3MBGA

Crystal structure of human augmenter of liver regeneration (alr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
b'DCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title Structure of the human sulfhydryl oxidase augmenter of liver regeneration and characterization of a human mutation causing an autosomal recessive myopathy .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3mbgA00
3R7CA 1JRAA 3U2LA 3LLKA 3LLIA 3GWLA 3O55A 3TK0A 1JR8A 4E0IA 3U2MA 4LDKA 4E0HA 3U5SA 3GWNA 2HJ3A 1OQCA 3MBGA 3TD7A 3W4YA
chains in the Genus database with same CATH superfamily
3WHNA 1GS9A 2PFDA 3EGDB 4EBBA 1OCZC 1TWHA 4WABA 3ZIBA 4AK9A 5DS6A 2V3CC 4IARA 1JRAA 1OCCC 1PCXA 4DRHB 2MYSA 1E83A 1OR2A 3ABKC 4E18A 3JT1A 1YA9A 4C3EA 4DRIB 3JTLO 2HV6A 2YRFA 3B71A 3CEXA 3FOOA 4U5CE 4WGYA 3RW0A 3EH1A 2OOCA 5EGYA 5HV9A 1ZU4A 4XLPF 4DVYP 2Y3DA 2KYHA 1JR8A 2HFIA 2V26A 3E70C 2A69F 1Z23A 3DJNB 1M6TA 3RKOF 2R7VA 2J9WA 2JX0A 4LLEA 2J0WA 2OJED 1ZZPA 1K40A 4XTKA 1H9TA 2Z15A 3UNGC 4Q5SF 1NFNA 4A2NB 3CSKA 5CI9A 1TFKB 3L34A 1JPJA 3I5PA 3NG1A 2EILC 2KJGA 1WATA 1A7VA 3C7JA 5DQTA 4EKWA 5L0GA 3DAFA 2RD9A 4IWBA 2R7OA 2Q00A 2W45A 1MNEA 3JRMO 3RQGA 5L3VA 3N24A 1D0ZA 4CS8C 1S7ZA 2L6HA 2OQMA 4HFFB 1YYJA 2EIJC 4P9TA 3RQEA 2XM4A 1FFTC 5A6KA 4MVRA 1NSGB 3GEIA 4IGGA 1FMWA 3UGPA 4LERA 2IYLD 3B0PA 3SYNA 2VASA 2OEVA 1T9KA 2YWAA 2YVKA 1HE9A 2KSFA 2OCCC 1RCPA 3NMIA 1M2VA 3RIPA 3DM5A 4MTGA 2QNLA 3ZVRA 2Q9AA 1LI5A 1XZPA 2LFDA 4XPYA 3W2VA 2P1AA 5JT4A 4OD5A 1V74B 5E2QA 4O7GA 3TOMA 3WAQA 1M2OA 4MVQA 2XS8A 1VTMP 4LACB 5EK0A 2W4MA 1YLMA 3H65A 5B3IA 4RD9A 1CPQA 1N1CA 2AU5A 3JSEO 4K0DA 3SEOA 3QVZA 1M2VB 4Z9HA 1ZHWA 3T6GB 2CCYA 3JSZA 3C63A 1FR0A 2X51A 3M15A 1LPEA 2CNWD 4JIOA 4YL0A 3RVZA 2HZ8A 3DMDA 3EZIA 3L1MA 1Z7Qc 2Y39A 4AE4B 2KNHA 1T01A 5JSLA 4CDYA 4G0HA 4U5EE 4EBJA 1VB5A 2D5RB 4N06A 3F47A 4GYTA 3W2WA 1VLSA 3DI5A 1ZYRF 2L6GA 2KC3A 3HNIA 1OQCA 5B3SC 4JC7A 1TWCA 2EPMX 2TMVP 3VF0A 3UGOA 4CIHA 1V54C 5B1AC 2HKVA 3NRHA 1NZEA 4DVZA 1Q0FA 2F22A 2VCBA 4RBNA 3G4XA 2B0JA 1D1CA 1Z63A 4U5FE 1XZQA 2XLDA 1EQ1A 3LJBA 4EIYA 1I4YA 2NSFA 3U8VA 1BR2A 3LS1A 3WG7C 5AC5A 3AG1C 4K1OA 5JRAA 4MS2A 4XEKA 1BBHA 5E3AA 1OKKA 1ORYA 5F5FA 2WVOA 3DAGA 1M57C 3OWTA 1PD1A 1OXKA 4N4WA 4MNDA 1Y4CA 3K6BA 2R25A 5AGFA 4Z9JA 4XLNF 2YL0A 5IY5C 4NTFA 4C7OA 2WVQA 1U0BB 1LE4A 3DJUB 1KU2A 2J9BA 1YYXA 1GM5A 2D4UA 4H54A 5K0IA 3IQTA 1LI7A 5L0IA 2R7RA 2DGJA 4IJJA 2R7WA 