3MBGA

Crystal structure of human augmenter of liver regeneration (alr)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
DCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title Structure of the human sulfhydryl oxidase augmenter of liver regeneration and characterization of a human mutation causing an autosomal recessive myopathy .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 41
structure length 112
sequence length 112
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3mbgA00
3U2LA 3TD7A 3LLKA 2HJ3A 4E0IA 3U5SA 3GWNA 3R7CA 1JR8A 3TK0A 1JRAA 4E0HA 3MBGA 3O55A 3GWLA 3LLIA 4LDKA 3U2MA 1OQCA 3W4YA
chains in the Genus database with same CATH superfamily
1NBBA 3KMIA 2KYHA 1FTSA 2IXMA 3LLKA 4MQ9F 3N24A 1LE4A 1G4US 4PJNA 3TULA 5CI9A 5CIVA 3EH2A 2IYLD 5T3WA 1ZW3A 3RFYA 4NTFA 3US6A 1TQGA 3AGTA 3ZTMA 3EGXB 4GQHA 4YT5A 1Z63A 3OA1A 3G4ZA 4FESA 1YA7O 3IQCA 4KNVA 2PNOA 5DS6A 4YK5A 5D92A 1V54C 1Q0FA 1HE9A 1KNYA 1SYQA 2R7WA 1ZVZA 2W45A 3NMKA 4YL0A 3RH3A 2EINC 2CDQA 2R05A 5HSWA 4MVMA 3NRHA 3EGDA 4YL1A 5A69A 1T9KA 1QQ3A 1E86A 1YARO 2EILC 4PFOA 2FAPB 4EUKB 2XLWA 1FR0A 3AOUA 5AC5A 1FFTC 3ZG1A 2L6GA 5T1DB 1H9GA 1NZEA 3A11A 4ONSA 3V5ZA 4XWJA 3M1CB 5JP7A 1S7ZA 4H4KC 2F22A 5AGFA 3R7CA 5AC4A 5DQTA 4XLPF 2PX0A 1NSGB 2VCBA 3KL4A 4E18A 4I1OB 1RJ9B 1E84A 4G7ZF 2R7QA 4D4XA 1TKNA 2XM4A 2ZPAA 3FOOA 2CNWD 2QY9A 3RQFA 4A4AA 3L34A 4JTDB 1IW7F 3U8VA 4CJGA 3S27A 2OQMA 1JPJA 3VYWA 3GM2A 2LFFA 2HV6A 2OJQA 4P6IC 1V74B 3M4CA 5EGYA 1QLEC 2LIGA 4HEAJ 5A6KA 1YYJA 1MNEA 3N0TA 4EHPA 1G4WR 4H54A 3UMHA 2WZLA 1A7DA 3GEHA 5F5HA 4LACB 3X1OA 2JPUA 4O79A 2J8WA 2I15A 5K0IA 2KSFA 5FZTA 2R02A 2JX0A 4JCHA 4XEFA 1J8YF 4YT4A 3JCUQ 2YLDA 2P7VA 2QUPA 2Z15A 4P9TA 2A69F 2PBEA 3C62A 2HKVA 5D91A 2XS1A 3DE8A 3O10A 5L0GA 1Z5ZA 3JSZA 2VB6A 5DS4A 1R4TA 5L0HA 4IGGA 3NG1A 3I4UA 3M4BA 2KW3C 3K7DA 2YHSA 3SXYA 1GQAA 1SMYF 2QLAA 1ZHXA 4JCZA 1VTMP 2J45A 3VRCA 1ORYA 3O6XA 4FWVA 4NTBA 5L3VA 4MTOA 2NUPB 1SF8A 2QTVA 3W2WA 4DRJB 5A6BA 1ST6A 4O7GA 4G7HF 2R7OA 4QI0A 1LS4A 4EIYA 1SZIA 1K05A 1OCRC 1LPEA 1OCOC 2KGOA 1LI7A 4PJJA 2H8AA 1Z7Qc 3PDMP 4BJ5A 1W2WA 4KBLA 5FCLA 1BZ4A 4PJLA 1Z6AA 2BC5A 2YKZA 1Y6DA 3T6GB 2ZXOA 2L9JA 2NUTA 3J06A 3C8GD 3AQBA 2GAQA 4IAQA 2R7XA 5BQIA 2LQGA 4CBEA 2RD9A 4OIRF 3B29A 5DVWA 1UFBA 1CPQA 3T6JA 3ZIBA 3PMRA 4YJWA 2L7AA 4MVUA 5KYXB 4JURI 4KC9A 4RBNA 3AG1C 5L0JA 3AQCA 4CIPA 2A6HF 3GWLA 3DJNB 256BA 2YEVA 2VASA 2OEVA 4JJGA 