3MBGA

Crystal structure of human augmenter of liver regeneration (alr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
DCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human sulfhydryl oxidase augmenter of liver regeneration and characterization of a human mutation causing an autosomal recessive myopathy .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3mbgA00
3R7CA 1JR8A 3TD7A 3GWNA 4E0IA 2HJ3A 3O55A 3GWLA 3LLIA 3MBGA 3U2LA 4LDKA 1JRAA 3W4YA 1OQCA 3LLKA 3U5SA 4E0HA 3U2MA 3TK0A
chains in the Genus database with same CATH superfamily
3LNMB 5T3TA 3GWNA 1O5HA 2PX0A 2VCAA 1AVOB 3M79A 4GEHA 4RD9A 4FAPB 4J7TA 1G4WR 4G0HA 4J7YA 4MVOA 4C3EA 1OR3A 2KGOA 1J8MF 3G50A 1VLSA 3JSEO 2XLOA 1Q0GA 1GQAA 3C7JA 4C3BA 4KNWA 4J30B 4E18A 4JJGA 1OCCC 4YJWA 3SEOA 3SYNA 3IHUA 1S05A 1A7DA 4NC3A 3UMHA 2CNWA 4MTOA 3B0PA 5DVWA 1DOVA 2HV6A 1D1CA 2RSEB 3AQBA 3V5ZA 1NZEA 4CJGA 1LE2A 3H2UA 3IQ6A 2QNLA 5KYWA 2YL0A 4B6IA 4C7OB 4BJ6A 1EI7A 1WTYA 1D0YA 2YHSA 3ASOC 3FVYA 3ASNC 1TWCA 4LLCA 1ZHXA 4KNVA 2HZ8A 4AE4B 5BQIA 2GA0A 2CYDA 2Q9AA 4YL0A 2WZGA 3HKKA 3VM6A 4ER9A 4U5FE 2LD6A 5L0HA 1ORYA 1FAPB 2ZXPA 4O6NA 2WZLA 2D5RB 2X51A 3HNLA 5L0FA 2NG1A 3QVZA 4N06A 1ZHZA 4KC9A 4R32A 3T6GB 1OW6A 1BR2A 4MW8A 3AGTA 3HJCA 4OIOF 3V5XA 2J9WA 4W8KA 1BZ4A 2R7QA 2XXAA 3QTHA 2V3CC 1YA9A 4HFKB 1K04A 1VTMP 1HY5A 2XLMA 3LESA 3WODF 4C7OA 4CSAA 3RQGA 4GYTA 1TFKB 1O3UA 4JCZA 5EHHA 5DQTA 3U8PA 4IRUA 1YAUO 3KL4A 1VOMA 3VRCA 2A0UA 2IXNA 2DGJA 2WVNA 3U9JA 3GM2A 5JVEA 3TULA 3C63A 2FAPB 2A69F 4P9TA 4EHPA 4ZLCA 3DMDA 3ZIBA 5CI9A 2A1DD 2HJ3A 1YLMA 2LFFA 1A0BA 2AWCA 2Y3HA 3JRTA 2LSEA 3L0IA 1XWJA 4JEBA 4PJLA 3T4RA 1U0BB 3TJ5A 3S29A 1Q0FA 4NTBA 4G7OF 1R5ID 3FAJA 3L8IA 2A68F 2XLEA 4KBLA 4CS9A 5L3QA 5DS5A 1D1AA 2HFIA 2VASA 3B29A 3DKAA 4KI2A 2PF4E 2D4UA 2R03A 4ONSA 1LPEA 2JPUA 2IXMA 1OKKA 2CDQA 2HJMA 2LIGA 2IYLD 3UGPA 1PCXA 4DOZA 3O55A 4DVYP 1U89A 4IAQA 3OWTA 5F5FA 1ZU4A 4RDAA 1NU7D 1V55C 1EA8A 1LIHA 3EFOB 5AC4A 3FOPA 4RBNA 5EGYA 1QLEC 5DS6A 1L3PA 4MVZA 2VH3A 2YLGA 2YEVA 4P9FA 4A2NB 4CDAA 3G4ZA 3B9QA 3QW1A 1G5ZA 1WWPA 2BL2A 1AUEA 2VCCA 3DJUB 4MTGA 2Q9CA 2X0CA 2NUTA 1FNTc 3ATPA 3NMIA 4C3DA 1Q0MA 1ZHTA 3AJMA 4XPXA 5D92A 3U5SA 1I4ZA 3UMKA 3JT1A 2JX0A 4ANJA 2YL1A 3MYIA 1ST6A 2R02A 3RKOF 4AE4A 2R7UA 2PFDA 3EPVA 3JYHA 3FAPB 256BA 3MFNA 1HMOA 2Y69C 3SP1A 3X1OA 3B71A 4BJ1A 4DBQA 2XRHA 2WVOA 3AQCA 2EIJC 4NTFA 3W2WA 1S7ZA 3R2PA 4LDQA 3EQLF 