4YWQA 4CSAA 3MX3A 4CS9C 2A1DD 4YT5A 4BJ6C 1CGME 3IQ6A 4EBKA 1ZW2A 1FMVA 3KPHA 3ASOC 2ZPAA 1OW7A 1WTYA 3JRTA 3GM2A 3V5YA 4W8PA 4XQ1A 1NG1A 3H2VA 1BR1A 2NUPA 2XSEA 4B6IA 4DBQA 4E7ZA 3S9OA 3IPMO 4LDRA 1ST6A 2NUTB 3X1OA 5L0JA 1O3UA 4HE8D 5JVEA 4WJ0A 4BJ5C 2VC9A 1YZCA 4J32B 2C04A 4L6RA 3RFYA 4JTCB 2GWWA 3C8GA 3DE8A 3ECSA 3EHMA 4E0IA 4PJLA 1A7DA 3AJMA 3S27A 2KGOA 3CQZA 3KYJA 1HY5A 2H7OA 4CDVA 4JCHA 3QZCA 1TR2A 3B29A 2HMZA 4BEMJ 1EA8A 3E9VA 2L7AA 3NMJA 1NU7D 4DOZA 1U89A 1C02A 4JEBA 3Q7GA 2YL7A 3Q7LA 1MMNA 2HV7A 2J46A 4DXWA 3EFOB 4WGZA 3DKAA 4CJOA 4QI0A 1YZAA 1JAFA 2Q3TA 3JZ0A 1BR4A 4CS7A 2EPNA 3L8JA 1BZ4A 3DZAA 4I1MA 3R2PA 2AP3A 2AVKA 3DWWA 2MWQA 1UG7A 4W8KA 4PJMA 3G4ZA 3AG4C 5F28E 5KYYA 1DOWA 2GAQA 2LFFA 1Y6DA 3O10A 4FX5A 5F5HA 2YHSA 2LD6A 3U3BA 1KTMA 5KYNA 4QI2A 1K05A 3RH3A 1LKXA 2HJMA 3L8IA 3EG9A 1R4TA 3Q6MA 3MYIA 3WODF 5KYUA 3ZTZA 5COMA 3EHNA 3PCVA 4J7TA 4IAOA 1Q0KA 2IOQA 1MNDA 1LM3B 2LK4A 3DXJF 3M79A 2H7BA 2L6FA 2YLDA 5T3TA 3Q6NA 1L7CA 2W4BA 4NQFA 4D4NA 1ORSC 1NU9C 4Z9IA 1RMVA 4C3DA 5JS5A 1H7IA 3EG9B 2WZLA 2WZGA 4YT8A 4OINF 5A6BD 1JPNA 5KYUB 1RKEA 3B9QA 3JYYA 4PJNA 3NKDA 5TJ5E 5DS5A 4U5DE 1T6QA 2YEVA 3IEEA 1Z5ZA 4CIPA 1TWGA 3MFNA 1ZHXA 4PR9A 5A6JA 2R7UA 1WN0A 4H4KC 2XM0A 4ER9A 3T4RA 2WZFA 2G3VA 1G4US 5FCLA 2FAPB 5COFA 1YARO 3IHUA 2LCHA 2WL8A 2GFHA 2DYSC 3MYFA 4LLCA 4PFPA 4CDAA 3J06A 4XPXA 1KNYA 3LEVA 5L0CA 4AL0A 4BEJA 4FWVA 2OU6A 3GODA 1PV3A 3HTKC 3UMKA 4BG0A 4BJ1A 4U9EA 3V7OA 1C03A 2ZXOA 2XXAA 2L81A 3TOLA 1ZHTA 3HNJA 4EUKB 3U2LA 3UMIA 1TFOB 2IBFA 3G50A 4JEAA 3S84A 2YLIA 4XEFA 3US6A 4CJGA 2PBEA 256BA 2XRHA 3ABLC 4NC3A 3S29A 3T6JA 3SXMA 1MMDA 1PD0A 1YJGA 3AQBA 4DBRA 4MVMA 1MMGA 2IM8A 2IXMA 1V4AA 2QY9A 2XXAB 1OW6A 3N2ZB 2XL6A 3LAYA 5L0DA 4UDVA 4JURI 3JCUQ 4U9DA 5AC4A 2XL4A 2BE5F 2EPLX 4CBEA 1ORJA 3IQCA 3FHDA 3W4YA 3FDQA 3KH2A 4G7ZF 3LUTB 1CGOA 1I4ZA 2I15A 3JYHA 5DLJA 3ZTMA 3FXHA 1EKYA 5EHHA 1HMDA 3ATPA 4FESA 3SNHA 3TULA 2ZXRA 3EGXA 2PNOA 4P6IC 4GQHA 3NKEA 2R05A 1BDJB 5FZTA 3ZC4A 4ZLCA 2E87A 4PFOA 3U0CA 1FTSA 1SF8A 5DVWA 2EPKX 4BJ6A 2CNWA 2R9RB 1CPRA 4MW3A 4X0RA 3KKBA 3TJ5A 1M56C 1D0XA 3KL4A 4K7BA 1HE1A 2ICWG 4MVOA 2L9JA 2H7VC 2PX0A 2HMQA 3BEHA 3SXKA 2XLWA 1FAPB 3U2MA 3UR3C 5CI8A 5E33A 2ZD9A 3GWNA 1QZXA 3EGXB 4MQ9F 2Q9CA 1SZIA 4P9FA 5JP7A 2J9UA 1C17M 5A69A 2J0XA 1JOGA 3FAJA 4ULVA 4OD4A 3HJCA 3MLGA 2HSQA 4JJFA 2HSBA 2BC5A 3VYWA 3W8IA 3HKKA 1J8MF 4KI2A 2A68F 2DB4A 1TQGA 3EH2A 