3MBEC

Tcr 21.30 in complex with mhc class ii i-ag7hel(11-27)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
192
structure length
192
Chain Sequence
MPVEQNPPALSLYEGADSGLRCNFSTTMKSVQWFQQNHRGRLITLFYLAQGTKENGRLKSTFNSKERYSTLHIKDAQLEDSGTYFCAAEDGGSGNKLIFGTGTLLSVKPNIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKCVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS II H2-IAg7 ALPHA CHAIN
publication title The diabetogenic mouse MHC class II molecule I-Ag7 is endowed with a switch that modulates TCR affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 25
structure length 192
sequence length 192
chains with identical sequence G
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mbeC02
4HFWB 1U8NB 5DEFA 1J0KA 4M6NL 1HYSC 3BGFB 2VWEE 5DEFB 5FM5M 2AAVA 4OFKA 3WBDA 5KVGH 1BZ7A 3EZJB 3SBWC 1BZ7B 3K4AA 3CSYA 3MUHL 4J23A 3BQUC 5DD3L 4CAGA 4K07A 3CSYB 2JF1A 4FNLH 4N8CL 1TNMA 4RMVA 5BV7H 2VDNH 3HUJE 4JQIH 5IHLB 3UTSD 5KSAD 1KGCD 1FYHB 3ZKND 1KACB 2HTLC 1WGOA 3O6KL 4KROB 1FNLA 1P9MC 5IHZA 2ZPKL 3MA9L 4CKVX 3BX7C 3SQOL 1MCFA 2XG4A 3GO1L 3TLRA 5IHZB 2BHUA 3RGVC 3U2SA 4NFDA 2VDKL 4G6ML 4TNWF 3U2SB 4I3SH 2G5RA 5HHQA 5E2JA 2CKNA 2LAGB 2YD6A 3CVIL 5HHQB 4I3RL 2Q3ZA 3SKOA 4XP5L 3R8QA 2EO1A 3WV0A 3SKOB 3NCMA 2VXSH 4PLJC 3MLRL 3DHMA 4NO0D 1SY6A 2QSTA 2VDQH 5T1KD 2X10A 3BSZH 4JM2C 4KDTC 1MELA 1ZANL 2AK4E 3VH8A 2EDWA 3AAZA 1KFAH 1FNFA 1EZVX 4WTWA 5HD8D 3VH8B 2VQTA 3AAZB 2B4CL 3GSVA 1ZV5A 4HWZA 4YHKL 3L7FA 3T0ED 3GSVB 2Y5TA 4OI8A 4HWZB 3WSQH 3HTLX 2W0LA 3L7FB 2Y5TB 5DWUH 3BPOB 4S1QL 4OD1H 4P2RD 4HC1L 5C0AE 1CLZH 1E6OL 1QO3A 4OFYD 2BVPA 1MCBA 1H3TA 3BN3B 2VE6A 2APVA 1QO3B 5DD1L 1J11A 2BVPB 5M95B 2X5PA 3LN4A 2VE6B 3LQAC 3PP3H 3WFHA 3LN4B 5IEHA 1WTLA 3WFHB 5L2KE 4L3EE 5E5RB 3ARYA 5IEHB 2EIDA 4P0DA 3T0WA 1UXWA 2X9XA 1NUFA 2CK0H 3D3VA 2YUXA 5C92A 1UXWB 4C4KT 1MCQA 3DO7A 2HJKA 4HEME 2NY5H 3DO7B 2C4FT 2H2PD 2QADD 2HJKB 1OY3B 2VZTA 4M3JA 3UPRA 2ZUVA 3IFNL 3MR9A 3ARXA 2AK1L 1T1ZA 4NSKA 1J88A 3MR9B 2GJ6A 4M8QA 3T04D 2GJ6B 1SM3H 4M8QB 1LE5A 4KV5F 4O4YL 1LE5B 3BXNA 1LK3H 2EIEA 2EXWC 3BXNB 1ZSDA 3MGTA 1T7XA 1EZVY 5I1JH 1RZFH 1ZSDB 3MGTB 2EKJA 4JQVA 4Z7OF 1SJHA 4YZFE 4LSSH 5FFLA 4D0BA 1SJHB 1NFDA 1DVFD 2F58H 4D0BB 3CDCA 3WLBA 1NFDB 3MZGB 5IT2H 1MRCL 4CUCA 3GI9H 2X2YA 3WLBB 2NR6D 3UJTL 2C9AA 2KZWA 1QNZH 1HN1A 1QRNE 3QRGL 5F3HA 4FQJH 5ERWA 3DWTA 2CR6A 5IVXF 3QG7H 1IKFH 5GHWH 2YMXH 5F3HB 3RL2A 4JHBA 1IC7L 4LPVA 1T2XA 3CXHJ 5ERWB 4I18A 2B5IC 1OAZH 4C56A 3RL2B 1QSFE 3SDCC 5D2LA 4I18B 1NCAH 4C56B 5I15H 3ARED 1HNFA 5D2LB 3QHTC 1HCVA 4XXCC 4ZAKC 3P9LA 1IGIH 5DC0A 3P9LB 4LRIC 3D1MC 1NH6A 5MEND 4AK1A 2YPKA 4HLJA 4NM4H 2DQUH 4JFPA 4JRXE 4QWWD 5I8OL 2D7NA 4G7YL 2YPKB 3PQYA 4PLOB 4JFPB 4G7VH 4BSJA 4LMQI 4NNPH 3PQYB 4QY8A 2NY2B 5SWQA 3FFDA 2H9GA 5DVLA 4QY8B 1YEKL 1YJDL 5SWQB 3FFDB 2H9GB 3VJ6A 2IAMA 1T20A 2KQMA 5DJZA 3VJ6B 2Z31A 3U79A 4POYA 5I18L 2IAMB 5EBGA 5BRZE 1T20B 3IGAA 3O3EA 5DJZB 7FABH 2Z31B 2ADGB 3OBAA 4UT6H 5HHME 3IGAB 3MLYL 3O3EB 4CDGC 2HVJA 4JJ5A 5HGHB 2XG5A 4FMFA 4CMHB 2CRZA 2HVJB 4JJ5B 4GKOA 2VLRA 3RL1B 2D31A 3KPRE 3BRFA 3HG1A 5C9JA 2VLRB 1NCBL 2D31B 1H8SA 4D2NA 5HHOA 4N0CC 3HG1B 4JRYD 5C9JB 1MFBL 1KIRA 4N0UA 5HHOB 1UEYA 1KIRB 1AGDA 4N5UA 2Y25A 2NXZD 4N0UB 2K7QA 1H0DA 2GY7B 4A2MA 1AGDB 4S1SH 1H0DB 1Q1JL 1C5CH 5D7LD 1PAMA 5E03A 4TOYH 4ODVL 4OLWL 2LU7A 4O5LH 5HDLA 5JZ7C 4OLUL 1ZHBA 4HJGA 1BWWA 5H37H 3O3UN 1I3RA 1ZHBB 2XA8L 1KJ3H 4HJGB 4QRRA 1ZXQA 1B4JL 1I3RB 3VI3E 2VXVL 3FZUD 3MJ9H 4M7KL 4QRRB 1DE4A 4NQCA 4YFLI 1DE4B 4Z9KB 1TJGH 4I0CC 4WDIA 4M3KB 4F8QA 4NQCB 1M4KA 2SEBA 4WDIB 4X0KB 2SEBB 1YC7A 2PYFB 2F5AH 5INCA 4RGNE 5IEKA 4G43A 5INCB 2AKRA 2IFFL 3G6JA 4XBGA 5IEKB 3BD4A 5BCAA 1QFUL 4G43B 5HHXH 4R26H 2AKRB 4RDQF 4XBGB 1CK0L 2MQ3A 4HJJH 1TZGH 1OGAA 5HPMA 4UQ3A 3TT3L 3JUYA 2XN9A 1KG0A 1OGAB 5HPMB 3HLAA 4UQ3B 4MXQC 1Z9LA 2XN9B 4M00A 1KG0B 1UKTA 3HLAB 4KRPB 1FE8H 1F4AA 1AQKL 1DFBL 4ODUA 3SN6N 5SWSE 3RWDA 4ODUB 5IB2A 3VXUB 4QRPD 1VEMA 4U1MA 5F7MC 3BKJL 3QQ3A 3RWDB 1Z6JT 5IB2B 3RNQA 2DQJL 4U1MB 4RFEA 4Q97A 1K3ZA 1P9MA 3QQ3B 3V5HA 2NY3C 3EAKA 3RNQB 4YHLL 4RFEB 5ALBH 3V5HB 4YO0A 1MEXH 4EI5A 1FFPA 1D9KC 2WP3O 4YO0B 5E8PA 3RGVA 2F15A 43C9A 4E0RA 4EI5B 4GG6E 1KLGA 1FFPB 1WCBA 5E8PB 3RGVB 43C9B 5DR5H 3ILPA 4E0RB 1KLGB 1WCBB 2GYSA 1FH5H 3O2VH 5KS9F 3ILPB 3MFGB 4PYHA 5E2UL 3T0AA 1YEEL 2BXZA 1HQ4A 1HQ4B 1TVDA 3OQ3B 2M8XA 4S1RL 1UH4A 1IZKA 3IJSA 1A6VH 2E7LA 3VFTA 4M5YL 3UYOD 4Q2ZA 3IJSB 3VFTB 3UDWA 4Q2ZB 1DUYA 1NUDA 4PJIF 1AE6L 2F5BH 1DUYB 3L3IA 1MF2L 5H37G 2NY6C 4OD3H 1KCRH 1CDCA 3L3IB 4HS8H 4KDTA 4K3EH 4UTAH 5AAMA 1J8HD 1AC6A 2R0LH 4DVBA 3QDJE 2FX8L 1S9KC 1PZUB 4DVBB 4NWTH 1RUKL 1A0QH 1YECL 4Q9BA 3U7AA 1SJVA 1IAOA 4LPCA 1UACH 2OR7A 2PYEA 3GIVA 2VZ1A 1OARL 2PYEB 3RWIB 1F00I 5KANI 4CN4A 2C4XA 3GIVB 4POUB 5GS2D 1WZ1L 3LD8B 3MODH 2X42A 4AG4H 5B8CC 1EPFA 3P30H 1TZHA 1C08A 1KPVA 4L29A 5DT1L 5FUCE 4Q9QL 2DLHA 3ECBA 1TZHB 4F7CA 1C08B 1T5XA 1KPVB 1NMCC 2NYYD 4L29B 1MCOH 1ZEAL 3ECBB 4F7CB 5IIEA 1T5XB 2W38A 2BVQA 2FBJL 1GGYA 3A6BL 5IIEB 2BVQB 3DYMA 1S3KH 5D9SB 2B2XH 4LHJB 3VG9B 4AIZA 5CFHA 