3MBWB

Crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
127
Chain Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords Ephrin type-A receptor 2
total genus 27
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3mbwB00
2YAEA 3QJUB 4P5SA 3WKPA 3NJKA 4GP8B 2WO3B 4GYBA 1OCOB 1NIEA 2XV2A 1ZIBA 3OMNB 4DP0X 4PAZA 4G7RB 1TEFA 4GXFA 1IKOP 4A2DA 5B1AB 4YSSA 2HLEB 1R1CA 2VSKB 1V54B 3FSWA 4AKQA 1NINA 4GY4A 4E9YA 4YSAA 2QDWA 3MBWB 2AANA 1OE1A 3EH3B 4F7KA 4X4KA 4BWUA 5I6KA 4BWWA 1MZYA 2PCFA 1UATA 1ZDQA 4G71B 3S8FB 3FPXA 2BZ7A 2UXFA 3TA4D 4YSDA 2Q5BA 1E30A 4YSOA 4YSTA 2XX1A 5B1KA 1X9UA 4AKPA 5I6LA 1AZUA 2B08A 2CUAA 2EINB 3QJVB 5F7BA 1NIBA 3ASOB 2UXTA 2GC4C 3RYMA 3NJFA 1MG3C 1L9QA 2Y1AA 2OV0A 4DP5X 4CSPA 1SDDA 2YAHA 3NP4A 3ABLB 1NPJA 3NSFA 1AZRA 2AZUA 3ZDWA 2XV0A 5B7EA 3PAZA 2H47C 3TASA 2IDTA 5I6MA 3NJMA 4HCIA 2MTAA 2BP0B 1ZIAA 2H3XC 2BHFA 1KV7A 2W8CA 3BVDB 1JZFA 1BYOA 3IBOA 3T6XA 1J5CA 1I53A 3KW8A 2EIMB 4G7QB 3D12B 3QPKA 4DP4X 3NSYA 3NJJA 3FSVA 2DY2A 3AY2A 5I5IA 2PLTA 4DP2X 1W6LA 3EH5B 1GSKA 2PP9A 4PCYA 3SBPA 5I6NA 2WSDA 1OV8A 1BQKA 4Q89A 1OF0A 3JTBA 3UAEA 2VMJA 2MRYA 2UXGA 1NICA 2IH8A 2GSMB 4UANA 4DP9X 3S8GB 2AVFA 4E9RA 1JXGA 2QDVA 2LLNA 3TBBA 2FTAA 5B7FA 2QT6A 1BXAA 4Q8BA 4KOCA 2CALA 2FT6A 1BAWA 3ABGA 2CAKA 1JZGA 2CCWA 5B1JA 3WKQA 3OQRA 3FSZA 2PPCA 1E5YA 2XYBA 5B1BB 5D4JA 3NJLA 4ZK8A 1TU2A 1XB3A 3OM3B 4YSCA 1YLBB 1NWPA 1PLAA 4KO6A 4G72B 1OE3A 3AW5A 5F7AA 1J9QA 2GHZA 2FQDA 1L9SA 2J55A 5B1JC 1PZBA 3CG8A 2J57A 1NDTA 6PCYA 3C75A 3AG3B 1BQRA 3H56A 2HRGA 3ASNB 1A3ZA 2BZCA 1HFUA 2FQEA 2PPAA 3T6VA 3PLYA 4L0PB 2XXFA 4N8UA 2I7SA 1E65A 3S3DB 1RCYA 2YAMA 2IH9A 1PLCA 1WS8A 3OMIB 2ZONA 1NPNA 3QQXA 1TEGA 2DWTA 2YAPA 1WA0X 2IDFA 3UAAA 1E5ZA 2J5WA 3S3CB 1V10A 5IY5B 4N4YB 2FWLB 3FT0A 3ABKB 3QJSB 1GS8A 1HAWA 3DIVA 2PCYA 4A2GA 4DPAX 3UABA 3GXUB 3QJRB 1XB8A 3CVCA 1MDAA 3N2JA 4HCFA 2VW7A 4KO5A 1WA2X 4YVUA 3CDZB 3NJIA 2JXMA 4HHGA 5FC9A 1AANA 1GR7A 1AZNA 3ZBMA 2GI0A 1DYZA 1AS8A 4M3HA 1N68A 3SBQA 3T6ZA 4W1TA 3NSCA 2A3TA 2FT8A 2X87A 1PNCA 1JVLA 2BWDA 1J9TA 3ERXA 3T9WA 4KNSA 2UX6A 3FU7B 4DP1X 1ID2A 4DPCX 1KCWA 2QPDB 1AACA 3X1BA 3FQ1A 2JFCA 1J9RA 1OCCB 2XV3A 2ZWNA 1AIZA 3UACA 3MX0B 4WKXA 1SDDB 1SHWA 1SJMA 3ZX1A 4KO7A 2YAFA 3V9EA 1E67A 1URIA 2HRHA 4RH4A 4QLWA 2XX0A 4JHVA 4G7SB 3X2QB 3T6WA 2PP7A 3FPYA 4NAJA 2J56A 5EHFA 4YSPA 1SNRA 2PPFA 4FAAB 3FQ2A 3S3BB 3T71A 1ASPA 1GW0A 4YL4A 1B3IA 2IDQA 1GY1A 2GIMA 3G5WA 2JKWA 2VW6A 1SF3A 2BW5A 1GS7A 1PAZA 2XVBA 1XB6A 4GP4B 3WG7B 1AG0A 1OCZB 3QJQB 5D4HA 2VN3A 3TU6A 2BW4A 3FU7A 4KO9A 1EHKB 5PCYA 4YSUA 1QHQA 1GS6X 3KW7A 1SF5A 2DV6A 1IUZA 1IC0A 3OD3A 1MZZA 2VM4A 1QNIA 3IN2A 4BDVB 4JHUA 3X1GA 2HX9A 8PAZA 1BQ5A 1TKWA 3U25A 2BP8A 3CDZA 2TSAA 1KBWA 4E9WA 3NJNA 4NERA 1AS6A 1A8ZA 1KYAA 2GB2A 4M4RB 1NZRA 2AZAA 2OJ1A 1AAJA 4MFHA 2Q9OA 4BK5C 5B7MA 5I6OA 4AX3A 1WS7A 3CVDA 3FU8A 2PPEA 4DP7X 4UAHA 3DKHA 1KDJA 1QLEB 1CC3A 5A7EA 1AR1B 3OMAB 2NRDA 1L9TA 5B3SB 2H5UA 9PCYA 2AFNA 1XMEB 3N55A 2HXAA 2P80D 2PP8A 3UADA 1L9PA 2E86A 3NYKA 3AG4B 1ASQA 1CURA 5TK4A 2XXGA 2TSBA 7PAZA 5PAZA 3X1EA 2N0MA 4E9SA 1NIDA 1FWXA 3NJHA 4DP6X 1CYWA 1ET5A 1KDIA 3SBRA 1CUOA 7PCYA 5I28A 1W6WA 3GYRA 2YQBA 1ZV2A 2FJSA 4F2EA 1KBVA 3WIAA 1NIFA 3UGEA 1JOIA 2UX7A 1SHXA 4AZUA 3FS9A 1W8EA 4E9XA 5AZUA 2BWIA 2IAAC 3NSDA 3HEIB 1L9OA 1OCRB 1HAUA 2CJ3A 4HHWA 5ANHA 1A4CA 1X9RA 4DPBX 4A67A 1IBYA 4EF3A 1SFDA 1KGYE 1JZJA 3H4HA 2VW4A 2QPEB 2PPDA 1JVOA 1ZPUA 1JZEA 2IDSA 3AZUA 6PAZA 4AKOA 1AOZA 1NIAA 2BP0A 4GP5B 1BEXA 3IE9A 2EIJB 4BXVA 1M56B 4NB7A 1JXDA 3AG1B 4BWTA 1ILUA 2FQFA 3SQRA 3PXLA 4HZ1A 1A65A 2IWEA 2X88A 2YAOA 4E9TA 1ASOA 2FNWA 2I85A 3PAUA 1ET8A 1PCSA 1EZLA 4TXVB 4DP8X 2R7EA 1OE2A 1AS7A 1A4AA 2OCCB 4W9ZA 1PY0A 3WI9A 1AZCA 5I5JA 1J5DA 1PNDA 3FSAA 1GYCA 1NWOA 2BP8B 2FQGA 2BO0A 1JXFA 2IDUA 1ZDSA 2UXVA 4FA7B 2ZOOA 2B3IA 4A2FA 4BDVA 2YARA 4KOBA 3EH4B 3HB3B 5AFAA 2XUWA 4QKTA 1L9RA 3L45A 2IWKA 2XWZA 1NTDA 2WO2B 5LDUA 1ET7A 1ILSA 2HZHA 1PLBA 2HX7A 2VM3A 1WAEA 2VSMB 4E9VA 1PMYA 3FQYA 4KNUA 3NJGA 5E9NA 1J9SA 1FA4A 4YSRA 1BXVA 3NT0A 3V9CA 4A66A 3EHBB 5I5MA 1RZPA 2HX8A 3X1FA 3QJTB 5TK2A 1PZCA 3FYEB 4UF7C 1JZHA 2FT7A 3JT2A 1RKRA 5AKRA 4G70B 4KNTA 1PZAA 1GY2A 3EF4A 4HCGA 4YSQA 3WNIA 3FU9A 2R7EB 2DYSB 2ZXWB 3WNJA 1ETJA 2XLLA 2YXVA 5D4IA 1PF3A 3BQVA 4F2FA 3NP3A 4E9QA 1VLXA 3FYIB 2RACA 1A4BA 2YAQA 3TBCA 1V55B 3H4FA 4A2HA 1ADWA 1N70A 1FFTB 3ABMB 3PAVA 1RZQA 2W88A 3CZUB 3PCYA 2EIKB 3IN0A 4JKNA 5I6PA 1CYXA 1MG2C 1WA1X 1JERA 5I26A 1M9WA 4P5RA 4ENZA 1DZ0A 1SFHA 2Y69B 2GBAA 3PPSA 1M57B 4YVNA 3CVBA 4WTQA 2I7OA 4CSZA 3AG2B 2IWFA 2XU9A 4K9JA 1BYPA 4HALA 4YSEA 4A68A 1T5KA 3IEAA 2EILB 4HAKA 3ZIYA 2P80A 1OOWA 1IBZA 4AI7A 4BXSV 1BXUA 3GDCA 1F56A 2YXWA 4A2EA 2GC7C 1AZBA 1AG6A 3DTUB 2DYRB 2DWSA 1KCBA 3X1NA 1AQ8A 4HIPA 2CBPA 1JZIA
chains in the Genus database with same CATH superfamily
