3MBGA

Crystal structure of human augmenter of liver regeneration (alr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
DCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title Structure of the human sulfhydryl oxidase augmenter of liver regeneration and characterization of a human mutation causing an autosomal recessive myopathy .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3mbgA00
4E0HA 3MBGA 1JR8A 3O55A 3U2MA 3U5SA 1JRAA 3LLIA 4LDKA 3LLKA 3TD7A 3GWLA 3R7CA 2HJ3A 3U2LA 3TK0A 3GWNA 4E0IA 3W4YA 1OQCA
chains in the Genus database with same CATH superfamily
1LI5A 1MMDA 2A68F 1T9KA 3NG1A 4CBEA 5A6BA 3G4ZA 3NYLA 3JT1A 2V3CC 1ZU5A 5AC5A 2R7UA 4Z9JA 1D0ZA 3JSEO 4U5BE 3T6GB 3TOMA 1IZMA 2VB6A 2ETSA 2L6FA 5F5HA 3RQFA 1EI7A 2NPUA 4FESA 1XWJA 4HFFB 3JYYA 1Z6AA 2EILC 2WVQA 1TWCA 3LNMB 2ZXPA 3CZ6A 3DAGA 2YL1A 2R7TA 1LE2A 2ICWG 5E33A 3C62A 2LIGA 2UUHA 2PX3A 3EGDB 3VYWA 5KYUA 2HMZA 2Q9CA 2HJ3A 2Y3GA 4DVZA 3O6XA 4JCHA 2V26A 4MVUA 3RYLA 2H7OA 3UR3C 3NMJA 3EGDA 3TOLA 4JIOA 3FDQA 2EPOA 3MX3A 4N4WA 5KYXB 2WZLA 3BRJA 4JTCB 3GM1A 5L0JA 2R7RA 1Q0KA 2EPKX 2M4EA 1G4US 2NUTB 1VLSA 3L8JA 5T3WA 3MBGA 1LS4A 3LESA 2CNWD 4WABA 4W8PA 4PFOA 4AE4B 2ZXRA 3S9OA 4JVSA 2Q00A 1FMVA 3NRHA 4D4NA 4CIHA 4OD5A 3RF3A 1HW2A 3DJUB 1OCZC 1Q0FA 2YLDA 4LLEA 4R32A 2A6HF 4XEKA 3AG3C 3N0TA 4LACB 3AG2C 1APCA 4CS9C 4L6RA 4MVSA 1S05A 4C3EA 2L7AA 4JRZA 1WTYA 3Q7LA 4FWVA 3PMRA 3V7OA 3B71A 4PACA 1D0YA 2HJMA 2RSEB 3JZ0A 4EBJA 1FAPB 3UNGC 3O10A 1T5OA 3GWNA 4U5DE 5E2QA 5EK0A 4EIYA 5JT4A 4J32B 1VMAA 1LPEA 3HKKA 4QI2A 4AL1A 1KTMA 2R25A 1GQAA 2W9YA 2KC3A 3AGUA 3DI5A 4O79A 3SXZA 1TKNA 3VRCA 4I3MA 3RVYA 1E85A 5A6JA 3LLIA 5BQGA 3S28A 2GFHA 1OKKD 1OCRC 1WWPA 2LFDA 5B3IA 3RW0A 1OW7A 1TR2A 1FR0A 2GAQA 3HNKA 3QW0A 2CDQA 4MVRA 3IQ5A 1H7IA 1NZEA 3ZWIA 4DVYP 1NU7D 3EG9A 2YQYA 4JJGA 3T9OA 1HE9A 4U5EE 3K1HA 2FAPB 4DJ9A 3L0IA 1YYJA 2ZXOA 2HS5A 3ZDLA 4XTKA 1NBBA 4CS7A 1A41A 3AG1C 3JRTA 4PR9A 2OKUA 3M1CB 1TFOB 1CGNA 2R03A 5L0FA 5HSWA 4BJ6A 3DAFA 1ZHYA 1YAUO 3L1MA 2QLAA 1Q0GA 3HNLA 3S29A 3MFNA 1K40A 3K1IC 4IRUA 5T3TA 2Y3HA 4PK4A 4U5FE 3QW1A 2XRHA 1R4TA 3RQGA 1RKEA 2AP3A 3F46A 3VAYA 1J8MF 3B0VC 3BEHA 1A7DA 1OKKA 2KJGA 1I4ZA 3Q6MA 4G0HA 5L0CA 3U8PA 1HE1A 3WAQA 3EZIA 4J7YA 1PD0A 2QTVA 4XWJA 5DS6A 1M2VA 4IGGA 5KYWA 2XLWA 4JTDB 1RMVA 4UDVA 2C04A 3GEIA 2VCBA 2IXOA 2J7PA 3DMDA 3NYMA 1VYIA 2L9JA 2LCHA 2NUPA 1A7VA 4AK9A 1QLEC 5L0HA 5COGA 1QSPA 