1XGPA 3MRCA 4AIZB 1LO0H 3HE6C 1XGPB 3MRCB 2HT4D 1JN6A 5L9DH 3NIFF 4LAQL 4WO4C 1JN6B 4AIXA 2DMKA 3L3GA 1SEBA 4MD5A 3L3GB 4JGUA 2IQ9H 4XRCA 3WKMH 3RY6C 1SEBB 2GQHA 4MD5B 4KI5C 4XRCB 2FHCA 2JCCE 3UJIH 3UTSA 3UX9B 3KHOA 1YYLH 2NXYD 4KK5D 1VCAA 2DKUA 4CDHA 3UTSB 3PDOB 3VFNA 3JV0A 5EC2A 3ZL4H 4LBEA 1JZ3A 3VFNB 5EC2B 1XCTB 5JW3H 5F9WC 4GFTB 1CFTA 5D7JD 5IMMA 1IL1A 2NNAA 1CFTB 5IMMB 2YBRA 1HIMH 3LEYL 4NQXA 4RISL 5C0DA 4YBQD 1IL1B 1ZGLA 1JPST 2NNAB 2EH8H 2YBRB 3KLDA 3T2NH 4NQXB 5C0DB 5ESQB 1ZGLB 3AS0A 1SBSH 2ZUWA 3B5TA 4OIIL 5HGBA 4OSUL 4HKZA 2MJWA 5ICYB 3QRFM 2WW8A 4KY1H 5HGBB 3HZKA 1ACYL 1MRDH 1ZOXA 4LPXA 3F58L 5BZDA 5JUEH 3HZKB 3VG0H 4UI2A 5E2TL 1ITCA 1JGUL 4U1SA 1OM3H 1GC1L 5BZDB 3L3DA 4XXCA 4U1SB 4F9PA 3VA6A 4ZAKA 3L3DB 5FOJA 3CUPA 1QUNA 2V5YA 2FJGA 4NFCA 4BZ1L 1W72L 1AKJD 4JAMA 3ARQA 2FJGB 3BIKA 1JRHI 4JG0H 3ZYIA 2D03L 4QT5A 4JAMB 1H3XA 5DVOA 4OZHF 4YPJA 4PB0H 3BIKB 1L9NA 4QT5B 4NN5B 4Z7QE 5FYLD 3IDXL 3TT1H 1DQLH 3BKMH 3SE3A 4AMKH 3GRWH 2ADFH 4UV7H 1CDJA 1J0IA 1KN4L 3A6OA 2WUBH 2H32B 3EOTL 3WHXA 4P2OC 3FRPG 5D7IE 3TYGH 4XCFH 4P2RA 3WHXB 5GXBB 5DVMA 3C60A 2VUYA 1PX4A 4P2RB 1V05A 3SKMB 3C60B 3NCBB 1QFWI 1DP0A 4JANA 4L9LA 4QTIH 3H2WA 4F7EA 4J3VA 4JANB 4D0CA 4U0QB 4L9LB 4F7EB 2Q1EA 2UYLA 4D0CB 1NEZA 1ORSA 2GJ6E 2UYLB 1NEZB 1ORSB 4P59L 4MZ2A 2OI9C 4J6RL 4XBEH 3MV8E 1P7KA 5FYJL 1GGCL 4NCDA 3T09A 3RY5A 4QF1A 1QSEA 3LKPA 2QADB 4QF1B 1IAKB 4PYGA 3CXHK 2VLKD 3K4ZA 3LKPB 3WEXA 3R1GL 5GGVL 5F6IB 5DMKA 3TJHC 3WEXB 5DJCA 2DJUA 4YHOL 5D1QC 1NFDE 5DMKB 4LKCA 3QEHB 5DJCB 3JTSA 3RWJA 1A7BA 4HC1A 5DD3H 4LKCB 1EJOL 3JTSB 4N8CH 3RWJB 1J0HA 5JHDD 1I1AD 4HCRL 3PXHA 1FSKC 4XC1L 3U1SL 3VI4E 4NJ9L 1N2RA 2H8PA 1KTRL 4Y1AA 3O6KH 4C56E 1KOAA 1N2RB 2H8PB 4Y1AB 2ZPKH 3MV7E 4X4ZA 3C9NA 1AGBA 3SQOH 4UOJA 3GO1H 3C9NB 1DVFB 1AGBB 2H32H 2HAZA 4KQ3L 1DTUA 1YY9C 2VDKH 4G6MH 2QKIA 3OAYK 4CMMA 3KPQA 2E6QA 2QKIB 2AEQL 5HVHC 4CMMB 4Z7WF 2X1QA 3KPQB 3PQYE 5AD0A 3IJHA 3CVIH 5F7WC 4I3RH 4W6WB 5GRVL 5AD0B 2BVUA 3IJHB 2HJLA 4XP5H 1UWEL 4N0FB 3WD5L 1UFUA 4ELME 4K9EL 4KK8D 2P8LA 3MROA 2RIKA 4ODHL 1WK0A 3RVTC 2P8LB 1GPOL 3MROB 1ZANH 3TM6A 2FDBP 1U3HD 2B4CH 3QEGL 5CINH 4PJFE 3SO5A 3HG1E 5IBUB 2ZCLL 4YHKH 5HHOE 4CL7A 2YZ1A 4ETQA 4WENB 4ZOBA 4W81A 4S1QH 4ETQB 5HYQA 5EOTA 3SQBA 3FAWA 5I71B 5ESAA 1E6OH 2XWJA 5EOTB 1AD9A 1IM3A 5HYQB 4HSQA 5ESAB 2XWJB 1AD9B 1IM3B 5I1CL 1LEGA 4B7LA 1N7ML 4LARL 1TQBB 1LEGB 2Z9TA 3HHRB 1P7QA 2XRAL 3B9KC 4HDIA 4WCYL 3VFVA 2NY6B 2R0ZL 1P7QB 4HDIB 3VFVB 1MUJA 2CUMA 2EDHA 2I9TB 1MUJB 4Y8AA 4UIKL 4NQCE 5IKCA 1XF4A 5GS3A 1INQA 5IKCB 2NY1C 4G8IB 5D7LA 4KKBC 1XF4B 4X98A 3VCLA 5HI3D 2XY1A 4Z8FL 2WINB 5D7LB 4WV1C 4YHYC 5J8OA 3VCLB 4XWOD 1F3DJ 1B0GA 3IFNH 2VKXA 2AK1H 2YUVA 3ZYZA 2YK1H 1B0GB 5F7UA 4XVUC 1E4KA 1OGAE 3D9AL 3HB3D 2NY7L 2XN9E 1G7JA 4P3WA 3W81A 3P4LA 5J9PA 5GGSY 1NMCB 4O4YH 4PY7A 5C0BD 1G7JB 2PO6C 5J9PB 4YQXL 3HN3A 4PY7B 3MRFA 2IAND 4RFNC 1UCTA 3MRFB 4XVJL 3VXUE 4OGAD 5J6HA 3CZFA 3PHOA 1NEZG 4XHJD 4NN7C 5J6HB 3CZFB 4MMXC 4G6JL 3PHOB 2YD8A 4R4FL 1S9VA 4ZO8A 3QQ9C 1MRCH 5FHAL 3O81A 1S9VB 2XFXA 3UJTH 4YK4C 4L9DA 3RY6A 3QRGH 2XFXB 1IC7H 4YHML 5FB8A 4BZ2L 1I7UA 3U0WL 5FB8B 4Y2DC 1I7UB 4TSCL 3ZT6A 1VADA 3G6AA 3PABA 4PPTA 1NC4A 4BJLA 3STLA 3G6AB 3PABB 2JB6A 2EXYC 1NC4B 4D3CL 2JB6B 1FN4A 1RJYA 3SCMD 5I8OH 3DECA 4G7YH 1FN4B 1RJYB 4KVCL 4OQTL 2ITCA 1J0JA 4X9BA 5AUMA 3ALWA 4QHLA 2BX5A 1EBPA 5C08E 2ITCB 1A22B 1NAMA 5AUMB 4QHLB 4TSAL 1YEKH 1IM9D 1YJDH 1NAMB 2IALA 4ZS6D 1QBML 4Z0BL 2QSQA 2IALB 2B39A 5I18H 3SDDD 4XC3H 2ARJQ 4XPBL 3MLYH 5CEYA 2APFA 2P5WA 4MHHG 5I76A 1J1OL 3MCKA 5CEYB 1QR1A 2P5WB 4YAQA 5IHBA 3MCKB 2W9DL 1FPTL 1J8HA 3QZWG 4YAQB 3VXMD 1NCBH 1HWHB 1J8HB 1NFKA 2VC2L 1MFBH 2OMNA 1YN7A 3C87A 4PRHD 3L7EA 2FGWL 1YN7B 5EDXA 5B39A 3L7EB 1DN0A 2OBGA 4I4WA 4G6FD 5B39B 1DN0B 1Q1JH 2DMBA 2HN7A 1P5VA 4I4WB 1QLRA 1UC6A 2AABL 4ODVH 3A0OA 2HN7B 4OLWH 3PGFL 3BKYL 4LPTA 1QLRB 4LHUD 4X80L 2CLRB 2X70A 4OLUH 1A8JH 4GJTB 2X70B 2XA8H 3PWLA 1B4JH 4MS8C 4UU9A 5I73C 2VXVH 3RI5F 3KGRA 3PWLB 4UU9B 1AGCA 4Y4FD 4RMTA 5FA3A 2KQNA 1AGCB 1JMZA 1BBDL 3IT8D 5FA3B 4J1UA 5GZOD 1WF5A 5TQ0L 2AP2A 1FIEA 4ISVA 4J1UB 4OFPA 3UTSE 1KGCE 3EDEA 4ISVB 3W0WD 5IVXA 2UV3A 2IFFH 4FXLA 1QFUH 2DLTA 5IVXB 1BQLL 3D48R 3TT3H 3O9WC 5D1QA 4XTRC 1HYSD 3OJ2C 3DI2B 4FTVD 4ORGA 3V7MA 2PTTA 2H26A 3UTZA 4ORGB 1J8KA 1AQKH 4OUUA 3PHSA 3UBXI 5FKPA 1DFBH 2PTTB 4JRWA 2H26B 3UTZB 4OUUB 3VGAB 3L95A 3BQUD 4JM4L 4FZ8H 4YLQT 3BKJH 5AWNL 3MRIA 4N8VG 2DQJH 2E6PA 1BVZA 5D7JA 1JZ4A 1DQQA 3MRIB 4DOHB 4WIQA 4YHLH 5D7JB 5AEAA 1DQQB 3RVWC 3EKCA 5ID1A 4ODBD 5ID1B 4LVHC 2ZG1A 1EEZA 4M6OL 4H25A 2C3VA 3JVGA 1JZ5A 4P9HC 1EEZB 5SX5H 5E2UH 4H25B 2C3VB 1RHHA 4XCNA 3UTOA 1RHHB 2K9UA 2Q7YA 4S1RH 5E4EC 4XCNB 4WU5A 3T0EE 3AGVA 1QOKA 2Q7YB 1BVLA 4WU5B 4EN3D 1X5GA 4OIBA 2WANA 1AKJA 1IT9L 1DN2A 1BVLB 1AE6H 3LQAL 2KBGA 2FGZA 4X4XA 1AKJB 4P2RE 4QXWA 4X4XB 1BFOA 1MF2H 3WL9A 3LAFA 4U3CA 2VH5L 1BFOB 5DHVA 2NW3A 3WL9B 5DHVB 2NW3B 2FX8H 1I3GL 4Y19D 1WIPA 4JPVL 1I1FA 5FGCE 3RJDA 1RUKH 1G9EA 1YECH 5FO7A 2DLIA 3JTTA 4TRPH 1I1FB 1X5HA 1P6FA 5FO7B 3JTTB 1OARH 2EE2A 5T5NF 1T83A 