3HG1E 3CN2A 5CLZA 1A6UL 1CGXA 1DE4B 5HJ3B 1MUJB 3LNGA 3QHZL 2LQRA 1AGBA 1Q9KB 3WKYA 3WIFB 4JY6B 4EOWH 2VKWA 4F9PA 1IC4H 1AD9A 4HX1B 1TO4A 4QYAA 2PYEA 2X7LB 4O9HH 4XMWA 5IF0A 2OK0L 2EDRA 1NCHA 2MKLC 3B1UA 2AGJL 4PGZA 4OVVA 5B3NA 3B4NA 1N5AA 3BGFB 2JI2A 3RPKA 1CTOA 1CYGA 2D7TH 4LLAA 3BRGC 2WXQA 1AHKA 2V9RA 1IGML 3FQRB 5FYLE 3W38A 4JFFD 1G0XA 2M8XA 3ULVD 3KH3A 5A2CA 1TTUA 4QXTA 2QLVB 3UBXA 2DM3A 3NJFA 4YN3A 3T3PB 4WQOA 1VFUA 1CGYA 2K70A 4YO0B 4LVEA 2RCSL 1CTMA 1MCPH 1UOLA 4MX7B 4Y2OA 4K4KA 2BVQA 1M05A 3MRHA 3V0IA 3QIWD 4FMKA 2LABA 3DETD 3ZUNC 4N28A 4RAVB 4TSBH 2FYYA 1B6DA 5DEFB 1PY9A 2Q87A 2HUHA 4F7CA 3IXAA 1KBGH 4L3ED 1R3JB 1MH5B 1BQLH 1RUAH 3WDJA 3WNMA 1W15A 4PV9B 3VXTA 2DQGL 2CK0L 1RFDH 3CK0H 3MV9D 5KG9A 4G7YH 5GGQL 1MHCB 1TZOA 3THMH 4MJ6B 4Q6IC 3E8UL 1YNLH 5IEKB 3ELAT 4OFVA 1RK1B 1CDCA 4PPTA 2R27A 4JREB 5CHNB 3Q9PA 1SRDA 2DI9A 5AW4B 3SY0A 2EEBA 2XSKA 4F57H 2NDGA 4AQZA 4LT7A 5CSZA 4ETQA 1OP3H 4NN7C 4AJYV 3VWJC 3ZE2F 2FATL 1DE4A 4Q89A 4MJHA 4K7PX 3STBA 4L1LA 4IKKA 5J8OA 1I31A 5DF0A 1Z9OA 4Z8FH 1JXGA 5DZAA 2AEPH 1M05B 2UYLA 3PG2A 3LEXB 5IGXL 3KDMA 5IW1A 3UTSA 4LDLB 4UZSA 1UFUA 1ND0A 4FFVC 4FQ1L 5T5FA 1BAWA 2IH3B 2EACA 4H8VA 3RPBA 3WKQA 2ZXQA 4S1SL 4PVMA 4XZUA 3TFBA 4LKXA 4KFMA 5E99L 3NABH 2CUIA 1QPXA 1I4FB 4JFDA 3MROA 1D9KD 3OF6A 1ESOA 3VD1A 1M2OA 5HHQA 3MNVB 1J9QA 1HXMB 4IBZA 2GHZA 2VDPH 3BUBA 1BBDL 1PZBA 2QKIB 2VMDA 4P4KB 5LG6A 2XG4A 3EFOB 5A7BA 3TEWA 3D39E 7FABL 1FVCB 4OKVB 3TN0D 3O9WC 3H53A 4DK5A 2DYPB 4GSRA 3MTRA 5ADPL 2RA1A 2XXFA 2HVJA 3HFMH 4F24A 5HGHB 1IJ9A 3CDGA 3VYOA 4N2IA 4UDUB 1PLCA 2W9LA 3MVSA 1EVTC 1ZJAA 4ZD3L 1S5HA 1EJFA 4W4OA 1BM3H 3RWEA 1AY1L 3OF6D 4GI9A 4OFKA 1G6RA 5IY5B 1PZDA 5GS0L 1MJ8L 3S3PA 5KJ7E 4P2RE 1GS8A 3EDJA 2XETA 4S0HA 2N1KA 3TZVD 2MPAH 1CE1L 1AGEB 3D9AL 2QVTA 1DBAH 2OSYA 5B8CC 5GZNA 2N56A 5TE4L 4TVPL 5E0FA 4ENEC 3WS3B 4EZKA 1O5DT 3CC5A 3MMEB 4OUUB 2W60A 4WWID 4YPJA 5A2BA 3RVTC 1JBJA 4W1TA 1JWSA 3NSCA 3QXAA 1J0JA 5HI5D 2RFXB 4LCWA 2VLJB 4XNYL 1LE9B 1XBRA 5FUOH 2LW3A 3QULA 2PW2A 4ZXBA 5C7XL 4E0RA 2XG4B 3QWOA 4R6UA 3X1BA 2HP4A 4G8GB 4LEXL 1UFGA 4CU7A 1ZKAA 1LP9A 1DEEB 3STLB 1XR8A 5F1IA 1UZ8B 4LKCA 3UGUA 3B9EA 4S1DC 2V2TA 3H54A 3FUEA 2F53A 2VZ3A 3ALPA 3LQZB 4ZO8A 1YEFH 2NY2C 4LCWD 4AQ1A 5EO0B 4NNYA 4JRXA 3NA4A 4JM4L 3SGDI 1AXIB 1NAMB 5C0JA 4JLRB 5J1AB 4PS3A 3J7HA 2J2ZB 3Q5TA 1PY4A 3GM0A 4LOUD 3NAAH 5EU6D 4D0CB 5BS0A 1PL3A 4TLTA 1UXWB 3EF7A 3CHPA 1XL4A 3LVTA 1IVTA 1JGEB 1TLKA 3QYCA 3AS1A 5CZXD 3TVMC 3KPQA 3VMPA 2FECL 3MGAA 1UB5A 2XYCA 4G43B 4ZTOH 3VCLB 4YSUA 2YSSA 5LQBL 1ZMYA 1ZEAL 3DURB 4PTTA 2WLYA 3VRJB 5TF0A 1AYOA 5DJCA 1UADC 1T5XA 2VM4A 2WXNA 1HOEA 3MRBB 4OZHB 1NFDA 3W3BA 3IFNL 5T3XH 3TT1L 4EZLA 5D6CB 4GFTB 1U8MA 2BRRH 3FU5A 4EO5A 1SYVA 4PTUB 3BP5A 2ZSWB 1LO0L 3LQZA 1EHAA 2WQUA 3SDAD 4NERA 4XN7A 3VI3B 4AEIL 2Q86B 1NZRA 2OJ1A 1YNLL 2W0FA 1F58H 2EDHA 5KS9F 1IC7H 3D52A 2WBJD 3S36H 5JPNB 5JLZA 4X8JA 3RPIA 4AX3A 4XNXL 5DUBA 4ZQKA 4NZTH 4OZHF 3RA7L 2C4FU 4U7SA 1HX0A 3OMAB 3B2UD 3UBXG 2Q7YB 1IEAB 1E8ZA 3N50A 4NHCL 5EPMA 4MJIB 1T0MA 5EA0L 1GAFL 3NGBB 2OFQA 1HSBB 4XN4A 2PP8A 1T7VA 3RNKA 4LL9A 4TUKL 5DA0B 3SY6A 1IAKB 2QVFB 4XN1A 4KXCA 5J11C 4RISL 4KDTA 4DW2L 2ED6A 1MCPL 1XF2A 2P5EE 3O6FC 2HLFD 4JM2B 4MCNA 4RAUB 5D7JC 5IM7A 3ZKND 1S7SB 3QFJD 5FR3A 3F04A 3A67L 2BHUA 2F7IA 4HCRH 5MP6H 4X5RA 3B7SA 1JUFA 1QBMH 4RFOH 4NRZB 3PWLA 3UTSE 3ARDB 2G2PA 1QG3A 2P7TB 3ARUA 4TNVK 4HP5A 1D2PA 2PMZA 4KUCD 3ATDA 4F2EA 3F58L 1M7XA 4Z95L 3ZE1E 3OXSB 5D7LA 2WXMA 3P40A 1FC1A 1JV5A 2UX7A 3EO1B 3G6JB 3G9AB 1JL8A 4KX7A 3GRWL 4YX2H 1KBBA 1NGZA 5DC2A 1QTYT 3OPZH 4UT6L 5L4JA 3GMNA 1CFVH 3IB4A 4DN3H 4HIEB 2X4TA 1A1MB 3GI8H 5IR1B 4YHIB 4DEPC 4UQCA 5DHVB 4KHTL 4KNQA 4CJ1A 1FQ9C 3DX3A 2AQTA 2KYIA 2YKLH 5EF0A 1K85A 2VSDA 3DJ9A 3L4TA 5JIPA 4U49A 4JO3H 2D31B 2H9GB 5AWNL 2ISDA 3D87B 3L3HB 4HMCA 5F9JA 5INDA 2VW4A 4UMSA 4LEEA 1DJGA 3AZUA 3ZMRA 1NC2D 4PJBE 3WFHA 2Z34A 4QTHA 3CZFB 3EYOA 5MENE 4FQJL 5IJDC 1ES0A 4TYUA 1OAJA 1U8OA 3LHPH 4Z7WF 3B9DA 4BFFA 1SGKA 3KGTA 4LDCA 4HZ1A 3C08L 1ODAA 1JRHI 1KV3A 3S8WA 1JXKA 1CIDA 2WV3A 2Q1EA 5BRPA 1SBSH 2J8UB 1XXDC 2ZX6A 4G8IB 2JTYA 1HKFA 2F68X 2WGNB 3OAUL 5DQDH 2BMKB 5IB1A 1I9IH 4EDXB 3W1ZA 4MJIE 2HLFC 4L4VA 3TIDA 5I5JA 3D08A 1NJ9A 4HJ0C 5DK2A 4AYBA 4YHZL 5C0BE 3DSNB 5HYJE 4Y4HC 4G9FD 5BQ7A 4X0NA 3QEGL 4X42A 2APTA 3BKYH 2AJ3B 4LLUB 1FAKT 4KOBA 1FYTB 3VWJA 4KTYA 2R0LH 3LPWA 5INCA 1DCEA 1U4FA 4FFWC 3QUZC 1B2YA 1CR9L 1A3RL 2NYZA 2WHVA 2X4UB 4L18A 2E7HA 3FQTA 5CXPA 1ET7A 1T0OA 2CDGA 3QQDB 4EQ2A 5IW1B 1ES0B 2XY1A 5GGTH 2V5TA 1MCRA 5E9NA 4DGVH 2RAMA 4J1UB 1BXVA 4A66A 1MLCA 1OAZL 1RVFH 5I5MA 1CF8L 4XB7A 2X9ZA 3DHJA 1UOVA 3UTQB 3QYMA 3PL6D 3IGAB 1O0VA 4DKFH 1WICA 5EEUA 1AI1H 3MLUH 3OTTA 2OMTA 5AKRA 3DI3B 3MUJA 4RA0C 2DMKA 4X6CE 4KNTA 1IIKA 4MAUH 4ZTOL 2YK1L 4IRSA 3SPHA 4GW1A 1OM9A 3QDMA 5EC2A 1YNTA 2XWBA 4ODUB 5FB8B 4U7MA 1JFQL 2Z64C 3FU9A 1RXLA 3DVIA 4BQ9A 2QELA 2BM3A 3F7QA 4F2FA 2AJSL 2R56L 3H42L 3N1PC 2ZT9C 4LSUL 4G3YL 4FNLL 4JZNA 2VLLA 1IBBA 1R34A 5IVXA 2Y7SA 1EZVY 2DIEA 2OMUB 1KEML 5HYEA 2GVYA 4G1MA 5DGRA 3QNZA 5EBWB 4POZC 1O9WA 3IN0A 3OB0K 5G4MA 1ZSDA 3D0VB 4NZFA 5L4MA 2EH8L 4XX1E 4N6QA 5I26A 1I1CA 4UDTB 5FWQA 2QGCA 5IHBA 2OSWA 3WJMB 4IS6B 5H37H 4HWNA 4OCRH 1YMHB 3O0LA 