5GPGB 2LSEA 4LDKA 5DLJA 2NG1A 3EH1A 4KI2A 3LLKA 3ASNC 1NLXA 4JC7A 4MW8A 3LEVA 2Q3TA 5DVWA 1JOGA 4BJ1A 3TD7A 1D1BA 1BR1A 4U5CE 2HUJA 4BEMJ 4NY3A 4YK5A 2YZSA 1H6GA 1C17M 2R9RB 2A0UA 2RD9A 2J0WA 4U9EA 2J45A 4OIRF 4EHPA 3U8VA 1MNEA 1UG7A 1FTSA 3I4UA 3EGXA 4EBKA 3T6JA 5L0GA 1OQCA 2GDCA 3H2VA 1S7ZA 2P0NA 2YL7A 1NFOA 4I1MA 2F22A 2H7BA 1JR8A 2XM0A 1NSGB 2QNLA 2B0HA 3G4XA 1M56C 4JKVA 3SXYA 4Z9IA 3CEXA 1YVIA 4I44A 4ZLDA 3VM6A 1I5NA 3RVZA 1T01A 5DQZA 4EUKB 1IW7F 2IYLD 4P6IC 3TQOA 5F5FA 3K33A 5BUOA 4G7ZF 2Y3DA 2YHSA 3QVZA 5KYUB 5EGYA 3KH2A 1SMYF 4HE8D 3ZG1A 3US6A 5HV9A 4DXWA 3NYJA 3PHF2 2IBFA 1WASA 2W4MA 1YA7O 2XLEA 3IHUA 3IQTA 4H54A 2AVKA 4YL3A 3SP1A 3U2LA 4WJ0A 3E9VA 3WODF 3ABKC 4F4BA 5A6AA 2TMVP 2D4UA 1VB5A 2DGJA 2NSGA 3KYIA 4DRJB 4E0HA 1B68A 1HMDA 1Y6DA 3MYIA 2BL2A 4A2NB 3ZQYA 2R7WA 1OCCC 3U3BA 4CSAA 1CGME 5A6KA 2XS1A 1WN0A 1XZQA 4XLNF 4JW1A 4G7HF 2QY9A 3C7JA 1OW8A 4P9FA 3B0UX 3C18A 3K66A 4MTGA 5KYYA 4PJJA 1E86A 2YKZA 1NU9C 2IXNA 1SF8A 2L6GA 2DYSC 1Y4CA 2LD6A 1H9TA 4YT8A 5JVEA 1KNYA 1RKCA 3DXJF 3OWTA 1MNDA 4E17A 1YYXA 4C7OA 2BC5A 1EQ1A 3KYJA 3M4BA 3SEOA 4MNDA 4EKWA 2VH3A 3LS1A 2PFDA 1C03A 2ASRA 3NKEA 1L7CA 4NTFA 4DBQA 1Q0MA 3H2UA 1W2WA 2Z15A 3EHMA 3DWWA 2YLGA 2Y69C 1VLTA 1JAFA 3C8GD 2XLVA 1TFKB 2HZ8A 2H8AA 3E70C 3EJNA 4J7TA 5E3AA 3TJ5A 1U6HA 2ZPAA 4CS8C 5BQHA 1V74B 5K0IA 1QQ3A 2R7QA 3OEOA 2W4BA 3IEEA 1K04A 2IXMA 4XPWA 4YT5A 2OOCA 3DM9B 4ULVA 4BJ6C 2J9WA 5JS5A 2R7SA 1RJ9A 2YLIA 1DOWA 2OEXA 4IWBA 3V5YA 2A0BA 2Q4FA 2CNWA 4GQHA 4YN0B 3EG9B 3KKBA 4O6YA 3GWLA 1LIHA 2Y39A 1T6UA 2ZD9A 3QZCA 1FNTc 3FMSA 5BQIA 2XLOA 2EIMC 1Z63A 4DBRA 4JJFA 1OR3A 2QE9A 4NQFA 1YZCA 5IY5C 3JCUQ 1ZU4A 4H4KC 4IB4A 2Q7RA 2YL0A 4I1OB 2B0JA 3I5QA 4ULWA 2AWCA 2J9UA 2KGOA 2LP4A 4U5GA 5JSLA 3L34A 3UMHA 2XLDA 1AUEA 4CS8A 1Z5ZA 3GANA 3IPMO 1ZHWA 3O55A 3HJCA 3DKAA 1BDJB 1V4AA 2Y3BA 4YL1A 4EBBA 3ZQVA 2DYRC 4OIOF 4U9DA 2AWYA 1RKEB 2J0XA 3C8GA 4GYTA 4K7BA 4XEVA 2XXAA 3SYNA 1ORSC 1GM5A 2FFHA 3SXKA 4LDRA 1Z3IX 3W2WA 2WZFA 2XLHA 2WL8A 4QDLA 4YT2A 4WGZA 2L6HA 3MLGA 3TJ6A 4MTFA 3AOUA 1M2VB 2KSFA 3M79A 5KYWB 2ZXWC 1VOMA 4BJTA 2J9VA 5JLIA 4Q4ZF 3DE8A 4CDYA 4O6NA 3CAXA 2GA0A 3HNJA 3NMKA 3CQZA 3UMKA 2NUPB 3V5ZA 3Q7GA 2PP4A 4BEJA 1CPQA 3ABLC 3U0CA 4E7SA 5B3SC 3DJNB 3V5XA 1ZYRF 2IOQA 3EQLF 1G5ZA 3LAYA 5FZTA 3M4CA 4C3DA 3QVYA 3JRMO 2MYSA 4A4AA 3SXMA 3SZRA 4QI0A 3GEHA 2A69F 2XL8A 1NG1A 2L81A 2UUIA 2P61A 1BR4A 1MMAA 2PF4E 4CX9A 3EFOA 