3CVHH 4P23D 4APQC 3QIBA 3NVQA 5IVZA 3T0VA 1WZ1H 4DFHA 4RGMC 3QIBB 1T21A 4Y8DC 5C0IA 4XNZC 3IDNA 4UV4L 1T21B 4RA0C 2W65A 5C0IB 2EDQA 5DT1H 3IDNB 4YH6A 4FQXC 1PG7X 4UOW1 2W65B 4XPGL 3QJHA 1CD1B 1W72A 1ZEAH 2UUDK 3JV4A 5F97E 2FBJH 3QJHB 1W72B 3A6BH 5AG9A 3JV4B 1KJ2A 2Q20A 2AXGA 3L3KA 1KJ2B 1F4HA 2AXGB 4MB3A 1I3UA 4ERSL 3L3KB 2NY1B 3TGXA 4WV1A 2FH6A 4LKXA 2VLKA 1LNUA 3VXSD 4N68A 3DSNA 4WV1B 4QCIA 4LKXB 2VLKB 1LNUB 3CSPA 4ODSL 3HI1A 1CXLA 4PGJA 4LAQH 4DKFL 4HGMA 3F65A 4M02A 1CE6A 3HI1B 9CGTA 3SKNA 1CE6B 4IRJC 5B39G 2DM7A 3SKNB 4JN2A 1A2YA 1XF5A 1T4KA 4ZD3L 4JN2B 1A2YB 1XF5B 2NCMA 2PO6A 1T4KB 2BFVL 2EC8A 5JHDB 1I1AB 2PO6B 3C5SA 4NNYA 5E8DL 2XIDA 3C5SB 1C7SA 4QXTA 5KS9A 4KQ4L 4NNYB 2EXWD 4QXTB 5KS9B 5FAAA 1CGXA 3LEYH 1JNJA 3QFDA 5DMGC 1CXHA 4RISH 1A7QL 2ZP0T 3CJJA 4UNVA 3AVEA 3QFDB 3QYCA 2R56L 4B53A 5MENE 5C86A 1MCHA 1A6PA 3VW3L 4MNGA 3FQTA 4OIIH 4OSUH 4PJIA 3C6LC 1NBVL 1SBBA 4MNGB 3FQTB 4PJIB 2J8OA 1WBYA 3F58H 3JWDC 2IEPA 5E2TH 1JGUH 4HT1L 1WBYB 1GC1H 4WWKD 4WNQB 4LSTL 4X8XA 5C7XL 5FGBA 4M48L 4OF8A 4JO2L 2VDRL 1JRHL 4BZ1H 1W72H 4F3FA 1DANT 1OTUC 2D03H 1BP3B 4F3FB 3TO4A 2CIIB 5DMJB 2D7TH 4DEPB 4NBYB 3TO4B 1AJ7L 3QDMD 3T1FA 1U3HA 3IDXH 4H5SA 3A67L 3RU8L 1MI5D 3T1FB 1U3HB 4H5SB 3MO1A 5LVEA 1C8PA 4JRYE 1KN4H 3TYFA 1WIUA 5DQDL 5AZEL 4EIGB 3MO1B 3EOTH 1MFDL 3TYFB 3CGTA 1IEAA 4N1HB 4CN6A 1QFWL 1IEAB 3E2HB 5D7LE 1CTOA 4LDEB 1IJ9A 4NQTA 2NY0D 2A6JA 3RI5K 5IR1B 4UDTA 5EU7E 2A6JB 5CD5C 2CLZA 4UDTB 5EZOL 3IB4A 4JKPL 2CLZB 5L8KB 4P59H 3V4UL 2IPKA 2IMMA 4H0GA 2IPKB 4J6RH 4S1DD 1EHLL 4ZODA 4DCQA 4OV5A 5FYJH 1GGCH 5TE4L 3MZTA 5CZKA 3IJYA 4WI7A 4DCQB 4OV5B 1OSZA 1GJIA 3IJYB 3TFKC 1OSZB 1KEGL 5DK3A 3I3BA 3X12A 3R1GH 1IEHA 1A1OA 5GGVH 3S88L 4OZFH 1JTPA 3X12B 3OB0K 3MRJA 4NZDA 4YHOH 3CLFL 3MRJB 2J8UE 3F7VA 2DTML 1CGVA 1EJOH 2E7BA 1OT1A 5DJXA 3C6SA 5DJXB 2FX9H 4HCRH 2V9RA 4XC1H 3RWHA 3U1SH 3C6SB 3MFFA 4NJ9H 3KYKL 3RWHB 2OTUA 4QRPE 3MFFB 1B2WL 1Z9SA 3FT4A 2OTUB 1JMXA 2EEAA 4H20L 2YD4A 3BJ91 1UT9A 5EORL 4G8GA 4RDQG 2EDOA 3O9WA 1CFVL 5D93C 4G8GB 2BVOA 5HYJD 1T1YA 3O9WB 5DC4B 2D7PA 1GSMA 2BVOB 1T1YB 5BJTA 2AEQH 5BJTB 1IFHL 2AJYL 2ZCKL 5ICXA 4LCUA 1ZLWH 4OZHA 4M7LT 5ICXB 4LCUB 5CWSA 4OZHB 4M61A 4YHZL 4YDLB 3VFOA 1UWEH 5DRWA 4P46C 5EBMA 4M61B 1U93A 3VFOB 5TFSL 4MJ2A 5DRWB 4PR5A 5EBMB 3KLSA 3WD5H 2R1WB 1U93B 4JFFA 4PR5B 3T08A 4K9EH 4OM0H 4LGRB 3SCMA 4JFFB 4NC1C 4IHOA 4ODHH 1XAUA 4L4JA 2YUWA 2DQDL 4MAUL 1GPOH 4QYOA 3SCMB 4LVHB 2CPCA 4IHOB 1J9CT 2Y4SA 3I02A 1D9KD 5DLMH 4QYOB 4YXKL 4C54A 1J8HE 1EVUA 3I02B 4IDJL 3QEGH 3ARSA 1IM9A 2ZCLH 5KSVA 3R4DA 1U36A 3IS1X 5D6CA 3DRTA 4KK9D 1IM9B 5KSVB 1QZ1A 5D6CB 3DRTB 4JREC 4TVPL 4M8VA 5L0QC 4FQQA 1FYTD 2A2QT 4A6YL 4XNYL 2DQGL 1F3RB 4FQQB 5JORA 5I1CH 2YD7A 3HRZB 3FHQA 5JORB 4FA8A 1MCDA 3G5VA 1N7MH 1EO8L 1BJ1H 4HBCL 3IFOA 4LARH 4OZFG 3L5IA 3QO1A 3VXMA 2XRAH 4WCYH 3VWJC 3IFOB 3RX7A 2GW5A 3QO1B 1INEL 3VXMB 2R0ZH 3GSOA 1D7FA 4PJEF 5JIPA 1YNTA 1VSCA 4Z7OE 5C6TL 4TYUA 3NCYS 1YNTB 5J11C 4UIKH 3VGEA 2P8PA 4Q9RL 3HNSL 4PJGF 1VGKA 5K9OA 4Z8FH 1EXUA 2P8PB 4WI9A 4LHUA 1VGKB 5K9OB 1EXUB 3QPQC 5LQBL 4LHUB 5IVXE 3BP4A 4RGMB 3GDBA 3BP4B 2GSGA 4XNZB 3MRHA 4FQXA 2APWA 3D9AH 2NY7H 4Y4FA 2GSGB 3IU4H 4KKLD 4UINL 3MRHB 4FQXB 3N50A 4TVPD 1JI1A 5CMAA 1U95A 4Y4FB 4J3XA 4GMSL 1XIWC 1ZHLA 5CMAB 1U95B 4YQXH 1ZHLB 2P4AB 3Q2CA 1MH5A 1OT2A 4PBXA 4D9QD 4NP4L 4DVRL 1MH5B 2V7HA 2GKIA 3U82B 4Z7WA 1MCPH 4G6JH 4LLAA 2X4NA 2V7HB 5GS0D 1X5ZA 5T3ZL 4Z7WB 4ZS7L 3RVXC 1DDHA 2X4NB 3ULVC 1AXIB 5FHAH 4GRWH 5HGGS 1DDHB 1F6LL 4IRJA 4KJQC 4BQ9A 4WI5A 5KTEL 3DX8A 4IRJB 5I8KL 4PJXF 2CR3A 5D1XD 5I1AA 3DX8B 1EGJA 1CXEA 4NKDA 2EO9A 2X4UB 3B6SA 5I1AB 3S35X 1RZKL 4D9LL 4YHMH 3PP4L 2D4FA 4NKDB 3B6SB 4U6YA 4BZ2H 3SJVD 2OZ4A 3U0WH 3RRQA 4U6YB 3EYQC 2EICA 4TSCH 1BGXL 3EFDL 1I9RL 3FT3A 5DMIL 2DLGA 2DI7A 4HWBA 3GSNL 3FT3B 4D3CH 5C0ND 1CF8L 5TPWL 2G60L 2XTJD 1GHFL 2VERN 4KVCH 4OQTH 1UB6A 5FYLE 4ZG1A 1UB6B 4NDMA 4TSAH 2HTKD 3LIZH 4LLQA 5T3ZD 4NDMB 3MOQA 1QBMH 4LLQB 4PJDF 3CFJA 4U6XA 4EN3A 1DBJL 3BDYL 3CFJB 4EN3B 3C8HA 2PKDA 4XPBH 1NMAL 2H2SD 1J1OH 2VDLL 4R90L 2WMPA 4GLRI 1I9IL 2BK8A 2W9DH 2W59A 1FPTH 2IH3A 4NCC2 2DBLL 1LVEA 2X6MA 2ZZUT 4KTEL 2IH3B 1JCKA 2VC2H 2ZUTA 4Y19B 1UADC 3CFIC 3LKOA 5JXED 1UH2A 3LKOB 4WVRA 1BX2A 4P23A 2AABH 3HR6A 1BX2B 4P23B 3PGFH 3BKYH 4X80H 1NBQA 4KMLB 3SKJL 1YEJL 2VLKE 3MREB 1G9NL 3TJEH 3ARDD 1IEBA 4XX1G 4KJPC 3OG6B 2FWOA 4WEBL 2FECI 4LQFL 5FYKU 3UCRA 1NJ9A 2NY4C 3AFLA 3TO2A 1NJ9B 1BBDH 1CLCA 5KVFH 3TO2B 4RMQA 5TQ0H 5JHDE 5EZIL 2BRRH 4ZXBD 1RIVL 2R9HC 1JJUA 1CXIA 1HH6A 3VXSA 5HY9A 3NMEA 3ESVF 2E9BA 1NC2D 1HH6B 3V6ZA 1CQYA 3VXSB 1SMOA 5KS9E 5HY9B 3MYZA 3V6ZB 5D5MF 1Q0XL 3ARBC 4U05A 2MKLC 4L8CA 4NFBA 1N6QL 5DZLA 4V2BA 2QHLA 4C4KO 3TJHD 3MJ8A 2PR4L 3Q1SL 3MJ8B 4MNGE 1MLCA 4LHUG 4PJIE 4JM4H 1MLCB 4N9GA 5AWNH 4P3DA 4N9GB 2F74A 4YGVA 4P3DB 1QQDA 3HNTL 3I2CH 4WHYG 2F74B 4Z6AT 4YGVB 1QQDB 3NBNA 4KJYA 4RQQA 4M6OH 2R29L 3HC4L 1BVKA 4NZTL 4KJYB 4RQQB 3OSKA 1V8HA 4TTDC 5CGYC 4G3YL 4ZO7A 1BVKB 3QCUL 3IETA 4L1DA 5DUML 1I4FA 3IETB 1HHKA 5C07D 1I4FB 3TV3L 2XXMB 1HHKB 4R97B 4U0RC 4H88L 4P46A 