4UDVA 2NSGA 5BUOA 1L7CA 2NSFA 3HNJA 1Q0DA 1YZCA 3LAYA 4Z9HA 3SXKA 3S90A 2X0CA 1BBHA 1VLTA 4DOZA 3AGUA 3C18A 2WVNA 3M15A 1D1BA 4IWBA 4JVSA 1T6QA 3SXMA 3RQGA 5L0IA 2HV7A 4K1OA 2CCYA 3JRMO 2BL2A 1ZHZA 1QVXA 3C8ZA 3EFOB 1PD0A 4HFFB 4BEJA 2DYRC 2LFDA 4O6NA 1OR2A 3B0UX 1TFKB 2WVOA 3ABMC 3KPHA 1JMWA 3GODA 2H7VC 2QNLA 2J0WA 2L6FA 4IB4A 4CSAC 1U89A 5BQHA 4Z9IA 4E7SA 1KTMA 1TWHA 1M6TA 2Q9CA 4JKVA 4BJ5C 4BJTA 4AL0A 1CGME 1T01A 4DXWA 1MMDA 1QKRA 3JYYA 3Q6NA 2R03A 4LERA 1HY5A 2GWWA 5EK0A 2Y39A 2YVKA 2W4MA 4W8KA 3HNKA 4F4BA 4XPYA 5KYNA 2UUHA 5L3QA 2AU5A 2YL3A 1T6UA 1NFOA 3LS0A 3MX3A 3QTHA 3JYHA 4C7OA 1K04A 2RSEB 4JZAA 3ECSA 4J7TA 5COMA 4LDRA 4U5GA 2AWYA 1M2VA 4P9FA 3S28A 3V7OA 3L0IA 4HFKB 4XPWA 4OIOF 5F28E 1BR4A 1JR8A 4EBBA 3FDQA 1RKEA 2HMQA 4I3MA 3EJNA 3K1HA 4HE8D 4PR9A 3ABKC 1D1CA 1NLXA 4A2NB 3ITFA 3B0PA 1V55C 2R9RB 3O55A 4X0RA 1M56C 2PP4A 2HUJA 3UMIA 1AEPA 4NC3A 4U5BE 2O9XA 2IXNA 4AX2A 1MQVA 3WAQA 3WHNA 1JOGA 3U9MA 4R32A 4U5CE 2NG1A 2ZXRA 3FMSA 4U9DA 1Z3IX 2ETSA 5JRAA 3U0CA 4U5EE 3ZQYA 2YZSA 3JRTA 3MYIA 3SP1A 1QPUA 3OWTA 5HV9A 3DMDA 1RKCA 2VH3A 4Q4ZF 1GS9A 2Y3BA 1ZU4A 4WABA 1OKKA 1T6IA 3GM3A 2MHRA 3UGOA 2Q9AA 4U5FE 1OCZC 3Q7GA 2GA0A 3TQOA 4MNDA 4J32B 1OXBA 2CGEA 3GM1A 3K6BA 2A0UA 4PJMA 2OCCC 4ULVA 2J9UA 4ER9A 5A6JA 2R7RA 3K66A 2IM8A 1KU2A 5DS5A 3GORA 4QI2A 3L1MA 3LEOA 3MLGA 3I5PA 3RVYA 4G0HA 3RW0A 3TJ6A 2J7PD 2WZFA 4XQ1A 3SXZA 2KC3A 1ZU5A 2CYDA 3EHMA 5T3TA 3VAYA 2W9YA 1JAFA 2EPNA 1V4AA 2XLVA 2C03A 2XSEA 4DBQA 1LM3B 2HS5A 1NU9C 2YLIA 4IJJA 1AVOB 1YVIA 4K0DA 3GEIA 4CIHA 1YLMA 1CGNA 2J9BA 1XWJA 4ULWA 3JZ0A 1HMOA 3PHF2 2YQYA 4C3DA 2FFHA 4CS8A 1VK5A 1RXQA 3QVZA 2XXAA 2I8BA 3POVA 4C3BA 1UG7A 3TOMA 4IRUA 1RJ9A 4OD5A 3GEEA 1XZPA 3SZRA 4DVZA 5JS5A 1YDIA 4YWQA 1CPRA 3SNHA 1YYXA 3Q7LA 3EG9B 1TFOB 2WB7A 3MFNA 4J7YA 2Q7RA 2R7VA 4AL1A 3EPVA 2WL8A 2NUTB 3ZWIA 2DYSC 4JRZA 4MTGA 2CNWA 3L8JA 2P6VA 1VYIA 2IOQA 3NYMA 4Z9JA 1E2XA 2NPUA 3GWNA 4DBRA 1ORJA 1A41A 2A1DD 3DZAA 3M79A 4GYTA 4OINF 4YL3A 1M2OA 4JTAB 4WJ0A 4I1MA 1OR3A 4XLNF 2EIKC 3S0XA 2R25A 3UR3C 1Q0KA 1TWGA 3X2QC 1A7EA 1G8XA 4YT8A 1IZMA 1WATA 2XL4A 3IPMO 2HZ8A 2R7SA 4CX9A 3UGPA 3IEEA 5JVEA 4FX5A 5KYYB 2M64A 4L6RA 3NYLA 4O6MA 5B3IA 4YN0B 3G50A 2ZXPA 3CZ6A 3ZSUA 2QE9A 3H2UA 1O3UA 4B6IA 2NUPA 3IQ5A 3W2VA 3WODF 3AG3C 4BJ1A 2OKUA 1YZAA 1LVKA 2XS8A 4CS8C 4CSAA 1I4ZA 2AWCA 1F1MA 3DD7A 3NKEA 4K7BA 3GANA 4JEBA 1GGQA 2P0NA 5KYUB 3EQLF 4U9EA 1Z23A 2XLMA 1LIHA 1BDJB 