2DI3A 1HW1A 2VASA 3KPHA 5COFA 4YJWA 5A6BD 3EGXB 3M15A 2OU6A 1LM3B 2JPUA 3HNIA 4EWCA 1DOVA 5L3QA 2PNOA 1E2XA 5F28E 3TK0A 4E0IA 1O5HA 2KYHA 4NTBA 5A69A 2CCYA 4J30B 4PJNA 3U9MA 3B9QA 1GS9A 1EA8A 4MVZA 3C63A 256BA 2P6VA 1HY5A 3R2PA 4KNVA 3S84A 5CIVA 3ECSA 4CSAC 3GORA 4CDVA 1Z23A 1EKYA 3GODA 2EIJC 2R7OA 1JMWA 2GWWA 4RDAA 4N06A 3EH2A 4JEAA 3KMIA 1G4WR 1E83A 2LK4A 2CGEA 4GEHA 4JCZA 1PV3A 2I15A 4U5HA 5B1BC 1NFNA 3IQ6A 2E87A 3R7CA 4D4XA 1CPRA 2G3KA 2Q9AA 3K6BA 3NKDA 2EPLX 4N6HA 4KC9A 2LQGA 4FAPB 4MTOA 4C3BA 1YZAA 3W8IA 5EHHA 2EPNA 2X51A 2I8BA 3T4RA 3UMIA 3C8ZA 5JUAA 4G7OF 4LDQA 3ATPA 3UGOA 3J06A 1FFTC 2R02A 2VCCA 1LKXA 4XQ1A 2OEVA 3NDBB 1RCPA 2HFIA 1YLMA 3S27A 3DE9A 2R7VA 1O87A 2Q9BA 4LLCA 1D0XA 4JE9A 4CIPA 4PJMA 1JPJA 1OR2A 1OXBA 2OQMA 1TWHA 4M63A 3POVA 1VK5A 2NSFA 2WZGA 4WGYA 4MVMA 4C7OB 5AGFA 4N6CA 4Q5SF 1YARO 3ZC4A 2WVOA 3FHDA 4BPMA 3AQBA 4BG0A 3LUTB 3ZTZA 3RKOF 4E7ZA 3X1OA 3N2ZB 1AVOB 3MYFA 3S0XA 3EHNA 4BJ5C 1YDIA 1A0BA 3ABMC 4YT4A 4P9TA 2G62A 1YJGA 5KYXA 2P7VA 3HLZA 2X0CA 2J46A 3U2MA 2NUTA 3LS0A 2KNHA 5DQTA 5JRAA 1QKRA 1BBHA 1RJ9B 1UFBA 1D1CA 1RXQA 4AE4A 5DS5A 1M6TA 1WATA 1SZIA 3ZSUA 2HMQA 3B0PA 1U89A 2H7VC 1QVXA 1Z7Qc 1FMWA 2J8WA 2XS8A 2YVKA 1ZHTA 4Q7CA 3RFYA 3W2VA 4AX2A 2CYDA 5CI8A 2AU5A 1CGOA 3ZTMA 1N1CA 4NCQA 5AC4A 3Q6NA 2XL6A 4MS2A 5D91A 2OCCC 1GGQA 2OG2A 1MMGA 3O39A 4FX5A 1ZVZA 3ZVRA 1BR2A 4ANJA 2VCAA 3FAPB 1QZXA 1PD1A 1TWAA 3AJMA 4BJ5A 1L3PA 4W8KA 3U3FA 3RIPA 2A1DD 5CI9A 4OINF 2HKVA 3W4YA 1M2OA 1ZHZA 2G3VA 4MW3A 3GM2A 4OIPF 1G8XA 1F1MA 1LS1A 3I5PA 4B6IA 3JYHA 3FOOA 1SR2A 3C8GB 4G78A 4XEFA 5B1AC 4K0DA 3FAJA 4O7GA 2WVNA 2XXAB 3ASOC 4HFKB 3WHNA 3DM5A 2KQ9A 4CS9A 1D1AA 2HSBA 2VC9A 3VF0A 2XL4A 3QMKA 3RH3A 3LJBA 3X2QC 2J9BA 3F47A 5COMA 1ZW2A 2A6EF 3G50A 4CDAA 1U0BB 3SNHA 2R7XA 4XLPF 1SYQA 2J7PD 1WGWA 2KW3C 2FGYA 2YWAA 5KYYB 1E84A 2XM4A 1LI7A 2XSEA 3DD7A 4PJLA 5L0IA 4IARA 5L0DA 1LVKA 1ORYA 2DB4A 3HTKC 4DOZA 3FOPA 5E3CA 3N24A 4MVOA 2PBEA 1V55C 3PDMP 3UGPA 2QUPA 2CW0F 2IXPA 3WG7C 4RD9A 3DZAA 5L3VA 1ZHXA 1TWGA 1QPUA 4IAOA 3FVYA 3KL4A 1WOLA 2MWQA 1JRAA 1C02A 5DS4A 3A11A 1A7EA 1LE4A 4IJJA 3ZIBA 4JURI 3GEEA 2YL3A 1MQVA 1R5ID 2YEVA 3JTLO 2C03A 3OA1A 3EFOB 4CJGA 2LFFA 4E18A 5KYNA 1OXKA 2MHRA 2JX0A 2WB7A 4CJOA 2O9XA 1JPNA 2R05A 3AQCA 2EINC 2IM8A 3B29A 2KK1A 3EZHA 3JSZA 4JEBA 3NMIA 1XZPA 4ZLCA 1Q0DA 4DRIB 3S90A 1M57C 1TQGA 4O6MA 4DRHB 4ER9A 3RQEA 4PFPA 4YWQA 4Z9HA 2OJQA 3CSKA 3H65A 