3S96A 2KL6A 3C8KA 3D85D 1IT9H 4P46B 3S96B 3LQAH 2ZUQC 2IWGA 2PTUA 3C8KB 5IFHL 4OAWA 1WWBX 3L3JA 4X6BA 4K7PX 1MFEL 4X9IA 4YFDB 4OAWB 3L3JB 4GBXD 4X6BB 3VXPA 4LF3A 2VH5H 3DSFL 3VXPB 3OB8A 4LF3B 5DGQA 1D5XA 4MLIA 3ZHDA 1T6WA 1I3GH 3ZKQD 4GXVL 1XR9A 1D5XB 3RVTD 4JO1H 1XF1A 4MWFA 3RTQD 1XR9B 1JZ6A 1I8MA 4NCC1 1B3JA 3ROLA 4MWFB 5C09A 1Z3GL 2AJUL 3NIFE 5BW7C 4XXDA 4NHUA 2C5DC 1I8MB 3ROLB 1CLOL 5C09B 3FRUA 3TWCL 4E41A 4XXDB 4NHUB 3JUZA 5L0QB 3FRUB 3L1OL 4F15B 5DURD 3A6CL 3EOAA 2XY2A 4UV4H 1IAII 5D7SL 3EOAB 3BFOA 4XPGH 2HT2D 2ADJA 1A02N 2ADJB 3MXVL 1UYWL 1CCZA 2RJMA 3DUHA 5C0BE 2V17L 5TJWK 2O5ZL 1Y6NR 5J1SC 4HZAA 2IANE 4G8FA 3QXAA 3OPZL 4ERSH 4G8FB 3QXAB 2L4OA 5GGQL 1Q72L 4G42A 4RGOL 4ODSH 1YMHA 4KKBD 3HKFA 4G42B 2ORBL 1RZJC 3ZDXF 4DKFH 2D9QB 1YMHB 2K7PA 3HR5A 1IC1A 1TPXC 1EDQA 3HR5B 2OJZL 4Z0XA 4K7PY 1R6VA 2LTQC 4ZD3H 5CZXD 3ULUF 4Z0XB 1LO3L 1U91B 2OL3H 2BFVH 4U1GB 1HI6A 4NOBA 4GUPA 3FKUS 3EOYG 3OJVC 1NGXA 1HI6B 3NFNA 4M7ZC 4U1LA 3VD4A 4GUPB 2D0HA 3PIQA 5E8DH 1NGXB 2DIBA 3NFNB 4U1LB 4OZHE 3QIUC 2GEEA 4KQ4H 3PIQB 3ZSSA 3L3HA 3MGAA 3IS0X 2CDGA 1IC5L 3L3HB 3LQMA 2CDGB 1A7QH 1U8KA 1D3CA 4D9RD 5HYJA 2R56H 4I0KA 1DJSA 1U8KB 4KRMB 5HYJB 4AEEA 3ZLQC 4N90D 3VW3H 1YNLL 3OJMB 1NBVH 5A3ID 2DQHL 3LPFA 1UM5L 1T1XA 3B9DA 4LSRL 5F21B 1HNGA 1V3JA 4J3WA 1EVTC 1T1XB 3FJTA 3ZTNH 3NCFB 4HT1H 4X6FA 4XX1E 5EO1A 5BS0A 4X6FB 5C7XH 4M48H 4GRWE 4JO2H 1JRHH 5EO1B 5BS0B 3KPNA 4ZTPL 2HFGL 2BC4A 1I9EA 3RJQB 3BP6A 1OTSD 3B4NA 3KPNB 2BC4B 3DLQR 2MMXA 3BP6B 1HXMA 3ZE0E 4IBLT 1RV6X 1HXMB 1F02I 4PJCF 3MLXL 1AJ7H 4ETYA 4OTXL 1XT5A 2P47B 3VRLE 3LHPL 3A67H 3RU8H 3VXME 1JHTA 2R69L 3R0MA 3MBEC 1JHTB 8FABA 5GRWA 5DQDH 2W0FA 5AZEH 5C0EA 4PRHE 1MFDH 2LVEA 8FABB 2X05A 2W0FB 5C0EB 3DIFA 1S9XA 1PKQA 4LCIL 2C3HA 1FYTA 4OB5H 4HUKB 1QFWH 3TPUB 2P24A 4H8WC 2ED9A 3DIFB 1S9XB 4LMQE 1PKQB 3FN3A 4WFED 1FYTB 4NZUL 4PS4L 4OCRL 4AQOA 4ZNEA 5J7CC 1JPSL 1X4ZA 4LU5L 1MWAH 4GAJL 3SOBL 1S8DA 1YQ2A 5EZOH 3RP1A 1WFUA 1CFQA 4JKPH 4N0RA 1S8DB 1B9ZA 1AP2A 2R2EA 3V4UH 4EQ2A 1CFQB 3VD7A 3QB7C 3S37L 3TVMC 2HLFD 1AP2B 2R2EB 4G6AC 4Z5RA 2G5BA 1EHLH 2Y7QA 5TE4H 3ZZ1A 4Z5RB 2G5BB 2ICWI 3LKQA 2Y7QB 2UZIL 4RRPA 3LKQB 1DBAL 2I60L 1PY9A 1R3LA 3W0WE 1KEGH 3P0VL 5E1AA 4MCYA 4S0SD 1U42A 3BKCL 1R3LB 4HX1A 3S88H 2C1OA 3OKNA 1N0XL 2CRIA 5E1AB 4MCYB 5CJQL 3ZDYF 4HX1B 1JYWA 3OKNB 1TXKA 2ICCA 2EYRA 1S7VA 3CLFH 1TJHL 2DTMH 5DJ8A 2EYRB 1S7VB 3P0YL 4FTVE 1UM6L 5DJ8B 2NY4B 1P84J 3BN9C 4MS8D 1NCWH 3KYKH 4Y5YC 2BNUA 1LO4H 5KG9A 1B2WH 1FVDA 1BZ9A 4I2XE 1KELL 2BNUB 5KG9B 1KENL 1FVDB 4OQ1A 1BZ9B 1YMMD 5IB1A 5EORH 3FOLA 4ZOCA 5J56B 2WIIA 4P9HL 5IB1B 1KNOA 4Z7UF 3FOLB 4YXLL 4F58L 4OM1L 3ARBA 2WIIB 1KNOB 2AQ2A 4MX7A 4R4ND 4HFUL 1JGEA 5HYSG 1AIFA 2RR3A 4MX7B 4U49A 1H5BA 5D1XA 2GK2A 1JGEB 5GZNC 1AIFB 3VI3F 3EHBC 5TE7L 1IFHH 2AJYH 1H5BB 5D1XB 2ZCKH 4FOMA 2X1PA 3O3DA 1OLLA 3SJVA 1XEDA 1P53A 4YHZH 4L4TA 1OW0C 3O3DB 3DUSA 4G8EA 3SJVB 4L4TB 1ERNA 3DUSB 5TFSH 1YC8A 4G8EB 25C8L 4KPHL 2EEBA 4P9ML 1ULVA 1F13A 1RJZA 4FQHA 1RJZB 2XTJB 3WNMA 3L9RA 2BSTA 3F12A 4FQHB 3RHWF 4YXKH 4LDLB 4FQLL 3L9RB 2BSTB 3F12B 4IDJH 2YRPA 4Y19E 3AB0C 5KJRL 5DUPL 2A73A 3P4MA 2A73B 2HKFL 4TVPH 1Y6MR 5I74C 3L5WA 3P4MB 4A6YH 4XNYH 2DQGH 4FP8L 3L5WB 3QCVL 2E3VA 2ZUQB 3CD4A 2EZ0D 3I6LD 1EO8H 4HBCH 4PTTA 1V5JA 1TTFA 3Q5OA 5ACMA 5KBNC 4PTTB 5DI8A 2CUIA 4ONFL 1INEH 5IVOA 4G9FD 5DI8B 3T4AA 5C6TH 1CICC 4YR6A 2UZYB 4J8RA 4TVSa 3T4AB 5JXEA 4YR6B 4J8RB 1QBAA 3KS0H 4Q9RH 3HNSH 4NO5A 3DHJA 4OCMC 4NO5B 4F8TA 5H94A 5T5NG 3ULUD 4EUPA 5LQBH 5H94B 3ARDA 3VXSE 3ZKXC 1IAIM 4EUPB 5E5MA 5I1KL 3ARDB 1Z9MA 4DUVA 3P40A 4J4PA 5E5MB 2BMKA 4U1JA 2XV6B 3B8YA 3OV6A 1RUPL 2BMKB 4U1JB 2D7MA 5I1GL 4HXAL 4EDXA 2Z91A 1GZQA 1AO7D 4EDXB 1A7PL 2VWEC 1GZQB 2Z91B 4ZXBA 1RU9L 3QPXL 4NP4H 4DVRH 4ZXBB 3KYOA 1VFMA 3KYOB 2X89D 3QNYA 3KPOA 1BQHA 4PJ9C 2CO7B 5T3ZH 3QNYB 4ZS7H 3QI9A 3KPOB 4DQOL 1BQHB 4D0DA 1K4DB 3U7WH 1SEQL 3QA3A 3QI9B 1ZWIA 4O9HL 3G5ZA 4D0DB 4FQPA 4DW2L 3WS6C 1ZWIB 3JWDL 5I8KH 3G5ZB 3X3GL 3GMQA 3QUYD 2IBZX 4WUKL 1RZKH 4D9LH 3GMQB 1KXTB 4DTGL 3PP4H 1N5AA 5K59F 4M7ZB 3PWVA 2DL9A 3QIUA 5D6DC 3PV6A 1N5AB 1FJ1A 1BGXH 3EFDH 3GMLB 3PV6B 1I9RH 5DMIH 4YEFA 3FO2A 1FJ1B 4JQXC 1P4BL 3GSNH 1RURH 3FO2B 2WV3A 3GMMB 1CF8H 2W91A 5TPWH 4KUZL 1M6OA 2G60H 3P3YA 4YBLC 2BCKA 4JY4A 1GHFH 1RI8A 1M6OB 3CFDA 4HF5L 2BCKB 5ANMA 4JY4B 1RD6A 1UXSA 3LH2L 3N1GC 3QDME 1RUAL 5HI5C 1UXSB 3QUZD 5C07A 1EBAA 1K9TA 1MI5E 1X6NA 3LSOA 5I8CA 2JCCF 4KDWA 5C07B 4K71C 3UBXA 3LSOB 5I8CB 3IAQA 1ZT1A 1DBJH 5T1DL 5GRYA 1MHPL 1O5DT 3BDYH 4P5KA 3UBXB 4HMCA 4PJEA 3QSKB 1ZT1B 5C09E 3O3BA 4P5KB 5JDSA 4PJEB 4ZPTA 4OLYL 1NMAH 2GCYA 3O3BB 2XKNA 5JDSB 3QG6A 4ZPTB 2QL1A 2GCYB 1AHWC 1I9IH 5GGUA 3SE4C 4MGXA 2XKNB 3QG6B 1DEDA 3CDFA 4PJGA 3VXRD 5GGUB 2R1XA 2DBLH 2KZ1B 4KTEH 4PJGB 1BJ8A 1D5ZA 3CMGA 3QUXC 1E4JA 3LY6A 2R1XB 5LGJB 4Q9CA 1XH3A 2F54D 1D5ZB 3RZCC 2X7LA 3FQRA 2X7LB 3C5ZC 3DGGA 3FQRB 5GGTA 4X6CE 4XNQA 2IBGA 2IQAA 3DGGB 2DIJA 2IBZY 2FR4A 4XNQB 4M03A 5DC9B 2IQAB 2AEPL 3SKJH 2FR4B 4MAYC 1YEJH 5DURB 2FECL 1G9NH 4BQ6A 1DSFL 1A5FL 4MQXC 1P5UA 4NKMA 3WS3A 4JN1L 4LQFH 5DXWA 