4JZAA 3UMIA 3W4YA 1BR1A 2VB6A 2EPKX 2KQ9A 2EPLX 3S0XA 3LLIA 4G7ZF 3NYMA 1L7CA 4CDVA 5KYYA 2Q3TA 2QE9A 5B1AC 3SXZA 5BQHA 4XTKA 3SXYA 3LJBA 2LQGA 2OEXA 2QTVA 2HMQA 1V74B 1HW1A 1A7EA 2YWAA 2Z15A 3ABMC 1I5NA 2DYRC 2EPMX 3G4XA 2VC9A 2W45A 4I44A 3BEHA 3JTLO 5L0IA 3OA1A 1K40A 3ZWIA 1OCOC 5L0JA 2E87A 3U2MA 3ZSUA 4BG0A 3CEXA 4CDYA 3K7DA 3N2ZB 2W4BA 1NSGB 3RH3A 2ZPAA 4IWBA 4AL1A 2WB7A 2OU6A 3DI5A 2I8BA 3DJNB 3U8VA 2KW3C 2Y39A 1XZPA 3ZQYA 2DYSC 2KYHA 3I5PA 3N24A 3K1IA 5GPGB 1APCA 3T9OA 1RXQA 2XS8A 3KPHA 3GM3A 5KYUA 4CIHA 4XWJA 2TMVP 2J45A 1UG7A 1VLTA 3DXJF 4AX2A 3AG3C 3TK0A 3EGDB 4DVZA 4MVSA 3HNKA 4BJ5A 4BEJA 1Q0KA 3N0TA 1PV3A 3EJNA 2L9JA 4OD5A 2V26A 4K1OA 4FESA 5DQZA 2R7RA 2P6VA 3JRMO 3MYFA 1M2VB 2Q4FA 3I5QA 3KH2A 3NG1A 3QMKA 2YLIA 4O7GA 1YYJA 3SXKA 3AGUA 2HSQA 1VK5A 2CW0F 1MNDA 3ECSA 5E2QA 4PJNA 3V7OA 2HS5A 1CGOA 2I15A 1O87A 3MX3A 1KTMA 1ZVZA 4MS2A 4OIQF 2GWWA 3IPMO 1SYQA 4WGZA 1G8XA 1QVXA 2NUPA 2HMZA 5D91A 4W8PA 3EZHA 3QW0A 2ZXOA 3X2QC 5KYNA 4P6IC 2HKVA 1T6QA 1LE4A 4IGGA 3O6XA 2G62A 3U9MA 3J06A 2XL6A 3M4CA 2FGYA 4O6MA 3JYYA 5E33A 1MNEA 5COGA 3DM5A 1ORJA 5B1BC 2R7TA 3CZ6A 2CCYA 3GWLA 2XXAB 1R4TA 3F46A 4N6CA 5DS4A 2ETSA 3L34A 2J9VA 3LLKA 3O39A 2L6HA 1LI7A 1C02A 4G78A 4JKVA 3WHNA 3EH1A 3JZ0A 4U5HA 4JIOA 1HE1A 4QDLA 4D4XA 1OCZC 2FFHA 5FCLA 2Q00A 1HW2A 1LS1A 4E7SA 4CJOA 2J9UA 1GS9A 4YT5A 3W8IA 3K33A 1QQ3A 2A6HF 5L3VA 3EGXA 2R7OA 2OJQA 2WL8A 1LVKA 1T01A 4DRJB 3U2LA 3AG2C 4CS8C 3A9CA 5L0DA 3DZAA 3WAQA 4CX9A 2P0NA 4JEAA 4QI0A 5KYXA 4XLNF 3KYIA 3ZG1A 4WGYA 2XLDA 5TJ5E 4JW1A 3NKEA 1IZMA 1A41A 3C18A 2O9XA 4ULWA 3LNRA 2OEVA 4DXWA 4Z9IA 4DRHB 1JPNA 1B68A 4Q5SF 3LAYA 4PJJA 1JPJA 2MYSA 5DLJA 4IAOA 1SR2A 1YZAA 2OOCA 3DAGA 2EPOA 3NMJA 3PCVA 2W4MA 4IARA 2EIMC 4ZLDA 4LDKA 4JTCB 1JRAA 1TKNA 1E86A 1EKYA 4PR9A 1RKEA 3ABKC 2QUPA 3R7CA 5COFA 3NRHA 4K7BA 3DAFA 4BJTA 4U5BE 1M2OA 2PNOA 1H9GA 2L81A 2ZXRA 2C03A 1NFOA 3DD7A 1TWGA 4YT2A 5JS5A 2GFHA 2LFDA 5KYWB 1SZIA 1WGWA 2J0WA 1SMYF 1ZW2A 4F4BA 2HV7A 1A7VA 4E0HA 2KJGA 2ASRA 2Q7RA 4CBEA 1IW7F 3Q6MA 1H6GA 5F5HA 2IOQA 3RFYA 1OR2A 4JC7A 3CSKA 4DJ9A 5A6KA 3TQOA 5HV9A 3NDBB 4EUKB 3B0VC 3NYLA 2XLHA 3AG1C 3EG9A 4YK5A 1FTSA 3ABLC 4JRZA 4LACB 1YJGA 1BR4A 2J8WA 4NCQA 3MBGA 1ZW3A 4IB4A 4BJ6C 1M56C 1T5OA 4PFOA 2R05A 1PD0A 4G7HF 1TR2A 1MMAA 1WASA 2HUJA 3E9VA 3EG9B 1T9KA 4EKWA 2YRFA 3H65A 2LK4A 4PACA 2A0BA 4DRIB 3QZCA 3HLZA 1Z7Qc 4YL3A 5B3SC 3RYLA 2L7AA 3CAXA 2H7BA 