4Z7WE 5T1MB 1VPOH 5HDQH 1RZ8B 3ECBB 2XT1B 3MOBH 3U4EA 4UB0L 3FN3A 2NQDA 2E9JA 4AEIH 3QIWB 4WGVB 1S78D 1E9PA 3IDNA 3II1A 4FYQA 4WWKC 5IJCC 5JPMB 1AI1L 2E6QA 2EC8A 4OLZL 1RU9H 3FDWA 4RZCB 4WSJA 1OAXH 3B56A 4LCCC 4PCKA 4F92B 1BEYH 2R4RL 3EKCA 1M71A 4AVIA 3UG4A 4DKTA 2W65B 2P42B 2PTTB 1UH3A 1CS6A 5LGJB 5TE6L 1P7QB 3MCYA 3OZ9L 4MBOA 1CFMA 2VQ4A 3ZTEA 4D0BA 3O3BB 4PJEE 2KLRA 2YAEA 3L4WA 4B5EA 4KJWC 4PB0L 5I0WA 1TMCB 3IFOB 3MC0A 3IDMA 1UD5A 3QJXA 2I9TB 4MDJA 3JWNG 1BCIA 4TUJA 5KOVC 3OKDA 1XSIA 2PR4H 3FSWA 3RX7A 2X4SB 4OZ4B 5AG8A 5C6TL 2Y6SC 3HLAA 2AANA 2HJLB 2PXYC 3L3GA 4F7KA 1ITBB 2BX5A 4XVSL 3CVIH 1OARH 4EI6B 3FPXA 3TA4D 2ZUTA 1R3KB 3UFIA 5C0JB 1ITCA 4H44C 4LK4A 1TJHH 4CMHC 3HJ0A 2OAAA 1MCQA 4X6DA 5GRZA 5F7BA 5EZOL 1EMTL 1YAZA 2DQIL 3HG3A 3DK0A 3ULVE 2YEZB 5K59E 1L6ZA 5IOPA 4MA8H 4XWOC 1KTCA 3PRZA 4PIBA 3KPQB 4HAFA 4NO3B 2WQSA 3G9VA 3STLA 4NC1C 2A6KA 5E1AB 2X1QA 3NGBC 3QH3A 1RAMA 2OMYA 2OXGA 1HU8A 1L7TL 4F8LA 3PWNA 2JK5A 5DD5L 2X9YA 3ECQA 1PG7X 3K2UH 4OFIA 1CGUA 1F4XH 1QRNB 2JJTA 5TF1L 2IDTA 1EEZB 3TASA 5IMOB 5JIIA 1A9EB 2PWDA 4WWKD 1M42A 1LWHA 3JYBA 3QCVH 4HKZB 3BEWA 4P5MA 3TLRA 4A37A 1S2EA 5J9PA 4C47A 4GQ9L 3IBOA 3MRPB 4X7TA 5D93B 1F4YH 4M62L 2CDFB 3U30C 5KBNC 1BVLA 2ZUQB 1E9QA 4DP4X 2CLRB 3VXMB 3IJ9A 3SE4C 1F4WH 1JDAA 2HH0H 2H6OA 2XNAB 4DN3L 2PW2B 1QEWA 1TJMA 2GITB 1A4KB 3KHOA 4IDJH 3RU8L 1DFXA 1O6VA 4XCEB 3VU2A 4Q2ZB 5GRYA 4P05A 1PIGA 4U1IA 3TC9A 4J5VA 5DWUL 5DUML 2HUEA 1ORSA 1WCBB 1P4IL 1YJDL 4X7DC 3NCEB 2IF7A 5IHWA 1G9MC 2R23A 1B88A 2MNUA 1Y6NR 3LB6D 2KL6A 3W9DB 2ARJB 3PF2A 4G8GE 5C07D 1BXAA 4B0MB 4JG0H 1G9NL 1A2YA 2AQQA 2OZ4L 4N25A 3D7PA 3VGHA 3RDTB 3FQUA 1OGTB 4FI8A 4OIAA 2BNQE 5DZ9A 1MVYA 4DCQB 3S2CA 1HZHH 4NSKB 1UH4A 3KYMA 5LBSH 4RRPG 5E99H 5E5MA 3EJPA 3C5SA 4MWFB 1T04B 5B1JC 2G2RA 3O8XA 2ZUQC 3LIUA 4P5TC 2IWGA 4MAYB 3U7YH 2ZAIA 1DBMH 1F11A 3FCTB 3QIUC 4GBXB 3FO1B 1C08B 5E08L 2XN1A 15C8H 1NPNA 2D03L 4N8PA 4O02B 4PRPA 5F8QC 4Z3GA 2V7NA 2A6JA 4ERSL 4GSUA 1F8TL 3UEZA 1A3RH 1ANUA 2HG5B 2AEPL 2XQBH 5F7DB 3ABKB 3FW6A 3DIVA 3DBXB 1F3DH 5JW4N 3ZL2A 4WSKA 5CS7A 3LV3A 1XZWA 1QSFE 3BP5B 3NJVA 1FG2A 2YA0A 1XF3B 3DUSB 1UD4A 3L9EA 4I3SL 3DC0A 4OZHE 4R2GB 4YVUA 3IFPA 5L6YH 1KG0A 1WRFA 1JK9B 2NUPA 4IBSA 4KROC 3CN4A 1W0YT 3ZDXE 3ZLQC 2XWCA 3DO7B 3PDDA 3QXTA 2DF3A 4JFEB 2BIHA 2VDNB 2Z93A 1U21A 4JLRA 2A6DB 1Z9NA 3GUFA 1DQIA 1YEGH 4FZ8L 3TYFA 4MCZA 3LIZL 3T9WA 4KNSA 5E8PB 2WLKA 3VI4A 3WXVH 2Z6FA 4JPVL 5DRWB 5I19H 3CFQA 1ZGLP 3BZDA 1XH3A 4TVPD 3WDHA 4M93B 4UUJA 3RWGA 1MEXL 5DMGD 3VWKC 1IGFH 2HKHH 2OQJB 2MCAA 4PRIB 5AVYB 1CL7I 3B34A 4K55A 5D2NC 4JG5A 1F3RB 4LQFH 1A7QH 3MCG1 4NQEA 4N2OA 1E28B 4FI7A 4NENB 3D2UA 1GKEA 3BKCH 3K91A 3GEWB 4XAKD 2AK4E 3QNXA 1XCQB 5AB2A 2VGLM 3T3PF 4PJIB 4WEBL 4G59C 2NY0D 1YEFL 1KYFA 1A21A 3ESNA 3SKNA 3TNMB 4H8WC 1ZANH 2ZUYA 4YSPA 5L6YL 4QRQA 4UQ3B 1JWUB 1S6NA 3MLXH 1N4XH 4YL4A 2YJLA 4G1EB 2GIMA 2YRBA 3AQZA 4DT2A 3V4UH 1J7VR 1SY6A 1AQMA 3LY6A 1Q4NX 2P8PB 1YAIA 1BOGB 5G55A 2C9XA 4MBRA 3FSOA 1U8PB 3LN9A 3L6FA 1DVXA 1MQKH 4QAWA 4W9LC 3NIDF 3TCTA 3RY4A 4ZPTB 1QWNA 1KWKA 5I8CA 4PCSA 1VZGA 4R7LA 3VXUE 3B3BA 3ISYA 4R4FL 5AVUB 1DQQA 1SOKA 5F1KC 2I07A 1TPXB 1WFOA 1MHHA 3IN2A 2X89A 2GJRA 5TDPA 4E42A 5MHSD 1MIEH 2ZYSA 3K81A 1KJ3H 3L2NA 4FXTA 5F7YC 3FULA 1MN4A 1KJ2A 1MCKA 2Q3ZA 2YUWA 3OG4B 8PAZA 3QCTL 1AXTH 1VACA 1FN4B 3D51A 3VG9B 2QGDA 2C9AA 2ZAHA 4PFEA 3OKOB 4OSUH 1CDHA 2VXQA 4V33A 1F42A 1NCJA 1UGNA 1XH0A 5IB1B 1A8ZA 3BPCB 4N26A 3BRDA 5I0ZA 4P3WA 5TF1H 4FNTA 3S88H 3B5TA 1OTTD 1WVZA 4QUOA 4CJ0A 4GS7C 1F02I 4OFQA 4RSYA 3NDZE 2JI1A 5A7EA 2IEPA 1CFSA 3OLEA 3T09A 4Z7OB 4XNZB 2IV8A 1L9TA 2HRPL 5IKCB 1NMAH 1OW0A 4ABVA 1JPSH 1E4WL 2AEQL 3WIIH 4Y1AE 3VTAA 2V7HB 2I60L 1U8CA 1B6UA 4I0PA 5DRZA 2XZCL 4NP4L 1OHQA 2B1OA 2Y1VA 3CFCL 4LE8A 4QF1B 1ASQA 3FTSA 2GK0B 2BZDA 1CURA 3QO0B 3MBWA 3B83A 3EUUA 3GXFA 4XCNA 2DTML 3WHE0 4HIXH 4XNMB 4AK1A 4M43L 3H9SD 2HPOA 2F08A 3ATAA 4M7KH 4PP2B 4GW5B 4K5MA 4PBVC 1NCDH 4F33A 2I9TA 1W6WA 4YXLL 1A25A 1DVFB 4WI6A 3IMUA 2FNBA 5L88L 4DGIL 3PL6C 5AOKA 1N64H 2P44B 4EBQH 4AQOA 1JOIA 2F1BA 3VMNA 4FFYA 4I85A 5DJDA 3W2DH 2O6DA 4PRNB 1FYTD 3OQ3B 5FHBH 2C26A 3ARVA 1NKRA 4J6IA 1JI2A 4JMXA 1I7ZA 4E5XB 2EUZA 2J1YA 3KPNA 1RIUL 3X11B 1Q0XH 4ADIA 1F3JA 5AAMA 4I13B 1VCAA 3E0GA 3H4HA 1AC6A 2QPEB 3H42H 3KBPA 1E2ZA 4ZMYA 1SN5A 4HWZA 4KDWA 2OJEB 2J25A 3CN3A 3EOTH 4UDTA 2ED7A 2EH7L 3IT8D 4IBLT 4ZPVB 1CDJA 2V17L 4P2OB 3M7OA 4V1DB 5C1MB 4HSQA 2VN4A 5DS1A 4HJGB 5A2IH 5ID0A 2HMIC 5H35A 4AMXA 4HS3B 1V3JA 2F9BT 4OD2A 2R0ZH 4Z18A 3SJVB 3EGDB 3KPSD 3NCWA 4JDEB 4LOEA 3VFSB 5JW5A 4QRUB 1E27B 1NAMH 4FG4A 3T8MA 2P43B 4LBEA 3E6FB 4YDIL 1A7OH 4P4KD 1P9MA 1KYOK 1MRCH 3IDXH 3NA9L 1X5LA 1PU0A 1JV2B 4TXVB 4EAEA 4KU1A 4PD4J 1M53A 1CD0A 1A6AB 4JFQA 4MTMA 3AREB 4XMLH 3B2DC 4K9EL 3KZ8A 2F53E 1CFQA 4OJCA 2VR4A 1DUYB 4HMEA 1NGYB 5KSAA 3U0WH 3MACH 5DC0A 2JI3A 6TAAA 1G7LB 1OAYL 2NTFB 4QGTA 3LKRB 4M8UA 5BXFB 4J12A 4PUBH 4HK3J 4XT1C 1JCKA 2R1XA 5LDSA 1B4RA 4AIZA 2KQNA 5EOTB 5FM5O 5C3LD 1C8PA 2FLBT 1M3IA 1VFBB 4UM9D 3TZVB 2Y1ZA 