3MBWB

Crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
127
Chain Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords Ephrin type-A receptor 2
total genus 27
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3mbwB00
3PAZA 1N68A 3FU8A 3X1EA 5LDUA 1M9WA 2JFCA 3ABKB 2I7OA 1GS6X 3WI9A 2YAMA 5D4IA 4WTQA 1PY0A 4A66A 2QDWA 1JZEA 2HX9A 2PPFA 1QHQA 4A2HA 2UX7A 1N70A 4YSCA 2CALA 4HCIA 4YSDA 1IBYA 3FQ1A 1AZNA 5I26A 4QLWA 2XWZA 4P5RA 1M56B 4X4KA 3BVDB 2HZHA 3CVBA 4JKNA 2HX7A 3DKHA 1ILUA 2YAEA 2HLEB 3EH3B 2XUWA 4YSQA 4KO5A 1GS7A 2H3XC 5I6KA 1ASPA 2QPEB 1PNCA 4E9YA 4GP8B 1EHKB 2XX0A 3T6XA 3WKQA 2I7SA 2XV0A 2FWLB 1SF3A 1KDJA 4GXFA 4G71B 1AZRA 1OCRB 3MBWB 1SNRA 3V9EA 4KO9A 2IH8A 2CBPA 5AKRA 1NIFA 3TBCA 1AZUA 1MG3C 2OV0A 4PCYA 1E5ZA 4DPAX 1GYCA 5TK4A 4YSAA 1E5YA 3QJTB 3ZDWA 1RZPA 4K9JA 2DWTA 2BP8A 2BW4A 1NIDA 4MFHA 1BAWA 2ZXWB 4AZUA 1YLBB 5B1AB 1AZCA 2N0MA 2FQFA 1HFUA 2YQBA 3ABLB 3T6VA 5IY5B 1DZ0A 5I6NA 2AZAA 3WNIA 4HCGA 1PNDA 1BXUA 1MZYA 3OQRA 2YAHA 3H4FA 3OMAB 1KGYE 4YSOA 4DPBX 1RZQA 4CSZA 4HIPA 2QDVA 1ZV2A 2VMJA 1ASOA 2PCYA 1AS7A 2DY2A 2TSBA 2WO2B 2LLNA 1A4CA 2FJSA 4G7SB 4G7QB 4A68A 1AACA 3NJMA 3H56A 1T5KA 1WS7A 4UF7C 1AS8A 1NDTA 1E67A 3UACA 5I5IA 5F7AA 4DP4X 2W8CA 5FC9A 1CURA 3MX0B 1BYOA 2H47C 2GI0A 2UXVA 1J9RA 3G5WA 2BWIA 2OCCB 3FYIB 1BQKA 1B3IA 2BWDA 2A3TA 2IWEA 4AKQA 4YVUA 4BWTA 1JXGA 1JERA 4W9ZA 2EIKB 2B08A 2IDTA 5I5MA 1RCYA 4EF3A 4DP2X 2FTAA 5AZUA 2P80A 3IN2A 1XMEB 4E9SA 1TU2A 2VW4A 4NERA 2J5WA 2FQGA 1GW0A 3X1FA 1MDAA 3SQRA 3OMIB 3CZUB 3UAEA 1KBVA 4BXVA 3AW5A 3S3BB 3FSVA 2VW6A 3QQXA 2JKWA 4E9VA 2IH9A 1OF0A 5E9NA 1ZDSA 2I85A 7PAZA 1R1CA 1ADWA 4HHGA 1WA0X 4M3HA 5D4HA 4DPCX 1A65A 1BXAA 1JZHA 1A4BA 3FU9A 4DP1X 3OMNB 4F7KA 1NIBA 2HRHA 1ET8A 3NSFA 1WS8A 1AG0A 2EILB 2DV6A 1OCZB 2HX8A 4A2GA 3CDZA 3ERXA 4G70B 2XX1A 1A8ZA 4AX3A 3AZUA 2BP0B 2BW5A 1A4AA 2AVFA 2EIMB 2XXFA 2VW7A 3DTUB 3FSZA 2UXTA 3TU6A 4E9XA 3FT0A 1SDDA 3GXUB 3NJIA 3V9CA 3FYEB 3PCYA 2IDSA 3AY2A 1AIZA 1JOIA 4KO7A 1MG2C 3ABGA 5A7EA 1JZJA 4L0PB 3SBPA 4E9QA 1AZBA 1ET5A 2FQDA 2GC4C 5B7FA 4E9WA 1SF5A 3NJKA 4HHWA 3QPKA 1BYPA 2P80D 5PCYA 1L9OA 4DP5X 4KO6A 3PXLA 1XB3A 3BQVA 1ZIAA 4G72B 4DP7X 1J5CA 1M57B 1F56A 4KOCA 4NAJA 1NICA 2GC7C 2PPDA 3AG1B 3FSAA 2J56A 1JVOA 3L45A 2RACA 3FSWA 1V10A 4KOBA 2IDUA 3TBBA 1L9SA 1NIAA 1JXFA 1E30A 3WG7B 4A67A 1OCOB 3FQ2A 2JXMA 4W1TA 1KDIA 1URIA 3S8GB 3AG2B 2BZCA 2UX6A 3NT0A 3N2JA 4A2DA 2FT7A 1OCCB 4G7RB 4KNTA 3C75A 4DP6X 2VSKB 4AI7A 4YSEA 3S8FB 1L9PA 3AG4B 4YSRA 1JVLA 4F2EA 1TKWA 4WKXA 5I6OA 5I6MA 2GIMA 4FA7B 1AS6A 