3PMRA 1O5HA 1D0YA 4YT4A 4C7OB 2ZXPA 4XPWA 3QMKA 4BPMA 4E17A 2EINC 3EPVA 3AGTA 3GWLA 2J7PD 1E86A 3N0TA 4DRJB 1O87A 4ANJA 3LNRA 1RXQA 5T3WA 3M1CB 1V55C 1YDIA 2QUPA 4YJWA 3RVYA 4YL3A 3O55A 4MVZA 3SXYA 1GGQA 2G62A 1VYIA 3F46A 4O79A 4JRZA 5CIVA 3AG2C 4CS9A 2NUPB 2C03A 3GORA 3LS0A 2OJQA 4YL1A 2AWYA 2VH3A 3AG3C 2A0UA 3TD7A 2GA0A 1OW8A 2NPUA 2Y3HA 3AOUA 3QTHA 3QW0A 1WOLA 1I5NA 2P61A 1NLXA 4U5BE 4O6YA 3V5ZA 3SP1A 4OIQF 4ONSA 2A0BA 3A9CA 2FGYA 3C8GB 2OG2A 4PJJA 1IZMA 4JW1A 5JLIA 1MMAA 1T6IA 3K1IA 3ZWIA 2IXNA 1F1MA 3AGUA 3KYIA 4XWJA 2VCCA 2WB7A 4Q4ZF 3EGDA 2P7VA 1SR2A 4KBLA 5KYWA 3K66A 2JD3A 1E85A 1APCA 2FFHA 1TWAA 4JKVA 4OIRF 3EZHA 4KNVA 1J8YF 1LE2A 3GEEA 3RF3A 1AVOB 5BQHA 4U5GA 4O6MA 2CGEA 4JVSA 2R03A 1Q0GA 2XL8A 2PX3A 1QVXA 2CW0F 4YN0B 3B0VC 2Y3GA 1FNTc 3BRJA 2XLHA 1U6HA 2R02A 4IAQA 3K1HA 4CX9A 3O39A 4QDLA 5DQZA 4IRUA 4E7SA 3POVA 2QE9A 4KNWA 1T5OA 2NSGA 5KYWB 1YVIA 3UMHA 1HW1A 4JE9A 3RQFA 1ZHYA 3IQ5A 1LS1A 5KYYB 3FAPB 3CAXA 3T6BA 4I3MA 4JTDB 5L3QA 2AWCA 1CGNA 2PF4E 3LLIA 1ZVZA 2MHRA 5BQGA 1OCOC 1ZW3A 1OR3A 2KK1A 4JCZA 2LSEA 3M4BA 1QLEC 5HSWA 1MQVA 3DD7A 4HFKB 4ULWA 3ZQVA 2EIKC 1RJ9A 2QLAA 2KW3C 1A7EA 3ZSUA 1TKNA 3KMIA 1NBBA 2HUJA 3HLZA 2X0CA 1K04A 2LQGA 2J8WA 2UUHA 1Z3IX 3LEOA 2UUIA 3X2QC 3NDBB 1E2XA 5D91A 1RKEB 3PDMP 4NTBA 3NYMA 2EPOA 2Q9BA 1SMYF 1QKRA 1A41A 1RJ9B 3K33A 4ZLDA 1QSPA 4JZAA 2DI3A 5KYXA 3OEOA 4AX2A 2J45A 2A6EF 1AEPA 1S05A 2P6VA 4MVSA 4RDAA 3VM6A 4CS8A 5A6BA 4Q7CA 2R7XA 1WGWA 2BL2A 3VRCA 3C62A 4M63A 2G3KA 4U5HA 1E84A 2CYDA 1OXBA 3TK0A 2R7SA 1A0BA 3TJ6A 2GDCA 4E0HA 4G78A 3U5SA 3LESA 2B0HA 2OEXA 3LNMB 2NG1A 5DS4A 5KYXB 3B0UX 3ABMC 3ZG1A 1H6GA 3MBGA 1L3PA 1B68A 1YAUO 4AE4A 4A4AA 1GQAA 3SZRA 1H9GA 1Q0MA 1QQ3A 2OKUA 4I1OB 4O6NA 1G4WR 1Q0DA 1WASA 3R7CA 3AQCA 4KC9A 2IXOA 4MW8A 4C3BA 5L0FA 3LLKA 3H2UA 2XLMA 2A6HF 2IXPA 2VCAA 3GM3A 4IB4A 1LVKA 4I44A 3C18A 1VMAA 2H8AA 4N6CA 3U8PA 3ZQYA 2Q4FA 3L0IA 2J9VA 4MVUA 3TQOA 3FOPA 2M64A 2M4EA 2ZXWC 2QTVA 1OKKD 2XS1A 3QVYA 5GPGB 1HMOA 2Y3BA 4LDQA 3S28A 5BUOA 5JUAA 2EIMC 4JJGA 3U3FA 4D4XA 4PACA 2HJ3A 4BJTA 5E3CA 4OIOF 4N6HA 4CSAC 3DM9B 1DOVA 2CDQA 3EQLF 3K7DA 4J30B 2VB6A 1NFOA 2LIGA 1VOMA 3I5QA 3HNLA 3S90A 3ASNC 2PP4A 2DYRC 3DE9A 2RSEB 5BQIA 3GM1A 3FVYA 3NYJA 3C8ZA 1RKCA 1T6UA 2W9YA 1FFHA 2HS5A 1ZU5A 3CZ6A 3V5XA 3GANA 5T1DB 2KQ9A 4EHPA 1VYKA 1Z6AA 4YK5A 1R5ID 3C8GD 4YT2A 4MTOA 2NUTA 3FMSA 4LDKA 1IW7F 2ASRA 3O6XA 3SXZA 3U9JA 5D92A 3A11A 