3EHNA 3VF0A 1H7IA 1VB5A 1EI7A 2HSQA 2XRHA 5COGA 4D4NA 4LDQA 2FGYA 2XLHA 3R2PA 1EKYA 1ZYRF 3LESA 4DRHB 4BG0A 1FAPB 5JT4A 3RIPA 3FOPA 3W8HA 4LDKA 3QW0A 5KYXA 1OCCC 2Q00A 4I44A 3C8GA 2LCHA 4BPMA 1B68A 4WGYA 1I4YA 3W4YA 1HW2A 1EQ1A 2EIJC 4MS2A 1M2VB 3ATPA 4LLCA 3RKOF 5JUAA 1U6HA 1CGOA 1ZW2A 2XM0A 2A6EF 1RKEB 4N6HA 3HTKC 2HJMA 2LD6A 2X51A 4MVOA 3ZQVA 5KYWA 3B9QA 2HFIA 2A68F 3DM9B 3QZCA 1S05A 3EFOA 2Y3GA 4JW1A 3KYJA 4RD9A 3BRJA 3DM5A 3EGDB 2P61A 3RQEA 5EHHA 3VM6A 1Q0MA 2J9WA 2Y3HA 3NKDA 1PV3A 1HW1A 3DAFA 3B71A 4J30B 2YRFA 3HNIA 2GFHA 3QVYA 4N6CA 1VMAA 4AE4A 5B3SC 5DLJA 1PD1A 3FAJA 3HJCA 3LNRA 3CQZA 4U5HA 3UNGC 2MYSA 3FXHA 2D4UA 1TWCA 4EBJA 2AVKA 3DI5A 2J46A 3LNMB 1G5ZA 3TD7A 4IARA 1FNTc 5GPGB 1MMAA 1LE2A 2Q3TA 1MMNA 4E7ZA 1J8MF 4E0IA 1OW7A 2ICWG 2XL6A 1D0YA 1ORSC 3DAGA 3HNLA 2EPLX 2YL1A 4DRIB 4BJ6A 1BR1A 4IAOA 5BQGA 5KYWB 4C3EA 1LI5A 2ZXWC 1LS1A 1Q0GA 3H2VA 3OEOA 5B1BC 3KH2A 1WWPA 4CDVA 2ZD9A 3MYFA 3U3FA 4EKWA 3Q6MA 4W8PA 5L0CA 1E83A 3RYLA 3TJ5A 1RMVA 1QSPA 2EPKX 1Y4CA 4NCQA 1HE1A 2DI3A 3S9OA 2WZGA 4DJ9A 4WGZA 4E0HA 3NDBB 1ZHYA 2KJGA 2AP3A 3CEXA 1PCXA 3EGXA 4M63A 1VOMA 1DOVA 2OU6A 2P1AA 3S29A 3U2MA 4ZLDA 2JD3A 1JPNA 1R5ID 1OW6A 3IHUA 1C02A 3DWWA 4MVSA 3I5QA 4MVRA 1MNDA 4YT2A 2HSBA 2J9VA 2XLDA 4JTCB 3NMIA 2B0HA 3AG2C 2VCCA 3K33A 2XXAB 4OIQF 4Q7CA 2PF4E 5A6BD 3FVYA 1WGWA 3JTLO 4LLEA 3ASNC 1EA8A 2DB4A 1K40A 1TR2A 1WOLA 3DKAA 3KYIA 4JIOA 2A0BA 2G3VA 5B1AC 2D5RB 1N1CA 3WG7C 2L81A 3L8IA 4JC7A 4Q5SF 2OG2A 2OOCA 3K1IA 4JJFA 4NY3A 3LLIA 1FMWA 3LJBA 3BEHA 3ZTZA 1YJGA 3A9CA 1A7VA 4BJ6C 3EH1A 3KKBA 5E2QA 2KQ9A 2IXOA 2BE5F 2WVQA 3U2LA 4CS9A 4PK4A 3SYNA 3RF3A 2DGJA 3U9JA 5A6AA 1E85A 1XZQA 2V3CC 2HJ3A 4RDAA 4FAPB 3U5SA 3JSEO 2IXPA 1VYKA 3CAXA 4GEHA 1L3PA 3V5XA 2J0XA 4JEAA 2YLGA 3AG4C 3DE9A 3QW1A 1ZHWA 2M4EA 5JSLA 4ANJA 5E3CA 3E9VA 4MW3A 1C03A 2E87A 2C04A 2EPMX 4NTAA 2EPOA 2J7PA 1JRAA 1ZZPA 3UMKA 2TMVP 3N2ZB 3E70C 3QMKA 3MBGA 1AUEA 4MVQA 4QDLA 3IQTA 2OJED 3IQ6A 2XL8A 4KI2A 4CDAA 2EIMC 1BR2A 3ZC4A 3FHDA 1GM5A 2H7BA 1FMVA 2Y3DA 4XEKA 3HLZA 3O39A 4XEVA 3U8PA 3NMJA 2CW0F 4CS7A 3T4RA 2MWQA 2YL7A 1OW8A 4N06A 4ZLCA 3EG9A 3U3BA 1H9TA 1FFHA 1NU7D 1WASA 4XPXA 4NQFA 1APCA 1MMGA 5DQZA 2GDCA 3ABLC 2KK1A 3B0VC 3EZHA 3JT1A 5COFA 3K1IC 2R7UA 3F47A 4OD4A 5L0DA 2XLOA 2LK4A 3H65A 1TWAA 1QZXA 2PFDA 1WTYA 1NFNA 1A0BA 3RVZA 1I5NA 3C8GB 3AJMA 1M57C 2H7OA 2IBFA 5CI8A 4CJOA 4CS9C 5L0FA 2ASRA 4G7OF 2L6HA 1D0ZA 2B0JA 2YL0A 1NG1A 