4DBRA 1NU9C 4XEVA 1F1MA 1CGNA 4BPMA 3L8JA 1CGME 2KK1A 2P61A 2YZSA 4JTDB 4CSAC 1PD1A 1ZZPA 5IY5C 1LM3B 2KC3A 4CIPA 4I3MA 3FDQA 2QLAA 4CS8A 4MVUA 1LI5A 3IEEA 4WABA 3C8GB 5T3WA 3VF0A 1OXBA 1YZCA 1CPQA 1D0ZA 3US6A 2B0JA 2WZFA 2AP3A 3HTKC 4NY3A 3SZRA 3SXMA 1RKCA 3B0UX 1BBHA 4O6YA 2XM0A 1VYIA 2EPNA 1FMVA 4BEMJ 3VAYA 4L6RA 4OD4A 1D0XA 5KYXB 3W8HA 1E83A 1WN0A 1OW8A 3LS0A 2KSFA 3M1CB 3IQTA 3ITFA 3ZC4A 1HMDA 1Q0DA 3DWWA 3OEOA 1OKKD 3KMIA 1QSPA 3PMRA 1GGQA 1M57C 4H4KC 3TD7A 3W2VA 2XSEA 3K66A 2GAQA 5B3IA 3MLGA 3ZQVA 5KYUB 1J8YF 3Q6NA 3TJ6A 3U3FA 5BQGA 1YYXA 3EGDA 3FMSA 3GEIA 4U9EA 1V54C 3JCUQ 3S90A 5A6BA 3ZTMA 4JE9A 3GEEA 1DOWA 2YL7A 4N6HA 4MW3A 3TOLA 4XEFA 5JSLA 4CS7A 2CGEA 1T6UA 2YVKA 4IJJA 3RVZA 2ZXWC 4D4NA 3LEOA 2AU5A 4PFPA 4U9DA 3WG7C 1M2VA 3LEVA 2PBEA 3HNIA 4JURI 3RQEA 2J9BA 3RW0A 4AL0A 2H8AA 1K05A 1ZYRF 4MNDA 3RVYA 3T6JA 1E84A 2IM8A 5COMA 4XLPF 2G3KA 4NTAA 4YWQA 4U5GA 3NYJA 3C8ZA 4U5EE 1OW7A 4MTFA 1C03A 2R7SA 4LLEA 1I4YA 4EIYA 4U5CE 5HSWA 2AVKA 3KYJA 4MVQA 1D1BA 1U6HA 3PDMP 2M64A 3VYWA 2B0HA 5A6JA 4M63A 2A6EF 2OKUA 2MHRA 1C17M 2P1AA 5FZTA 4YT8A 5EK0A 5JT4A 3SNHA 1NLXA 1JR8A 1WOLA 1KNYA 2G3VA 2HSBA 2OQMA 2XL4A 1Z6AA 2JD3A 3A11A 3EH2A 1FR0A 2NUTB 1FMWA 1CPRA 2R25A 2Y3GA 1UFBA 1FFTC 2DB4A 3IQCA 1VB5A 4YL1A 2UUHA 4NQFA 2BE5F 4PK4A 4WJ0A 3ZVRA 4X0RA 1V4AA 1JOGA 2BC5A 2P7VA 4I1OB 1JMWA 1JAFA 3ZDLA 3HNJA 5L0CA 1RCPA 4I1MA 4XEKA 4MVMA 1GM5A 2AWYA 4U5DE 3K1IC 4K0DA 1G4US 2WVQA 3I4UA 3UR3C 2YL3A 3IQ5A 3RQFA 1HE9A 1RJ9A 2L6GA 4OIRF 4AK9A 2NSFA 4HE8D 1ORSC 5A6BD 2J46A 4EWCA 4YT4A 1FFHA 5K0IA 1OCRC 1Z5ZA 2Y3BA 2UUIA 3KKBA 2EINC 4Q4ZF 1Z3IX 2PP4A 3EGXB 4JJFA 3GANA 2J0XA 1RJ9B 2ICWG 1MMDA 3GORA 3H2VA 5KYYB 3FHDA 1Z63A 2IXPA 1TQGA 1LS4A 4Z9HA 2GDCA 4EBKA 2EILC 2OCCC 3S84A 2W9YA 3M15A 4MVRA 2NPUA 2LCHA 3DM9B 2MWQA 2VCBA 3CQZA 4E0IA 4FWVA 2R7WA 1NBBA 4GQHA 1QZXA 2L6FA 5CI8A 2KNHA 5JLIA 5E3AA 3FOOA 3JSZA 4ULVA 3S28A 3M4BA 1Y4CA 3E70C 2R7VA 4JCHA 5E3CA 3S27A 3POVA 4XQ1A 4CS9C 2OJED 3C62A 4Q7CA 2M4EA 3EZIA 3NKDA 1W2WA 3BRJA 3AOUA 3L1MA 2NSGA 3F47A 1ZHYA 4A4AA 3C8GD 1H7IA 1TWHA 1KU2A 3V5YA 3PHF2 4N4WA 2DI3A 3EHNA 2XS1A 5L0GA 1QKRA 1OQCA 4MQ9F 2IXOA 3EHMA 1BDJB 4PJMA 3EFOA 5JUAA 4QI2A 1SF8A 1AEPA 4OINF 3NMKA 1YA7O 3U0CA 4BJ5C 2QY9A 1MMGA 4OIPF 5JP7A 3QVYA 2XM4A 3TOMA 1E85A 4LDRA 4FX5A 1NG1A 1YDIA 4HFFB 2YLDA 3K6BA 1LKXA 3UGOA 1T6IA 2J7PA 1XZQA 1ZHWA 3T6BA 2XL8A 1M6TA 1E2XA 4O79A 2NUPB 4E17A 5CIVA 