4JHWL 1XGQA 4V1DA 4NKMB 3WS3B 1CU4L 2IC2A 4Z7QF 4V1DB 1AH1A 3F5WA 5CIPB 4OFIA 4WY7L 4GO6B 5C6PB 3QDHA 3F5WB 2FX7L 3V0WL 3V8CA 4K55A 2DBJA 5JIHA 1NAKL 5EZIH 1L0QA 1P6AB 5GJSL 3EOBA 4E9LA 1RIVH 1I3VA 3ILQC 3EOBB 4PJXA 2XWBA 5D7IF 4L3CA 4GQPH 4PJXB 5IJKC 2XWBB 4L3CB 2HA1A 4PG2C 4BUGA 4M43L 3BOVA 1Q0XH 1OAUL 4LPYA 1N6QH 1JWSA 3UC0L 1JNLL 5HYJE 4UT7L 1UEMA 3TBSA 3WJJC 3ZT5A 1JWSB 3DVGA 3GHBL 3Q1SH 3J8F7 3TBSB 3UTPD 1G7QA 4GKZA 3DVGB 5JW4R 3OTTA 4EUPG 1G7QB 1WZKA 3MNZA 5EN2A 4PRPA 2JIXD 3T65B 3MNZB 1JFQL 4H1LH 5EN2B 4PRPB 3HNTH 2NZ9C 3HS0A 1LK2A 4LDOB 1K2DB 5HYFA 5EBLA 3HS0B 2AERT 3FO9A 1LK2B 5GSVA 1O7SA 3STZA 3VFUA 4PJDA 4R9HA 5EBLB 4Q6IA 2R29H 3FO9B 5GSVB 3RHWK 3STZB 3VFUB 3HC4H 4PJDB 5EOCL 3U9UA 3TC9A 4Q6IB 4G3YH 1BD2D 1ONQB 2P45B 4N5ED 5DUMH 4HJ0D 1SVCP 3K1KC 4YWGH 2A0LC 1ZA6A 3TV3H 2FIRT 3CIQA 3ZDZE 5ELIA 4H88H 1ZA6B 3MUY1 4D8PA 5DGRA 3W11C 2HRLA 5CIPH 1P7HL 5E9DA 1PKQE 5IFHH 1FYTE 1MFEH 4TUOA 2VUOA 5E9DB 1WAAF 1KFAL 3GMOA 4TUOB 1E28A 3DSFH 4JPKH 4AEFA 4X83A 3GMOB 4ZNEE 3RPIA 3H0TA 3V6OE 3RPIB 4GXVH 3WSQL 1QFPA 3H0TB 4AYFA 1T66C 4OD1L 1UM4L 3O4OB 3AB0B 3L5XL 1NQBA 1Z3GH 3ARFC 4M1GH 1CLOH 4EBQL 3TWCH 3ZKMD 1QLEL 2C3XA 1P84K 1IAIL 3L1OH 3WO4C 1V3MA 2FEDD 2DRUA 3FN0L 2BY2A 1A3QA 3A6CH 2X4QB 3WYRA 3GBLA 1CWVA 5D7SH 4ELMF 2ICEA 1RZIA 3UBXG 2ICEB 2A83A 4YGAB 3IXAA 1RZIB 4TVPE 5FIEA 3MXVH 5JHLL 3UJJL 4PB9L 1UYWH 2A83B 3SGEI 3IXAB 2V5RA 5D5MA 2V17H 2O5ZH 4OF5A 4PJFF 4X4YA 4QHKI 5D5MB 3OPZH 2W9EL 4X4YB 4XMKL 4OGZA 3C2AL 4D9QE 4KTYA 5GGQH 1KYOJ 3ULVL 2F19L 1Q72H 4H1LG 4UBDC 3VFPA 5EA0L 1EFXD 4RGOH 3VGBA 1KF9B 2ORBH 3VFPB 1UVQA 1OTTD 4UILL 3AU1A 1C12A 3TCLA 1UVQB 2OJZH 3AU1B 1C12B 3BRGC 3TCLB 1T2JA 4RGNC 3BMVA 4ONGH 1LO3H 1QBBA 3DRQA 3O41B 1SVZA 3D0LA 3K8MA 2IPUK 1Q38A 3DRQB 1YEGL 3S5LA 3D0LB 3RIFF 3QR2A 1RIUL 4WW2C 3S5LB 3DNKA 1PG7W 2BOBA 2F58L 2AXJA 2Y6SC 3BGMA 3PP3K 3SJVE 1YMMA 4PP1C 2DTSA 4QHMA 2BOBB 4EI6A 1IC5H 5IT2L 3BGMB 1IGJA 4PJ9A 1YMMB 5C6WH 4QHMB 4EI6B 3CX5J 1IGJB 4PJ9B 5ITBL 1YYML 4EKXA 5EU3B 3QG7L 1CDBA 3TBYA 4BUHA 1FO0L 1U2CA 1YNLH 2GI7A 5F72S 3TBYB 2XTJE 4X9FA 3TESA 3ULVD 1F2XK 1ZLVH 4LSRH 3QUML 2IFGA 4NRYA 2RB8A 3H3KA 5ILTL 3RBSA 2A1WL 3MUZ1 4NRYB 5IQ9A 5T3ZE 2XQYK 1X5XA 4KGLA 1YEIL 5IQ9B 4ZTPH 2HFGH 2CKBL 5DA0B 2VSCA 4JQXA 4MXVF 4NM4L 1I7RB 5HJ3A 1JYXA 5HJ3B 3V4PL 3VD9A 4LLMA 5KSUA 3QIWD 3MLXH 4CN1A 3UPCA 5KSUB 4OTXH 4Y7MA 3CCHA 3LHPH 5C0CD 3O8XD 2R69H 3CCHB 3V79C 4M6AA 4K3HA 2N7AA 3ELAT 3RWCA 1P1ZA 3AROA 2QHRH 3F7RA 1MVUA 3CDGA 4K71B 2HJFA 3RWCB 1P1ZB 1P4LA 1MVUB 3CDGB 2HJFB 3WLWD 4NZUH 1P4LB 4PS4H 3JWNC 4HUXA 4EXPX 4OCRH 2ZG3A 4HUXB 3SE4A 3FFCA 1T89C 4LU5H 3ZHKA 4GAJH 2HFEA 5EU6D 4KKAC 4DZ8A 3SOBH 2FO4A 3FFCB 2HFEB 3SHSA 1IC4H 1CL7I 2AGJL 1NEUA 4RMSA 4DZ8B 4IJ3B 2FO4B 2WWMC 1L7TH 3NA4A 1V3LA 3S37H 4S1SL 2VR9A 3DURA 1EERB 5JPMA 1UGNA 3DURB 4TOYL 1NCUA 2D9CA 4LK4A 1DBML 5DO2D 1G6VK 1B4RA 5JPMB 1IARB 1JGVL 2XZAH 2UZIH 4CVWA 4NT6A 5FUCC 1DBAH 2I60H 3HMWL 2BY1A 5L2KA 5DJ6B 4NT6B 3P0VH 4MAYA 3WXVL 3BKCH 5L2KB 1U0QA 1N0XH 3BH9A 5CJQH 4MAYB 4MVBD 4OGYL 1CGYA 4BA8A 3BH9B 4KUCD 3PWJA 1TJGL 1TJHH 2KUTA 5B21A 3QXDA 3P0YH 3PWJB 1UM6H 4FQ1L 3QXDB 1SJXA 4KROC 1AO7B 1ADQA 2MWCA 1GYAA 3K3QA 4JFHD 1Z9OA 2FJHA 3ZTJG 2LFGA 3GSRA 4LLYB 5FCSH 1KELH 1KENH 1D5BB 4MD0A 3GSRB 5IJKA 3NPSB 5FUZL 5AG8A 5DVNA 4MD0B 1FGVL 1BAFL 1QSVA 4PG2A 2NY5C 4P9HH 2D0FA 4F58H 4OM1H 3H7BA 4H0HB 1FE8L 5HHPA 4FRWA 1I1YA 4EVNA 4HFUH 3H7BB 4HK3J 4RAHA 5HHPB 4X7DC 4OZ4A 1I1YB 4PJBE 2HT3C 2LU3A 4EVNB 4OZ4B 5TE7H 2FRGP 4KJWD 3GB7A 5CILL 1JZ8A 3QUYB 1N59A 1T5WA 4XMLL 2PXYA 3GB7B 3C09B 3D69A 1DLHA 1N59B 4PJCA 1T5WB 3QEQD 2QTEA 2PXYB 4MJ5A 3D69B 5C07E 1DLHB 4PJCB 3LV3A 4MJ5B 1A1NA 1QRNA 25C8H 3HPLB 1K8DA 3LV3B 1A1NB 3HI5H 4PJEE 1K8DB 4P9MH 1EH9A 1FH5L 3LKRA 5TF1L 2ENSA 1QSFA 3S5LG 3LKRB 1KTLA 4JFDD 1QKZL 2OMBA 4V2CB 1QSFB 2VNCA 3ABZA 1KTLB 3EJZC 4FQLH 4PJGE 3QUZA 3BPOC 4NJAL 1ZVHA 5KJRH 4JFXA 5DFWH 3QUZB 5CGYD 5DUPH 4JFXB 2VL4A 5CSBA 4NKIL 5F9DC 4JRXA 2BSRA 4JRXB 1OP3H 3QCVH 4FFVC 1LEIA 5D72L 2BSRB 1FLRL 4I0PC 1LEIB 2W07A 3DO3A 4IRSD 2FHBA 2APXA 2J6EL 4R0LA 4ONFH 1A0QL 1MFCL 4X8JA 4R0LB 5BRZA 5EFIA 4X8JB 4NQED 1WZLA 1WFTA 3UMTA 5BRZB 3BUTA 5EFIB 3DMMD 4M7LL 5EBWA 4YDIL 2IADA 4PUBL 2CJUL 5EBWB 1U92A 4BQCA 2IADB 4JVPA 3KPRA 4HH8A 3SGJA 1U92B 4XT1C 3KPRB 3IKKA 4Y4HD 1OVZA 1EA9C 4PJXE 3LPGA 4IOFC 5I1KH 1Q0YL 3O0RL 1RUPH 2DF3A 5I1GH 4HXAH 5J89A 4FFYL 5ADPL 3RIFK 2WM0A 2O26U 4Z7UA 1A7PH 4KTDH 2Z4QB 1RU9H 4Z7UB 4YHNA 3QPXH 1DQDL 2VZVA 1TTGA 2Y23A 3QCTL 1HHJA 1XF2A 3ZO0A 4BM7A 3IDYC 4JFOA 1HHJB 1XF2B 4Q58C 3I3DA 4DQOH 3N06B 4JFOB 1MAML 1SEQH 2FH8A 3RKDC 4JR9L 3WKML 4ELKA 1CT8B 1FZMA 4D9RE 4O9HH 5AZ2H 4DW2H 4ELKB 2DM3A 1FZMB 3JWDH 4N90E 4RGNB 3X3GH 4WUKH 3EDDA 4FQIL 3BEVA 1QVOA 4DTGH 4ZUTA 4Y4KA 2JIXA 1QD0A 3BEVB 1KCLA 2QQLL 1QVOB 1JIBA 2CH8A 4UT9H 4ZUTB 1T04A 4Y4KB 2JIXB 4RBPH 2HMIC 4LSPL 3I84A 1FBIH 1FZOA 1T04B 1F2QA 3RX5A 1LP9F 4GW1A 1J0ZA 5B4MD 1P4BH 4GW1B 1YN6A 1ED3A 4HGKC 4OKVA 2NY2C 2N56A 3D6GA 1YN6B 1ED3B 4KUZH 5F8RC 3O11A 4OKVB 2YOCA 4DKEL 4PRID 4LLVA 1BD2A 5C9KA 4HF5H 3O11B 4Y16D 1RUAH 