1AAJA 3NJGA 3CVDA 3JT2A 3T6ZA 2IAAC 3ZX1A 2HRGA 3PAUA 1HAWA 3D12B 2W88A 1OE2A 1ZDQA 1AOZA 2PPAA 3NJFA 3NJJA 1PLAA 2H5UA 3NJHA 1L9QA 1BXVA 2YARA 4F2FA 1KBWA 1W6WA 3NSDA 1FWXA 1V55B 1BEXA 3SBQA 3UABA 2PPCA 2AZUA 5TK2A 3HEIB 1NZRA 2GBAA 2IDFA 1W8EA 3FQYA 4E9TA 3NJLA 1JZFA 5B3SB 2BHFA 1J9TA 4DP9X 2EINB 3T71A 3NSCA 4HAKA 1NWOA 5I6PA 2R7EB 3NYKA 1AR1B 1JZGA 2PLTA 2HXAA 2PP9A 4YSSA 1GSKA 1OOWA 3N55A 2NRDA 2Y1AA 4KNUA 3X1BA 1ID2A 5B7EA 4BWUA 2DWSA 3X1NA 3ZBMA 1FA4A 2CUAA 2ZWNA 2MRYA 4PAZA 5B1BB 3OD3A 3DIVA 3QJSB 2VM3A 3FPXA 2YAPA 5D4JA 2E86A 5B1KA 2FT8A 9PCYA 2B3IA 2XV2A 3KW8A 4Q8BA 4BK5C 2XVBA 3UADA 4DP8X 4ENZA 3CG8A 2WSDA 1BQ5A 2XLLA 4YVNA 1KYAA 3IEAA 1SHXA 4DP0X 2YXVA 3U25A 2IWKA 3PLYA 4KNSA 4CSPA 1TEGA 1AANA 1PLBA 3NP3A 4BDVA 1X9UA 1PF3A 1DYZA 1ZIBA 3ASNB 8PAZA 2BP0A 1NTDA 1XB8A 1GY1A 3FPYA 5ANHA 2CCWA 4BDVB 1NINA 4GP5B 4HCFA 1NPJA 1GR7A 4M4RB 1CC3A 1NPNA 2X87A 1PCSA 1PAZA 4TXVB 5B7MA 3CVCA 2IWFA 2AFNA 1SHWA 1WA2X 1IKOP 1OE1A 4E9RA 1PMYA 2UXGA 3OM3B 3UGEA 1W6LA 1WAEA 2VN3A 1E65A 1J9SA 2DYSB 3H4HA 3IE9A 3PAVA 3NP4A 3PPSA 3IBOA 3WIAA 2CJ3A 1SFDA 1ZPUA 3QJVB 1TEFA 3ASOB 3AG3B 2BP8B 1UATA 3GDCA 2GB2A 3ABMB 6PAZA 1PZBA 5I28A 3RYMA 2QPDB 3HB3B 2J55A 4GYBA 1X9RA 1OV8A 2PP7A 3FU7A 4AKOA 1XB6A 3WKPA 2YXWA 4NB7A 4YL4A 4A2EA 4AKPA 1L9RA 1FFTB 4JHVA 3ZIYA 1J9QA 1IC0A 1IBZA 2PPEA 3IN0A 1PZAA 4UANA 5F7BA 4JHUA 6PCYA 4Q89A 2Q5BA 1KV7A 4P5SA 1QLEB 3FS9A 4YSTA 3JTBA 1CYXA 2UXFA 2GHZA 1BQRA 1KCWA 2YAOA 2X88A 1ILSA 1SJMA 3QJRB 1IUZA 3TASA 5B1JC 1J5DA 5PAZA 3CDZB 2XU9A 3S3DB 1WA1X 2FNWA 3EH5B 1AQ8A 4A2FA 2EIJB 2ZONA 4YSUA 1GS8A 5I6LA 2FQEA 1ETJA 2IDQA 3TA4D 2AANA 1NIEA 1ET7A 1HAUA 1PZCA 4GY4A 3NJNA 1VLXA 4N8UA 3QJQB 1I53A 4HALA 2OJ1A 2QT6A 1GY2A 2R7EA 2CAKA 5B1JA 2TSAA 3FU7B 4QKTA 1JZIA 5AFAA 7PCYA 4RH4A 1ASQA 1RKRA 3SBRA 4YSPA 4ZK8A 2J57A 4BWWA 1SFHA 2XXGA 1KCBA 1CYWA 1JXDA 3S3CB 5EHFA 2ZOOA 1NWPA 1A3ZA 2PP8A 4HZ1A 3WNJA 4FAAB 1CUOA 3KW7A 2FT6A 3EF4A 2BO0A 5I5JA 4GP4B 3GYRA 4N4YB 2XV3A 2WO3B 2VSMB 3T6WA 3X1GA 1MZZA 2MTAA 2YAQA 3EHBB 1V54B 3EH4B 3T9WA 1L9TA 1OE3A 2BZ7A 1PLCA 2PCFA 2Y69B 1QNIA 2XYBA 3X2QB 1AG6A 2YAFA 4BXSV 1EZLA 1SDDB 2Q9OA 4UAHA 2VM4A 3UAAA 3NSYA 2GSMB 3QJUB 2DYRB
chains in the Genus database with same CATH superfamily