5B1BC 3HNKA 2ETSA 3QW1A 1D1AA 2I8BA 1D1BA 1EI7A 4NCQA 1SYQA 4PK4A 2WVNA 1JMWA 5COGA 4EWCA 3S0XA 2YLGA 1HW2A 3I4UA 4G7OF 3NMKA 2XLEA 2XLVA 3OA1A 3PHF2 4F4BA 2Q7RA 4J7YA 4AL1A 2YZSA 1OCRC 1AUEA 2YL1A 3GEHA 3NYLA 1WWPA 1VK5A 4DJ9A 4MTFA 4FAPB 2YL3A 3ITFA 1W2WA 4R32A 1G8XA 2R7TA 3K1IC 2J7PA 1VLTA 2JPUA 2O9XA 2XLOA 3VAYA 2R7QA 4BJ5A 3W8HA 1ZHZA 3U9MA 2Y69C 3T9OA 4G7HF 4XEVA 5L0HA 1QPUA 4JTAB 4GEHA 3RYLA 1YA7O 1LIHA 3M4CA 4NTAA 4NY3A 3EFOA 5A6AA 1UFBA 1XWJA 2YKZA 3EJNA 1G5ZA 2LP4A 2P0NA 4OIPF 3ZDLA 4HEAJ 1LS4A 2YQYA
chains in the Genus database with same CATH topology
3R7CA 1JRAA 3U2LA 3LLKA 3LLIA 3GWLA 3O55A 3TK0A 1JR8A 4E0IA 3U2MA 4LDKA 4E0HA 3U5SA 3GWNA 2HJ3A 1OQCA 3MBGA 3TD7A 3W4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  1JRA A;  3U2L A;  3LLK A;  3LLI A;  3GWL A;  3O55 A;  3TK0 A;  1JR8 A;  4E0I A;  3U2M A;  4LDK A;  4E0H A;  3U5S A;  3GWN A;  2HJ3 A;  1OQC A;  3MBG A;  3TD7 A;  3W4Y A; 
#chains in the Genus database with same CATH topology
 3WHN A;  1GS9 A;  2PFD A;  3EGD B;  4EBB A;  1OCZ C;  1TWH A;  4WAB A;  3ZIB A;  4AK9 A;  5DS6 A;  2V3C C;  4IAR A;  1JRA A;  1OCC C;  1PCX A;  4DRH B;  2MYS A;  1E83 A;  1OR2 A;  3ABK C;  4E18 A;  3JT1 A;  1YA9 A;  4C3E A;  4DRI B;  3JTL O;  2HV6 A;  2YRF A;  3B71 A;  3CEX A;  3FOO A;  4U5C E;  4WGY A;  3RW0 A;  3EH1 A;  2OOC A;  5EGY A;  5HV9 A;  1ZU4 A;  4XLP F;  4DVY P;  2Y3D A;  2KYH A;  1JR8 A;  2HFI A;  2V26 A;  3E70 C;  2A69 F;  1Z23 A;  3DJN B;  1M6T A;  3RKO F;  2R7V A;  2J9W A;  2JX0 A;  4LLE A;  2J0W A;  2OJE D;  1ZZP A;  1K40 A;  4XTK A;  1H9T A;  2Z15 A;  3UNG C;  4Q5S F;  1NFN A;  4A2N B;  3CSK A;  5CI9 A;  1TFK B;  3L34 A;  1JPJ A;  3I5P A;  3NG1 A;  2EIL C;  2KJG A;  1WAT A;  1A7V A;  3C7J A;  5DQT A;  4EKW A;  5L0G A;  3DAF A;  2RD9 A;  4IWB A;  2R7O A;  2Q00 A;  2W45 A;  1MNE A;  3JRM O;  3RQG A;  5L3V A;  3N24 A;  1D0Z A;  4CS8 C;  1S7Z A;  2L6H A;  2OQM A;  4HFF B;  1YYJ A;  2EIJ C;  4P9T A;  3RQE A;  2XM4 A;  1FFT C;  5A6K A;  4MVR A;  1NSG B;  3GEI A;  4IGG A;  1FMW A;  3UGP A;  4LER A;  2IYL D;  3B0P A;  3SYN A;  2VAS A;  2OEV A;  1T9K A;  2YWA A;  2YVK A;  1HE9 A;  2KSF A;  2OCC C;  1RCP A;  3NMI A;  1M2V A;  3RIP A;  3DM5 A;  4MTG A;  2QNL A;  3ZVR A;  2Q9A A;  1LI5 A;  1XZP A;  2LFD A;  4XPY A;  3W2V A;  2P1A A;  5JT4 A;  4OD5 A;  1V74 B;  5E2Q A;  4O7G A;  3TOM A;  3WAQ A;  1M2O A;  4MVQ A;  