4PV9A 3Q8AA 2FUTA 4XVOA 1OPGH 4YK4C 5LDUA 5KW9L 5CFHA 5GHWL 5BZZA 3BJ91 2WLLB 3RHWF 2EDLA 3BUTA 3L1OH 4M7LH 4OJDH 2F74A 3IFLH 3RIKA 5KVFE 3E8UH 3LZPA 1SUJA 2HX8A 4F7TB 2NOYA 3BAEH 1GOGA 3OR7A 5CO1A 3RWDB 2J5LB 1YYCA 3FYEB 4RGMC 1AO7E 4P9ML 3D25B 1C7TA 2BIOA 3BXNB 4LARL 5LCVH 5I1DA 3I6LD 1NLBH 5IJBC 1LDSA 3DGGB 3IK2A 2W07A 5JPNC 5K59F 4AYFA 5HDRA 5J6GB 2YBRB 3WNIA 1GGIL 2R7EB 1J86A 2YRLA 4JNXA 4J7RA 3NEXA 3RZWA 2WYZA 3T4AA 4YHOL 2CHXA 5CD3A 2J88H 1SJHA 3N85L 5IW3A 3P0VL 2A0LD 3FYIB 2IQ9H 3F8UB 2RACA 4U6VH 3MV7A 5F1IB 4P5MB 4ZUVA 5BRQA 3ZY7A 4U3SB 1SXBA 4PLKD 1RJYB 3GMPB 5E70A 3FL7A 3V0VA 4Z7VF 1RJCA 4I4WA 5DD6A 1N0XL 2AJYH 1CBVH 1CGWA 4PD4K 4HGKC 3KEHA 5L2JB 2P5WE 3RDJA 5HGDA 4AUUA 4HG4J 2FDBP 4ENZA 1QASA 1JHTB 2W9DL 1MAML 4GXVL 4HJSA 2KPNA 3CVBA 4WHYG 2I7OA 4YVNA 2QMKA 2XKNA 2XBTA 3CDFA 4HXBH 3TN0C 5CEZL 4G8AC 4LSQH 3BAEL 3NCXA 5G5DA 4ADJA 3K6NA 3WY4A 5IOPB 4U1IB 3T4AB 4ORZC 3MCKB 2DYPA 2WMPB 1ZA6B 3ULUE 1GJUA 2A9NH 1IBZA 1TITA 1U91B 4JO2L 4OZIF 2XN9A 3FRPB 2CG9X 3GDCA 4PEEA 3DGGA 2COVD 4QY8A 5JR1L 3KBFA 4B50A 1FNEA 2DYRB 4AJ0A 2OXGB 1HXYB 3LKOB 4ZUSA 1ACCA 2ZP0T 4MNQB 1G6RB 1A6WL 1QSEB 1Y0LB 2GKIA 5C9JB 5LN8A 3E80A 3LB6C 4PJ7E 1JZIA 3O41B 3D39A 4GYBA 3FONA 4LLYA 4TUKH 4GQRA 1EFXA 3BEWB 2IV9A 3REWA 5ANMA 4PN6A 4A2DA 1TQTA 4P5KA 4DKDC 2HLEB 3FT2A 3QQ9C 3NIFB 4XPBH 3R4DA 5GIRA 3B9KA 4JB9L 2Q76B 5TTRA 4HCRL 1YUKB 1BW8A 1LJMA 4ZS6D 2PCFA 3S8FB 2ED9A 2Z93B 5GSRB 4NUMA 2FHCA 3TBSA 1RUMH 4M1DL 4NJAH 4WZ9A 2QQQA 4EXKA 4HJEA 1EO5A 3QUZA 4R5VA 2P5WD 1P53A 2A0LC 4KGLA 5I8EB 2FEDC 1UGKA 1DQJB 1GGCL 4Z5RA 4L4JA 1C5DA 1FZOA 1GW6A 2WBWB 1KCVH 4W9EC 3I9GL 3K1KC 4PRPB 4ALAL 3ABLB 3ABZA 1BZEA 4FQLH 2FIKA 3CPLA 1NDGB 1XGQB 3TF7C 1NL0L 3ARDD 5D6DC 1AP2A 1RERA 4K2UH 2Q2EB 1IBHA 1ULVA 5DJXA 4LOUC 3GC3A 4AENB 1FFNA 1YRKA 2OR8A 5TQ2H 2BC4B 4M8RA 3THML 1G9EA 5FUZH 3SCMC 4XNDA 5C0AA 1PLGH 5M7QA 4OCLC 1C5CL 2VXUL 2OXHA 2Y36H 3GS7A 4WI9A 1X4ZA 2BNRD 2Q20A 3QUYB 1RVFL 3I9PA 1KB5B 1E2VA 2IMMA 3BPLB 1RV6X 1C5DB 5IF0B 1NAML 5DD0H 5IHZA 2ZXDA 3MNMA 5M94B 4XCFH 3MLTB 2C1OA 5DLML 2YSSB 3BD5A 2UZYB 5CN1A 4Y16D 5KYUA 1AHMA 4ISVA 2NLJA 3PWPB 4WW2F 4PRAB 3WIHL 1TZGH 4Z3TA 1CXEA 4WV1C 4X9GA 2AQNA 1D5XA 3MACL 5FDWA 2YFNA 5FUCC 5FO8A 1KXTB 3S8GB 2B59B 2NY4D 4JL2A 5A2JH 5HVWA 1A8JH 1CLZH 1N3NA 1N8ZA 3AABA 4ODHH 3B9KB 2BNQB 4TSCH 1XGYH 2F53D 4APQA 4MMXC 5CJQL 1NGWB 1JZGA 5HI3D 2XWDA 3MLTA 4CA4A 2Q8AL 5A6IA 2G4EA 3RUGF 1UXSA 1B0WA 3BC9A 2BCKA 2CLVB 4GW4B 5HHOD 1EO7A 3CPUA 1TFHA 3INOA 6PCYA 1J0HA 4YHPA 1RZGA 3B7RL 1YPZA 2H1PH 3RY6A 1FZKA 4IRJA 1DN2A 3GGWB 4TSAH 3UZVB 3OWRA 5FYKU 5JZ7D 5AYUL 4XNYH 3NCYP 2W59A 2YAMA 2IH9A 2AC0A 3ETBJ 1NDGA 1UASA 3X3FH 1UWEL 4Y19B 1HHKA 5F9OL 4HJUA 4ZDHA 4DK3A 5KBMA 3UAAA 2R69L 4PY8J 1CE6A 4HJJL 4D9LL 2KBGA 2L8AA 2JQAA 2L7QA 3T2NL 2F54D 1OF2A 4MMZA 1I9JH 4Y5VC 4M9OA 1CE1H 2ITDA 2WZ5A 3UABA 3GXUB 1VRSA 3LMJH 1V3KA 3HLKA 3OKOA 4XCCH 1OTTC 2QQKL 3DUUB 4FLQA 3WIHA 4LP4A 2E56A 1HK6A 3ZTNL 5A6MA 4XE0A 3PHSA 4YFDB 4ZMNA 4JG1H 4AG4L 3KPRB 3HAEG 5LXVA 2ILLA 3ARGD 3WNOA 4YX2L 5HJBA 3EGSA 1GKOA 5E7BA 4X4YB 2WUBL 3O11A 4UTAL 3UYRL 4AT6A 2W9DH 4ELMB 2JCWA 3BT0A 1J8HD 3QFJE 4K94C 4OGYH 4FNQA 1CFTB 2FIRT 3DVNB 4NRXA 1WT5C 1AZZC 2YXMA 4GBXC 3LH2L 2F8OA 1RZGB 3L48A 2IBZX 3FKUS 5T3ZH 2B3RA 2ZPKL 2D9CA 2ZWNA 3KR3L 1X44A 4H4NA 3GXDA 1Y18A 3BGMA 3PE9A 3KPRE 4L1TA 4CU8A 4Z77A 3TNNA 3V6ZA 5DMIH 1YY8B 3N85H 4PLNC 4KO7A 4AK2A 3MV11 5AVZB 4RX4A 4FHKA 1QABA 2DLFH 4UTCA 3V9EA 3UJTL 4F37F 1UB6B 4DQOL 4LHUD 2H26A 4NAJA 5EHFA 4G6JH 5J89A 3DXAE 4NBXB 4NM4H 5H2BB 4N2EA 2VERA 4MRCA 3MRQB 4X9FA 2EC9U 5FAAA 3VTTA 3S3BB 3E6FA 3ZQ9A 3ZU8A 1EGJL 2FX7H 3PREA 1GW0A 1YMHA 2EE9A 3U82B 1QRNE 2JB6B 1X5XA 2JKWA 4QRRB 3P3UA 4KUZH 4Y4HD 3ZJAA 5FO7A 1PAZA 3NZUA 4O5LH 3IPBA 1J18A 2IH3A 3BD3A 3AREC 5CAYB 3Q43A 4X5PA 5D4HA 4NQSA 1SDYA 3MLVL 1BZQK 1HESA 2BOBB 2EICA 5KAQG 2VYRE 4X5WA 2QQNL 4FHBD 4ZPVA 4GAGH 2XN9E 1YPZF 2WVSA 2B8OT 4UNVA 4PB9H 4OZFH 1E4XL 1A7QL 3M1BB 1W8NA 3V5HA 3DI2B 5BPPA 2PWGA 2QMJA 4MXVE 5E00B 2N7SA 3SPCA 3QUGA 4BDVB 3VSUA 5MEQA 4Q52A 3U2SB 2W38A 3LN5A 3P11H 4Y1SA 3L7EB 2MCG1 2IGFL 3U25A 2MPVA 3A4FA 3GSOB 5DRXA 5FYKE 2R0KL 3FTUA 3L9RA 3GUTA 4JZJA 3SDYH 5FUZL 4W6WB 3Q13A 3HE7C 3SDDB 2QSTA 2VLKA 3NBNA 8FABA 2ZE0A 2ZTBA 4D9RD 1ZVSA 1AHWC 5EEVA 3OR7B 4H0HB 3RWDA 4N8CL 4N9GB 3ARXA 1U4EA 1EAOA 5CILL 1MHCA 1BX2B 1E0OB 4NZRH 4UAHA 1S9KC 4OLXH 5D2LB 4FNRA 4IK6A 3IKKA 4OFPA 2LLLA 5MEPB 1GMEA 1HHIA 3Q7JA 4U1HB 5LG1A 4DGYH 1KSRA 9PCYA 3GSWA 4H0GA 1GGBH 3JWNC 3TTSA 5EBLA 2P80D 1KGIA 4J3OH 4N1CA 5GXBB 3NSXA 4FL4B 1YA5A 3BWZA 1GSMA 2QQLH 1E4KC 1PYWB 1UOKA 2VJXA 4Z6AT 3VUAA 1A4KA 3TZVC 2MNJB 3ZYZA 5F7KC 1EJ6A 1TZHA 2B0SH 4WWPA 5IQOA 2X6VA 4AEEA 2X1PA 3WMPA 1B4LA 1R17A 3I50H 5GS2H 4DP6X 5DRXB 1KDIA 2WBKA 1S78C 2F15A 1XGRB 3GMMA 4M02A 4M56A 3SPVA 7PCYA 4F93B 3KM2A 4O2EA 1UZ8A 4F15C 1C1EH 4PG2A 4NQTA 4QRRA 1IAIH 1R75A 4Q58C 2JKNA 1RK7A 4CVXB 5B8CA 1WFIA 5EO1B 4MA1C 3G08A 4F2ME 4QRUA 1YEKL 3UC2A 1SQMA 1D5IH 4DGUA 2OCJA 4JR9L 5MENA 1UWFA 1A3QA 4FXGC 3BI9X 1FC2D 