4N6QA 2OMBA 2A1WH 2AC0A 4X6EB 5AVZB 4KKLD 3GSWA 1PKQE 5AENA 4B9ZA 4OLUH 1NBCA 2I7OA 3A6CH 4H25A 4LEBA 4NPKA 2XWJA 5D4IA 3NACL 4MNQE 1NEUA 1GYUA 1NEZG 3B2MA 4MNQB 4FN0A 2MCG1 1GZQB 1ZLVK 2Y0SA 5FWRA 1S7TB 2F15A 4DAGL 4YHMH 1NGQH 5DUJA 2K6ZA 5DR5H 3CCHA 2WBJB 3HBGA 5DFTA 5I0YA 5H35B 3DKHA 2IBBA 3BWZA 5AUMA 4YSQA 5SWZD 1YNTA 2J6WA 2NY1B 1P5UA 4JVWA 4EJ1C 3BH4A 4P5KB 3SDCD 3RFZC 4MCZB 4W6YB 3BP7B 2YD5A 4PPTA 3S36X 3T2PA 5KW9L 2NTFB 1PNCA 3O11A 3O4OB 4QPEA 2WQSA 3H55A 4KRPB 1PZ5A 2CK0H 4XGZB 5HYJD 3T6XA 3T77A 4OVVA 3BVXA 1SF3A 4N8CH 3CSYA 4CU7A 4PVMA 1MQKH 1MHCB 1ID5I 1UFUA 4KO9A 4I18B 1G5GA 4ZTPL 1MG3C 3NCMA 1X5AA 1MLCA 5LG1A 1AGDA 1A7QH 1YEDB 4UV4L 4LOFA 3QJTB 4JAMB 1IMHC 2VR4A 3IMRA 1IKNC 3H9HA 5HP5A 4AZUA 2ZXWB 1D9KD 1A6VH 1JCVA 5B1AB 1G7LA 4MTMA 1YEKL 1FZKA 2VERA 2DQDL 3LSOA 2ICWI 5DUMH 3FTGA 4BFGA 1BHGA 1WAPA 1CFVH 2NZ1A 2ZXBA 3IYLW 4PV1C 1IGTA 1DVFB 3GF8A 4O58L 4G8AC 2QKIA 3HS8A 5D2LB 4GAGL 4KUCF 1T7VA 2NT1A 2DY2A 4PRBA 4LCIH 1HI6A 4GAFB 2VT0A 4DQOL 2P45B 3OAYH 5E7BA 5FM8A 4ONFL 3MLRH 3QEQB 4PJHA 1THCA 3WGVB 2WXQA 2WWMD 4PJ8C 1KEMH 4NPYB 1NAKH 4PRPE 1MCNA 4QHMA 4XP4L 3DTXA 3B2XA 4PRAA 2W8CA 3LS4L 3PWPB 3S37L 5FC9A 4C56D 3C09B 3G6JB 3OKEA 1ZOXA 1J9RA 2BVOB 3BZDA 5T3XH 1KB5L 4LP5A 4ZXBD 4NUGL 3SOBL 1MUJA 1UQSB 2NY6B 3GEWB 1F8TL 2YQ2A 4ZZFA 2AV1B 1QLRB 3VI3E 5C2UB 1NJ9B 5TDPA 3S4SA 4OLYH 3ZDXF 4W9CC 1YMMD 1A7OH 1AQMA 1NCCL 5CLWA 5L8JB 1QWHA 2LR4A 3EFOA 4Q0XH 5DJ6B 5E1HB 2OR9H 2P8MB 3FMGH 4E0RB 2DMKA 2H4EA 4K8RH 1OWRM 1UTDA 1VGKB 2FECI 4RMRA 2W0KA 2BH0A 5L2KB 1G1OA 4NHUA 4I1RA 3FL7A 3DX6A 2X4SB 1BIIA 3JYBA 3OR6B 5HDBF 1EFXA 3CXHJ 1WUZA 3ULUH 3RWCB 2JIXD 4I0PC 3DETC 1KCSL 3ATDA 3GXTA 3IFLL 4HPOH 1O9WA 4NQQA 4FNQA 3VFTA 2ZOUA 3R4RA 4YEEA 1R0AH 3STZA 4B3EA 3LPWA 4I48B 1Y07A 2HB0A 3FB5B 4WI9A 1K8DA 1SDYA 4JO2H 3BZEA 5TF1L 4FL4B 4Z18A 3SN6N 1N7ML 3LKNB 2YA2A 1QABA 4LEXH 4U3HA 4X99B 5F0MB 3ZZSA 4F7KA 1KCVL 4J3OF 4W9DC 3ZR6A 2PW1A 4TQEL 3UG5A 1AQKL 1MCRA 1CBJA 3IFOB 2WP3T 4JN2B 5KN5B 3QWOB 5T3ZD 5KVEH 4MA7H 2YJLA 4KWUA 1JHKH 2I27N 1JF6A 3TP4A 1A4AA 1S3RA 4I88A 5JUEL 3SJVE 1PDKA 1NBYB 4OCNC 3DTUB 4AQOA 1KTRL 3FT0A 3GEFA 4QNPF 4HFUL 1QA9A 4JFDE 4NNPL 3RHWF 4FFZH 4PJAB 5EU6B 2YIHA 3J7HA 2AK1H 4LGRB 1KYDA 4LVNC 1Z5YD 3KS0H 4JRYD 4PJ8A 1TTFA 3BKYL 4HLJA 5EN2A 4L0PB 2IANE 3GMOA 3K4ZA 4ACTA 4E9QA 1QZNA 4JBSA 5JPMB 5B7FA 4WNQA 5EIIG 4YHKH 2RCSH 1E9OB 3GXNA 3VWJC 2JH2A 3X14B 4Z78B 4H1LB 4HF5L 1RERA 4PMEA 1RULL 5DMKA 2VXSL 3OHXA 3ULSB 4LARH 2BRQA 4Z7UE 2Q10A 2AEOA 3L16A 1FPTH 1TJIL 2FBJH 4X5WA 2BP3A 3FSWA 5BS0A 1UEYA 1KXHA 1UURA 3U7WL 1EVUA 1RI8A 3FHEA 4N8CL 3SDXE 5L4MA 3PHQA 2DQMA 3GC3A 4NUGH 1HSAB 2AXGA 4P05A 4D0BB 2ZXCA 3K4AA 4RGND 3U4KA 3NT0A 3RX7A 1HS6A 3U7YL 4G6AC 1J8HE 5ECGA 4IOSD 3W3BA 2KH2B 4AI7A 1Q38A 3KAAA 2C34A 1RHHB 2YEZB 4GT0A 2B8OT 1NMAH 4D3CH 3RWCA 2CUHA 2GIMA 1B90A 3HFML 