2XS8 A;  1VTM P;  4LAC B;  5EK0 A;  2W4M A;  1YLM A;  3H65 A;  5B3I A;  4RD9 A;  1CPQ A;  1N1C A;  2AU5 A;  3JSE O;  4K0D A;  3SEO A;  3QVZ A;  1M2V B;  4Z9H A;  1ZHW A;  3T6G B;  2CCY A;  3JSZ A;  3C63 A;  1FR0 A;  2X51 A;  3M15 A;  1LPE A;  2CNW D;  4JIO A;  4YL0 A;  3RVZ A;  2HZ8 A;  3DMD A;  3EZI A;  3L1M A;  1Z7Q c;  2Y39 A;  4AE4 B;  2KNH A;  1T01 A;  5JSL A;  4CDY A;  4G0H A;  4U5E E;  4EBJ A;  1VB5 A;  2D5R B;  4N06 A;  3F47 A;  4GYT A;  3W2W A;  1VLS A;  3DI5 A;  1ZYR F;  2L6G A;  2KC3 A;  3HNI A;  1OQC A;  5B3S C;  4JC7 A;  1TWC A;  2EPM X;  2TMV P;  3VF0 A;  3UGO A;  4CIH A;  1V54 C;  5B1A C;  2HKV A;  3NRH A;  1NZE A;  4DVZ A;  1Q0F A;  2F22 A;  2VCB A;  4RBN A;  3G4X A;  2B0J A;  1D1C A;  1Z63 A;  4U5F E;  1XZQ A;  2XLD A;  1EQ1 A;  3LJB A;  4EIY A;  1I4Y A;  2NSF A;  3U8V A;  1BR2 A;  3LS1 A;  3WG7 C;  5AC5 A;  3AG1 C;  4K1O A;  5JRA A;  4MS2 A;  4XEK A;  1BBH A;  5E3A A;  1OKK A;  1ORY A;  5F5F A;  2WVO A;  3DAG A;  1M57 C;  3OWT A;  1PD1 A;  1OXK A;  4N4W A;  4MND A;  1Y4C A;  3K6B A;  2R25 A;  5AGF A;  4Z9J A;  4XLN F;  2YL0 A;  5IY5 C;  4NTF A;  4C7O A;  2WVQ A;  1U0B B;  1LE4 A;  3DJU B;  1KU2 A;  2J9B A;  1YYX A;  1GM5 A;  2D4U A;  4H54 A;  5K0I A;  3IQT A;  1LI7 A;  5L0I A;  2R7R A;  2DGJ A;  4IJJ A;  2R7W A;  4YWQ A;  4CSA A;  3MX3 A;  4CS9 C;  2A1D D;  4YT5 A;  4BJ6 C;  1CGM E;  3IQ6 A;  4EBK A;  1ZW2 A;  1FMV A;  3KPH A;  3ASO C;  2ZPA A;  1OW7 A;  1WTY A;  3JRT A;  3GM2 A;  3V5Y A;  4W8P A;  4XQ1 A;  1NG1 A;  3H2V A;  1BR1 A;  2NUP A;  2XSE A;  4B6I A;  4DBQ A;  4E7Z A;  3S9O A;  3IPM O;  4LDR A;  1ST6 A;  2NUT B;  3X1O A;  5L0J A;  1O3U A;  4HE8 D;  5JVE A;  4WJ0 A;  4BJ5 C;  2VC9 A;  1YZC A;  4J32 B;  2C04 A;  4L6R A;  3RFY A;  4JTC B;  2GWW A;  3C8G A;  3DE8 A;  3ECS A;  3EHM A;  4E0I A;  4PJL A;  1A7D A;  3AJM A;  3S27 A;  2KGO A;  3CQZ A;  3KYJ A;  1HY5 A;  2H7O A;  4CDV A;  4JCH A;  3QZC A;  1TR2 A;  3B29 A;  2HMZ A;  4BEM J;  1EA8 A;  3E9V A;  2L7A A;  3NMJ A;  1NU7 D;  4DOZ A;  1U89 A;  1C02 A;  4JEB A;  3Q7G A;  2YL7 A;  3Q7L A;  1MMN A;  2HV7 A;  2J46 A;  4DXW A;  3EFO B;  4WGZ A;  3DKA A;  4CJO A;  4QI0 A;  1YZA A;  1JAF A;  2Q3T A;  3JZ0 A;  1BR4 A;  4CS7 A;  2EPN A;  3L8J A;  1BZ4 A;  3DZA A;  4I1M A;  3R2P A;  2AP3 A;  2AVK A;  3DWW A;  2MWQ A;  1UG7 A;  4W8K A;  4PJM A;  3G4Z A;  3AG4 C;  5F28 E;  5KYY A;  1DOW A;  2GAQ A;  2LFF A;  