4OD4A 4MQ9F 2JD3A 1I4YA 2OJED 1T6QA 1HMOA 3ITFA 4IAQA 4KBLA 4JZAA 1KU2A 3IQCA 3U5SA 3K1IA 3AGTA 3TULA 1OW6A 4XPYA 3T6BA 3U9JA 1VYKA 2YRFA 4AL0A 5JP7A 1VTMP 4XPXA 2XLMA 2EPMX 5T1DB 1O3UA 4X0RA 4LERA 1MMNA 4OIQF 1H9GA 1J8YF 1OCOC 3GM3A 5FCLA 3W8HA 4YL0A 2M64A 4MVQA 2HV6A 2PX0A 3AG4C 4ONSA 1YA9A 1ZW3A 3LEOA 3EPVA 4NC3A 1ZZPA 1FFHA 3FXHA 3LNRA 2P1AA 4HEAJ 4NTAA 4RBNA 1BZ4A 1T6IA 3L8IA 2D5RB 2HV7A 1V54C 1ST6A 2HSQA 2EIKC 3K7DA 4JTAB 1ORJA 4KNWA 4K1OA 5D92A 2W45A 3A9CA 3PCVA 5TJ5E 3QTHA 1AEPA 1PCXA 2BE5F 1K05A
chains in the Genus database with same CATH topology
4E0HA 3MBGA 1JR8A 3O55A 3U2MA 3U5SA 1JRAA 3LLIA 4LDKA 3LLKA 3TD7A 3GWLA 3R7CA 2HJ3A 3U2LA 3TK0A 3GWNA 4E0IA 3W4YA 1OQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0H A;  3MBG A;  1JR8 A;  3O55 A;  3U2M A;  3U5S A;  1JRA A;  3LLI A;  4LDK A;  3LLK A;  3TD7 A;  3GWL A;  3R7C A;  2HJ3 A;  3U2L A;  3TK0 A;  3GWN A;  4E0I A;  3W4Y A;  1OQC A; 
#chains in the Genus database with same CATH topology
 1LI5 A;  1MMD A;  2A68 F;  1T9K A;  3NG1 A;  4CBE A;  5A6B A;  3G4Z A;  3NYL A;  3JT1 A;  2V3C C;  1ZU5 A;  5AC5 A;  2R7U A;  4Z9J A;  1D0Z A;  3JSE O;  4U5B E;  3T6G B;  3TOM A;  1IZM A;  2VB6 A;  2ETS A;  2L6F A;  5F5H A;  3RQF A;  1EI7 A;  2NPU A;  4FES A;  1XWJ A;  4HFF B;  3JYY A;  1Z6A A;  2EIL C;  2WVQ A;  1TWC A;  3LNM B;  2ZXP A;  3CZ6 A;  3DAG A;  2YL1 A;  2R7T A;  1LE2 A;  2ICW G;  5E33 A;  3C62 A;  2LIG A;  2UUH A;  2PX3 A;  3EGD B;  3VYW A;  5KYU A;  2HMZ A;  2Q9C A;  2HJ3 A;  2Y3G A;  4DVZ A;  3O6X A;  4JCH A;  2V26 A;  4MVU A;  3RYL A;  2H7O A;  3UR3 C;  3NMJ A;  3EGD A;  3TOL A;  4JIO A;  3FDQ A;  2EPO A;  3MX3 A;  4N4W A;  5KYX B;  2WZL A;  3BRJ A;  4JTC B;  3GM1 A;  5L0J A;  2R7R A;  1Q0K A;  2EPK X;  2M4E A;  1G4U S;  2NUT B;  1VLS A;  3L8J A;  5T3W A;  3MBG A;  1LS4 A;  3LES A;  2CNW D;  4WAB A;  4W8P A;  4PFO A;  4AE4 B;  2ZXR A;  3S9O A;  4JVS A;  2Q00 A;  1FMV A;  3NRH A;  4D4N A;  4CIH A;  4OD5 A;  3RF3 A;  1HW2 A;  3DJU B;  1OCZ C;  1Q0F A;  2YLD A;  4LLE A;  4R32 A;  2A6H F;  4XEK A;  3AG3 C;  3N0T A;  4LAC B;  3AG2 C;  1APC A;  4CS9 C;  4L6R A;  4MVS A;  1S05 A;  4C3E A;  2L7A A;  4JRZ A;  1WTY A;  3Q7L A;  4FWV A;  3PMR A;  3V7O A;  3B71 A;  4PAC A;  1D0Y A;  2HJM A;  2RSE B;  3JZ0 A;  4EBJ A;  1FAP B;  3UNG C;  3O10 A;  1T5O A;  3GWN A;  4U5D E;  5E2Q A;  5EK0 A;  4EIY A;  5JT4 A;  4J32 B;  