3B2UD 3IJHA 3O41B 1B9ZA 3QUKB 2X1OA 1UVQA 4HCRH 5A3ID 4BK5A 5E2WH 4YLCA 3SKNB 4FTVE 5DHVB 4PP2A 4BGLA 1M3JA 3VXSA 1R4XA 3OZKA 5IT2H 1NCJA 4ETQA 1U3HD 3NJJA 1SLWA 5CWSB 2NY2C 4FQ1L 4OI9A 3NJHA 3BW9B 2P24A 2QV4A 1D9KB 1O7DC 4HWEL 4QY8B 5KJ4A 2HMID 1PD0A 3KPOA 3NIFF 4Z7VB 1FWXA 4RETB 1EA9C 2PPCA 2AZUA 2AF2A 4Y1AD 1QRNE 1AR2A 1ZMYA 5GGRA 3APNA 4UDUA 4C83B 1I1AD 4N90E 1IC4H 5C0RH 5DLML 3I6LD 2KERA 3FFCB 5FDWA 3N1QC 4TSBL 5J12B 3GBNL 4DP9X 5FGSA 4G7YH 3CIQA 1U2YA 3DRQA 3ZTJH 5IIEB 1XHHA 4JKKA 1J0IA 3MREA 1IB5A 4XOCA 5JO5B 2F58H 5KBLA 3TYGH 3GTNA 5SX4H 3QCUL 5JYMA 3JUZA 3WN5B 2OYMA 1FJ1A 5DRZB 3JTSA 1QFWH 5K93A 2EDKA 4F9LA 2NY6D 1ID2A 1II4E 3ESUF 1OF2B 4NYLB 5DSCA 1T3FB 4L3CB 4R0LB 5K39B 2ZPKL 1NKRA 4IW4C 1D9KC 2MRYA 3DUSA 4HP5A 4WU5B 4WUUD 3V6OA 1I7RB 4U3XA 1JPFB 2VM3A 4Q74A 5HYEA 2XA8H 4LVOC 1A7RH 1NGWA 4EN3A 1CGSH 1X5GA 2CMRH 4L4TE 4XXWA 5F8RC 4QLRA 2V5RA 1QFOA 4WHYH 2BWQA 3Q9QA 2HJFB 3FJTA 1BQLL 4DZBB 5T1KA 3QORA 3CCHB 4JRXA 1DL7L 1GGIL 2ZWKA 1JHLH 2DQJH 3UPAA 3T3PE 3MRFA 5F7NC 1RZJH 1TYRA 5IOPB 3QFGA 2GBTA 1UH4A 3C08L 5M7QA 4QJ5B 4Z3HA 3L17A 3EYOA 2RQEA 4FF9A 2V2WB 4Y19A 5T5NF 5DFAA 1HHHB 4IMLB 2BCMA 2CCWA 4WSGA 5HGAB 3VFVA 3VRLE 1AHWC 3VX0A 3T77B 3VFPA 3QJFB 3QDJE 4M7LL 5TE6H 3O41A 3O6ML 4FD0A 5JR1L 4W6WB 2NUPA 1PMYA 3IT8D 2BSTA 2JJVA 3AITA 2QJDA 5JOPE 4OZFA 4LPVA 3F6JA 5D7EA 4FXGA 1EZSA 1KC5H 2IC2A 2WXHA 3EJQA 4MQ7B 5E6UB 1A22B 2CLRB 4Y5YA 1UATA 1U8NB 2QKIB 2WIIA 4Y16B 1OARH 2H3KA 2JXMB 5GGRB 3DYMA 2WBKA 3FOMB 3CXFA 5KYNA 2WZPD 3FTGB 2VDLB 1QBMH 1EV2E 4GKSB 2YWZA 2ERJB 3WFBL 1G7IA 3BGMA 3MBEC 2OSXA 1CK0H 1JI1A 3C60A 2DM7A 1WBYB 5JW3H 4IKJA 2YPLE 1K5WA 3EGSB 1U91B 4MXVF 3CC5A 5BVPL 5IB1A 4BSWA 4IHBA 5D7IF 4X5PA 4ODWA 3FS9A 4M8RA 2XRAH 5MHSD 1J1OH 3DC0A 3IRCA 1VACA 3QVAA 2CDEB 4XP6H 2AERT 2MCPH 2Y1VA 5F88B 3QCUH 1NFDA 3KPSE 1YNTB 5B1JC 4JDEB 3CDZB 4HD9A 1QPXA 3KGRA 3PS6A 1WA1X 3EF7A 2Z31C 4ECNA 2LQRA 2COQA 2IFFL 4GUQA 3BP4B 2AJZB 1HEJC 1DFXA 1U95B 2B4CC 2ZSWB 2YD8A 4KJWD 1WZLA 5D1XA 2GJZA 3GXPA 2P8PA 1WV7T 4YH6A 3KWTA 3LZQA 1V7MH 2H2PD 3ECWA 2MQGA 2GTZA 2VUKA 5F44A 1IGYA 1MNUH 1RJLB 1N9PA 3OSVA 5H37A 1WEJL 4MS6A 3SGJA 3MLXH 3WLBA 3GTTA 2I9TA 3FDWA 4OQTL 1YN7A 4MMXA 5E03A 4R4NC 4X7SL 5TQ2H 2BVYA 2QADD 3GMMA 3MYJB 1HNYA 3SDCC 3AXHA 4MD5A 4EIZC 4UI2A 2ID5A 4PJIF 4YGAB 3AREC 4Y16D 1SDAB 5T5FL 3QCVH 4L3ED 3ARQA 2Z0UA 4MXWL 1S5IL 4JFDB 2M2DA 4PJGE 1FZOA 2QGCA 5JIMA 3SJVB 1JGVL 3K91A 4O2FA 4H8VA 4FXKA 1N59B 2AITA 5C97A 2FEDC 5C3TA 4MD4A 3L5WA 3CXDH 1EJ8A 3WLWD 4PGCA 1QFUH 1SBSL 2HUHA 2G3MA 2EDWA 4KHTH 