3DE9A 3Q7LA 1YARO 3GODA 1TFOB 1N1CA 5AGFA 2OG2A 1WATA 3DE8A 3GEHA 1VYKA 5T1DB 1Y6DA 2Y3DA 1TWAA 1YVIA 1H9TA 3Q7GA 3ZTZA 1NFNA 3K1HA 4E7ZA 4Z9JA 3C8GA 3FXHA 2H7OA 2CNWD 2XLVA 5BUOA 5A6AA 4EBJA 1RMVA 4EBBA 1EQ1A 5A69A 2EIKC 2R9RB 1OXKA 4YN0B 1MMNA 2F22A 2XLWA 4XPYA 2PX3A 4J32B 3RF3A 5AC5A 2ZD9A 3UNGC 3GM1A 4JVSA 5F28E 2IBFA 3LS1A 2YKZA 3LUTB 3O10A 4JTAB 3RIPA 1MQVA 2LP4A 4H54A 5JRAA 2R7XA 2Q9BA 2RD9A 3AG4C 3U3BA 4XPWA 2YQYA 3S9OA 1Z23A 1ZU5A 4UDVA 2H7VC 1RKEB 4LERA 2J7PD 1QPUA 2C04A 4HEAJ 1VMAA
chains in the Genus database with same CATH topology
3R7CA 1JR8A 3TD7A 3GWNA 4E0IA 2HJ3A 3O55A 3GWLA 3LLIA 3MBGA 3U2LA 4LDKA 1JRAA 3W4YA 1OQCA 3LLKA 3U5SA 4E0HA 3U2MA 3TK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  1JR8 A;  3TD7 A;  3GWN A;  4E0I A;  2HJ3 A;  3O55 A;  3GWL A;  3LLI A;  3MBG A;  3U2L A;  4LDK A;  1JRA A;  3W4Y A;  1OQC A;  3LLK A;  3U5S A;  4E0H A;  3U2M A;  3TK0 A; 
#chains in the Genus database with same CATH topology
 3LNM B;  5T3T A;  3GWN A;  1O5H A;  2PX0 A;  2VCA A;  1AVO B;  3M79 A;  4GEH A;  4RD9 A;  4FAP B;  4J7T A;  1G4W R;  4G0H A;  4J7Y A;  4MVO A;  4C3E A;  1OR3 A;  2KGO A;  1J8M F;  3G50 A;  1VLS A;  3JSE O;  2XLO A;  1Q0G A;  1GQA A;  3C7J A;  4C3B A;  4KNW A;  4J30 B;  4E18 A;  4JJG A;  1OCC C;  4YJW A;  3SEO A;  3SYN A;  3IHU A;  1S05 A;  1A7D A;  4NC3 A;  3UMH A;  2CNW A;  4MTO A;  3B0P A;  5DVW A;  1DOV A;  2HV6 A;  1D1C A;  2RSE B;  3AQB A;  3V5Z A;  1NZE A;  4CJG A;  1LE2 A;  3H2U A;  3IQ6 A;  2QNL A;  5KYW A;  2YL0 A;  4B6I A;  4C7O B;  4BJ6 A;  1EI7 A;  1WTY A;  1D0Y A;  2YHS A;  3ASO C;  3FVY A;  3ASN C;  1TWC A;  4LLC A;  1ZHX A;  4KNV A;  2HZ8 A;  4AE4 B;  5BQI A;  2GA0 A;  2CYD A;  2Q9A A;  4YL0 A;  2WZG A;  3HKK A;  3VM6 A;  4ER9 A;  4U5F E;  2LD6 A;  5L0H A;  1ORY A;  1FAP B;  2ZXP A;  4O6N A;  2WZL A;  2D5R B;  2X51 A;  3HNL A;  5L0F A;  2NG1 A;  3QVZ A;  4N06 A;  1ZHZ A;  4KC9 A;  4R32 A;  3T6G B;  1OW6 A;  1BR2 A;  4MW8 A;  3AGT A;  3HJC A;  4OIO F;  3V5X A;  2J9W A;  4W8K A;  1BZ4 A;  2R7Q A;  2XXA A;  3QTH A;  2V3C C;  1YA9 A;  4HFK B;  1K04 A;  1VTM P;  1HY5 A;  2XLM A;  3LES A;  3WOD F;  4C7O A;  4CSA A;  3RQG A;  4GYT A;  1TFK B;  1O3U A;  4JCZ A;  5EHH A;  5DQT A;  3U8P A;  4IRU A;  1YAU O;  3KL4 A;  1VOM A;  3VRC A;  2A0U A;  2IXN A;  2DGJ A;  2WVN A;  3U9J A;  3GM2 A;  5JVE A;  3TUL A;  3C63 A;  2FAP B;  2A69 