1W80A 5FYJH 1FGNH 1OCRB 2RMNA 2K8MA 3SDAB 4ZFGL 5C6WH 2E7DA 3L3DB 1U33A 4JO4H 4NFCA 1G7QA 1X5MA 4OQTH 5DJ6B 2CLZA 4LLMA 2OLDA 3GJFB 3EZ8A 3BT2H 4P23D 1UZGA 4JPKH 3H9YA 1PJWA 2D9QB 4BEIA 2E7LC 2WBJB 4AQ1C 3P0VH 5A16B 3AQXA 4ZMZA 3T4YA 2A83B 3P11L 3QEQD 4HKXB 1WZLA 2F19L 4TKWA 2Y3AA 3LRLA 4G8FA 4K71C 2QQKH 2AXWA 1BF2A 2HKAA 4O9HL 4MA1B 1XH1A 4HUXB 3FOMB 4BRVA 4Z3IA 3K6DA 3E1F1 2ICWJ 4XCCL 1W72L 4I0KA 5CZXC 2C3WA 2I85A 3HNSL 5D7EA 1IM3B 3N9GH 3HRPA 4KVCH 1NKOA 1DSFH 3L95B 2Y25A 2A77H 2R7EA 3S4SG 2WUBH 3MFFB 3FOLB 5D7KD 5D7JA 4OF5A 3N6YA 1PNDA 3BW9A 5DVKA 1FYTE 5FGSA 3ZKQD 3ZE0E 3FO2B 2K1MA 4H5SA 3CHOA 3BXNA 5I1DB 4W9JC 4U6XB 1ZGLA 4FFYL 4HWUA 1HJCA 1RJYA 5TFSL 5AYUH 5JYMA 3KXFD 2ESVD 4MQ7B 4EN2A 1USZA 3R18A 3U4AA 1BZ7A 2PR9A 4ZNCD 3VFOA 2WY3B 4LVOC 2CMRH 2P26A 2VMFA 2XUWA 3L45A 2IWKA 4JAMA 1A9EA 2Z0UA 4J4PC 1X9LA 2VITB 4ES9A 3JV5A 3H9SE 3GJEA 4AXWA 4Z0BL 1RPUA 3H7BA 4B9KC 2VSMB 5F2FA 4G6AC 2EE6A 1ZS8A 4MKTA 4RDQG 2HB0A 2NYKA 1CK0H 3FTGB 3BDYL 4WGKA 4XBEL 2F8IA 3Q1SH 4CC4C 2F7RA 1MQ8A 2R2EB 5KANG 3TWCL 5C0IB 4L2YA 4NO5B 4NZJA 2EIDA 1HWHB 5FDYA 1ZVHA 3BP6B 4QRQB 4D7PA 5KYUB 5JIKA 4N24A 4ZJ9A 2G4GA 4TVSa 5H37A 2DLEA 4DVRH 2WBJC 3BE1H 1OAYH 2R0WL 3VD0A 5FK9B 1F41A 2IALA 3BH8A 2VDOH 3BQVA 1YEIH 1MVFA 5CR1A 4KUCF 5JMOC 1YCSA 4HQQL 2IO5A 4E68A 1IGCH 4M61B 3RTQC 3DURA 4PTTB 1G9HA 4PGDA 3NFPB 5L9DH 4BE6A 3GSUB 5DJ8A 4RETB 2AHIA 1MIML 1KXVC 1D7FA 2FX9L 4HAGA 2XCMC 2C1OB 2W0PA 1Z32X 3OV6A 2UWEE 1UC6A 1T80A 2VWEE 4UB0H 2WTPA 3IGFA 1OB1B 3OAYH 1AR1D 2E9BA 4HALA 2BP3A 1Z9LA 2QJDA 1OL0A 4JKWA 4WKZB 4JVUA 4BH8B 2QQNH 3QFGA 4BXSV 1AKPA 4RLDA 1F56A 4LPTA 3DROB 3ISWA 2NY4C 3ILQC 2EKJA 4HUMB 3IJSA 3F7YA 2CPCA 3QWRD 4WGWB 3KYOA 4ERSH 3FQWB 4MXQD 3MODH 4OF6A 3HG0A 4G6AD 4TNVF 4DETA 2N59A 1IX2A 2X3BA 1MCNA 1YQ2A 5HI3C 5C0AB 3NG5A 4ODSL 4AGPA 4MQTB 1JNNL 4CAGA 3QB7C 5FFLA 1CICA 1DUZA 1A5FL 2WANA 1XTMA 2HLAA 4JB9H 2DYPD 3MV9A 1MI5D 3Q1SL 4U0QB 3SKMA 4U0RB 3SDXF 1ZA3A 2HJKA 2BS8A 4HEME 4OAWB 1RZKC 5DQDL 2VDLL 1BPVA 3K2MC 2ENJA 3FH5A 5I6LA 1TQBB 1A6WH 2Y7MA 4XZ4A 3CCHA 3GBEA 1THCA 3JTTA 2NNRA 4MMYB 4OCYH 2Z7UA 3OG6B 3EZJB 3HBGA 2C3XA 3UTQA 5CKAA 4D0DA 5EN3A 5JTWA 1KULA 2B1AL 3LXAA 3QEGH 1RUKH 1I8IA 3HN5A 4KZDL 3QJOA 2UVEA 3N40F 5DUMH 4KVNH 5E8NB 4QI3A 2X40A 4OTXL 5BMFH 5ICYB 5JW4R 2P5PA 5DRNB 2XTSA 1TUPA 3UTSD 5T8IA 4OIBA 2H26B 4YFEA 1AR1C 5LGHL 1VACB 2C5DC 3EADA 3HS8A 3D48R 2FO4B 4QTHB 3ZHDA 4GW4A 1BQHG 5KSBB 2FH6A 5IQNA 1JZFA 1X6NA 3T6XA 1AJ7L 2DQDL 3ARQA 5DZNA 2X05A 4JR9H 4LDOB 4ZODA 1JWMA 3RGHA 3TA3A 4MMYA 2AERT 2HJLA 3L3GB 5DEZA 3QPKA 4FTVD 1Y18B 1T66D 4L9LC 3UIYA 2DQFA 3LRSA 3HNSH 2IOMA 2WW8A 2NSXA 3VSVA 5I5IA 4QWWC 1GSKA 2JCCE 2XA8H 1AD0B 3G5VA 5LBSA 1FZMB 1IB5A 4KXDA 4KKQA 3N44F 4UV7H 4NCC2 5DVLA 4KXZI 4XNBA 1PCXA 2CO6B 3QZWG 3IAQA 1J1PH 5IROC 2GSMB 4CU6A 2MHAA 3ARGB 1XGPA 1XH2A 2GSIA 4HUVA 1GYWA 4A7TA 2VISB 1HHGB 3A3YB 4JPQA 5CEYB 3VVVA 1H8LA 3BQUD 3G6DL 4AW4A 3LZFH 4TNEA 2NY7H 4GO9A 3KYKH 4LU5H 3UPAA 1XGYL 4GKOA 5CHNA 3UBFA 5B1BB 2O4EA 4XP5L 3GXPA 4OAWA 4PJ9A 4X9HA 5IESH 1J5OH 2GIYA 4I3SH 2NY3B 5EN2B 1I7UA 2E7MA 1A6ZA 1PLAA 3ARED 3S36L 1OE3A 4NGHH 5GS1B 2FB4L 1DVYA 2PTTA 4MXWH 3M45A 3OPZL 4UT6H 4OD3L 5HVFB 2J57A 3K71B 5CBEB 2OMWB 4DN4H 4WWKB 1QUPA 1J8KA 1BAGA 1IGJA 2FQEA 4U7KA 1ONQB 2D03H 3BUIA 3P4NB 2C4FT 3GQFA 1BFOA 1CO1A 4LPVA 3OMIB 2XACC 3K1DA 1CLCA 3WFBH 2DN7A 3U1QA 15C8L 1DJSA 2UWEA 3GSNL 1INQB 1E5ZA 4XNQB 3W39A 8FABB 3ZQXA 5JQ6L 2XVKA 4PP2A 2GSGB 2YPLD 4A2GA 1C5BH 4Y1AA 2HT3D 1U8KB 4JVPA 4MNGE 3RWFA 1HZHL 2E9IA 4CW1B 5IBTL 3K2KA 3NJIA 5C97A 3FUFA 4KJWD 5L88H 1R0AL 1AANA 2AKRB 3IDNB 5JPMA 4H8UA 4PRIE 1O6TA 4I1NB 5AOIA 4P57B 5I76A 4E9LA 1N6VA 1E5CA 4FZEL 3O2VH 5EZIH 2HVKB 1T1WA 4LIQE 2FJHA 3RWIB 2FBRA 1SVZA 4LRNL 1J9TA 2HT4C 3ECVA 3WXVL 2UY7B 5L2KA 3OKEB 3IJHB 4Y2DC 4P4RB 2R9HC 5T5FL 4DP1X 5IJVB 2P1YA 3LIZH 4F2MA 2VDOL 1BWWA 3LQMA 5C2BH 1HCZA 4HQQH 5CEXB 3D39B 2V2WB 2GJZB 4JCWA 2E4FA 1QO3B 3C6SA 3R4RA 1L4IA 5DD3L 5F44A 5DFVC 4FF9A 4A38A 4W6YB 5IW6A 3IPEA 3LZQA 3U36A 3WBDA 3CTTA 4CBPA 3VW3L 1YUHA 5MEOB 4BZ2H 3P9MA 3SJVA 1ZLWH 2FO8A 1L0YA 3CFUA 3RVWC 4QLWA 3PABB 4G7SB 5EO0A 3MV01 1WF5A 4NS0A 3OVUB 2XWJB 4WDIA 3L7EA 3QSKB 4PRBA 1JTTA 3SHSA 3WKML 2PPFA 2YD8A 1MJUL 5GS1A 1LO0H 2P8MA 3DIDA 3K8MA 2A6IA 4XMKH 4IU3B 1UD6A 2CXGA 1ZHLA 2OBGA 2Q76A 1GS7A 2VXQH 3WTTA 5EDSA 1AQHA 3W0WA 1RLBA 4FTVA 4YHLH 1RULH 3PL6A 3H7LA 3NSJA 4MNHA 1QHQA 3X13B 3IVKB 3D4ZA 3RWEB 3Q6FB 4IOFC 4N2NA 5KVEH 5C86A 1GMIA 1ZGLM 5I1JH 3GSXA 2DLFL 1BZ7B 4ZX6A 4B95C 1SJHB 1IC5L 1KCRL 5FK9A 1NEUA 3ZTDC 1E50A 4IQHA 4NZ8A 5GGTA 5IFHL 5SWSE 5ITBH 1NBZB 4A7QA 3P9MB 3LQAH 3HG2A 1IGIH 4F5CA 5GRJH 5E5LA 2R29H 1E9QB 1HYRC 4NKDB 2H1LM 4M4RB 3DARA 1CVSC 5E6RB 4P49A 4MFHA 2UZXB 5E6SB 1JHTA 5B7MA 3CFDA 4BQBA 2BNUA 1TCRB 5BNXD 2HFGL 3VFVA 5HGBB 1IQWH 1KELL 1QLEB 1RURH 3MRDB 4L5FE 3VD4A 1OGAA 4HKBA 2BVUA 1MJ7L 3L4XA 1PZUB 3QEQB 3BIBX 1SOSA 3H2PA 5F7LB 4F20A 3P4MA 4B6ZA 4OR1A 1LMIA 4FFYH 1P0SE 2A6DA 4LFHG 3U4BL 3OR6A 4F7MA 4J4PD 1U41A 3WLWD 4NEHB 4K5LA 1PS3A 1I8LC 