4MX7B 2C9XA 4F7CB 1QEWA 1MVUA 2XV3A 2VE6A 3HCVB 1GYAA 5E5MA 2H32B 1L6ZA 2KHAA 4WWKC 1MZZA 3C5SB 4WWKD 4XCNA 3SY0B 2D4FA 5G4NA 3W0WD 3X1GA 4NPYA 3HS0A 3OF6D 3ORJA 4EQ3A 3I6KA 5KSVA 3QG7L 3WLWC 2YGPA 3X2QB 4NWTL 4LGSB 3Q01A 5C0FA 4YHNB 1K8IA 2LU7A 5I19H 3WU1A 2XVGA 1KB3A 3FN0H 4LLMB 4H26A 5FO7B 3UAAA 2AJUH 3O3UN 4BUQA 4S0HA 1CPUA 3EGSA 3Q7JA 3ECBB 1UZ8B 3APMA 4QRSB 3FO2B 1N68A 4F37F 3QJOA 3FU8A 3FUFA 4F7EB 3NFSL 1VIWA 5F88A 2Z31A 2B0SL 4K0OA 5E24E 1X44A 4JY6A 3IGAB 2V5TA 3C08H 4BCYA 4N2EA 4HS6B 1CYGA 1A4KB 2GSGA 2Y6SD 3VI3B 2X4SA 2NY4D 4UNUA 5AW5B 5ABAA 2WYZA 4MYWB 5E2WL 4UT7L 3TJHD 3ZE0F 1BZOA 5AD0A 2EQDA 2WUBH 4XN9A 2OKMA 4Q6YA 1LNUA 2G9HA 2GUYA 3GMRA 4A6YB 1T0NA 3CVBA 2AEPL 3MBWA 4Z23A 3BSGA 3QUZA 4QXUL 4WI3A 4XO9A 2HCZX 3DO7B 4Y5VA 4W6XB 1K5NA 2DBJA 3H2QA 3L2MA 2QFRA 3RA7H 1OT1A 3L9BA 2V17H 5J0BA 3PWUB 1GZPB 3OLEA 5SWSA 3UEZA 3BO8B 5MI0B 5LGHH 1CXIA 1FAIH 1MHEA 3OAUL 3IXAB 4ZW3A 3F7RA 4ETYA 1JV2A 3HUJA 3L95A 3HRZB 4JFEB 6CGTA 4IU3A 4I89A 3KVPA 1MCOH 3WXVL 3S48A 4ZTOL 5IUCA 5EIVA 3TESA 2F58L 1P5VB 2WLYA 2F18A 5EZJB 2OSYA 2ZX6A 2JQAA 2DJUA 3IFNH 3NZHL 1HI6B 2WKGA 4ATWA 2ODIA 4DPAX 4XMKH 1LP9A 4YS4A 1GYCA 5IBLD 5IMMB 4HF5H 3QGVA 2VR7A 3FTSA 4MD4B 3F00A 3V4LA 2G5BB 2C9RA 2MQCA 2R23A 4XBGA 4PTTB 2OK0H 4KQ3L 3B56A 3FAWA 4I4WB 1RUAH 4C83A 3N9GH 2UZPA 4HFWB 3KNBB 2AZAA 2J5LB 3LD8C 1ZHLB 4AEHH 1SYSB 1U30A 2ZCLL 3QHTC 4AYDC 3D85D 3IVKA 1KGYE 4LU5L 2QPUA 1ZLDA 4NWUL 3SKMB 1EPFA 1QG3A 2NR6A 4GBXD 2G75A 4V33A 1ASOA 2ROXA 3GS7A 5KZCD 5MENA 1CG9A 2R29A 2NYYC 2TSBA 4W4OC 5EUOB 1J18A 2WLHA 3WN5A 4JRXE 4JANA 3M7OA 5DZNA 3UZQB 2E27H 3VB9A 4G7SB 2HFGL 1A3QA 4OT1H 2HPOA 1JJUA 2NCEA 4X9BA 4OZFH 1HCYA 1R6VA 3QXTA 4JPQA 4MJIB 1CDGA 2BFVH 4JFUA 1AS8A 4HUVB 1IM9A 5F7AA 4N0CD 1LK2B 4JL2A 4OQTH 2NY4C 5IB5A 5IMLB 1T1XB 1P1VA 3VXTA 2LLGA 4HYTB 4FKKA 2YQGA 3NFSH 1CFTB 3AJ7A 4LHUD 1IKFH 4ODUB 1T22B 1T0OA 3IXTB 2PXYA 4NFBA 4MA8H 4W9ZA 5DQ9B 3F64A 4FADA 1YRKA 1NBQA 4M62L 1PKQB 4PP2B 3BYTA 5JW4M 1TTUA 3PHOA 4LSRL 3U6RA 3LZRA 2OW7A 4LCUA 1JMXA 1AGCB 2QQNH 3RBSA 3C2AH 1LILA 2O5ZH 3MLSL 5HSFA 1GZPA 1D9KA 2XSKA 5IBUB 3V6OC 4RIRA 2C3VB 1KXQA 2E3VA 2A4EA 1U33A 3U9UA 2Z1KA 3EOAB 4PRDA 3ZKXC 5H8DA 1JG9A 3LZOA 1FAIL 2VXQL 2XZQL 1BIHA 3BSZA 3R8QA 2JJWA 3ZMNA 1R3KA 4P2OA 1XF4B 5C0DA 1S7WB 3O3BA 1AGFB 2J72A 1BEYH 2APWA 2W0FB 3Q9PA 2W38A 1C8QA 4ZMXA 5D5ME 1QTSA 1WS8A 4J6RL 1NUNB 5KSBA 2HX8A 4AEEA 4NBZB 2GCYA 3A4AA 4G6MH 4AMWA 1IC5H 4IKIA 4PRHE 3VFRB 3I2CH 3C12A 3S2AA 4HFWA 2AVFA 4WU5A 3AS1A 1JTPA 3PIQB 2X89D 2UXTA 3TBTA 2CR0A 3MRRB 2NX5A 