F;  4P9T A;  4EHP A;  4ZLC A;  3DMD A;  3ZIB A;  5CI9 A;  2A1D D;  2HJ3 A;  1YLM A;  2LFF A;  1A0B A;  2AWC A;  2Y3H A;  3JRT A;  2LSE A;  3L0I A;  1XWJ A;  4JEB A;  4PJL A;  3T4R A;  1U0B B;  3TJ5 A;  3S29 A;  1Q0F A;  4NTB A;  4G7O F;  1R5I D;  3FAJ A;  3L8I A;  2A68 F;  2XLE A;  4KBL A;  4CS9 A;  5L3Q A;  5DS5 A;  1D1A A;  2HFI A;  2VAS A;  3B29 A;  3DKA A;  4KI2 A;  2PF4 E;  2D4U A;  2R03 A;  4ONS A;  1LPE A;  2JPU A;  2IXM A;  1OKK A;  2CDQ A;  2HJM A;  2LIG A;  2IYL D;  3UGP A;  1PCX A;  4DOZ A;  3O55 A;  4DVY P;  1U89 A;  4IAQ A;  3OWT A;  5F5F A;  1ZU4 A;  4RDA A;  1NU7 D;  1V55 C;  1EA8 A;  1LIH A;  3EFO B;  5AC4 A;  3FOP A;  4RBN A;  5EGY A;  1QLE C;  5DS6 A;  1L3P A;  4MVZ A;  2VH3 A;  2YLG A;  2YEV A;  4P9F A;  4A2N B;  4CDA A;  3G4Z A;  3B9Q A;  3QW1 A;  1G5Z A;  1WWP A;  2BL2 A;  1AUE A;  2VCC A;  3DJU B;  4MTG A;  2Q9C A;  2X0C A;  2NUT A;  1FNT c;  3ATP A;  3NMI A;  4C3D A;  1Q0M A;  1ZHT A;  3AJM A;  4XPX A;  5D92 A;  3U5S A;  1I4Z A;  3UMK A;  3JT1 A;  2JX0 A;  4ANJ A;  2YL1 A;  3MYI A;  1ST6 A;  2R02 A;  3RKO F;  4AE4 A;  2R7U A;  2PFD A;  3EPV A;  3JYH A;  3FAP B;  256B A;  3MFN A;  1HMO A;  2Y69 C;  3SP1 A;  3X1O A;  3B71 A;  4BJ1 A;  4DBQ A;  2XRH A;  2WVO A;  3AQC A;  2EIJ C;  4NTF A;  3W2W A;  1S7Z A;  3R2P A;  4LDQ A;  3EQL F;  4JZA A;  3UMI A;  3W4Y A;  1BR1 A;  2VB6 A;  2EPK X;  2KQ9 A;  2EPL X;  3S0X A;  3LLI A;  4G7Z F;  3NYM A;  1L7C A;  4CDV A;  5KYY A;  2Q3T A;  2QE9 A;  5B1A C;  3SXZ A;  5BQH A;  4XTK A;  3SXY A;  3LJB A;  2LQG A;  2OEX A;  2QTV A;  2HMQ A;  1V74 B;  1HW1 A;  1A7E A;  2YWA A;  2Z15 A;  3ABM C;  1I5N A;  2DYR C;  2EPM X;  3G4X A;  2VC9 A;  2W45 A;  4I44 A;  3BEH A;  3JTL O;  5L0I A;  3OA1 A;  1K40 A;  3ZWI A;  1OCO C;  5L0J A;  2E87 A;  3U2M A;  3ZSU A;  4BG0 A;  3CEX A;  4CDY A;  3K7D A;  3N2Z B;  2W4B A;  1NSG B;  3RH3 A;  2ZPA A;  4IWB A;  4AL1 A;  2WB7 A;  2OU6 A;  3DI5 A;  2I8B A;  3DJN B;  3U8V A;  2KW3 C;  2Y39 A;  1XZP A;  3ZQY A;  2DYS C;  2KYH A;  3I5P A;  3N24 A;  3K1I A;  5GPG B;  1APC A;  3T9O A;  1RXQ A;  2XS8 A;  3KPH A;  3GM3 A;  5KYU A;  4CIH A;  4XWJ A;  2TMV P;  2J45 A;  1UG7 A;  1VLT A;  3DXJ F;  4AX2 A;  3AG3 C;  3TK0 A;  3EGD B;  4DVZ A;  4MVS A;  3HNK A;  4BJ5 A;  4BEJ A;  1Q0K A;  3N0T A;  1PV3 A;  3EJN A;  2L9J A;  4OD5 A;  2V26 A;  4K1O A;  4FES A;  5DQZ A;  2R7R A;  2P6V A;  3JRM O;  3MYF A;  