2ZNWA 3LS5H 4PJEB 2WBJA 2DMCA 4UCFA 1A22B 3T4AC 5DQ9A 5PAZA 4TF4A 1I3RB 1QSZA 4XVSH 4KROD 4FADA 2FBJH 3AAZB 3RKDC 4EQ3A 4BZ1L 4KJPC 2I9LB 1N59A 3VFPB 4GKZA 4LO9A 4TQEH 2JVUA 5BZWA 2WLMA 5BW7A 4FTDA 1FDLH 1FVDB 2Q86A 4AZUA 3BHBB 1XH3B 4JANA 3WUWG 4BQ6A 4BKSC 5D7KE 2HLAB 2OL3L 1WGVA 3OAZH 5SWZE 5KBKA 1NC4B 2EO1A 2LU5A 3QEUB 5IB3A 1A9BA 5FYKL 1DLFH 4O58L 4PJEF 1GGUA 5EBGA 3HC0A 5EZOH 3DX8A 1DQLL 4CMMB 1UUSA 4PJXA 4JQIA 5AD0A 2VO5A 4F7EB 2N0KA 5GS0C 4I18A 3JBG7 3CJJA 3MBXH 4E41A 2NY5H 4L4TE 3UPRB 5FGCB 1UD3A 2N4IA 3QQ9D 2XICA 1ZE3H 3CFBA 3L3HA 5INDB 2PPDA 1U8JB 3ZHLA 4TSBL 3QNFA 2G9HA 3HAEA 2BP0A 3RDTA 4AYEC 2EEXA 1NCCL 4RBPH 2F58L 4BUHA 4A7SA 1RZKH 1NC4A 2DQCH 5IB3B 3QQ4B 4WUUE 1NCAH 2VIRB 1OXYA 2A4ZA 2E7BA 3KWXA 5I0VA 4HIHA 4XHQA 4OM1L 1RJLA 1BPLB 1MAJA 3PQYD 3GSNB 1LNUA 2N7AA 4GINA 3OXSA 4BFNA 2NUPB 4UILL 1DVFA 4R4ND 2BS9A 5E0QA 3FCTA 3F7KA 3FCUB 4P59H 5KVDL 3WNNA 1WAAF 3SGEI 4FEMA 4NQED 2CR3A 1DQMH 4QXTB 4JHAH 5I9QC 4JN2B 3I6GA 2AEOA 2UZYA 1RP9A 4JO8A 2FQGA 4EJ1C 2CR0A 3GTTA 1ZOXA 2NW3A 2YK1H 1GCFA 1YY8A 1AHWA 4AV4A 3I9GH 4ALAH 3PGDB 3L1FA 2YARA 1BZ9B 1EBPA 3SCMD 1F18A 2QSVA 1JS4A 5AFAA 1O75A 3GSNH 1QTPA 1HSAB 2DQTH 3KLAB 4K71B 4DUVA 1XF3A 1H3TA 1KCUL 4GKNA 5D2NA 1SBBA 1E5AA 1ILSA 2J73A 3OGOE 4IBUA 4GUPB 2XOTA 4EPSA 1HOCB 3P30L 1A1OB 2JB6A 3EHBB 3VE0A 4Y5XC 3BFQG 3QJTB 3RWHA 1JGUL 5KYNA 1BLNA 2D7TL 2GTQA 2FT7A 5GPRA 4IM8A 3IDJB 2Z8VC 4Q14A 3RIAF 4TULH 1OIOA 4U2ZA 5ELIA 1GY2A 2EDYA 1HWGB 5KANI 2JJTC 4YSQA 4QPEA 2V4LA 3QVAA 5SWSA 1JYWA 2EUVA 2Y0SA 3K5RA 2O6PA 4XNZC 2QHLA 3O2DH 1LO3L 3B8SA 4MD5A 1PEZA 4XXWC 2JKLA 1OP3K 3OB8A 5CCJA 2MHAB 4NPYA 4GS7B 2WB1A 1RK0B 3HBPA 4WY7L 5AVWB 2Y7OA 3AXIA 3MV8D 4TPRH 3AU1B 4L8DA 4M7JH 3RHWK 3PNWA 4PVBA 3A6CH 1IC5H 1KCRH 2BVOB 4Y7MA 1EZUA 4KKBD 4LLWA 1MG2C 3VXMD 3WNKA 3T0XA 1XGTA 4Q7DA 2EE0A 3LRSB 3FFCD 4TL4A 4LOFA 1FE8L 5GISH 5C09A 2IH1A 4LSQL 2VAAA 1D5BB 3M1OA 5AW3B 2W81C 2EXYD 5AKTA 1MAMH 4GXVH 3FMGL 3BPCA 1BYPA 3BZ5A 4A68A 4LEOB 1G94A 3B2VL 3IEAA 4OCSH 2AXFA 3ETTA 4NAQA 3ARFA 3FB6A 2O5XH 5JHMA 3GMLB 1P5UC 1LEKB 4MS8D 3V0HA 2VWEC 4NO0B 3NIDB 4YDVA 3VGBA 5AYQA 4MCMA 4HK3N 4Y5YB 4PS4H 5D1QA 1AIFB 3UTSB 1MCJA 3RDTD 1BJMA 2H6UA 1OZTG 3BAYA 1J5HA 2X2UA 1FP5A 4J2QA 3UJIL 5I1IH 3V7MA 5EOCL 5HVHC 1G7IA 3SYCA 5CSBA 1LO2L 2W95A 4GIOA 2VN6A 1XEDA 5B4MD 3IGLA 4I48B 3U9PL 1FL6A 2C4XA 5JQHC 2JWYA 4WEBH 1L7TH 3C12A 4JE4B 4YSAA 5DRNA 3ZTNH 3JWOL 3HPLA 4JQXC 5IOKA 3PGFL 3GINA 1A5FH 4X4KA 1IM9D 1U92B 4DERA 4GBXD 4ELMA 5EO1A 4TUUA 1KIQB 5MI0B 1KFAH 4KJYA 4AGOA 2DQJL 1BWMA 1OZUA 4I7ZC 1I4FA 4PRBB 3LNDA 4XMZA 4A7UA 4X7EC 5E03A 1YNTB 2QHRH 2XWBB 3RL1B 2NXZC 1AGEA 1F4YL 3WUWB 3BUPA 4URKA 2FJGB 2KLSA 2Y5TB 3U79A 5EA0H 4UINL 4UQDA 4AC4A 3I2CH 4WNQB 4DP5X 4PWKA 3P9WB 4R90H 1A9VA 4KKBC 1FSKC 1H15A 3ML9A 1JYVA 2D2OA 3OAZK 5GZOC 3UXFA 3NSFA 2EYSB 2HT3C 4JHWH 5K9KA 3TBYA 1IO4C 2F54E 3VFSA 4ODWA 3ZUCA 3DMMA 1ZSHA 3S0PA 3HS0B 1MW1A 1IEBA 1FHNA 1J12A 3NJMA 4HCIA 3BZFA 4TUJB 3QHTC 1L0PA 3ZGHA 1NGPH 4Y5XA 4G5ZH 4MS8C 2IG2L 4LVHB 3T0DA 3ARFC 2VXUH 3KPOB 1NCAL 1XF4A 3UOAB 4LKXB 4L0ZA 3ARWA 1R0AH 3B2VH 4OCSL 3RDTC 4IKIA 1G87A 4LSPL 5A43C 2WWOA 4PCYA 5DHEA 1A6AA 4O02L 2Y06H 3W39B 1OV8A 1UXWA 1BQKA 2DRUA 3Q48A 1KJ2H 4WV1A 3MRBA 3WFEL 2ZP8A 3R06A 2NDFA 3CD4A 3ZO9A 4XR8C 4D2NA 4OI8A 3RVWD 3RI5F 1UM6L 1VFAA 3WFZA 5D70H 4HF5H 4Z7UF 3NOIA 4L5FL 5JXAH 3ZMNA 1KC5H 4L9LB 5CLWA 4Z7UA 3FUKA 4X99B 3HMXH 4PJDF 4LASL 1DZBA 2IFGA 4XPAH 3UG3A 2NXZD 2VZVA 4LSVL 2XV6B 2R29A 2DWXA 4R26L 2ED8A 3OM3B 4QXVA 4L3CA 1DJXA 1SUHA 1ZXQA 3PYCA 1MREL 2BJMH 1R24A 3QZOA 2Z8SA 2FR4A 3K80A 4D9QD 2J12B 3C5ZA 1BQRA 2MMXA 2HRGA 2WC7A 1T03H 2E7LA 4HWBH 1F11B 1DQTA 4HUKB 1QNZH 2EIBA 4U3SA 5ANMB 3C5ZD 3DOHA 1T1XB 4TQ8A 3V4LA 1WS8A 5IQ7L 2XXCB 4WU5A 1K4CB 4IIQC 3X14B 2DS4A 5CZRA 5AOLA 5AZEL 3G6DH 4GO8A 2WTRB 4M4RA 2Y2TA 3QJSB 2OULB 2B9AA 3CUPB 3GM8A 3C60D 5TQ0H 3KWUA 1VGKB 1XCXA 1XB8A 1N18A 4QHUA 3X17A 4ZFZA 3FUIA 4Y2LA 4WHYH 4Z7QF 2W60B 1JGUH 4AMKL 2K4AA 4OCWH 1CB4A 5L0QB 1N68A 5F1NB 3WEBA 2EYTB 3MLUL 4Z7NB 2J3SA 4FQPA 3DHUA 2FEDD 3SKNB 3TNMA 1M1XA 1GC1L 3TESA 3OAUH 2BWDA 1TYJA 2VDLH 4PG2C 2Q2LA 3L5IA 1YMME 4JGNA 2VLJE 3T0ED 4ZS6C 3FU7B 4QXGL 5EU4B 3I9IA 3D6GA 3NIGE 1AIZA 2DQUH 4J3UA 2APSA 4WKXA 4J3OF 5FHAH 3TT3L 2VR8A 4R4FH 5JOPD 1OPOA 4N2AA 1K5NB 4JFEE 1YEHL 3KLHC 4Q9CA 4JFPB 1OAUH 1U8OB 4JDTH 5TQ0L 5FW7A 3GPSA 3TN0A 3MCLH 1NBCA 4YDLB 4NNPH 3TYGH 5KTEL 4G8EA 1GJIA 2XI9A 3PQYE 5BRZB 5CIPB 1MJUH 2H1XA 2XZQH 1WEJH 3F7PC 2YKKA 1HOCA 3ULUD 1XB6A 2AAAA 1EEUA 1WG3A 4ZUUA 3E9TA 3U2JA 1TG8A 5I73C 5F9WC 4KKAC 4PB9L 1Z3RA 1QNZL 2WWKT 3ATEA 4UTAA 3VA2C 3Q2NA 2ENQA 4CKVX 2RCSH 5DD3H 1Y6MR 3C60C 1SF5A 5DHVH 4AEFA 3GTVA 4M93C 2E4TA 4P9HH 2FJFA 3FT4B 5C0AD 1BZ9A 3S9DB 3V4VL 4JHUA 2PYFB 1YEDA 5BO1L 1MPAH 4N8VA 1DDHB 1BQ5A 1DANT 3DJRA 4P2QA 1QBML 5CP3A 3SDYL 4GKLA 5ESQA 1GOHA 4P3DB 2GABA 2DKUA 2X70B 2WXPA 1ZPLA 2DQGH 2OMBA 1IVLA 2GT9B 1E3FA 1AS6A 5IHZB 4RAVA 1RUQL 5HHNB 1W2KT 3ESVF 4HKJB 3T0EC 5BVJB 2E47A 1XIWB 4R4NC 5CFAA 3DX4A 3CHXA 1A6VL 2DBJA 5K9JL 