5E9DA 5D1ZI 3D52A 1UFGA 5EEZA 5IREA 5IVZB 4I1NB 3ML8A 2HRPH 4Z7OB 2IGTA 4MNGA 1AIZA 1V7ML 4OLUL 4KO7A 4TMPA 1MG2C 3ABGA 5A7EA 3PFUA 4QHUA 5E2TL 1OTTD 2FQDA 3BN9D 1XCQA 1G7QB 3ME0A 4FA8A 2F2HA 2MOQA 5J4MA 2WWKO 5D2NC 5CEXB 3HG0A 2Q3ZA 4QRTB 1A47A 5BMFH 5JIDA 1S7TA 4F8QA 4DUXA 4ORZC 4H8UA 3WELA 4RGNB 4L8DB 4NUJB 3ZTNH 3QXDA 4DVBB 4HG4J 3FSAA 3DVFA 2P5PA 2NYZA 1IE4A 2WQXA 4XZUA 4PJXF 3KGTA 1VCAA 4LSQH 4WI6A 4X5QA 2I9TB 3IDXL 1NGYB 3CFIC 3L8QA 5HDWA 4ZD3H 3DJ9A 2A9MH 1GZHA 2Z7YA 4IJ3B 4JPWL 4NKQB 3IDIB 3EJRA 4W1TA 1KDIA 5E2TH 2JKJA 2KKQA 5IVOA 3AG2B 4WI7A 1GHFH 4K5LA 3AAZA 1EXUA 1S3KH 4ODVH 1WLHA 3SY6A 3FFDB 3PL6B 4OCRH 1T03L 2DH2A 4G7RB 1QBML 3B7YA 3T3PF 4AITA 1OTUD 4HXBH 2CLRA 4Y5YB 3KLQA 3ZPDA 3S8FB 3E1F1 3AG4B 1NCBH 4A7GF 2Y5TA 2F54B 3ARSA 3NTCL 4U6VL 3MXVH 4OIIH 5D71L 1MXDA 1SOXA 2DQIH 3W0WE 3L9EA 1HJBC 1UC6A 4GMSH 2D3VA 1IC1A 2WXJA 4HWUA 1WZ1L 3ARGD 3PJSA 4JPVL 2HYMA 3D12B 1QTPA 1MEXL 2XBZA 2BIPA 4NQUA 4ZW8A 2D0GA 5TPWH 4B95C 3DJTA 3O11B 3MUY1 4LKXB 4P5MA 2CA3A 3D34A 1FLRL 5DVKA 1X5HA 1BXVA 1R75A 3PWNA 2V4LA 2XETA 4IMKA 1S78D 4JHAH 1XMWA 5I0ZA 1OHZA 1ZSDA 1P4LB 1DQMH 1F2XK 3BSHA 1RZKH 4MXQC 4WFFD 5J11C 3H2WA 2X6BA 4PRID 4X42A 1VACB 4WUKL 4KFMA 5FUZL 2R29L 3N43B 4KY2A 5BZWB 1ZGLA 2FYYA 4EI5C 1PFCA 3FCUB 1BXXA 4NGHH 2ILLA 5I6PA 3TPUB 5AWNH 5AAPA 4XMPL 3NA4A 1AR1B 1BLNA 3NPSC 1ZK5A 3OJMB 3HFMH 2WM0A 1D5BA 4ZT1A 4X4ME 1XL6A 3VFNB 4IRJD 3O9WB 2J2ZA 3US1A 4HJ1A 5CEXA 3FHAA 4PAZA 3KM2A 3O2VH 3SO3C 1KCVH 4ZBJA 3FPXA 4UQAA 2PETA 3ULVC 4QRRE 4PJ5D 1J1PL 3PGCB 5TE4L 2F74B 3RTQA 2ICCA 3TV3H 3Q13A 3KGSA 4XVSH 2NNFA 3QXWA 3WTSA 4TRPL 5AW9B 2BRRL 5IBUG 5CP3H 4L0ZA 5SX4I 4DP0X 2YXVA 4ABVA 3IDIA 5EF1A 1ZLSL 3LKRB 3NIGE 4IYKA 4PRPD 1SM3L 3DVNB 3HI6H 4GBXB 4UIMA 5KZCB 1FVCA 1NUFA 1EH9A 3X11A 2XDHA 4JGNA 5J1TC 5C0BD 2NCMA 3F7VB 4M29A 4JHWL 3NH7H 4S0TD 4B5ZA 1Q4NX 1BZEA 1DYZA 2VXQA 3LRHA 4WY7H 5BRZB 4AGOA 4UINH 4YHKL 3ZYIA 4AEHL 4TYUA 5F7MC 5A6IA 3HZYA 3E8VA 3REWA 2X87A 1EAPB 2V8LA 5K9JL 4U1SA 5KVMC 2P8MA 3GRWL 3CU7A 2O61A 1N12A 2HN7B 2UXGA 3B9KC 1D5ZA 3QWOA 1B0IA 3UG4A 4JE0A 5E08H 5CEYB 3VQLA 3BVTA 1FL3B 1OAUL 2ZKYA 3A4FA 3IE9A 3O4LE 4GRLC 2VR8A 5EC2A 43CAA 4BKLA 4D8OA 3OKOB 3FUIA 1JXJA 4IIQA 3AG3B 3BDBA 3E9TA 4DERA 3VFMB 3FQXA 1CXKA 4PG2A 2GB2A 1G6RL 4XPBH 2HLFD 4IKKA 5E6RB 2NQCA 2E9BA 1MF2H 2BNQB 4EN2A 2HFEA 4U1GB 3V0JA 4LSVH 4RGOL 1XF3A 2D03H 2PKDA 5DMIH 3F8UB 3QG6B 4JDTH 4AXWB 5AG9A 2V2XB 5M95B 1AO7D 1U58A 1GCYA 4YL4A 4L3EB 3RNQB 4TTDD 3SKJL 4AYID 12E8H 4AMKL 1PX3A 3JWDL 2VXVH 3QT2A 2V3EA 4H1LA 1U8MB 3B5GA 