1M2V B;  2Q4F A;  3I5Q A;  3KH2 A;  3NG1 A;  3QMK A;  2YLI A;  4O7G A;  1YYJ A;  3SXK A;  3AGU A;  2HSQ A;  1VK5 A;  2CW0 F;  1MND A;  3ECS A;  5E2Q A;  4PJN A;  3V7O A;  2HS5 A;  1CGO A;  2I15 A;  1O87 A;  3MX3 A;  1KTM A;  1ZVZ A;  4MS2 A;  4OIQ F;  2GWW A;  3IPM O;  1SYQ A;  4WGZ A;  1G8X A;  1QVX A;  2NUP A;  2HMZ A;  5D91 A;  4W8P A;  3EZH A;  3QW0 A;  2ZXO A;  3X2Q C;  5KYN A;  4P6I C;  2HKV A;  1T6Q A;  1LE4 A;  4IGG A;  3O6X A;  2G62 A;  3U9M A;  3J06 A;  2XL6 A;  3M4C A;  2FGY A;  4O6M A;  3JYY A;  5E33 A;  1MNE A;  5COG A;  3DM5 A;  1ORJ A;  5B1B C;  2R7T A;  3CZ6 A;  2CCY A;  3GWL A;  2XXA B;  1R4T A;  3F46 A;  4N6C A;  5DS4 A;  2ETS A;  3L34 A;  2J9V A;  3LLK A;  3O39 A;  2L6H A;  1LI7 A;  1C02 A;  4G78 A;  4JKV A;  3WHN A;  3EH1 A;  3JZ0 A;  4U5H A;  4JIO A;  1HE1 A;  4QDL A;  4D4X A;  1OCZ C;  2FFH A;  5FCL A;  2Q00 A;  1HW2 A;  1LS1 A;  4E7S A;  4CJO A;  2J9U A;  1GS9 A;  4YT5 A;  3W8I A;  3K33 A;  1QQ3 A;  2A6H F;  5L3V A;  3EGX A;  2R7O A;  2OJQ A;  2WL8 A;  1LVK A;  1T01 A;  4DRJ B;  3U2L A;  3AG2 C;  4CS8 C;  3A9C A;  5L0D A;  3DZA A;  3WAQ A;  4CX9 A;  2P0N A;  4JEA A;  4QI0 A;  5KYX A;  4XLN F;  3KYI A;  3ZG1 A;  4WGY A;  2XLD A;  5TJ5 E;  4JW1 A;  3NKE A;  1IZM A;  1A41 A;  3C18 A;  2O9X A;  4ULW A;  3LNR A;  2OEV A;  4DXW A;  4Z9I A;  4DRH B;  1JPN A;  1B68 A;  4Q5S F;  3LAY A;  4PJJ A;  1JPJ A;  2MYS A;  5DLJ A;  4IAO A;  1SR2 A;  1YZA A;  2OOC A;  3DAG A;  2EPO A;  3NMJ A;  3PCV A;  2W4M A;  4IAR A;  2EIM C;  4ZLD A;  4LDK A;  4JTC B;  1JRA A;  1TKN A;  1E86 A;  1EKY A;  4PR9 A;  1RKE A;  3ABK C;  2QUP A;  3R7C A;  5COF A;  3NRH A;  4K7B A;  3DAF A;  4BJT A;  4U5B E;  1M2O A;  2PNO A;  1H9G A;  2L81 A;  2ZXR A;  2C03 A;  1NFO A;  3DD7 A;  1TWG A;  4YT2 A;  5JS5 A;  2GFH A;  2LFD A;  5KYW B;  1SZI A;  1WGW A;  2J0W A;  1SMY F;  1ZW2 A;  4F4B A;  2HV7 A;  1A7V A;  4E0H A;  2KJG A;  2ASR A;  2Q7R A;  4CBE A;  1IW7 F;  3Q6M A;  1H6G A;  5F5H A;  2IOQ A;  3RFY A;  1OR2 A;  4JC7 A;  3CSK A;  4DJ9 A;  5A6K A;  3TQO A;  5HV9 A;  3NDB B;  4EUK B;  3B0V C;  3NYL A;  2XLH A;  3AG1 C;  3EG9 A;  4YK5 A;  1FTS A;  3ABL C;  4JRZ A;  4LAC B;  1YJG A;  1BR4 A;  2J8W A;  4NCQ A;  3MBG A;  1ZW3 A;  4IB4 A;  4BJ6 C;  1M56 C;  1T5O A;  4PFO A;  2R05 A;  1PD0 A;  4G7H F;  1TR2 A;  1MMA A;  1WAS A;  2HUJ A;  3E9V A;  3EG9 B;  1T9K A;  4EKW A;  2YRF A;  3H65 A;  