4LLVB 5T1LD 1BD2B 4JE4B 2IAMC 3QEUA 3BP7A 3RVVC 1NGZA 2C26A 2Z31C 1UJ3C 4JDZA 3BP7B 1NGZB 5T1DH 1MHPH 3ME0A 4JDZB 5FA4A 4CMHC 5BV7B 5BXFA 4QRSA 5FA4B 4RCAA 4GLRH 3HFML 2EE6A 4WFEE 5BXFB 4OLYH 3IVKA 4QRSB 2P43B 4NQSA 2PNDA 3IVKB 4NQSB 1VDGA 2DS4A 1KYOK 3MOAL 2Y36L 5IVNA 1NGPH 4LRNL 4JFED 5T3XL 3OKOA 1C16A 1G9MC 4K23L 4HUWB 3OKOB 4YUEL 4PLKD 2BHYA 4NWUH 1C16B 1KCSH 5D5ME 2EEDA 1GIGH 2ED8A 3QQ4A 2AEPH 3QDJA 3W5NA 5BVPL 3QQ4B 3KYNA 1DSFH 1A5FH 3QDJB 3MV9D 3U4EA 3V5KA 1NMBL 3KYNB 4IS6A 5E5UB 4JN1H 3U4EB 3V5KB 1PD6A 4IS6B 4X7CC 2AJVL 1CU4H 5A43C 4U6TA 3H3BC 5C0RL 3MLVL 4WY7H 5C0FA 2VMFA 1CD9B 2FX7H 3V0WH 1NAKH 5C0FB 3QNXA 4GT7A 5GJSH 1S78C 3PL6D 3U83A 3QNXB 3FCTA 1KCKA 5F3BA 3UAJC 5I17A 1EFXA 3FCTB 3HZYB 1GL4B 5F3BB 1OQXA 3NTCL 5T3XD 5I17B 3K7UA 1EFXB 4KRPC 1YMME 3QQNA 4M43H 5E2WL 4HZLA 1KBGH 4S11A 1OAUH 4C83A 2A9NH 3QDAA 4HZLB 1JNLH 4MA3A 3UC0H 4UT7H 3CC5A 4XVSL 5IBLD 1B6DA 3EJYC 4C83B 3KLAA 2D7OA 4MA3B 4MNQD 3CC5B 3GHBH 3KLAB 2RAMA 2NZIA 4F7MA 2A74A 1CD8A 1FZKA 4K8RL 4POZC 2A74B 4F7MB 3P9WB 1JFQH 1FZKB 4EI5C 5DF0A 1JPGA 5FDWA 3BUYA 3FHAA 3N9GL 3S9DB 2E7MA 2Q7NA 1JPGB 5FDWB 3BUYB 2JCCA 5I1DA 4XI5D 4M1CC 5FGSA 3HRPA 2JCCB 2MPAL 5J3HD 1RUQL 1EHAA 5I1DB 1I8LA 1AR1D 3DX7A 5EOCH 1A7RL 1BWMA 1F3JA 2OR9L 3DX7B 3JWOL 2J8UF 1F3JB 2E7LC 5J1TC 2ESVD 4UB0L 3UDWC 4CBPA 3D5OF 4QLRA 3D2UA 1V7ML 4MJID 2X9WA 4JDVB 2F53D 1GVIA 4LEXL 3S3SA 2A9ML 3D2UB 5DJDA 3TBWA 4KK6D 2E9JA 4O2CA 2OK0L 5CS7A 3BDBA 5DJDB 5GJTL 4L8BA 3TBWB 3GJFH 4O2CB 3QIWA 3LS5L 1RJLA 1PX3A 3Q5TA 4L8BB 5IB4A 3I6LE 3QIWB 5IK3A 5CINL 1RJLB 4K8RD 4WUUD 5IB4B 3FFCE 3H9HA 5IK3B 1PEZA 3K81A 3H9HB 4G9FE 1UM4H 3TIEA 3L5XH 2WBJD 3LD8C 3RPKA 1ROWA 3ZDXE 1PBYA 2XACC 3TIEB 3ZYOA 4EBQH 5GSRA 4MDIA 2GJZA 4WHTA 4KZEL 1QLEH 1IAIH 5GSRB 4MDIB 4OLZL 4BYHA 2GJZB 4WHTB 5CJ8A 3FN0H 4IIQA 4LNRA 3ULUE 4I0PA 4IIQB 4KU1A 3S97C 1JBJA 4LNRB 4CGTA 4I0PB 3MLWL 4O00A 3SDAD 1KN2L 3KLHD 5D7IA 3VG9C 4NQDD 4GAGL 5D7IB 5JHLH 3UJJH 4PB9H 4FG6D 3LDBB 1AO7E 1K5NA 1AD0A 4AJ0A 1F8TL 1FC1A 2W9EH 4XMKH 1QACA 1K5NB 3J7HA 1AD0B 3BISA 3C2AH 3LB6D 3AUVA 2F19H 2YK1L 3ULVH 5EA0H 1GOFA 1R5IA 3WIIL 4UILH 2QV2A 5DK2A 3RVUC 2E8YA 1R5IB 4LPWA 3QXUA 1FCCA 3OG4B 2Q87A 3MV8A 5DK2B 2RCSL 4U6HA 1GGIL 2NQCA 3MV8B 1YZZA 2W9LA 4U6HB 4Y5VB 1II4E 4KRNA 3ZKNC 3H3PL 1WVZA 4XHQA 2D0GA 3T8XA 4HUUA 1YEGH 1INDL 1OPGL 1RIUH 3D18A 3T8XB 4HUUB 4H26A 4LASL 5FKAA 3UEZA 5DFVD 3SPVA 3D18B 3KNBA 4H26B 5FKAB 3V0AC 5CUSL 4PJCE 5JW5A 3SPVB 4OBSA 3KNBB 4MJ6A 1MQKL 2DQCL 1T0PB 4ORZC 5JW5B 4TQEL 4MJ6B 1YUHA 1BIIA 3IDYB 5ITBH 4RZCA 1YYMH 3FN9A 3V52L 1AQDA 1BIIB 1YUHB 2IJ0C 4RZCB 1FO0H 1AQDB 3OF6D 5I30L 2RFXB 1YNKL 3MV7A 3QUMH 4AL8L 3MJ9A 1WAAA 4L1HA 3MV7B 4F9PC 3QEQA 5ILTH 2A1WH 4M62L 1M71A 1GH7A 3EDJA 3FAXA 3QEQB 2IPUG 1ODAA 1YEIH 1M71B 3FB6A 4CU6A 3MRKA 1EO7A 2CKBH 3FB6B 4NN5C 4QO1A 2R8SL 2X44D 3MRKB 3UZQA 3NIGF 4JKMA 4CW1A 1XGTA 3V4PH 4CW1B 1JZ7A 2QQQA 5HD8C 4JFDA 1XGTB 3SE3C 3T0EC 4JFDB 1JF1A 2UVFA 3VXRE 5B22A 1KIPA 1JF1B 4I48A 1KIPB 4P4KD 1UJ3A 2ADGA 2F54E 4ELMA 4I48B 3QWRD 3GGWA 3C60C 4XC3L 1UJ3B 4ELMB 2BSSA 3GGWB 5HGHA 3ZDYE 5CHNA 2MQ0A 2C3GA 2EDDA 3BT2L 3JBG7 2BSSB 4L9LC 3RL1A 2H41A 1RIHH 5CHNB 5FEBA 1PG7L 2XQYG 2OSLA 3K2MC 3K2UL 3Q5YA 4PJFA 2OSLB 1CL7L 3S3PA 1ZLUH 3U30B 3UYRL 4PJFB 1PSKH 1HINH 1N64L 1MRFL 4JCMA 2AGJH 1IRAY 1RULH 4P5TD 4NQEA 3C8DA 4NQEB 3P4NA 1EMTL 3DMMA 2H2PC 2QADC 3HMXL 4U7SA 3KXFD 3HCVA 3P4NB 2EDYA 2ZSWA 1DBMH 3DMMB 1DR9A 4KKCD 1JGVH 3HCVB 4H0IA 2B4CC 4Z7UE 3RZCD 5F6IC 5IWLA 1F42A 2ZSWB 5IMKA 2EKSA 4XCCH 3ARGD 4UIMA 3HMWH 2VLJD 3VWKD 5IMKB 2EKSB 3RFZC 1HILA 3WXVH 4UIMB 1H8NA 2OXHA 4I77L 1HILB 3S36X 4OGYH 1KCUL 4L3ED 1CGTA 2B1HH 2W92A 4X0KA 2PYFA 1HKFA 1LHZA 4FQ1H 4KHXL 4NRZA 3GKZA 1E4WL 3DETD 3DX9A 4NRZB 4U1HA 3UTPE 1WBZA 1JPTL 3DX9B 3WUZA 4U1HB 3ISWA 1WBZB 1DVFC 4L3AA 4PIRF 1F97A 5GGRY 1QFHA 1HZHH 2J8HA 5HVWA 2MKWA 4WHDA 1GRWA 5FUZH 2NR6C 1FGVH 1BAFH 4NC0B 5DD6A 2M26A 1PEWA 2BJML 5DD6B 3TA3D 3BPLC 2QSVA 3VXUA 5E56A 5EC1A 4FZ8L 4PJ8D 5CILH 3AREC 5EC1B 1FIGL 1BD2E 4XMLH 1T7YA 5FV1L 5ITFA 4ZQKA 3TZVD 5ITFB 2I25N 4ZQKB 4ZO9A 5IG7A 3FRPA 4EEEA 5IG7B 4QWWC 1NLDL 1T3FA 4P2QD 4LVOC 3B3IA 1U3YA 5TF1H 1T3FB 3B3IB 4PRIA 1KCVL 1QKZH 4LPUA 1ITBB 3IDIA 3JV6A 3RWFA 4PRIB 1BJ1J 3RWFB 3IDIB 3JV6B 5IJVA 5T1LB 4NJAH 5I71C 1OD7A 4W6XB 2YHGA 3NCYP 2FJFA 5CJBA 5IJVB 4C57C 2FJFB 4OZGE 4L4VD 1T6VN 1OSPL 4NKIH 3RAJL 4BFBD 1TQBC 4CVXB 4JHAL 5IBTL 1PY4A 3ZE2F 2VR5A 5D72H 5C08A 1FLRH 5FV2A 3R8BB 2QEJA 4HIXL 5C08B 5GGSA 2J6EH 5GGSB 3G5XA 3N1QC 4KDVA 1MFCH 1KTDA 3I6GA 4JFEA 4TRPL 3G5XB 3SGKA 3OR6A 1KTDB 3I6GB 2DLFL 4JFEB 5D1ZD 3RWIA 3OR6B 2YUZA 4M7LH 5LCVL 4YDIH 3CVHL 4PUBH 2CJUH 4WFFE 1CDYA 4UTBL 4YJZL 1RJCA 5HYIA 5K93A 3KAAA 1YJDC 5EU7C 2JE8A 5HHMD 3BEWA 2DWDA 2P46B 4GQ9H 1VPOL 5SX5K 2XPGA 1E4KC 3BEWB 3CXDH 2DWDB 4UZGA 3FZUC 3MV9A 4DFIA 4HV8A 2XPGB 1Q0YH 4Y88A 4LSUH 3MV9B 1A3LL 3T3PF 4HV8B 1GCFA 3O0RH 5D9SA 1T7ZA 5K59E 1VA9A 1IKNC 2MQCA 3E0GA 1V7NL 2RGSA 4FFYH 5FHBL 5ADPH 3CU1A 4QGTA 4BK4A 2VITA 2VITB 1IQWL 1DQDH 1QHOA 3GRWA 4AEIH 5CJXA 4K2UL 5KVEL 3S34H 1MJ7L 3EZ8A 5JQHC 3QCTH 