1VMA A;  1LPE A;  3HKK A;  4QI2 A;  4AL1 A;  1KTM A;  2R25 A;  1GQA A;  2W9Y A;  2KC3 A;  3AGU A;  3DI5 A;  4O79 A;  3SXZ A;  1TKN A;  3VRC A;  4I3M A;  3RVY A;  1E85 A;  5A6J A;  3LLI A;  5BQG A;  3S28 A;  2GFH A;  1OKK D;  1OCR C;  1WWP A;  2LFD A;  5B3I A;  3RW0 A;  1OW7 A;  1TR2 A;  1FR0 A;  2GAQ A;  3HNK A;  3QW0 A;  2CDQ A;  4MVR A;  3IQ5 A;  1H7I A;  1NZE A;  3ZWI A;  4DVY P;  1NU7 D;  3EG9 A;  2YQY A;  4JJG A;  3T9O A;  1HE9 A;  4U5E E;  3K1H A;  2FAP B;  4DJ9 A;  3L0I A;  1YYJ A;  2ZXO A;  2HS5 A;  3ZDL A;  4XTK A;  1NBB A;  4CS7 A;  1A41 A;  3AG1 C;  3JRT A;  4PR9 A;  2OKU A;  3M1C B;  1TFO B;  1CGN A;  2R03 A;  5L0F A;  5HSW A;  4BJ6 A;  3DAF A;  1ZHY A;  1YAU O;  3L1M A;  2QLA A;  1Q0G A;  3HNL A;  3S29 A;  3MFN A;  1K40 A;  3K1I C;  4IRU A;  5T3T A;  2Y3H A;  4PK4 A;  4U5F E;  3QW1 A;  2XRH A;  1R4T A;  3RQG A;  1RKE A;  2AP3 A;  3F46 A;  3VAY A;  1J8M F;  3B0V C;  3BEH A;  1A7D A;  1OKK A;  2KJG A;  1I4Z A;  3Q6M A;  4G0H A;  5L0C A;  3U8P A;  1HE1 A;  3WAQ A;  3EZI A;  4J7Y A;  1PD0 A;  2QTV A;  4XWJ A;  5DS6 A;  1M2V A;  4IGG A;  5KYW A;  2XLW A;  4JTD B;  1RMV A;  4UDV A;  2C04 A;  3GEI A;  2VCB A;  2IXO A;  2J7P A;  3DMD A;  3NYM A;  1VYI A;  2L9J A;  2LCH A;  2NUP A;  1A7V A;  4AK9 A;  1QLE C;  5L0H A;  5COG A;  1QSP A;  5GPG B;  2LSE A;  4LDK A;  5DLJ A;  2NG1 A;  3EH1 A;  4KI2 A;  3LLK A;  3ASN C;  1NLX A;  4JC7 A;  4MW8 A;  3LEV A;  2Q3T A;  5DVW A;  1JOG A;  4BJ1 A;  3TD7 A;  1D1B A;  1BR1 A;  4U5C E;  2HUJ A;  4BEM J;  4NY3 A;  4YK5 A;  2YZS A;  1H6G A;  1C17 M;  2R9R B;  2A0U A;  2RD9 A;  2J0W A;  4U9E A;  2J45 A;  4OIR F;  4EHP A;  3U8V A;  1MNE A;  1UG7 A;  1FTS A;  3I4U A;  3EGX A;  4EBK A;  3T6J A;  5L0G A;  1OQC A;  2GDC A;  3H2V A;  1S7Z A;  2P0N A;  2YL7 A;  1NFO A;  4I1M A;  2F22 A;  2H7B A;  1JR8 A;  2XM0 A;  1NSG B;  2QNL A;  2B0H A;  3G4X A;  1M56 C;  4JKV A;  3SXY A;  4Z9I A;  3CEX A;  1YVI A;  4I44 A;  4ZLD A;  3VM6 A;  1I5N A;  3RVZ A;  1T01 A;  5DQZ A;  4EUK B;  1IW7 F;  2IYL D;  4P6I C;  3TQO A;  5F5F A;  3K33 A;  5BUO A;  4G7Z F;  2Y3D A;  2YHS A;  3QVZ A;  5KYU B;  5EGY A;  3KH2 A;  1SMY F;  4HE8 D;  3ZG1 A;  3US6 A;  5HV9 A;  4DXW A;  3NYJ A;  3PHF 2;  2IBF A;  1WAS A;  2W4M A;  1YA7 O;  2XLE A;  3IHU A;  3IQT A;  4H54 A;  2AVK A;  4YL3 A;  3SP1 A;  3U2L A;  4WJ0 A;  3E9V A;  3WOD F;  3ABK C;  4F4B A;  5A6A A;  2TMV P;  2D4U