3ASOC 5TJ5E 2LSEA 3DJUB 4PACA 4U5DE 3ZDLA 4PFPA 1H6GA 3EZIA 1OXKA 3ZVRA 3T9OA 4C7OB 4G78A 4BEMJ 4CDYA 1U0BB 1T5OA 4KNWA 2KNHA 1VLSA 5KYYA 1C17M 5JLIA 2PX3A 4JE9A 1HMDA 1RCPA 3F46A 4XTKA 5E3AA 3HKKA 3V5YA 4O6YA 3S84A 4MW8A 2G3KA 2W4BA 3C63A 2LP4A 3NYJA 3TK0A 1SR2A 1YAUO 2VC9A 3W8IA 1DOWA 2V26A 1YA9A 2XLEA 3FAPB 3LS1A 4MVZA 1D1AA 1O87A 3C7JA 3LEVA 3LUTB 5KYUA 4N4WA 4AE4B 1ZHTA 4EWCA 4OIPF 2UUIA 3G4XA 5F5FA 4MTFA 3T6BA 3SEOA 2VCAA 2Q9BA 1D0XA 3DXJF 2G62A 2Q4FA 2Y69C 4EBKA 2HMZA 4DVYP 1WN0A 5IY5C 2R7TA 3PCVA 1OKKD 4AK9A 2OEXA 2YWAA 1OQCA 3TOLA 1LKXA 4E17A 1O5HA 5E33A 3CSKA
chains in the Genus database with same CATH topology
3U2LA 3TD7A 3LLKA 2HJ3A 4E0IA 3U5SA 3GWNA 3R7CA 1JR8A 3TK0A 1JRAA 4E0HA 3MBGA 3O55A 3GWLA 3LLIA 4LDKA 3U2MA 1OQCA 3W4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2L A;  3TD7 A;  3LLK A;  2HJ3 A;  4E0I A;  3U5S A;  3GWN A;  3R7C A;  1JR8 A;  3TK0 A;  1JRA A;  4E0H A;  3MBG A;  3O55 A;  3GWL A;  3LLI A;  4LDK A;  3U2M A;  1OQC A;  3W4Y A; 
#chains in the Genus database with same CATH topology
 1NBB A;  3KMI A;  2KYH A;  1FTS A;  2IXM A;  3LLK A;  4MQ9 F;  3N24 A;  1LE4 A;  1G4U S;  4PJN A;  3TUL A;  5CI9 A;  5CIV A;  3EH2 A;  2IYL D;  5T3W A;  1ZW3 A;  3RFY A;  4NTF A;  3US6 A;  1TQG A;  3AGT A;  3ZTM A;  3EGX B;  4GQH A;  4YT5 A;  1Z63 A;  3OA1 A;  3G4Z A;  4FES A;  1YA7 O;  3IQC A;  4KNV A;  2PNO A;  5DS6 A;  4YK5 A;  5D92 A;  1V54 C;  1Q0F A;  1HE9 A;  1KNY A;  1SYQ A;  2R7W A;  1ZVZ A;  2W45 A;  3NMK A;  4YL0 A;  3RH3 A;  2EIN C;  2CDQ A;  2R05 A;  5HSW A;  4MVM A;  3NRH A;  3EGD A;  4YL1 A;  5A69 A;  1T9K A;  1QQ3 A;  1E86 A;  1YAR O;  2EIL C;  4PFO A;  2FAP B;  4EUK B;  2XLW A;  1FR0 A;  3AOU A;  5AC5 A;  1FFT C;  3ZG1 A;  2L6G A;  5T1D B;  1H9G A;  1NZE A;  3A11 A;  4ONS A;  3V5Z A;  4XWJ A;  3M1C B;  5JP7 A;  1S7Z A;  4H4K C;  2F22 A;  5AGF A;  3R7C A;  5AC4 A;  5DQT A;  4XLP F;  2PX0 A;  1NSG B;  2VCB A;  3KL4 A;  4E18 A;  4I1O B;  1RJ9 B;  1E84 A;  4G7Z F;  2R7Q A;  4D4X A;  1TKN A;  2XM4 A;  2ZPA A;  3FOO A;  2CNW D;  2QY9 A;  3RQF A;  4A4A A;  3L34 A;  4JTD B;  1IW7 F;  3U8V A;  4CJG A;  3S27 A;  2OQM A;  1JPJ A;  3VYW A;  3GM2 A;  2LFF A;  2HV6 A;  2OJQ A;  4P6I C;  1V74 B;  3M4C A;  5EGY A;  1QLE C;  2LIG A;  4HEA J;  5A6K A;  1YYJ A;  1MNE A;  3N0T A;  4EHP A;  1G4W R;  4H54 A;  3UMH A;  2WZL A;  1A7D A;  3GEH A;  5F5H A;  4LAC B;  3X1O A;  2JPU