1Y6D A;  3O10 A;  4FX5 A;  5F5H A;  2YHS A;  2LD6 A;  3U3B A;  1KTM A;  5KYN A;  4QI2 A;  1K05 A;  3RH3 A;  1LKX A;  2HJM A;  3L8I A;  3EG9 A;  1R4T A;  3Q6M A;  3MYI A;  3WOD F;  5KYU A;  3ZTZ A;  5COM A;  3EHN A;  3PCV A;  4J7T A;  4IAO A;  1Q0K A;  2IOQ A;  1MND A;  1LM3 B;  2LK4 A;  3DXJ F;  3M79 A;  2H7B A;  2L6F A;  2YLD A;  5T3T A;  3Q6N A;  1L7C A;  2W4B A;  4NQF A;  4D4N A;  1ORS C;  1NU9 C;  4Z9I A;  1RMV A;  4C3D A;  5JS5 A;  1H7I A;  3EG9 B;  2WZL A;  2WZG A;  4YT8 A;  4OIN F;  5A6B D;  1JPN A;  5KYU B;  1RKE A;  3B9Q A;  3JYY A;  4PJN A;  3NKD A;  5TJ5 E;  5DS5 A;  4U5D E;  1T6Q A;  2YEV A;  3IEE A;  1Z5Z A;  4CIP A;  1TWG A;  3MFN A;  1ZHX A;  4PR9 A;  5A6J A;  2R7U A;  1WN0 A;  4H4K C;  2XM0 A;  4ER9 A;  3T4R A;  2WZF A;  2G3V A;  1G4U S;  5FCL A;  2FAP B;  5COF A;  1YAR O;  3IHU A;  2LCH A;  2WL8 A;  2GFH A;  2DYS C;  3MYF A;  4LLC A;  4PFP A;  4CDA A;  3J06 A;  4XPX A;  1KNY A;  3LEV A;  5L0C A;  4AL0 A;  4BEJ A;  4FWV A;  2OU6 A;  3GOD A;  1PV3 A;  3HTK C;  3UMK A;  4BG0 A;  4BJ1 A;  4U9E A;  3V7O A;  1C03 A;  2ZXO A;  2XXA A;  2L81 A;  3TOL A;  1ZHT A;  3HNJ A;  4EUK B;  3U2L A;  3UMI A;  1TFO B;  2IBF A;  3G50 A;  4JEA A;  3S84 A;  2YLI A;  4XEF A;  3US6 A;  4CJG A;  2PBE A;  256B A;  2XRH A;  3ABL C;  4NC3 A;  3S29 A;  3T6J A;  3SXM A;  1MMD A;  1PD0 A;  1YJG A;  3AQB A;  4DBR A;  4MVM A;  1MMG A;  2IM8 A;  2IXM A;  1V4A A;  2QY9 A;  2XXA B;  1OW6 A;  3N2Z B;  2XL6 A;  3LAY A;  5L0D A;  4UDV A;  4JUR I;  3JCU Q;  4U9D A;  5AC4 A;  2XL4 A;  2BE5 F;  2EPL X;  4CBE A;  1ORJ A;  3IQC A;  3FHD A;  3W4Y A;  3FDQ A;  3KH2 A;  4G7Z F;  3LUT B;  1CGO A;  1I4Z A;  2I15 A;  3JYH A;  5DLJ A;  3ZTM A;  3FXH A;  1EKY A;  5EHH A;  1HMD A;  3ATP A;  4FES A;  3SNH A;  3TUL A;  2ZXR A;  3EGX A;  2PNO A;  4P6I C;  4GQH A;  3NKE A;  2R05 A;  1BDJ B;  5FZT A;  3ZC4 A;  4ZLC A;  2E87 A;  4PFO A;  3U0C A;  1FTS A;  1SF8 A;  5DVW A;  2EPK X;  4BJ6 A;  2CNW A;  2R9R B;  1CPR A;  4MW3 A;  4X0R A;  3KKB A;  3TJ5 A;  1M56 C;  1D0X A;  3KL4 A;  4K7B A;  1HE1 A;  2ICW G;  4MVO A;  2L9J A;  2H7V C;  2PX0 A;  2HMQ A;  3BEH A;  3SXK A;  2XLW A;  1FAP B;  3U2M A;  3UR3 C;  5CI8 A;  5E33 A;  2ZD9 A;  3GWN A;  1QZX A;  3EGX B;  4MQ9 F;  2Q9C A;  1SZI A;  4P9F A;  5JP7 A;  2J9U A;  1C17 M;  5A69 A;  2J0X A;  1JOG A;  3FAJ A;  4ULV A;  4OD4 A;  3HJC A;  3MLG A;  2HSQ A;  4JJF A;  2HSB