A;  1VB5 A;  2DGJ A;  2NSG A;  3KYI A;  4DRJ B;  4E0H A;  1B68 A;  1HMD A;  1Y6D A;  3MYI A;  2BL2 A;  4A2N B;  3ZQY A;  2R7W A;  1OCC C;  3U3B A;  4CSA A;  1CGM E;  5A6K A;  2XS1 A;  1WN0 A;  1XZQ A;  4XLN F;  4JW1 A;  4G7H F;  2QY9 A;  3C7J A;  1OW8 A;  4P9F A;  3B0U X;  3C18 A;  3K66 A;  4MTG A;  5KYY A;  4PJJ A;  1E86 A;  2YKZ A;  1NU9 C;  2IXN A;  1SF8 A;  2L6G A;  2DYS C;  1Y4C A;  2LD6 A;  1H9T A;  4YT8 A;  5JVE A;  1KNY A;  1RKC A;  3DXJ F;  3OWT A;  1MND A;  4E17 A;  1YYX A;  4C7O A;  2BC5 A;  1EQ1 A;  3KYJ A;  3M4B A;  3SEO A;  4MND A;  4EKW A;  2VH3 A;  3LS1 A;  2PFD A;  1C03 A;  2ASR A;  3NKE A;  1L7C A;  4NTF A;  4DBQ A;  1Q0M A;  3H2U A;  1W2W A;  2Z15 A;  3EHM A;  3DWW A;  2YLG A;  2Y69 C;  1VLT A;  1JAF A;  3C8G D;  2XLV A;  1TFK B;  2HZ8 A;  2H8A A;  3E70 C;  3EJN A;  4J7T A;  5E3A A;  3TJ5 A;  1U6H A;  2ZPA A;  4CS8 C;  5BQH A;  1V74 B;  5K0I A;  1QQ3 A;  2R7Q A;  3OEO A;  2W4B A;  3IEE A;  1K04 A;  2IXM A;  4XPW A;  4YT5 A;  2OOC A;  3DM9 B;  4ULV A;  4BJ6 C;  2J9W A;  5JS5 A;  2R7S A;  1RJ9 A;  2YLI A;  1DOW A;  2OEX A;  4IWB A;  3V5Y A;  2A0B A;  2Q4F A;  2CNW A;  4GQH A;  4YN0 B;  3EG9 B;  3KKB A;  4O6Y A;  3GWL A;  1LIH A;  2Y39 A;  1T6U A;  2ZD9 A;  3QZC A;  1FNT c;  3FMS A;  5BQI A;  2XLO A;  2EIM C;  1Z63 A;  4DBR A;  4JJF A;  1OR3 A;  2QE9 A;  4NQF A;  1YZC A;  5IY5 C;  3JCU Q;  1ZU4 A;  4H4K C;  4IB4 A;  2Q7R A;  2YL0 A;  4I1O B;  2B0J A;  3I5Q A;  4ULW A;  2AWC A;  2J9U A;  2KGO A;  2LP4 A;  4U5G A;  5JSL A;  3L34 A;  3UMH A;  2XLD A;  1AUE A;  4CS8 A;  1Z5Z A;  3GAN A;  3IPM O;  1ZHW A;  3O55 A;  3HJC A;  3DKA A;  1BDJ B;  1V4A A;  2Y3B A;  4YL1 A;  4EBB A;  3ZQV A;  2DYR C;  4OIO F;  4U9D A;  2AWY A;  1RKE B;  2J0X A;  3C8G A;  4GYT A;  4K7B A;  4XEV A;  2XXA A;  3SYN A;  1ORS C;  1GM5 A;  2FFH A;  3SXK A;  4LDR A;  1Z3I X;  3W2W A;  2WZF A;  2XLH A;  2WL8 A;  4QDL A;  4YT2 A;  4WGZ A;  2L6H A;  3MLG A;  3TJ6 A;  4MTF A;  3AOU A;  1M2V B;  2KSF A;  3M79 A;  5KYW B;  2ZXW C;  1VOM A;  4BJT A;  2J9V A;  5JLI A;  4Q4Z F;  3DE8 A;  4CDY A;  4O6N A;  3CAX A;  2GA0 A;  3HNJ A;  3NMK A;  3CQZ A;  3UMK A;  2NUP B;  3V5Z A;  3Q7G A;  2PP4 A;  4BEJ A;  1CPQ A;  3ABL C;  3U0C A;  4E7S A;  5B3S C;  3DJN B;  3V5X A;  1ZYR F;  2IOQ A;  3EQL F;  1G5Z A;  3LAY A;  5FZT A;  3M4C A;  4C3D A;  3QVY A;  3JRM O;  2MYS A;  4A4A A;  3SXM A;  3SZR A;  4QI0 A;  3GEH