A;  4O79 A;  2J8W A;  2I15 A;  5K0I A;  2KSF A;  5FZT A;  2R02 A;  2JX0 A;  4JCH A;  4XEF A;  1J8Y F;  4YT4 A;  3JCU Q;  2YLD A;  2P7V A;  2QUP A;  2Z15 A;  4P9T A;  2A69 F;  2PBE A;  3C62 A;  2HKV A;  5D91 A;  2XS1 A;  3DE8 A;  3O10 A;  5L0G A;  1Z5Z A;  3JSZ A;  2VB6 A;  5DS4 A;  1R4T A;  5L0H A;  4IGG A;  3NG1 A;  3I4U A;  3M4B A;  2KW3 C;  3K7D A;  2YHS A;  3SXY A;  1GQA A;  1SMY F;  2QLA A;  1ZHX A;  4JCZ A;  1VTM P;  2J45 A;  3VRC A;  1ORY A;  3O6X A;  4FWV A;  4NTB A;  5L3V A;  4MTO A;  2NUP B;  1SF8 A;  2QTV A;  3W2W A;  4DRJ B;  5A6B A;  1ST6 A;  4O7G A;  4G7H F;  2R7O A;  4QI0 A;  1LS4 A;  4EIY A;  1SZI A;  1K05 A;  1OCR C;  1LPE A;  1OCO C;  2KGO A;  1LI7 A;  4PJJ A;  2H8A A;  1Z7Q c;  3PDM P;  4BJ5 A;  1W2W A;  4KBL A;  5FCL A;  1BZ4 A;  4PJL A;  1Z6A A;  2BC5 A;  2YKZ A;  1Y6D A;  3T6G B;  2ZXO A;  2L9J A;  2NUT A;  3J06 A;  3C8G D;  3AQB A;  2GAQ A;  4IAQ A;  2R7X A;  5BQI A;  2LQG A;  4CBE A;  2RD9 A;  4OIR F;  3B29 A;  5DVW A;  1UFB A;  1CPQ A;  3T6J A;  3ZIB A;  3PMR A;  4YJW A;  2L7A A;  4MVU A;  5KYX B;  4JUR I;  4KC9 A;  4RBN A;  3AG1 C;  5L0J A;  3AQC A;  4CIP A;  2A6H F;  3GWL A;  3DJN B;  256B A;  2YEV A;  2VAS A;  2OEV A;  4JJG A;  4UDV A;  2NSG A;  5BUO A;  1L7C A;  2NSF A;  3HNJ A;  1Q0D A;  1YZC A;  3LAY A;  4Z9H A;  3SXK A;  3S90 A;  2X0C A;  1BBH A;  1VLT A;  4DOZ A;  3AGU A;  3C18 A;  2WVN A;  3M15 A;  1D1B A;  4IWB A;  4JVS A;  1T6Q A;  3SXM A;  3RQG A;  5L0I A;  2HV7 A;  4K1O A;  2CCY A;  3JRM O;  2BL2 A;  1ZHZ A;  1QVX A;  3C8Z A;  3EFO B;  1PD0 A;  4HFF B;  4BEJ A;  2DYR C;  2LFD A;  4O6N A;  1OR2 A;  3B0U X;  1TFK B;  2WVO A;  3ABM C;  3KPH A;  1JMW A;  3GOD A;  2H7V C;  2QNL A;  2J0W A;  2L6F A;  4IB4 A;  4CSA C;  1U89 A;  5BQH A;  4Z9I A;  4E7S A;  1KTM A;  1TWH A;  1M6T A;  2Q9C A;  4JKV A;  4BJ5 C;  4BJT A;  4AL0 A;  1CGM E;  1T01 A;  4DXW A;  1MMD A;  1QKR A;  3JYY A;  3Q6N A;  2R03 A;  4LER A;  1HY5 A;  2GWW A;  5EK0 A;  2Y39 A;  2YVK A;  2W4M A;  4W8K A;  3HNK A;  4F4B A;  4XPY A;  5KYN A;  2UUH A;  5L3Q A;  2AU5 A;  2YL3 A;  1T6U A;  1NFO A;  3LS0 A;  3MX3 A;  3QTH A;  3JYH A;  4C7O A;  1K04 A;  2RSE B;  4JZA A;  3ECS A;  4J7T A;  5COM A;  4LDR A;  4U5G A;  2AWY A;  1M2V A;  4P9F A;  3S28 A;  3V7O A;  3L0I A;  4HFK B;  4XPW A;  4OIO F;  5F28 E;  1BR4 A;  1JR8 A;  4EBB A;  3FDQ A;  1RKE A;  2HMQ A;  4I3M A;  3EJN A;  3K1H A;  4HE8 D;  4PR9 