2LK4 A;  4PAC A;  2A0B A;  4DRI B;  3QZC A;  3HLZ A;  1Z7Q c;  4YL3 A;  5B3S C;  3RYL A;  2L7A A;  3CAX A;  2H7B A;  4DBR A;  1NU9 C;  4XEV A;  1F1M A;  1CGN A;  4BPM A;  3L8J A;  1CGM E;  2KK1 A;  2P61 A;  2YZS A;  4JTD B;  4CSA C;  1PD1 A;  1ZZP A;  5IY5 C;  1LM3 B;  2KC3 A;  4CIP A;  4I3M A;  3FDQ A;  2QLA A;  4CS8 A;  4MVU A;  1LI5 A;  3IEE A;  4WAB A;  3C8G B;  5T3W A;  3VF0 A;  1OXB A;  1YZC A;  1CPQ A;  1D0Z A;  3US6 A;  2B0J A;  2WZF A;  2AP3 A;  3HTK C;  4NY3 A;  3SZR A;  3SXM A;  1RKC A;  3B0U X;  1BBH A;  4O6Y A;  2XM0 A;  1VYI A;  2EPN A;  1FMV A;  4BEM J;  3VAY A;  4L6R A;  4OD4 A;  1D0X A;  5KYX B;  3W8H A;  1E83 A;  1WN0 A;  1OW8 A;  3LS0 A;  2KSF A;  3M1C B;  3IQT A;  3ITF A;  3ZC4 A;  1HMD A;  1Q0D A;  3DWW A;  3OEO A;  1OKK D;  3KMI A;  1QSP A;  3PMR A;  1GGQ A;  1M57 C;  4H4K C;  3TD7 A;  3W2V A;  2XSE A;  3K66 A;  2GAQ A;  5B3I A;  3MLG A;  3ZQV A;  5KYU B;  1J8Y F;  3Q6N A;  3TJ6 A;  3U3F A;  5BQG A;  1YYX A;  3EGD A;  3FMS A;  3GEI A;  4U9E A;  1V54 C;  3JCU Q;  3S90 A;  5A6B A;  3ZTM A;  4JE9 A;  3GEE A;  1DOW A;  2YL7 A;  4N6H A;  4MW3 A;  3TOL A;  4XEF A;  5JSL A;  4CS7 A;  2CGE A;  1T6U A;  2YVK A;  4IJJ A;  3RVZ A;  2ZXW C;  4D4N A;  3LEO A;  2AU5 A;  4PFP A;  4U9D A;  3WG7 C;  1M2V A;  3LEV A;  2PBE A;  3HNI A;  4JUR I;  3RQE A;  2J9B A;  3RW0 A;  4AL0 A;  2H8A A;  1K05 A;  1ZYR F;  4MND A;  3RVY A;  3T6J A;  1E84 A;  2IM8 A;  5COM A;  4XLP F;  2G3K A;  4NTA A;  4YWQ A;  4U5G A;  3NYJ A;  3C8Z A;  4U5E E;  1OW7 A;  4MTF A;  1C03 A;  2R7S A;  4LLE A;  1I4Y A;  4EIY A;  4U5C E;  5HSW A;  2AVK A;  3KYJ A;  4MVQ A;  1D1B A;  1U6H A;  3PDM P;  2M64 A;  3VYW A;  2B0H A;  5A6J A;  4M63 A;  2A6E F;  2OKU A;  2MHR A;  1C17 M;  2P1A A;  5FZT A;  4YT8 A;  5EK0 A;  5JT4 A;  3SNH A;  1NLX A;  1JR8 A;  1WOL A;  1KNY A;  2G3V A;  2HSB A;  2OQM A;  2XL4 A;  1Z6A A;  2JD3 A;  3A11 A;  3EH2 A;  1FR0 A;  2NUT B;  1FMW A;  1CPR A;  2R25 A;  2Y3G A;  1UFB A;  1FFT C;  2DB4 A;  3IQC A;  1VB5 A;  4YL1 A;  2UUH A;  4NQF A;  2BE5 F;  4PK4 A;  4WJ0 A;  3ZVR A;  4X0R A;  1V4A A;  1JOG A;  2BC5 A;  2P7V A;  4I1O B;  1JMW A;  1JAF A;  3ZDL A;  3HNJ A;  5L0C A;  1RCP A;  4I1M A;  4XEK A;  4MVM A;  1GM5 A;  2AWY A;  4U5D E;  3K1I C;  4K0D A;  1G4U S;  2WVQ A;  3I4U A;  3UR3 C;  2YL3 A;  3IQ5 A;  3RQF A;  1HE9 A;  1RJ9 A;  2L6G A;  4OIR F;  4AK9 A;  2NSF A;  4HE8 D;  1ORS