2AGJH 4ZBJA 1LYQA 3FU8A 3N42B 3N91A 1XAUA 1MRDH 2GK2A 3DKHA 5CILH 5EU4A 2GI7A 4GAGL 4QXWA 4A6YL 2VUYA 3R0MA 1E4XH 3CAFA 3QEUA 3RILA 2Y06L 3X12B 1DDHA 1IBGH 2E46A 3CSPA 4M6NH 3VVWA 4AMWA 1UM4L 3IWUA 3G04A 2NY6C 1XF5B 4Y4HB 3MRHB 4R7XA 5AAPA 5DUJA 4AM0A 3BESR 1AZVA 4HKJA 2X7LA 4HBCH 4PLJC 3CWGA 2G75B 3GTNA 4E5XA 5EUKB 3AACA 1D2OA 3HZVA 3UYPB 3GT6A 4Y4FA 3T2OA 3GS4A 1CQKA 1KBGL 3VFGL 3KCPA 5ACZA 2QSCH 1MHEB 4B41A 5DXWA 3NH7L 1BLIA 1G7MB 2HFGH 5D7IB 3QUZD 4G6FB 3H6JA 1NIFA 4GXUN 5E8DH 2JIXA 2Y5QA 1URZA 3N42F 2E27H 3JTSA 4XNXH 5AZUA 4N1EA 3WS6A 3EOBB 3LQAC 3HEIB 3GLZA 3MSPA 4YDVB 4KVCL 3SDDD 1KCLA 3LH2H 3ARGC 5E7FA 5FCUH 4LZKA 4H8QA 3UC0H 2YPVA 4H0IA 2FSEB 1HINL 3PP4L 4E42B 4GMSH 5FYJU 3RY6C 3BFOA 5KYXA 1UURA 2HFEA 5EU6E 2DI7A 3GSQB 1IFGA 5DRZB 3AXLB 4XMUA 4A7VA 3ZT5A 4U6HA 2DICA 3HHSB 1IAOA 4UT6A 4RGNE 5KEZA 1AGFA 1FORL 2APVA 4TQEL 2NX5D 1JXDA 3VFWA 5F88B 4BRJA 3D30A 3PGCB 1L9NA 2NT1A 4KDTC 5GISL 1V7MH 2IQAB 2WCPA 3TFKC 1SHMA 3N06B 2XFXA 5IMLA 2DDQL 3QG6A 4OB5L 1BVNP 1DEDA 5D7IA 1PCSA 4HLJA 3VXUA 4AGQA 4A04A 4MNQD 1KN4H 4WI8A 1AS7A 1W0WB 3GMOA 3RURA 4OFYD 4FQHA 3EFOA 4W9ZA 3P4OA 2C34A 3CVHH 2IAMA 7FABH 2BP8B 2CUHA 3GZOA 2BO0A 2O6EA 2GK0A 1HH6B 1T0PB 1ZDSA 3GMRB 2ZOOA 4LP5A 1QACA 5D1ZA 1P7QA 4MJ2A 2ATAA 1UWYA 2X0VA 3HB3B 2FVNA 4IIQB 3QC6X 3DUUA 5GJTL 2AJXH 2E74C 4F80A 2HZHA 1HEZA 4XI5D 4KXBA 4GI6A 2P5WB 2VM3A 3HE6B 5EV7A 4U1MA 5IW6B 1EAJA 4PBWD 4Y1AD 4YSRA 5EC1B 4UILH 5TH2A 1A3LL 1F45A 4AWJC 2A9MH 5AYTA 5FFOA 3OSKA 3ULVC 4Z7OE 5B39B 4QYOA 3VXSB 3IKCA 4GG6A 5HGHA 1WC7A 1MRFL 3L7FA 2AP2A 3GJFK 1G7QB 4KZEL 4OLVH 3OWEA 2AABH 1OVZA 3ZDYB 3FN9A 3R7RA 1FZJB 1PJ9A 1R24B 2V6HA 3QORA 1PDKA 3S2AA 2XLLA 5E8EA 1QWUA 3LN4B 2UYLB 3DYPA 3T0VA 4K0OA 4AH2B 1REIA 5E4EC 4YHLL 1J1OH 1NH6A 2VR5A 4PYGA 1IM9B 3VGFA 3VXOB 3GBMH 3L54A 2OTPA 1U95A 1EZSA 2UY6B 1DHKA 4WW2A 3H4FA 3MXWL 5LGKA 4LL1A 3SPIA 2H0PA 2CO3A 3PAVA 4JRXE 5D4QA 3HRZB 3P30H 3FB8B 1ERNA 3W11C 1BQLL 3P3SA 2JB5L 3UYOD 1KBPA 1KYOJ 3BDXA 1RFDL 3CK0L 2ZUXA 2ZCLH 3EG9A 1DCLA 5KS9E 2WXKA 3ZDYF 4S11A 1QTSA 4WTQA 3QFJA 1IAIL 3DHMA 1PX3A 4NGHL 5EC1A 2F1AA 1KLUB 1MRDL 1JGLH 2WSPA 4JKMA 1ZHBB 4NXSA 4AJVA 4JRXB 5EDXA 1BMWA 1P9MC 4LGRB 1BXUA 2DW5A 2ROXA 2LU4A 3VQMA 3JWDC 1ZT7B 2YFOA 2NY5L 1IGYB 2LAGB 4OKDA 2EEAA 2E59A 4OU3A 4DZBB 4HIPA 1WP6A 3MR9A 4U4IA 3CZKA 5FCSH 5DZLA 4RQQA 2V2WA 3L5HA 1HE7A 3NIGF 3ARZA 3ESMA 1C16A 4G7RB 4QIRA 3ILPA 3L5JA 1F97A 2BVPB 3MDJA 3AAZA 1R47A 4AQEB 3ZT6A 1R1CA 2EIEA 1EQWA 1YYLL 2VSKB 2FLRT 3ZDZB 4EDWL 4UQIM 1BMGA 2W0LA 3KPMA 4PJEA 4QHKI 1WZ1H 4A39A 1UATA 3BHBA 1CF8H 3VD3A 5EH1A 3BSZL 2G3NA 3MLYH 3JV6A 4YSTA 5GSRA 2FE0A 4NSKA 2YQGA 4QY8B 3M46A 3O9WD 3OC5A 4K23H 2JXMB 4H25A 4JPWH 3P2DA 3VI3E 2IVFC 3QJVB 5F3BA 4LVOB 1CXLA 4XRCA 5J12B 3CFTA 1XZ0A 3C09B 5T1LA 3DV6A 1CFVL 4JRFA 5I8OH 1L5GB 5E08H 2Y07L 1KY7A 2FGZA 2YAHA 4RNRA 4URTB 3HNVH 1O7DC 1QSEA 3ZR5A 5C9JA 1DTUA 1ORSB 1XT5A 2AZUA 2IFFH 3TO2A 3ETBF 2XWXA 4CN6A 1HI6B 5KYWA 1A1NB 1NCBH 1HQRB 4GG8B 4DKAA 5H8DA 1M1XB 2AITA 4YHNA 1IILE 1HH9B 1JNHA 5I66B 2NY7L 5E51A 4G42A 3VQ2C 3WS3A 3RQ3A 3VX1A 2GJPA 3FT9A 5HDOA 4C83B 2NY1D 2BIIA 3UBXI 1SDAB 3DDFA 4NC2B 4N0CC 3T3ME 3SKOA 2XVLA 4BUQA 3QDGD 3GRWH 4PJDE 4NRZA 3I6GB 5C0RH 2L3BA 4Y2DB 2F7OA 4RGNB 4CMHB 2J1WA 2CHZA 1GTNA 1I82A 3L81A 4G83A 3SPJA 2GJ6E 4ZUWB 2Z35B 4RAUA 5KVFL 3A6BH 3TVMB 2WTRA 2H4EA 1RUKL 3MPCA 4KZDH 4JQVA 2VSCA 4WHCA 1NC2B 3FQWA 3EAKA 5I1CH 2IH8A 1HDMA 5GRUL 1MDTA 1V27A 4J3WA 1T1XA 5ID1B 3X12A 2NMSA 4J2XA 2OKMA 3CXDL 1CWVA 3FC8A 1A02N 2B4CH 4X8CA 1QPPA 1CXFA 3TJHC 5I8CB 2OMVA 3UTTB 1YN7A 3MNWB 5A40E 5CP3H 3IJEB 5EOCJ 1QOKA 4FFTA 3IPFA 2IG2H 2ATPB 3T0EB 2MOGA 1D3CA 2P8PA 1T83A 3PWVB 4HDIB 3RUGE 4HV8B 4YSCA 3MUZ1 2KI6A 5CGBA 1IFHH 4RMRA 3T0WA 4ABWA 1JWUA 2ZF9A 1PQZA 3P2BA 3WLBB 5JHLH 1FV1B 1X5FA 4JN1L 4GUPA 4N0FA 3WXWL 5C0CD 3WLWC 2AS5M 3PJLA 1EHLL 2NZ9D 4G9FB 4QO1A 3ROLA 2CR6A 3PS6A 4F57L 4K9EH 3TYFB 4MXQC 3ZK0A 4KBPA 3REVB 4PJ5E 3VI3F 3LSOA 2DQEL 3QPQD 3O3UN 5E94B 3KPPB 2MJWA 3JSSA 4JX0A 5ENWB 3F7RA 4UTBL 4PWEA 2G0LA 3S3CB 2FAUA 3ZGIA 1JTOA 3K4ZA 3JTTB 3W0WD 4E36A 4FNLH 2G9HB 5D2NB 1FNSH 4HUWB 5IP4A 1FBIH 1JHKH 2Y7QA 3HR5B 2VLLB 1XWVA 5C07A 4C55A 2CJSA 3VWKB 4P0DA 2VUOA 5FECB 3ZBMA 3OKLA 4BZ1A 1MLCB 1LM8V 4XMLL 2X4RA 5GS0D 4OQTA 1MCHA 2JCCA 2WYTA 5DDHA 3RWJA 4PSRA 1R9FA 3LEVL 4HUCA 3LZRA 1LEIA 2O5NA 2ZX7A 2YPVL 2FHBA 1YNTF 2VXTL 1FCGA 5FUOL 2LFGA 4PV8A 4ZFFA 4XXCC 5DEFA 1TQCB 4PGEA 2DLTA 3V0JA 5D7JD 2X2IA 1EERB 1MFBL 1WFTA 5F7HA 5GQBA 4KXZH 3G6JF 5IVZB 1XIWD 3D5OF 3V6OC 2YC1B 1FAIL 4J4PA 4KH9A 4MJ6A 3ZYOA 4GEJA 1L9MA 5ICXA 5L0QC 3IDGB 1U36A 2P28B 5K93A 3SYOA 5I1AA 4NUGH 4ODUA 4CBZA 3T3MB 1WHPA 3SDCC 4JHVA 3TO4D 1UB6A 1F13A 1SNRA 4UOJA 1S9XA 3QHFL 4B9YA 3WLBA 3ARGA 1MCOL 2NZ9C 3MXVL 3FT3A 3QG6B 3RP1A 1A6ZB 1ZJBA 5J1TC 4S1QH 2DQDH 3FFDB 5JNYB 1JPST 1AOHA 4OCXH 3P9LB 2VW6A 4D8PA 2G5BA 2SEBB 2XVBA 2Z7YA 5HDWA 5DJAB 2D0FA 2J71A 3P4OB 3UH8A 4ZW5A 2HRPH 1G0DA 3HFFA 2ZOWA 4ZMXA 5JHDB 3DECA 4NRXB 3DOSB 4IHOA 4C56E 1QATA 2ZKXA 4NFDA 2Y07H 4J27A 4O4YL 