A;  3ABK C;  1D1C A;  1NLX A;  4A2N B;  3ITF A;  3B0P A;  1V55 C;  2R9R B;  3O55 A;  4X0R A;  1M56 C;  2PP4 A;  2HUJ A;  3UMI A;  1AEP A;  4NC3 A;  4U5B E;  2O9X A;  2IXN A;  4AX2 A;  1MQV A;  3WAQ A;  3WHN A;  1JOG A;  3U9M A;  4R32 A;  4U5C E;  2NG1 A;  2ZXR A;  3FMS A;  4U9D A;  1Z3I X;  2ETS A;  5JRA A;  3U0C A;  4U5E E;  3ZQY A;  2YZS A;  3JRT A;  3MYI A;  3SP1 A;  1QPU A;  3OWT A;  5HV9 A;  3DMD A;  1RKC A;  2VH3 A;  4Q4Z F;  1GS9 A;  2Y3B A;  1ZU4 A;  4WAB A;  1OKK A;  1T6I A;  3GM3 A;  2MHR A;  3UGO A;  2Q9A A;  4U5F E;  1OCZ C;  3Q7G A;  2GA0 A;  3TQO A;  4MND A;  4J32 B;  1OXB A;  2CGE A;  3GM1 A;  3K6B A;  2A0U A;  4PJM A;  2OCC C;  4ULV A;  2J9U A;  4ER9 A;  5A6J A;  2R7R A;  3K66 A;  2IM8 A;  1KU2 A;  5DS5 A;  3GOR A;  4QI2 A;  3L1M A;  3LEO A;  3MLG A;  3I5P A;  3RVY A;  4G0H A;  3RW0 A;  3TJ6 A;  2J7P D;  2WZF A;  4XQ1 A;  3SXZ A;  2KC3 A;  1ZU5 A;  2CYD A;  3EHM A;  5T3T A;  3VAY A;  2W9Y A;  1JAF A;  2EPN A;  1V4A A;  2XLV A;  2C03 A;  2XSE A;  4DBQ A;  1LM3 B;  2HS5 A;  1NU9 C;  2YLI A;  4IJJ A;  1AVO B;  1YVI A;  4K0D A;  3GEI A;  4CIH A;  1YLM A;  1CGN A;  2J9B A;  1XWJ A;  4ULW A;  3JZ0 A;  1HMO A;  3PHF 2;  2YQY A;  4C3D A;  2FFH A;  4CS8 A;  1VK5 A;  1RXQ A;  3QVZ A;  2XXA A;  2I8B A;  3POV A;  4C3B A;  1UG7 A;  3TOM A;  4IRU A;  1RJ9 A;  4OD5 A;  3GEE A;  1XZP A;  3SZR A;  4DVZ A;  5JS5 A;  1YDI A;  4YWQ A;  1CPR A;  3SNH A;  1YYX A;  3Q7L A;  3EG9 B;  1TFO B;  2WB7 A;  3MFN A;  4J7Y A;  2Q7R A;  2R7V A;  4AL1 A;  3EPV A;  2WL8 A;  2NUT B;  3ZWI A;  2DYS C;  4JRZ A;  4MTG A;  2CNW A;  3L8J A;  2P6V A;  1VYI A;  2IOQ A;  3NYM A;  4Z9J A;  1E2X A;  2NPU A;  3GWN A;  4DBR A;  1ORJ A;  1A41 A;  2A1D D;  3DZA A;  3M79 A;  4GYT A;  4OIN F;  4YL3 A;  1M2O A;  4JTA B;  4WJ0 A;  4I1M A;  1OR3 A;  4XLN F;  2EIK C;  3S0X A;  2R25 A;  3UR3 C;  1Q0K A;  1TWG A;  3X2Q C;  1A7E A;  1G8X A;  4YT8 A;  1IZM A;  1WAT A;  2XL4 A;  3IPM O;  2HZ8 A;  2R7S A;  4CX9 A;  3UGP A;  3IEE A;  5JVE A;  4FX5 A;  5KYY B;  2M64 A;  4L6R A;  3NYL A;  4O6M A;  5B3I A;  4YN0 B;  3G50 A;  2ZXP A;  3CZ6 A;  3ZSU A;  2QE9 A;  3H2U A;  1O3U A;  4B6I A;  2NUP A;  3IQ5 A;  3W2V A;  3WOD F;  3AG3 C;  4BJ1 A;  2OKU A;  1YZA A;  1LVK A;  2XS8 A;  4CS8 C;  4CSA A;  1I4Z A;  2AWC A;  1F1M A;  3DD7 A;  3NKE A;  4K7B A;  3GAN A;  4JEB A;  1GGQ A;  2P0N A;  5KYU B;  3EQL F;  4U9E A;  1Z23 A;  2XLM A;  1LIH