A;  2A69 F;  2XL8 A;  1NG1 A;  2L81 A;  2UUI A;  2P61 A;  1BR4 A;  1MMA A;  2PF4 E;  4CX9 A;  3EFO A;  2DI3 A;  1HW1 A;  2VAS A;  3KPH A;  5COF A;  4YJW A;  5A6B D;  3EGX B;  3M15 A;  2OU6 A;  1LM3 B;  2JPU A;  3HNI A;  4EWC A;  1DOV A;  5L3Q A;  2PNO A;  1E2X A;  5F28 E;  3TK0 A;  4E0I A;  1O5H A;  2KYH A;  4NTB A;  5A69 A;  2CCY A;  4J30 B;  4PJN A;  3U9M A;  3B9Q A;  1GS9 A;  1EA8 A;  4MVZ A;  3C63 A;  256B A;  2P6V A;  1HY5 A;  3R2P A;  4KNV A;  3S84 A;  5CIV A;  3ECS A;  4CSA C;  3GOR A;  4CDV A;  1Z23 A;  1EKY A;  3GOD A;  2EIJ C;  2R7O A;  1JMW A;  2GWW A;  4RDA A;  4N06 A;  3EH2 A;  4JEA A;  3KMI A;  1G4W R;  1E83 A;  2LK4 A;  2CGE A;  4GEH A;  4JCZ A;  1PV3 A;  2I15 A;  4U5H A;  5B1B C;  1NFN A;  3IQ6 A;  2E87 A;  3R7C A;  4D4X A;  1CPR A;  2G3K A;  2Q9A A;  3K6B A;  3NKD A;  2EPL X;  4N6H A;  4KC9 A;  2LQG A;  4FAP B;  4MTO A;  4C3B A;  1YZA A;  3W8I A;  5EHH A;  2EPN A;  2X51 A;  2I8B A;  3T4R A;  3UMI A;  3C8Z A;  5JUA A;  4G7O F;  4LDQ A;  3ATP A;  3UGO A;  3J06 A;  1FFT C;  2R02 A;  2VCC A;  1LKX A;  4XQ1 A;  2OEV A;  3NDB B;  1RCP A;  2HFI A;  1YLM A;  3S27 A;  3DE9 A;  2R7V A;  1O87 A;  2Q9B A;  4LLC A;  1D0X A;  4JE9 A;  4CIP A;  4PJM A;  1JPJ A;  1OR2 A;  1OXB A;  2OQM A;  1TWH A;  4M63 A;  3POV A;  1VK5 A;  2NSF A;  2WZG A;  4WGY A;  4MVM A;  4C7O B;  5AGF A;  4N6C A;  4Q5S F;  1YAR O;  3ZC4 A;  2WVO A;  3FHD A;  4BPM A;  3AQB A;  4BG0 A;  3LUT B;  3ZTZ A;  3RKO F;  4E7Z A;  3X1O A;  3N2Z B;  1AVO B;  3MYF A;  3S0X A;  3EHN A;  4BJ5 C;  1YDI A;  1A0B A;  3ABM C;  4YT4 A;  4P9T A;  2G62 A;  1YJG A;  5KYX A;  2P7V A;  3HLZ A;  2X0C A;  2J46 A;  3U2M A;  2NUT A;  3LS0 A;  2KNH A;  5DQT A;  5JRA A;  1QKR A;  1BBH A;  1RJ9 B;  1UFB A;  1D1C A;  1RXQ A;  4AE4 A;  5DS5 A;  1M6T A;  1WAT A;  1SZI A;  3ZSU A;  2HMQ A;  3B0P A;  1U89 A;  2H7V C;  1QVX A;  1Z7Q c;  1FMW A;  2J8W A;  2XS8 A;  2YVK A;  1ZHT A;  4Q7C A;  3RFY A;  3W2V A;  4AX2 A;  2CYD A;  5CI8 A;  2AU5 A;  1CGO A;  3ZTM A;  1N1C A;  4NCQ A;  5AC4 A;  3Q6N A;  2XL6 A;  4MS2 A;  5D91 A;  2OCC C;  1GGQ A;  2OG2 A;  1MMG A;  3O39 A;  4FX5 A;  1ZVZ A;  3ZVR A;  1BR2 A;  4ANJ A;  2VCA A;  3FAP B;  1QZX A;  1PD1 A;  1TWA A;  3AJM A;  4BJ5 A;  1L3P A;  4W8K A;  3U3F A;  3RIP A;  2A1D D;  5CI9 A;  4OIN F;  2HKV A;  3W4Y A;  1M2O A;  1ZHZ A;  2G3V A;  4MW3 A;  3GM2 A;  4OIP F;  1G8X A;  1F1M A;  1LS1 A;  