A;  2BC5 A;  3VYW A;  3W8I A;  3HKK A;  1J8M F;  4KI2 A;  2A68 F;  2DB4 A;  1TQG A;  3EH2 A;  3PMR A;  1O5H A;  1D0Y A;  4YT4 A;  4C7O B;  2ZXP A;  4XPW A;  3QMK A;  4BPM A;  4E17 A;  2EIN C;  3EPV A;  3AGT A;  3GWL A;  2J7P D;  1E86 A;  3N0T A;  4DRJ B;  1O87 A;  4ANJ A;  3LNR A;  1RXQ A;  5T3W A;  3M1C B;  1V55 C;  1YDI A;  2QUP A;  4YJW A;  3RVY A;  4YL3 A;  3O55 A;  4MVZ A;  3SXY A;  1GGQ A;  2G62 A;  1VYI A;  3F46 A;  4O79 A;  4JRZ A;  5CIV A;  3AG2 C;  4CS9 A;  2NUP B;  2C03 A;  3GOR A;  3LS0 A;  2OJQ A;  4YL1 A;  2AWY A;  2VH3 A;  3AG3 C;  2A0U A;  3TD7 A;  2GA0 A;  1OW8 A;  2NPU A;  2Y3H A;  3AOU A;  3QTH A;  3QW0 A;  1WOL A;  1I5N A;  2P61 A;  1NLX A;  4U5B E;  4O6Y A;  3V5Z A;  3SP1 A;  4OIQ F;  4ONS A;  2A0B A;  3A9C A;  2FGY A;  3C8G B;  2OG2 A;  4PJJ A;  1IZM A;  4JW1 A;  5JLI A;  1MMA A;  1T6I A;  3K1I A;  3ZWI A;  2IXN A;  1F1M A;  3AGU A;  3KYI A;  4XWJ A;  2VCC A;  2WB7 A;  4Q4Z F;  3EGD A;  2P7V A;  1SR2 A;  4KBL A;  5KYW A;  3K66 A;  2JD3 A;  1E85 A;  1APC A;  2FFH A;  1TWA A;  4JKV A;  4OIR F;  3EZH A;  4KNV A;  1J8Y F;  1LE2 A;  3GEE A;  3RF3 A;  1AVO B;  5BQH A;  4U5G A;  4O6M A;  2CGE A;  4JVS A;  2R03 A;  1Q0G A;  2XL8 A;  2PX3 A;  1QVX A;  2CW0 F;  4YN0 B;  3B0V C;  2Y3G A;  1FNT c;  3BRJ A;  2XLH A;  1U6H A;  2R02 A;  4IAQ A;  3K1H A;  4CX9 A;  3O39 A;  4QDL A;  5DQZ A;  4IRU A;  4E7S A;  3POV A;  2QE9 A;  4KNW A;  1T5O A;  2NSG A;  5KYW B;  1YVI A;  3UMH A;  1HW1 A;  4JE9 A;  3RQF A;  1ZHY A;  3IQ5 A;  1LS1 A;  5KYY B;  3FAP B;  3CAX A;  3T6B A;  4I3M A;  4JTD B;  5L3Q A;  2AWC A;  1CGN A;  2PF4 E;  3LLI A;  1ZVZ A;  2MHR A;  5BQG A;  1OCO C;  1ZW3 A;  1OR3 A;  2KK1 A;  4JCZ A;  2LSE A;  3M4B A;  1QLE C;  5HSW A;  1MQV A;  3DD7 A;  4HFK B;  4ULW A;  3ZQV A;  2EIK C;  1RJ9 A;  2QLA A;  2KW3 C;  1A7E A;  3ZSU A;  1TKN A;  3KMI A;  1NBB A;  2HUJ A;  3HLZ A;  2X0C A;  1K04 A;  2LQG A;  2J8W A;  2UUH A;  1Z3I X;  3LEO A;  2UUI A;  3X2Q C;  3NDB B;  1E2X A;  5D91 A;  1RKE B;  3PDM P;  4NTB A;  3NYM A;  2EPO A;  2Q9B A;  1SMY F;  1QKR A;  1A41 A;  1RJ9 B;  3K33 A;  4ZLD A;  1QSP A;  4JZA A;  2DI3 A;  5KYX A;  3OEO A;  4AX2 A;  2J45 A;  2A6E F;  1AEP A;  1S05 A;  2P6V A;  4MVS A;  4RDA A;  3VM6 A;  4CS8 A;  5A6B A;  4Q7C A;  2R7X A;  1WGW A;  2BL2 A;  3VRC A;  3C62 A;  4M63 A;  2G3K A;  4U5H A;  1E84 A;  2CYD A;  1OXB A;  3TK0 A;  2R7S A;  1A0B A;  