A;  1BDJ B;  3EHN A;  3VF0 A;  1H7I A;  1VB5 A;  1EI7 A;  2HSQ A;  2XRH A;  5COG A;  4D4N A;  4LDQ A;  2FGY A;  2XLH A;  3R2P A;  1EKY A;  1ZYR F;  3LES A;  4DRH B;  4BG0 A;  1FAP B;  5JT4 A;  3RIP A;  3FOP A;  3W8H A;  4LDK A;  3QW0 A;  5KYX A;  1OCC C;  2Q00 A;  4I44 A;  3C8G A;  2LCH A;  4BPM A;  1B68 A;  4WGY A;  1I4Y A;  3W4Y A;  1HW2 A;  1EQ1 A;  2EIJ C;  4MS2 A;  1M2V B;  3ATP A;  4LLC A;  3RKO F;  5JUA A;  1U6H A;  1CGO A;  1ZW2 A;  2XM0 A;  2A6E F;  1RKE B;  4N6H A;  3HTK C;  2HJM A;  2LD6 A;  2X51 A;  4MVO A;  3ZQV A;  5KYW A;  3B9Q A;  2HFI A;  2A68 F;  3DM9 B;  3QZC A;  1S05 A;  3EFO A;  2Y3G A;  4JW1 A;  3KYJ A;  4RD9 A;  3BRJ A;  3DM5 A;  3EGD B;  2P61 A;  3RQE A;  5EHH A;  3VM6 A;  1Q0M A;  2J9W A;  2Y3H A;  3NKD A;  1PV3 A;  1HW1 A;  3DAF A;  3B71 A;  4J30 B;  2YRF A;  3HNI A;  2GFH A;  3QVY A;  4N6C A;  1VMA A;  4AE4 A;  5B3S C;  5DLJ A;  1PD1 A;  3FAJ A;  3HJC A;  3LNR A;  3CQZ A;  4U5H A;  3UNG C;  2MYS A;  3FXH A;  2D4U A;  1TWC A;  4EBJ A;  2AVK A;  3DI5 A;  2J46 A;  3LNM B;  1G5Z A;  3TD7 A;  4IAR A;  1FNT c;  5GPG B;  1MMA A;  1LE2 A;  2Q3T A;  1MMN A;  4E7Z A;  1J8M F;  4E0I A;  1OW7 A;  2ICW G;  2XL6 A;  1D0Y A;  1ORS C;  3DAG A;  3HNL A;  2EPL X;  2YL1 A;  4DRI B;  4BJ6 A;  1BR1 A;  4IAO A;  5BQG A;  5KYW B;  4C3E A;  1LI5 A;  2ZXW C;  1LS1 A;  1Q0G A;  3H2V A;  3OEO A;  5B1B C;  3KH2 A;  1WWP A;  4CDV A;  2ZD9 A;  3MYF A;  3U3F A;  4EKW A;  3Q6M A;  4W8P A;  5L0C A;  1E83 A;  3RYL A;  3TJ5 A;  1RMV A;  1QSP A;  2EPK X;  1Y4C A;  4NCQ A;  1HE1 A;  2DI3 A;  3S9O A;  2WZG A;  4DJ9 A;  4WGZ A;  4E0H A;  3NDB B;  1ZHY A;  2KJG A;  2AP3 A;  3CEX A;  1PCX A;  3EGX A;  4M63 A;  1VOM A;  1DOV A;  2OU6 A;  2P1A A;  3S29 A;  3U2M A;  4ZLD A;  2JD3 A;  1JPN A;  1R5I D;  1OW6 A;  3IHU A;  1C02 A;  3DWW A;  4MVS A;  3I5Q A;  4MVR A;  1MND A;  4YT2 A;  2HSB A;  2J9V A;  2XLD A;  4JTC B;  3NMI A;  2B0H A;  3AG2 C;  2VCC A;  3K33 A;  2XXA B;  4OIQ F;  4Q7C A;  2PF4 E;  5A6B D;  3FVY A;  1WGW A;  3JTL O;  4LLE A;  3ASN C;  1EA8 A;  2DB4 A;  1K40 A;  1TR2 A;  1WOL A;  3DKA A;  3KYI A;  4JIO A;  2A0B A;  2G3V A;  5B1A C;  2D5R B;  1N1C A;  3WG7 C;  2L81 A;  3L8I A;  4JC7 A;  4Q5S F;  2OG2 A;  2OOC A;  3K1I A;  4JJF A;  4NY3 A;  3LLI A;  1FMW A;  3LJB A;  3BEH A;  3ZTZ A;  1YJG A;  3A9C A;  1A7V A;  4BJ6 C;  3EH1 A;  3KKB A;  5E2Q A;  2KQ9 A;  2IXO A;  2BE5 F;  2WVQ A;  3U2L