2RQ8A 2P1YA 3FB5A 3FB5B 2FYYB 4B50A 1MAMH 3N85H 3BD5A 4JR9H 4NC2B 4NN6B 5J06A 3PDOA 5KSAA 3HI6L 5I75B 5KSAB 1U8HA 2Q3AA 1XCTA 2Q6WA 3TN0D 3MRDA 3DYOA 1U8HB 2Q6WB 4FQIH 1WT5A 1N0LA 5DEZA 3SDYL 3MRDB 1C5DA 2QQLH 4KZDL 3MLPA 1C5DB 2VJXA 1T80A 4LSPH 4UAOB 5ESQA 3REWA 2HKHL 3KDMA 4HQQH 3REWB 4URTB 5ICYA 1UKQA 3KDMB 5I6XB 5SWZD 4AENA 4X5WA 2EDKA 1X5FA 4DKEH 4OF6A 1BF2A 5E8OA 1G7HA 4AENB 4X5WB 1IGYA 1MAKA 2C7UA 5E8OB 1G7HB 2CXKA 1I85A 3OXRA 1TNNA 3AS3A 1IGYB 2ESVA 5C0CE 3UYPA 2C7UB 5CD3A 3OXRB 2DD8L 3H9SD 2ESVB 5J4MA 2OCFD 4LOUD 5CD3B 1TETL 4MJIA 4NO0A 1FL5A 3MOBH 5KOVC 5IQ7H 3MLZL 5D8JH 5T1KA 4HXBL 3PUCA 4MJIB 4NO0B 1FL5B 4LHQB 2LQRA 3EDKA 5T1KB 3HFMH 4ZUWB 2D7TL 1Q9OA 2J3SA 1Q9OB 3O2DL 1DLFL 4WUUA 3T0EA 2H32A 3MOAH 5EU6E 2VSDA 4WUUB 2Y36H 4OF3A 3T0EB 3BYTA 4F80A 4LRNH 5K9QG 2DYPD 5T3XH 5KSBE 5JIKA 5J6GA 4K23H 4KKNA 3SKMA 4YUEH 4GRLD 3VXQA 3B83A 4OFYA 3SDXF 5J6GB 3MRQA 1QBLL 3VXQB 1BFVL 4IOSD 3MRQB 3PWPD 2ZNWA 5JXAH 4EOWL 2CRYA 4GRWF 2UWEF 4LVNC 5BVPH 4R2GD 2NYYC 5F44A 3K46A 1NMBH 3SDAA 5FGCB 1UWGL 3ZE0F 1FNEA 3SDAB 1AC0A 3IRZA 4NQDA 2AJVH 1FNEB 5HHNA 5C0RH 3MLVH 3DGCR 3Q0HA 4NQDB 4KKAD 1PKOA 4WI3A 1NLBL 4ZTOL 3VRLF 1VERA 5HHNB 2NTFA 1IAKA 1JP5A 3RDTD 1SJEB 2NTFB 2HT4C 4AQ1B 4DKDC 4JFHE 2V6HA 2VLLA 4HS3A 3QEHA 3NTCH 2VLLB 4HS3B 2V2TA 4U33A 5LJYH 1A4KA 4PY8I 4KMTL 4OFDA 5E2WH 2V2TB 4HKXA 2PETA 3BJLA 1A4KB 3BGAA 4MHHI 3S35L 3VGAC 4HKXB 4IDLA 2NXYC 4DK3A 4KK5C 1OAQL 4XVSH 1N26A 2FX9L 1LP9A 1C1EH 1LP9B 1WFNA 1A7OL 1TVBA 3CAFA 4YEEA 5D7JC 1J5OL 1TVBB 3RUGF 1DVFA 4K8RH 1WAAE 4KROD 4YBQC 3QEQE 1OAXL 4B0MM 4ZFFB 1QSZA 3N9GH 3MUGA 1ZT7A 5FYJD 2HFTA 3MUGB 1ZT7B 4J3UA 3JVGC 4S0TD 2MPAH 1RUQH 1T7VA 5E0QA 5DFTA 2FNBA 1A7RH 2APTA 2OR9H 2X4SA 3BPLB 3JWOH 5EOQH 5IB5A 4JFDE 3QZWA 4PP2A 2X4SB 3AREA 2EIBA 4GKNA 5IB5B 4QRTA 4N0FA 3H8NA 3QZWB 1ZHKA 4PP2B 3AREB 4GKNB 1UZ6F 3FB7B 3GM0A 4QRTB 4UB0H 1ZHKB 1HXYA 3O6FD 1OOAA 5MENA 3QHZL 1HXYB 1V7MH 5D96B 4LEXH 5MENB 4OM0L 2A9MH 2OK0H 1NGYA 4YFLF 5GJTH 3K8KA 4MSWA 1NGYB 5DLML 3LS5H 4LVOB 4MSWB 3OXSA 1BFTA 2J12B 5F1IA 4RMUA 3OXSB 1A14L 4XVTL 2FD6L 2E8ZA 3AS1A 2J88L 1S7RA 4OFVA 4HKBA 5F1IB 1VGEL 4AEHH 1LDSA 4P4KA 3MPCA 5CEZH 5JMOC 2ENYA 1S7RB 4HKBB 2XNAB 5I0DA 4NQEE 4P4KB 2FZ3B 4HGWB 1N3NA 1T83C 3NAAH 3QIBC 2EC9U 1N3NB 4F7PA 3GNML 3TNNA 4KZEH 2ZWLT 5EIVA 2D7QA 4F7PB 4OLZH 3TNNB 1GC1C 4K3GA 2I9TA 4JRYA 4N9OB 1ZLWK 3MLWH 5GRVK 4JRYB 5K9KA 1KN2H 4K3DL 4PJ7F 4P5TA 4WGVB 5TH2A 3SGEH 1CQKA 4LSVL 4N1CA 5K9KB 4G8IA 4GAGH 4P5TB 5TH2B 2X1XR 2NXZB 3M07A 2V5SA 5C0GA 2WINA 3BESR 3KXFA 5F9OL 3FOMA 5C0GB 2H6PA 3GFUA 3KXFB 3D3VD 3FOMB 1F8TH 2YXMA 2H6PB 3E8UH 3I50L 1UWXH 3F6LA 4JM2F 4TPRL 1KJVA 4N8VA 3V6FA 3BZDA 1KJVB 3H7LA 1QPXA 4N8VB 5CLTA 3V6FB 3WIIH 4TNVF 5IW3A 2VO5A 3IU4L 1DEEA 4NO3A 3OKKA 15C8L 1QA9A 2CMRL 1DEEB 3IYLW 2RCSH 1I1AC 4NO3B 4WFGD 3OKKB 1GGIH 4MNHA 1IKNA 1QA9B 3GK8L 4DGVL 4K94L 3ZYJA 4MNHB 3H3PH 1DBBL 4XBPA 4LLWA 2YD5A 1INDH 1OPGH 3HE7D 4MXVE 4PV8A 1YEFH 4XBPB 4YC2B 3BIAX 2VXTL 4LLWB 4HIJB 1DCLA 2COQA 4LASH 2GAZB 5FUOL 4PV8B 1MCPL 4P57A 1UA6L 1QLFA 5CUSH 2J8UA 4P57B 5HHVL 3ARZA 5E6ID 1PGRB 1QLFB 1MQKH 1TITA 2DQCH 1NPUA 1WCQA 4UMGA 2BXYA 2ZOLA 2J8UB 4TQEH 3BVNA 4HPOH 1G7LA 2ZOLB 3TA3A 3V52H 3BVNB 1IILE 1G7LB 1T1WA 3B2UD 3I6KA 2VXUH 3TA3B 3MX0A 1CZ8L 1WJ3A 5I30H 1T1WB 4PJ8A 3I6KB 4QRPA 2V2XA 4MA1B 1YNKH 2AQ1A 3WNOA 4PRIE 4PJ8B 5FM8A 4QRPB 4AL8H 2V2XB 1KUMA 2WLZA 1Q94A 4X5XA 1B88A 3TZVA 5FGBC 1ZVYA 4M62H 1Q94B 4X5XB 3HAEH 4K7PL 3TZVB 32C2A 2EH7L 1XZ0A 3BDXA 32C2B 4KK8C 1XZ0B 1U3JA 4DEPC 2R8SH 3TO4C 4XAKD 3NGBB 1DZBA 3BZ4A 1U3HC 4I9WD 3BZ4B 1PFCA 3LIZL 5JOEA 5E95B 3PQYD 3GMRA 5CJ5A 4K7FA 1MY7A 3GMRB 4JFEE 4K7FB 3E2HC 2YRLA 2Z8WC 3OGCA 3U0TA 3BT2H 3OGCB 4C58B 3U0TB 1PG7H 2IBBA 5TDNA 3K2UH 3H9ZA 4YNYA 5IUSA 2R4RL 5TDNB 1CL7H 4B7IA 2E7CA 4YNYB 4J7RA 1NCDL 3UYRH 1N64H 1MRFH 2AQ3A 3MV9E 2VLRD 4K9EC 5GISL 3HG1D 3UROR 5D1ZA 5HI3C 1EMTH 3HMXH 1EHNA 5D1ZB 1I75A 2P42B 2YA1A 5CZVL 3QISA 2B7DT 2CLRA 2XZCL 5CP7A 5HI4D 5C71A 1QFWM 3ZE1F 4OCSL 5CP7B 3CLEL 1BECA 4Y2OA 3TJEL 1BJMA 5DQ9A 4PRBA 3HB3C 5DQ9B 4HPYH 4PRBB 1AXSA 4LVNB 4I77H 43CAA 5T3XE 3DROA 1AXSB 1KCUH 3HA0A 43CAB 4NHCL 3V4VH 2DM4A 3DROB 3EIFA 1MIEH 4QRRD 3DTXA 1FDLH 5KVFL 2VDPL 4KHXH 2YD2A 4YPGA 3DTXB 4MQ7A 2BRRL 5ETUA 1E4WH 4MNQE 4OGAC 4F9LA 5DJAA 4QHNA 4YPGB 4MQ7B 4OCYL 2Y1VA 5ETUB 1CGWA 1JPTH 4XHJC 5DJAB 4QHNB 4P49A 4U31A 4ODTL 5EUOE 1CGUA 1H3WM 4X6CF 5HDBF 2BJMH 3CVHA 3BYYA 1FL3A 5J12B 4IMLA 4QNPF 3CVHB 1FL3B 4IMLB 2BNRD 2NXYB 4NQUA 1KEML 4YDLC 5F89A 1CXFA 1FIGH 1X5AA 5F89B 3DBXA 3I2CL 4I1NB 2ESVE 1Q9WB 2HTLD 2JJTA 1A6AA 3DBXB 5J13B 1A6AB 3DUUA 3SCMC 4MJIE 3DVIA 2F53E 1NLDH 5CLWA 2CSPA 3DUUB 4M9PA 1DUZA 2WNGA 3MNWA 5SWZA 3X3FL 3ZSTA 5CP3H 4ZSOA 3RGVD 1DUZB 5SWZB 3MNWB 1KCVH 4ZSOB 4XAWL 1CBVL 5JNYA 4ZS6C 4WUUE 5D2NB 1GZPA 5MEQA 5JNYB 3H9SA 1GZPB 5MEQB 1NBYA 3SDDC 3H9SB 3I3EA 1NBYB 1UKSA 3FB8A 5I8EA 5FECA 1OSPH 3RAJH 3FB8B 4DJMA 1CG9A 1MJUL 4BFIA 4W4NA 5I8EB 5FECB 4QHUA 4JHAH 5IBTH 1FNGB 3KS0J 1CG9B 4BFIB 3ROOA 2MSPA 4QHUB 3LEXA 4PLJD 4YDKL 5HVGB 3ROOB 4HIXH 3LEXB 2GIYA 1RAMA 1RZGA 