GH 2XPGB 4MQXD 5I18H 5LWYH 1CWVA 4KKNA 4GAJL 4JAMA 5DSCA 3BRDA 3BH8B 4P49A 1W72H 5C0JA 1N2RA 3ZTNL 5I71C 4KK9C 2YKLL 3U7YL 1B9ZA 5ICZB 3EKCA 3LCYA 4RGMB 4M6NH 2XZAH 3OZ9H 1MELA 3ETBF 2PCPB 3TFKD 3NH7H 4ODUB 1YEKL 3OG4B 4QYOB 4HFUH 2BNRD 5SWZE 4WDIA 1UB5B 5FYKE 4GMSL 4OLYL 3L3IB 1YMHA 2IAMB 2PETA 1EPFA 3MRNB 3QZWB 4I3SL 4U1LB 4XMPL 2NCMA 1INQB 5KJRH 1S7TA 2R0ZH 4YDIH 2VERN 3C5ZB 3P2TA 3QG6A 1D7FA 2Q1EA 5JOPD 1WCBA 5IR1A 1ETZB 3T0EA 1AH1A 4QF1B 5ESAA 5TH2A 5F9AC 1X5ZA 4RMTA 1DDHA 3MV8E 2JK5A 2IQ9L 3EHBC 3NN8A 1MEXH 4HH9A 4LSVL 2ZZUT 5BS0A 5CBAA 3FT3B 1OSPH 1EV2E 5FYLE 4HZLA 1K8DA 2FLBT 2O5XH 3PIQB 4LCYA 5ALBH 1NCAH 4WI6A 5D2NC 4D9LH 3E6FA 2E7BA 3C8KB 2DLIA 3DIFB 3LD8B 1ZKAA 3ES6A 3MZTA 3VH8A 1ZAGA 2R29H 2X4NB 2HFEB 3RWCB 4UMGA 5CCKH 4O2FA 4JZJB 5J3HD 4MS8C 5JNYA 4LHUA 4PGEA 1I7RA 3L7FA 3GSNB 3EUUA 1PZUB 2W59A 3QDMD 4UDTA 2DQUL 1HHGB 2JJWA 3HA0A 1BGXL 1LDSA 3LVEA 4RRPA 4RQQB 3STLB 1JZ3A 1J05A 2AXGA 1GYAA 3NFNB 2GSGB 2BVTA 4K3DL 3L95B 4J3VA 4ONGL 4Y16D 4JRYB 4M61A 1T1XA 5K9OB 2HTKD 3VFMB 4UAOB 3RTQC 1Y18A 5E4EC 2Y7QA 1YNLH 3B8SA 4X4MA 3O9WD 1P4IH 5I8OH 5KS9E 4NNPH 3JUZA 5KBNC 1BBDL 4XRCA 1A64A 4PLKD 4JB9L 1AR1D 3CXDH 3V4UL 1QO3B 4HK0B 4EN3B 3MGTA 4OCWH 1ZT7B 2P5WD 5F7YC 2LU7A 4DTGH 3MOAL 3GSRB 4KROC 3VXSD 3I6KA 3O2WH 2R9HC 4YO0A 2C26A 4UV4L 4H8WL 2BNQA 3UDWA 5KAQG 3ZYIA 2ZOLB 4JHWL 5HHVH 2QEJA 1MH5A 4MX7A 3IJHA 4JLRA 1I1YA 5CIPA 2PNDA 4KJQD 4MJ5B 4S0SD 1RUPH 1XCQA 3PL6A 4P2OB 2AJZB 3FO2A 2R1YA 4NRYB 4QGYA 2HRPH 2VB5A 3DXAD 2EYRA 4ZXBD 1NSNH 3FQXA 3BSZL 2GUOB 3PDDA 3ARDA 2FEEI 4PJXF 1QLFB 3WXVL 4HPYL 1ORQB 4GKNB 4APQC 2HFGL 2KUTA 4MNGA 1IT9H 1ZHLA 3GIZL 4P57B 4NN5B 4R7DA 1RUKL 4S1DC 1BQLL 3MRFB 1P53A 3MTRA 5C07E 3VD9A 1CS6A 1OB1B 2BOCA 5LAXB 5IW6B 3KR3L 5GS1B 5HY9A 3TLRA 4LDOB 1H5BB 4PRDB 1EZVX 1LP9E 2NZ9C 4ZMAT 2JCCF 2H45A 3ARFA 2VXQL 1YMME 2ADIA 2R23B 3CFCH 4FXKB 4QHMA 4YDLC 1O7SA 5GSVB 1UWEL 4PJBB 5DD0L 5EU3A 1NGQL 1FH5H 1X5KA 1FSKC 2OK0L 2IFGA 3LH2L 3PABA 3PQYA 1EEYB 2DLGA 5B38G 1UEYA 4LASH 3LQAL 4QRRA 2B5IB 1VFBB 2H32A 1W72B 1DANU 4LLVB 1LNUB 5DC0A 3NZHH 4PB0L 1RFDL 1QBLH 4KMQA 5E24E 3GSOA 4H1LG 1A1OB 3ZHDA 1FNAA 1HYRC 5HVHC 2P8PA 4AL8H 3BGFB 4R2GC 1FVCA 3L5XH 2DD8L 1JCKA 3QXTA 3KJ4B 4NUJB 3ALWA 4YLQT 4JFOA 5F88A 4P4RB 5K59F 1D5ZB 1MCSA 1GOFA 5LJYH 4LOUD 4C83B 2WIIB 5AZEH 4I3RH 1ZHKA 1FQ9C 3BXNB 3MCLL 2E6QA 1MUJA 5IEHA 4FQJH 5HVGB 4NGHH