A;  4CS9 A;  4PK4 A;  3SYN A;  3RF3 A;  2DGJ A;  3U9J A;  5A6A A;  1E85 A;  1XZQ A;  2V3C C;  2HJ3 A;  4RDA A;  4FAP B;  3U5S A;  3JSE O;  2IXP A;  1VYK A;  3CAX A;  4GEH A;  1L3P A;  3V5X A;  2J0X A;  4JEA A;  2YLG A;  3AG4 C;  3DE9 A;  3QW1 A;  1ZHW A;  2M4E A;  5JSL A;  4ANJ A;  5E3C A;  3E9V A;  4MW3 A;  1C03 A;  2E87 A;  2C04 A;  2EPM X;  4NTA A;  2EPO A;  2J7P A;  1JRA A;  1ZZP A;  3UMK A;  2TMV P;  3N2Z B;  3E70 C;  3QMK A;  3MBG A;  1AUE A;  4MVQ A;  4QDL A;  3IQT A;  2OJE D;  3IQ6 A;  2XL8 A;  4KI2 A;  4CDA A;  2EIM C;  1BR2 A;  3ZC4 A;  3FHD A;  1GM5 A;  2H7B A;  1FMV A;  2Y3D A;  4XEK A;  3HLZ A;  3O39 A;  4XEV A;  3U8P A;  3NMJ A;  2CW0 F;  4CS7 A;  3T4R A;  2MWQ A;  2YL7 A;  1OW8 A;  4N06 A;  4ZLC A;  3EG9 A;  3U3B A;  1H9T A;  1FFH A;  1NU7 D;  1WAS A;  4XPX A;  4NQF A;  1APC A;  1MMG A;  5DQZ A;  2GDC A;  3ABL C;  2KK1 A;  3B0V C;  3EZH A;  3JT1 A;  5COF A;  3K1I C;  2R7U A;  3F47 A;  4OD4 A;  5L0D A;  2XLO A;  2LK4 A;  3H65 A;  1TWA A;  1QZX A;  2PFD A;  1WTY A;  1NFN A;  1A0B A;  3RVZ A;  1I5N A;  3C8G B;  3AJM A;  1M57 C;  2H7O A;  2IBF A;  5CI8 A;  4CJO A;  4CS9 C;  5L0F A;  2ASR A;  4G7O F;  2L6H A;  1D0Z A;  2B0J A;  2YL0 A;  1NG1 A;  3ASO C;  5TJ5 E;  2LSE A;  3DJU B;  4PAC A;  4U5D E;  3ZDL A;  4PFP A;  1H6G A;  3EZI A;  1OXK A;  3ZVR A;  3T9O A;  4C7O B;  4G78 A;  4BEM J;  4CDY A;  1U0B B;  1T5O A;  4KNW A;  2KNH A;  1VLS A;  5KYY A;  1C17 M;  5JLI A;  2PX3 A;  4JE9 A;  1HMD A;  1RCP A;  3F46 A;  4XTK A;  5E3A A;  3HKK A;  3V5Y A;  4O6Y A;  3S84 A;  4MW8 A;  2G3K A;  2W4B A;  3C63 A;  2LP4 A;  3NYJ A;  3TK0 A;  1SR2 A;  1YAU O;  2VC9 A;  3W8I A;  1DOW A;  2V26 A;  1YA9 A;  2XLE A;  3FAP B;  3LS1 A;  4MVZ A;  1D1A A;  1O87 A;  3C7J A;  3LEV A;  3LUT B;  5KYU A;  4N4W A;  4AE4 B;  1ZHT A;  4EWC A;  4OIP F;  2UUI A;  3G4X A;  5F5F A;  4MTF A;  3T6B A;  3SEO A;  2VCA A;  2Q9B A;  1D0X A;  3DXJ F;  2G62 A;  2Q4F A;  2Y69 C;  4EBK A;  2HMZ A;  4DVY P;  1WN0 A;  5IY5 C;  2R7T A;  3PCV A;  1OKK D;  4AK9 A;  2OEX A;  2YWA A;  1OQC A;  3TOL A;  1LKX A;  4E17 A;  1O5H A;  5E33 A;  3CSK A; 
#chains in the Genus database with same CATH homology
 3U2L A;  3TD7 A;  3LLK A;  2HJ3 A;  4E0I A;  3U5S A;  3GWN A;  3R7C A;  1JR8 A;  3TK0 A;  1JRA A;  4E0H A;  3MBG A;  3O55 A;  3GWL A;  3LLI A;  4LDK A;  3U2M A;  1OQC A;  3W4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...