4Q6YA 1RZGB 4JM2D 4JO1L 5TE6L 2DYPA 3HNVL 2HP4A 2YZ8A 5EU5A 2DYPB 2DLFH 4NQDE 5EU5B 1EHXA 5LCVH 2WBKA 3OKYA 1A64A 4GMTL 3PWPA 4UTBH 3S4SA 3ZDZF 5JW4Q 2PYED 1MFNA 3PWPB 4LSQL 4TNVK 1HHGA 3S4SB 5GS1A 3NCEB 3CMOL 1VPOH 1BM3L 1HHGB 2Q8BL 1CD1A 1URLA 5GS1B 4Y4FC 1FG2A 1A3LH 2OQJA 3WFBL 2JB5L 1TTUA 3PGCA 5GZOC 3T2PA 1FG2B 2OQJB 1V7NH 3PGCB 2AI0L 5FHBH 1KB5H 4RFOH 1JHKL 4OLEA 3RDTA 1LP9E 3T0XA 3RDTB 1IQWH 2GFBA 4K2UH 5JA9A 5KVEH 2GFBB 1MJ7H 4RMWA 3P2TA 2VN7A 3VFSB 4CNIA 1EUUA 4CNIB 2ED7A 3KPTA 4PFEA 3S8WA 1S7XA 5EIQA 4Z7NF 4GXUM 1S7XB 4OT1L 3GMPA 5JHDA 1I1AA 2OL3L 1F6AA 3HI6H 3GMPB 2BOCA 3RVUD 3MRGA 1F6AB 1T0NA 3Q48A 2BOCB 3JV5A 3MRGB 1T0NB 4NM8L 4G5ZL 4HUNB 3SDYH 4KZDH 3FONA 4MDJA 1MVFA 2X4RA 3E3QE 4PJHF 5BOPA 3FONB 4MDJB 3T3MF 4A2LA 1TIUA 1OL0A 2X4RB 1JNNL 2HKHH 3IDUA 4OJFL 4QGYA 2KPNA 2FLRT 1H9VA 1EJ6A 1S7UA 4OZFA 3U48A 1S7UB 4WNQA 5IROA 3ZTNL 4OZFB 1MCLA 2BZDA 3STBA 4EN3C 2DD8H 3CX2A 2X4PA 2Y06L 3G5YA 4OCXL 4LCCC 8CGTA 3O6FA 1TETH 2DMCA 3SDCD 2X4PB 3G5YB 4HK3N 1FFRA 3MLZH 3O6FB 4FHBD 4HCRA 2CIIA 4HXBH 4NZJA 3T2OA 3WJLC 4IOIA 4ZAKD 4KI5F 5DTFA 5ENWA 3GSWA 4IOIB 2PF6A 4HG4J 4P99A 1J86A 5DTFB 5ENWB 3GSWB 1F4YL 3O2DH 1H15A 1DLFH 3KR3L 2BY3A 2BY0A 1H15B 1MJJA 5JW4N 1MJJB 2R2BA 3UP1A 1KXQE 5IV2A 1X9QA 2R2BB 4JHZA 5CKAA 2X9YA 1NKRA 3N1PC 2EYTA 4OB5L 5J1AA 1WWCA 4P23C 5IV2B 3GMNA 1QBLH 3SY0A 1F4WL 5J1AB 1HHHA 1K3IA 1BFVH 2EYTB 3KXFE 3BH8A 3GMNB 3SY0B 1HHHB 5IR1A 3BH8B 4MB4A 1Z5LA 2JLLA 4EOWH 3C60D 4OCWL 1MWAL 5DRZA 5KVDL 1Z5LB 2VLJE 3VGFA 5DRZB 2LABA 4R7DA 3BIBX 3RWEA 4JDTL 1UWGH 3MJ7A 4HW6A 4R7DB 3RWEB 3CZJA 3MJ7B 3U7YH 2VOTA 4ZTOH 1NLBH 4N0CD 3GHEL 5E2VL 2MCG1 3D3VB 4FFZL 5DRXA 4JO3L 4OKDA 3BWAA 4RSVA 5DRXB 1QSED 3BWAB 3VXNA 2YN5A 5B3JE 1CI5A 2JTDA 2YKLL 3VXNB 1RZ7L 4KMTH 5JZ7D 3UPRB 1HK6A 5F70A 5C0BA 1FORL 1T1ZB 4NSKB 3S35H 3LKNA 5DSCA 2IANA 5C0BB 3NABH 1OAQH 2YC1A 1Q9KA 1DL7L 3LKNB 4U4BA 3S6CA 1EEYA 1WTGT 1NCWL 2IANB 3VXTA 5DSCB 3S4SG 2YC1B 1Q9KB 1EEYB 4X6DF 1A7OH 3VXTB 3HE7A 5CAYB 1LO4L 2I27N 5DUBA 2MCPH 1J5OH 1SY6H 2WZPD 3HE7B 5ALCL 5DUBB 1BQUA 1FVCA 4HIHA 5E6IA 1OAXH 4Y1AD 4WW1A 1FVCB 1IGML 4HIHB 2O5YL 5E6IB 3W9EA 4WW1B 4PJ5D 3MJGX 5ICZA 1BZQK 3W9EB 1MY5A 2X4OA 5ICZB 4OZIF 2KKQA 4P2QE 4XP9L 2X4OB 2I26N 1OAKL 4MXQD 1KIUA 2OTWA 4R97C 1X7QA 4WWKC 1KC5H 4C55A 2OTWB 3FO0L 2X1OA 4KAQH 1AR2A 1QEWA 4UQ2A 1X7QB 4ONHA 2IGFL 2R1WA 1QEWB 4UQ2B 1OP5K 3FO1A 3W39A 4ONHB 1EV2E 1T7WA 3FO1B 3QHZH 4JZNA 4OGXL 3W39B 1IMHC 3CNKA 5DD5L 2IPTL 4L4VE 2NY3D 4JZNB 5IM7A 3L3OA 5IM7B 2R4SL 4YBHA 3SDXA 3L3OB 1F45A 3SDXB 4CU7A 2V2WA 4P48A 4JVWA 4LSDA 3WXWL 5MI0B 1A14H 4XVTH 1LWRA 2V2WB 2UZXB 2FD6H 2J88H 4XWGL 2UWEA 1A6TA 4WTZA 4PJBF 1VGEH 2VB5A 5SX4H 2FBOJ 4GRWB 2UWEB 1A6TB 3F62A 3SDDA 5IP4A 4DWHA 5I1HL 1KPUA 2J2ZA 2YSSA 3AY4C 4JLRA 4F15C 3SDDB 4YE4L 3HRZA 2E9IA 1KPUB 2YSSB 3DV6A 3IKCA 1OP9A 4JLRB 5D7KD 5A2KH 3GNMH 1B90A 2NY0C 4XPFL 4U1NA 3IKCB 3DV6B 3QHFL 3ARVA 1WEJL 4U1NB 3X14A 3VMNA 3X14B 2JJVA 2L7UA 4PRHA 2YWZA 1C5BH 2NY6D 4K3DH 5JQ6H 1P7QD 1SMAA 5JOPD 4HIIA 4S1DC 3GSQA 4LSVH 4PRHB 3MRNA 1VB9A 3SE9L 4HIIB 3GSQB 1XGRA 3MRNB 1R3KA 4OQTA 5F9OH 5JA8B 4G6FB 1A9BA 3SEPA 1XGRB 3MQIA 1R3KB 2ZUYA 3ZHLA 4NGHL 3LEVL 1A9BB 5F7EL 3I50H 2CD0A 3CFCL 4TPRH 1W8OA 1BFSA 4J3SA 4NUJA 5FCUL 3VH8G 4NUJB 3U4AA 3RUGA 1NGQL 2I5YL 4U1GC 5EUKA 4CJ0A 15C8H 1KPRA 2CMRH 3RUGB 3ARTA 5EUKB 3GK8H 4G80A 1KPRB 4HWUA 1NANI 5LG1A 1XGYL 4K94H 4DGVH 1A7NL 1DBBH 2XZQL 1J0YA 4G80B 3ETBF 3TF7C 5E7FA 3W0WA 3WNNA 3VFRA 3W0WB 4W4OC 2VXTH 3PF2A 3NIGE 3VFRB 4EDWH 5FUOH 3QXVA 1UA6H 4N1EA 3MNVA 2X40A 3CFEA 5HHVH 3HE6D 3U7WL 3MNVB 4FTVA 3CFEB 3G6JB 1NAML 2DICA 4FTVB 3SBWA 4WO4D 4B5EA 1FFNA 4LLDA 2X4UA 4TNWK 1CZ8H 2BNRA 5SWZE 5HVFB 2I9LA 3BQUA 2AJXH 1FFNB 4LLDB 4WFHD 4ZSOE 2BNRB 4I2XA 2I9LB 2NLJA 3BQUB 3NIDF 4XNXL 3BO8A 4KI5D 4QXGL 5D2NE 4I2XB 2NLJB 5MEOA 1R5WA 3BO8B 2EECA 4RA3A 2YD3A 5MEOB 1R5WB 4K7PH 2P48B 3H9SE 2EH7H 1TDQA 3QT2A 1RURL 5M94B 4OLXL 5C3TA 5CGTA 4RNRA 4K3JH 1NC4D 1CDUA 3MRLA 4RNRB 3OKDA 3MRLB 5KOMC 1I7TA 3OKDB 1G9MH 3VDBA 1BHGA 1GOHA 4KK9C 1I7TB 2GTWA 5FXCH 4LL9A 5IESL 1BLNA 2GTWB 5FYKL 3SGDI 1WQVT 1S7SA 1LILA 2EDXA 3L5HA 3LMJL 1BLNB 4LCCA 5IHUL 3BE1L 1S7SB 2XA3A 4LCCB 4PJ7A 3VDAA 3OX8A 4QTHA 3WJLA 4DN4L 4M93C 4PJ7B 2FO1A 3VGGA 3OX8B 1JI2A 4QTHB 1Q8MA 1F5WA 3PWPE 5EG6C 1LE9A 5FM4A 3V6OC 2Q86A 2R4RH 1LE9B 4Q0XL 2P5WD 1JGLL 1TFHA 2Q86B 4Y19A 1X5IA 1NCDH 1X4YA 1HKLL 2I24N 4JG1L 5DZOA 4JM2A 4YX2L 2ZUSA 1HWGB 1JYVA 4JM2B 1FAIH 5GISH 1F90L 5JLZA 5AYUL 5FM5O 5JLZB 1BIHA 2UY7A 1VHPA 1RUML 5J57B 5CZVH 2XZCH 3MREA 4P2OD 4HAFA 4OCSH 1IAOB 3CLEH 2QSCH 5FF6A 2ARJA 3WHE1 5FYKD 3GSUA 3H9YA 4KKLC 4WTZG 2ARJB 5FF6B 3GSUB 2C3WA 4NHCH 3F6IA 1HOCA 1JTOA 1L4IA 1ZKAA 1HOCB 4XPHL 2VDPH 1E0OB 5CSGA 5I1IL 4BELD 3ARWA 4OCYH 1B0WA 5CJOL 1RFDL 2XI9A 5GS0C 2IH1A 4ODTH 4Z7VF 5D70H 2IH1B 3PHQA 4MZ3A 3PHQB 1VFOA 5FYJE 4TUKL 2FIKA 1H5BC 5D1XC 5D1QD 1CDIA 2FIKB 1J10A 2YWYA 4XP1L 1CFBA 1KEMH 4NPYA 4DGIL 1MSPA 4HG4K 4LVEA 4NPYB 3FQUA 3PG2A 1U9KA 3ZE2E 3T1WA 3MLTA 3FQUB 2HRPL 3FQWA 5ID0A 3MLTB 5FYLL 3Q3GA 4LBEB 3FQWB 4WU7A 5ID0B 1YPZF 2EDJA