1COBA 1LDPH 2ZCKL 5J13B 1GGYA 5KYXB 1FL5A 3SZKC 1YECL 2AJYL 4TLKA 1I85A 1WO2A 1QHOA 1SY6L 2ALAA 4L05A 3VFRA 1I1YB 3M07A 3IDGA 5ITBL 3MJGX 3LD8C 3OLIA 1ECYA 4WFFD 1XQ4A 4RA3A 5HHXL 4OLYH 3U36B 5BOPA 2V37A 2IANA 1RIHL 1ZANL 2J8UF 3MZGB 1TVBB 2GJ6A 1MFNA 1RZJL 2AZAA 1EFXD 3QRBA 4JFWA 1QVOB 2J8UA 2Q9OA 4JY4A 4I9WE 3M1CA 3Q06A 3CVDA 4K8RD 4UDUA 1XGRA 3GMMB 4HKZA 4WENB 1K9TA 4ZFFB 4CSSA 1AQKH 3RIFK 4AEHH 4WK2B 3FUNA 4M1GL 4WUKL 1QUNB 3ZZ1A 4YEEA 3CLFH 2JJVA 3U30B 2F6AA 3QUMB 4W4NA 3PV7A 4P2RA 5E9DD 1KGXA 2O5ZL 5C70A 2HVKA 4JO4L 5DEJA 1R3KA 3CBKB 4N2FA 2KDYA 4PV1C 2AJ3A 2FCBA 2DH3A 3MRKB 4P48A 2B0SL 3L9YA 2O93L 1AY1H 4ODTH 1KJ3L 1TVBA 2EDOA 1TOXA 2YBRA 1TVDA 1YG9A 2XXGA 1N12A 1NCBL 1S9YA 4HYTB 7PAZA 4L37B 3C5JA 2R39A 3BP4B 2WNWA 3AT9A 4NKQB 5I28A 2XBDA 3U1PA 1K72A 3FTVA 4FXKA 1DJIA 2D7MA 2P5EA 5HYJB 5HYQA 4CGUB 3MYJB 1AMXA 1UKTA 3N44B 2F74B 5JPMC 2GUYA 3DX6A 2EXTA 4M6MH 4Q97A 5DFTA 1RPQA 2WXIA 4W9KC 3WELA 5CD3B 4K07A 3O6LL 3FOMA 4G7VL 2KZ1B 3CZEA 3NSDA 2LU7A 2UUDH 4MNHB 5KBDA 4CN1A 3JT0A 2JLLA 2BOCB 5IT2L 4JPKL 5ANHA 4PLOB 1TTBA 2WLIA 5MEOA 4I5BA 3MOAL 2QKIC 2QVKA 1IBYA 2YKLL 3DWTA 4IU3A 3NCJL 2JSFA 1U3NA 1J1OL 2A4EA 3HZYA 5D5MF 5AW6B 2WYHA 2ERJC 1YYMH 3MX0A 4M5YH 5JDSA 4HS6A 3S5ZA 1LGVA 3V5KB 4AKOA 4KV5E 2QSCL 4JZJB 4WU7B 5EMYA 2A9DA 4KQ3L 4PWHA 3DPDA 4POYA 2L7EA 1FL3A 1FNSL 1T0NB 1M56B 2RR3A 1I8MB 4NB7A 1KPUA 3DMMB 4LSDA 4CADB 2ADIA 3BH9B 1A6PA 4NJ9L 4Z7UE 3TO4A 1YHPA 3T77A 2G30A 5BOJA 2IBGA 1RPKA 2EUXA 1WWBX 4HD9A 4O58H 5I2IB 5GIRB 1PFCA 1GJWA 4KROB 4R9HA 1B0RB 1I8LA 2NTFA 2CJUL 2NX5E 1NDMA 4MMXA 4IW4C 1WC7B 4S10A 1PKOA 4ZMWA 1IBDA 3O4LB 2Y24A 3T2LA 1BVOA 4LKCB 5CINL 2XDHA 3KYMB 2YR3A 5C8JB 2GY7B 4PJGB 2FD6H 4ZUSB 4NFBA 4WI0B 2XQBL 4G8GA 5E8EB 1I9JL 2MNWA 3B5HA 3EH4B 2CGYA 4PJ8A 5DJ0A 3BZFB 1RY7B 3ARFD 4IOFD 3QCUH 3FO1A 4KMQA 2BK8A 4Q4EA 4AXWB 3DYMA 3UDWA 2QZ5A 3FCSB 4NQDD 1HXKA 3BGFC 3DIFA 1U3JA 3RWCB 4WFHD 3HAEB 4WNJA 1J9SA 2FIKB 1EJOL 3CPLB 3MMEA 4OUUA 1OD7A 3DPBB 4YGVB 2F54A 4U4BA 4MZIA 3I6KA 4FC3E 3WO3B 5DHYA 1LO4L 3D2TA 2NTSP 3UYRH 4BKLA 4DVRL 1HCVA 2H3NA 3F65A 2VJ8A 3UJJL 5AD0B 1BGXL 1B0GB 1KTLA 1MRFH 1VADA 3EF4A 4IGBB 4HLZH 4YQXL 1WBYB 1ZEAH 2DYSB 5DMIL 5LAXA 5I71C 4X7CC 4HJJH 2EJ1A 4D9LH 4B60A 2VLKE 3S6CA 3UZQA 3VGEA 1U2YA 1IQDA 1S5IH 2QFPA 4YDKL 5GRXG 1A4BA 2I27N 3IS0X 4YHNB 4MA7H 2AJUH 3CSYB 4L8SB 3TBCA 4WI5A 4HJTA 4NQCE 3LS5L 4ZUTA 4ZOBA 5B1CA 2C7FA 2J5LC 1KOAA 2KMWA 3RVXC 4OFDA 1M7UA 2R4SL 2QGBA 3A4EA 1QSEE 3CDYA 4Z7VB 4PJHA 5HGDB 4B3EA 5A3IC 4JFXB 4AG4H 2VDNL 5DHYB 4XBGB 5FKPA 1TCRA 3DJZA 4R8WH 4UTAH 1DZ0A 2H2SC 2BSSB 2Y69B 4FG0A 1I9RH 5CJOH 5AW7B 3VG9C 4JG1L 3FT1A 1MAKA 3II3A 1PD0A 4AVJA 3OB0H 3R1GH 3C5ZC 4M48H 1JF1B 1QI3A 3OAYK 4AITA 4KJPD 2OJZL 3QDJE 3ZIYA 2EAEA 3GGWA 5CJBA 4CUCA 2XNAA 2Z0BA 4QJ4B 2W5PA 3RGVB 3N1QC 2EQDA 1WZAA 1E9OA 2H3NB 2FWUA 3GIZL 1N8ZB 3WFHB 2DBLL 1A64A 5AVXB 3PP4H 2P5ED 4C4BA 2XZCH 3G5YB 3OJDA 5CLXA 3WO4B 2CBPA 4Z3HA 1Q9OA 2ZOKA 5F96H 3BP7B 1AXTL 3OMNB 5CBAB 4GXFA 1BXXA 4YUEL 3FHAA 3Q8BA 1TJXA 4PY8I 3FH8A 5IK3A 4HJIA 3WL9B 4YIQB 3Q2LA 2MQGA 4ABQA 3BUYA 2V9TA 4JJHA 3TO2B 3QFDA 3TH4T 3U0TA 4RMTA 4WFGD 4X6CB 4IK7A 2VDRB 1HTYA 3CFJB 1DJZA 2FWSA 2Q5BA 4YSOA 1VGEH 1S9XB 2NW3B 2VT0A 3CFEB 3HC4L 4N2BA 5DEGB 1TETH 2V8MA 4OIFA 2CUAA 2EINB 1H8SA 1IEAA 5ANME 1NIBA 1OTSC 2BPBA 3EYFB 5I18H 3SSGA 1NGXA 1JXJA 1WISA 3RTLA 1T6WA 3WEAA 2CIKB 1L9QA 2X28A 2YD9A 3QUXD 5DHXB 2AEWA 3SGKC 5AKVA 4C4KT 2BVQB 1QFWL 1VEMA 3FUDA 3ECWA 1Q90A 4IRZL 4R90L 2WZPD 1GRWA 3EYSL 5IUCA 3VW3H 4WLCA 5IWLC 3TURA 1GIGH 3ZDWA 5D7HA 2O5YL 4NO0D 3VQLA 5H35B 2NXYB 3I3DA 5IHUL 3H3KA 4U05A 1KIRA 2WLJA 2BP0B 4YK4B 3TBVA 2Q10A 4W70A 4YE4L 3IF1B 4RWHA 5EZLA 4JFEA 4XBMA 2Y2YA 5AL0A 4X6CA 1XIWA 3PWVA 2CIKA 3D39D 1TFPA 3JUZA 5CJ8A 3K6SB 3W81A 2Z7ZA 3BPOB 3DROA 2DPKA 3K46A 4N20A 3BVWA 3H3BC 2LR4A 1X3DA 4MAUL 5DEGA 4KZEH 4NQDA 3GZPA 4ICWA 4OD3H 3UZEC 3VXPB 2HYMA 4PJCE 2OMUA 3B3IA 1JV2A 3JTBA 2BXZA 2HTLC 4FN0A 4JM2C 1RIUH 3NCJH 2PCXA 4EVNB 1BBJA 4MX7A 1JK8B 1S7UA 3OKMB 1C5BL 4QHPA 3NEOA 4LPXA 3QNYB 5CSZB 4ETQB 4KX9A 1JPTL 3SDCB 3WFCL 3F05A 2WVTA 2ZG3A 2FT6A 3H8NA 3QAZC 5JQ6H 3QNZB 5AZ2H 4KQ4L 4J3SA 1CR9H 3D3VA 4LEOA 2EXYC 4N8VG 5GGTL 4HOZA 4GXUM 1U3HB 5JXED 4TM9A 1OTSD 3HTLX 2GIXA 1DVFC 1KENH 4EI5A 4OZFG 5F7AA 4CN4A 5EZLB 2GTZA 1G7PA 2FQDA 4HH9B 4U1MB 1E3ZA 5GRVK 3C75A 4QRPA 4ONGH 4E0RB 1UD2A 5EBMA 3MLVH 3O3EA 4KRLB 1IGJB 3GSRB 3R8QA 2NX5A 4FQQB 2OMTB 5JORB 1UTDA 1BG9A 4JFVA 3KJ6L 3S36X 2B4CL 5I1CL 4KITB 4K7PH 3J8F7 1NOLA 5BMFL 4FKEA 4G80A 1DSYA 4W81A 3IYLW 4U6VL 5EEXA 2BSTA 3M88A 3U9PH 4I88A 3N2JA 2PETA 4KO5A 4Q0XH 4R83A 3V0GA 1GZPB 4LCYB 3WE6A 1Z7JA 1UHVA 3RL1A 1DBKH 5I1HH 2F5AH 1OP9A 2EUWA 3FAXA 3DOIA 3RAJH 3LHAA 4FQ2H 4LARH 5LCVL 4U6TA 1H3WM 1HILB 5EBLB 5I1EH 2XWJA 2IH1B 2ZWLT 3OZLA 4MAZA 4Z7WA 1PNCA 1HN1A 1U2CA 2HTLD 4JM2D 3BD4A 2VE6A 2BVTA 4KTEL 5CCGE 5CEXA 3OAWA 3NIDE 4YHOH 3FFOA 1VFBA 4PWFA 5K33A 5GS2D 3DETC 1SYSA 1ZHLB 1OSEA 4OV5B 3B2MA 3T65A 1YN6B 3QZWB 3ZHKA 3HAEH 1MW3A 3MKGA 4X5XA 3VXNA 2EZ0C 4NO3A 2BHZA