3TA3D 2ALWA 5DD5H 6PCYA 1MREH 4P5SA 1N8ZB 2CKNA 3OHXB 4FQ2L 4DKFL 3KPLB 4MJ5A 1NC2D 1ILSA 1XZ0B 4URTB 3QJRB 4HAGA 4LL4A 3TASA 2R1WA 1BREA 2J8UB 5GIRB 5C0CA 5EFIA 1U41A 4QR7A 2FNWA 3L6FB 3TH2T 1T1YA 4GO9A 4Y9EA 2RTTA 1CFTA 4LESA 3WDJA 4CNIA 2EC8A 3V79C 3QBTB 2OZ4A 1VFMA 3U6RB 3DTDA 5J1AB 3N9GL 3MGAA 1NL0L 2GJPA 5C86A 4HLEA 1OB1A 1NIEA 3CFCL 5EZLB 1ET7A 3CHXA 2JK5A 1EZVY 4KMQA 3VW3H 4W4OA 3QJHA 4JN2A 1O9VA 3ZL1A 3P4LA 2M1KA 4L1SA 1J8HA 2YQ3A 5BVJA 1MI5E 3F7VA 2ITDA 4XE5B 2Y7MA 1DTUA 3E2HB 4OZHB 4RH4A 3CFKA 5CLYA 4BA8A 3T2NL 1TQBB 2QVTA 3FO1A 3RY4A 2NY7H 2AAVA 3RB5A 3KPNB 4P8QA 1CYWA 5FHBL 4ELMF 3C8KB 3KNBA 4PJHB 1HZLA 3KXFE 2H0FA 5INDA 1OTUC 4MMXC 1MY7A 1G7HB 3BOVA 1T1ZB 5MENB 1ACYH 3B6SB 1Z3GL 4OFVA 4U1JB 4LSDA 5IR1B 5T3XE 1ECYA 4GP4B 3GYRA 5CN2A 2OJEB 1BD2E 2WO3B 1XEUA 1NJ9A 5TDPB 4GG6A 1M7DB 2P5EA 5C3LD 4JPKH 3H9SD 3HI1A 4KVNH 4RNRB 2Z4QB 4M5SA 4UTBL 3T9WA 1MQ8A 2R0ZL 3IS1X 4G8FA 4PW4A 4QY8A 2EIZB 3G9AB 1P0SE 3QNYA 3MCKA 4K07A 4S1QH 2VIRA 1ZHKB 3FO9B 4GW5A 1QWUA 1GAFL 2Z7WA 3RP1A 5IW1B 3ZUNC 4ZXBA 3LXCA 3LEXB 1RP8A 4CGUB 4DGWC 3VFTB 1D3CA 1ZHBB 3SQBA 4OD1H 4HEME 4Y2DC 3K5RA 3E3QC 3RJOA 1QNZH 4ODXA 1BW8A 4YDZA 5ID1A 2ZT9C 3QUXB 4UQEA 2B3RA 4LPXA 1CDUA 3BT0A 3TWCL 4F7TB 1JHKL 3NRFA 2FR4B 1N70A 2CALA 2V9QA 4FZ8H 4G1MA 1UACH 2O6DA 4QLWA 2WWMC 1AD9B 2XWZA 3BYYA 2WINB 2J12B 1MAKA 3BT2H 4K3JL 4P3CH 4P5RA 1QATA 4OLZH 4X4KA 1RSYA 4EUPH 4X83A 4AQEA 1W72B 1IJ9A 1K4DB 5DEFA 1NDGA 3TYFB 4LQFL 5TQ0L 2OAAA 1NA8A 1C5BH 5JW3L 4TNWF 3IDJB 4RAUB 4KK9D 3V5KB 3L1EA 3ROOB 3GJFK 2IWGA 4Y5VC 3QJZA 4WWKA 3D3VE 1AI1H 3GM0A 4OZFB 1BJ8A 1DDTA 2VDRL 3O3EB 1BD2B 1B0RA 1QSFE 3MRKB 5DK0A 1G9NH 3C8KA 4NUPA 4QO1B 4GSXA 4M9OA 4JFFA 5E56A 4LCVA 4K2UL 5ICYB 1XF5B 1OAKH 3AT0A 4QTIH 3TFKD 1MRDH 2VL5B 1G1YA 4F8PA 4KQ0A 5AB9A 1HHHA 3FO0L 3NIDF 4MNGB 5AVWB 4KH2A 2F1AA 5IKCB 1RZPA 3TV8A 3RU8H 5CAYB 2G2PA 1X5JA 1EFXD 5EBLA 3VXPB 3O6MH 1TU2B 3I6LE 1F6AA 3ZE0E 1Y6KR 4QUOA 5TDNA 5MEND 4GRLA 4IBWA 2P5EB 3ULAB 5J57B 2X42A 4N68A 3MUHL 3ULVF 4MJHA 2SEBB 3VXOA 1W0VA 3EXLA 1ONQA 3ARED 1XGPA 4IDLA 3E6HB 4WSKA 1X3DA 4S1SL 5GS2D 3OWRA 5GPRA 1L4IA 2CHDA 4TQ8A 5HGDB 2XY2A 4XN8A 3SKUD 5H4ZA 1DJIA 4DAGH 4P59H 4Y19B 3B9EA 4PY7A 2EDQA 1MHCA 3NJMA 1WS7A 4GO8A 2FL5A 4FQCL 4L4VA 3LCYA 5I5IA 5T1DL 5C0GA 4LSUL 1KPVB 1U95A 2O6EA 2WWOA 3O45A 3S5YA 3ZTJG 3P3SA 3VXMD 3ESVF 4X8CA 2JNZA 5J11B 2IWEA 3EADA 2XTSA 4XNQB 4HBCH 4TSCL 3IFPA 4NDMB 3NSXA 3FUHA 1VKXA 4MQSB 1N6QL 1CFQA 1T5WB 2YUXA 3ROLA 4C59B 3HC4L 1FFOB 1RURL 1UXMA 3M07A 2H6OA 5I5MA 4M8QA 2J1KA 1E27A 1H5BA 