3TJ6 A;  2GDC A;  4E0H A;  4G78 A;  3U5S A;  3LES A;  2B0H A;  2OEX A;  3LNM B;  2NG1 A;  5DS4 A;  5KYX B;  3B0U X;  3ABM C;  3ZG1 A;  1H6G A;  3MBG A;  1L3P A;  1B68 A;  1YAU O;  4AE4 A;  4A4A A;  1GQA A;  3SZR A;  1H9G A;  1Q0M A;  1QQ3 A;  2OKU A;  4I1O B;  4O6N A;  1G4W R;  1Q0D A;  1WAS A;  3R7C A;  3AQC A;  4KC9 A;  2IXO A;  4MW8 A;  4C3B A;  5L0F A;  3LLK A;  3H2U A;  2XLM A;  2A6H F;  2IXP A;  2VCA A;  3GM3 A;  4IB4 A;  1LVK A;  4I44 A;  3C18 A;  1VMA A;  2H8A A;  4N6C A;  3U8P A;  3ZQY A;  2Q4F A;  3L0I A;  2J9V A;  4MVU A;  3TQO A;  3FOP A;  2M64 A;  2M4E A;  2ZXW C;  2QTV A;  1OKK D;  2XS1 A;  3QVY A;  5GPG B;  1HMO A;  2Y3B A;  4LDQ A;  3S28 A;  5BUO A;  5JUA A;  2EIM C;  4JJG A;  3U3F A;  4D4X A;  4PAC A;  2HJ3 A;  4BJT A;  5E3C A;  4OIO F;  4N6H A;  4CSA C;  3DM9 B;  1DOV A;  2CDQ A;  3EQL F;  3K7D A;  4J30 B;  2VB6 A;  1NFO A;  2LIG A;  1VOM A;  3I5Q A;  3HNL A;  3S90 A;  3ASN C;  2PP4 A;  2DYR C;  3DE9 A;  2RSE B;  5BQI A;  3GM1 A;  3FVY A;  3NYJ A;  3C8Z A;  1RKC A;  1T6U A;  2W9Y A;  1FFH A;  2HS5 A;  1ZU5 A;  3CZ6 A;  3V5X A;  3GAN A;  5T1D B;  2KQ9 A;  4EHP A;  1VYK A;  1Z6A A;  4YK5 A;  1R5I D;  3C8G D;  4YT2 A;  4MTO A;  2NUT A;  3FMS A;  4LDK A;  1IW7 F;  2ASR A;  3O6X A;  3SXZ A;  3U9J A;  5D92 A;  3A11 A;  5B1B C;  3HNK A;  2ETS A;  3QW1 A;  1D1A A;  2I8B A;  1D1B A;  1EI7 A;  4NCQ A;  1SYQ A;  4PK4 A;  2WVN A;  1JMW A;  5COG A;  4EWC A;  3S0X A;  2YLG A;  1HW2 A;  3I4U A;  4G7O F;  3NMK A;  2XLE A;  2XLV A;  3OA1 A;  3PHF 2;  4F4B A;  2Q7R A;  4J7Y A;  4AL1 A;  2YZS A;  1OCR C;  1AUE A;  2YL1 A;  3GEH A;  3NYL A;  1WWP A;  1VK5 A;  4DJ9 A;  4MTF A;  4FAP B;  2YL3 A;  3ITF A;  1W2W A;  4R32 A;  1G8X A;  2R7T A;  3K1I C;  2J7P A;  1VLT A;  2JPU A;  2O9X A;  2XLO A;  3VAY A;  2R7Q A;  4BJ5 A;  3W8H A;  1ZHZ A;  3U9M A;  2Y69 C;  3T9O A;  4G7H F;  4XEV A;  5L0H A;  1QPU A;  4JTA B;  4GEH A;  3RYL A;  1YA7 O;  1LIH A;  3M4C A;  4NTA A;  4NY3 A;  3EFO A;  5A6A A;  1UFB A;  1XWJ A;  2YKZ A;  3EJN A;  1G5Z A;  2LP4 A;  2P0N A;  4OIP F;  3ZDL A;  4HEA J;  1LS4 A;  2YQY A; 
#chains in the Genus database with same CATH homology
 3R7C A;  1JRA A;  3U2L A;  3LLK A;  3LLI A;  3GWL A;  3O55 A;  3TK0 A;  1JR8 A;  4E0I A;  3U2M A;  4LDK A;  4E0H A;  3U5S A;  3GWN A;  2HJ3 A;  1OQC A;  3MBG A;  3TD7 A;  3W4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...