C;  5A6B D;  2J46 A;  4EWC A;  4YT4 A;  1FFH A;  5K0I A;  1OCR C;  1Z5Z A;  2Y3B A;  2UUI A;  3KKB A;  2EIN C;  4Q4Z F;  1Z3I X;  2PP4 A;  3EGX B;  4JJF A;  3GAN A;  2J0X A;  1RJ9 B;  2ICW G;  1MMD A;  3GOR A;  3H2V A;  5KYY B;  3FHD A;  1Z63 A;  2IXP A;  1TQG A;  1LS4 A;  4Z9H A;  2GDC A;  4EBK A;  2EIL C;  2OCC C;  3S84 A;  2W9Y A;  3M15 A;  4MVR A;  2NPU A;  2LCH A;  3DM9 B;  2MWQ A;  2VCB A;  3CQZ A;  4E0I A;  4FWV A;  2R7W A;  1NBB A;  4GQH A;  1QZX A;  2L6F A;  5CI8 A;  2KNH A;  5JLI A;  5E3A A;  3FOO A;  3JSZ A;  4ULV A;  3S28 A;  3M4B A;  1Y4C A;  3E70 C;  2R7V A;  4JCH A;  5E3C A;  3S27 A;  3POV A;  4XQ1 A;  4CS9 C;  2OJE D;  3C62 A;  4Q7C A;  2M4E A;  3EZI A;  3NKD A;  1W2W A;  3BRJ A;  3AOU A;  3L1M A;  2NSG A;  3F47 A;  1ZHY A;  4A4A A;  3C8G D;  1H7I A;  1TWH A;  1KU2 A;  3V5Y A;  3PHF 2;  4N4W A;  2DI3 A;  3EHN A;  2XS1 A;  5L0G A;  1QKR A;  1OQC A;  4MQ9 F;  2IXO A;  3EHM A;  1BDJ B;  4PJM A;  3EFO A;  5JUA A;  4QI2 A;  1SF8 A;  1AEP A;  4OIN F;  3NMK A;  1YA7 O;  3U0C A;  4BJ5 C;  2QY9 A;  1MMG A;  4OIP F;  5JP7 A;  3QVY A;  2XM4 A;  3TOM A;  1E85 A;  4LDR A;  4FX5 A;  1NG1 A;  1YDI A;  4HFF B;  2YLD A;  3K6B A;  1LKX A;  3UGO A;  1T6I A;  2J7P A;  1XZQ A;  1ZHW A;  3T6B A;  2XL8 A;  1M6T A;  1E2X A;  4O79 A;  2NUP B;  4E17 A;  5CIV A;  3DE9 A;  3Q7L A;  1YAR O;  3GOD A;  1TFO B;  1N1C A;  5AGF A;  2OG2 A;  1WAT A;  3DE8 A;  3GEH A;  1VYK A;  5T1D B;  1Y6D A;  2Y3D A;  1TWA A;  1YVI A;  1H9T A;  3Q7G A;  3ZTZ A;  1NFN A;  3K1H A;  4E7Z A;  4Z9J A;  3C8G A;  3FXH A;  2H7O A;  2CNW D;  2XLV A;  5BUO A;  5A6A A;  4EBJ A;  1RMV A;  4EBB A;  1EQ1 A;  5A69 A;  2EIK C;  2R9R B;  1OXK A;  4YN0 B;  1MMN A;  2F22 A;  2XLW A;  4XPY A;  2PX3 A;  4J32 B;  3RF3 A;  5AC5 A;  2ZD9 A;  3UNG C;  3GM1 A;  4JVS A;  5F28 E;  2IBF A;  3LS1 A;  2YKZ A;  3LUT B;  3O10 A;  4JTA B;  3RIP A;  1MQV A;  2LP4 A;  4H54 A;  5JRA A;  2R7X A;  2Q9B A;  2RD9 A;  3AG4 C;  3U3B A;  4XPW A;  2YQY A;  3S9O A;  1Z23 A;  1ZU5 A;  4UDV A;  2H7V C;  1RKE B;  4LER A;  2J7P D;  1QPU A;  2C04 A;  4HEA J;  1VMA A; 
#chains in the Genus database with same CATH homology
 3R7C A;  1JR8 A;  3TD7 A;  3GWN A;  4E0I A;  2HJ3 A;  3O55 A;  3GWL A;  3LLI A;  3MBG A;  3U2L A;  4LDK A;  1JRA A;  3W4Y A;  1OQC A;  3LLK A;  3U5S A;  4E0H A;  3U2M A;  3TK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...