3I5P A;  4B6I A;  3JYH A;  3FOO A;  1SR2 A;  3C8G B;  4G78 A;  4XEF A;  5B1A C;  4K0D A;  3FAJ A;  4O7G A;  2WVN A;  2XXA B;  3ASO C;  4HFK B;  3WHN A;  3DM5 A;  2KQ9 A;  4CS9 A;  1D1A A;  2HSB A;  2VC9 A;  3VF0 A;  2XL4 A;  3QMK A;  3RH3 A;  3LJB A;  3X2Q C;  2J9B A;  3F47 A;  5COM A;  1ZW2 A;  2A6E F;  3G50 A;  4CDA A;  1U0B B;  3SNH A;  2R7X A;  4XLP F;  1SYQ A;  2J7P D;  1WGW A;  2KW3 C;  2FGY A;  2YWA A;  5KYY B;  1E84 A;  2XM4 A;  1LI7 A;  2XSE A;  3DD7 A;  4PJL A;  5L0I A;  4IAR A;  5L0D A;  1LVK A;  1ORY A;  2DB4 A;  3HTK C;  4DOZ A;  3FOP A;  5E3C A;  3N24 A;  4MVO A;  2PBE A;  1V55 C;  3PDM P;  3UGP A;  2QUP A;  2CW0 F;  2IXP A;  3WG7 C;  4RD9 A;  3DZA A;  5L3V A;  1ZHX A;  1TWG A;  1QPU A;  4IAO A;  3FVY A;  3KL4 A;  1WOL A;  2MWQ A;  1JRA A;  1C02 A;  5DS4 A;  3A11 A;  1A7E A;  1LE4 A;  4IJJ A;  3ZIB A;  4JUR I;  3GEE A;  2YL3 A;  1MQV A;  1R5I D;  2YEV A;  3JTL O;  2C03 A;  3OA1 A;  3EFO B;  4CJG A;  2LFF A;  4E18 A;  5KYN A;  1OXK A;  2MHR A;  2JX0 A;  2WB7 A;  4CJO A;  2O9X A;  1JPN A;  2R05 A;  3AQC A;  2EIN C;  2IM8 A;  3B29 A;  2KK1 A;  3EZH A;  3JSZ A;  4JEB A;  3NMI A;  1XZP A;  4ZLC A;  1Q0D A;  4DRI B;  3S90 A;  1M57 C;  1TQG A;  4O6M A;  4DRH B;  4ER9 A;  3RQE A;  4PFP A;  4YWQ A;  4Z9H A;  2OJQ A;  3CSK A;  3H65 A;  4OD4 A;  4MQ9 F;  2JD3 A;  1I4Y A;  2OJE D;  1T6Q A;  1HMO A;  3ITF A;  4IAQ A;  4KBL A;  4JZA A;  1KU2 A;  3IQC A;  3U5S A;  3K1I A;  3AGT A;  3TUL A;  1OW6 A;  4XPY A;  3T6B A;  3U9J A;  1VYK A;  2YRF A;  4AL0 A;  5JP7 A;  1VTM P;  4XPX A;  2XLM A;  2EPM X;  5T1D B;  1O3U A;  4X0R A;  4LER A;  1MMN A;  4OIQ F;  1H9G A;  1J8Y F;  1OCO C;  3GM3 A;  5FCL A;  3W8H A;  4YL0 A;  2M64 A;  4MVQ A;  2HV6 A;  2PX0 A;  3AG4 C;  4ONS A;  1YA9 A;  1ZW3 A;  3LEO A;  3EPV A;  4NC3 A;  1ZZP A;  1FFH A;  3FXH A;  3LNR A;  2P1A A;  4HEA J;  4NTA A;  4RBN A;  1BZ4 A;  1T6I A;  3L8I A;  2D5R B;  2HV7 A;  1V54 C;  1ST6 A;  2HSQ A;  2EIK C;  3K7D A;  4JTA B;  1ORJ A;  4KNW A;  4K1O A;  5D92 A;  2W45 A;  3A9C A;  3PCV A;  5TJ5 E;  3QTH A;  1AEP A;  1PCX A;  2BE5 F;  1K05 A; 
#chains in the Genus database with same CATH homology
 4E0H A;  3MBG A;  1JR8 A;  3O55 A;  3U2M A;  3U5S A;  1JRA A;  3LLI A;  4LDK A;  3LLK A;  3TD7 A;  3GWL A;  3R7C A;  2HJ3 A;  3U2L A;  3TK0 A;  3GWN A;  4E0I A;  3W4Y A;  1OQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...