2D73A 2GVYA 3L3OA 2ZICA 4U1MA 5IHLB 1AHWB 1WD9A 2DQFB 2BVUA 5AWNL 1HIMH 1RJZA 5DMGD 4YHPB 4KX8A 3LXBA 4JCLA 3RWGB 4XPBL 3X1FA 3SQRA 1HHGA 2YPKB 4MRCA 4QMEA 1RURH 1KEGL 5BS0E 3BD4A 4FYSA 3WEAA 1PKOA 2VUOA 2MSPA 1RPQA 5AW4B 1ZDSA 2YUZA 3QFDA 2MHAA 3QUYA 4CRPA 1L7IL 1KB5A 4PV8A 1SXBA 4XPGL 2E76C 5SWSD 2BCKB 3I6GA 1GW6A 4JRYE 3O4LB 5FV2A 3M1BA 1C12A 1LO4H 3HRPA 3IDMB 8FABA 2OL3B 2E8YA 2V7NB 4IRSA 4Y5XC 3BXNB 3LHAA 4N0UB 2M83A 3D39E 3Q6GH 4I18C 2FB4L 3KPMB 5DS8B 2JMRA 1P84K 4JFDA 4XP1H 1EEYA 4TRPH 3HZKA 4D3CL 1I8KA 2C9AA 2GJ6A 3BAIA 4PREB 4U1IA 2VDNB 4E41D 2GJZB 4I13B 3ZT6A 4JS7A 3BKCH 3CFNA 4NP9A 4GRWH 1YYMH 4F80A 2QVKA 2YPLA 3KLSA 3QIUB 3BE1L 2WSPA 2WTPA 2CHNA 2LTQB 5T1JA 4NN7C 3U82B 4J8QA 3LEYL 2EUVA 5ANME 3OAZH 3FB5A 1UOWA 1IIIA 1Q0YL 4U7MA 1M57B 2M8XA 1B3JA 2PO6A 4NAJA 4OIBA 5JHDB 1GTFA 4G9FE 1Q0EA 4M6NH 3QRGH 1AQHA 4G83A 5HI5C 5D2LA 2WLIB 2AQTA 4XBPB 3KMDA 5FO2A 1B4LA 1T1YB 3UTZA 4HETA 3NDYE 4DW2H 5G4MA 4CA4A 3ZN6A 2R9HD 4XOAA 3D7PA 1FZMA 1PGRB 3MROB 4MAYB 2VLJD 3UAFA 3JV6A 1KTDA 1CFQB 1T5WA 1ZT7B 4UMSA 3U46B 5C07E 4DGUA 1H9VA 3QPXH 1F41A 3X13B 1ORQB 1NQBA 1S9YB 1YYLL 3L1OH 3ETSA 4A2DA 4FQ1H 2VE6B 4KROD 3ULUE 1ZSDB 1OCCB 2WYIA 1QFWM 3NEXA 5FYJU 4WW2A 5GJSL 3C75A 1UD8A 1B9KA 1QTYT 3C60B 3PDGA 4HV8B 5KVFE 3CLFH 2E56A 3S35X 1NC2B 2IV8A 2X0WA 4OF6A 4FA7B 3F7YA 1AAJA 1LP9B 3QUMA 2LW3A 5KVEL 3AUWB 2CD0A 1FCGA 4R97C 3L4CA 4XXWC 4G6KL 2X1QA 3MV9D 1A5FH 1IQWL 1DEDA 2W88A 4ZO7A 1P6WA 5MP6H 1AOZA 5CCKH 3EOTH 4JY4A 4UMGA 4Z76B 1ANUA 1KBWA 1X7QA 4Y4KC 4BFRA 4XN5A 4U2ZA 4KNQA 1FE8H 1NUDA 4WV1C 3UJJL 1E28A 2IGLA 2ZX8A 3EJZD 4BBWA 2DZEA 4MKMA 3NRQA 4OSUH 3WNMA 2R2HB 1SJEA 1SOKA 3NOIA 3A21A 4IK6A 1NEPA 2EIDA 2BHFA 1J9TA 2EDEA 4YWGL 3CHOA 3BZEB 2JVUA 4XAKE 2ADGA 5C9JB 1ZVNA 5GRVK 2ADIA 4OBRA 3BP5B 1DUYA 1S7RB 1SXZA 3PWJB 5I8OH 3K6FA 1PW3A 1UJTA 1KYFA 1ZEAH 4KVPA 4N1EA 4K94L 5ESAA 2PP9A 1U8JA 2A9NH 5DWUH 3RX9A 5HHQA 3B9KB 3V4PB 2ZG2A 3HE7A 3QIWD 4OLYL 4QJ3B 2VLKA 1IEAA 2R59A 3ZE2E 5IFAH 4XTRD 4Y5YC 5DHYA 2J6EL 4JPIB 3N50A 2UYLA 4WHTA 1QO3A 5EZOL 2WBJD 2HLFC 2XV2A 2Y3NA 3HE6B 3GSOA 3D2TA 4I5BB 4D7BA 1AMYA 2WMPA 4PBDA 4CVWA 4A63A 1RL1A 4X7TB 3F62A 3QFJB 2BIMA 4ZAKD 1M9SA 3OGCB 3ARGA 1E9OA 3MR9B 4HH8A 4XNXH 3O2DH 3WY2A 4GUOA 5AB0A 1E4XH 2QZQA 3WFDH 3BH8A 4I0PB 1QBBA 3MV7A 4Z7OE 3CN4A 1Z1WA 4X4ZA 2JIXA 4YDNA 3X3FL 4GG8A 3Q43A 4HWBH 4HSCX 1JPST 3FPYA 4JRFA 2K3HA 5C0BE 3IRZA 5LN8A 2YJQA 4NQDA 2G75B 3B1TA 1XGYH 2Y22A 5ESVA 2XHNA 4G8IA 1MCPL 4ZRGA 2E4TA 3V4VA 2HUEA 4JR9L 3EOBA 3VXMA 4JREB 2HKAA 2WPGA 3DXAD 4QT5A 1WAEA 2IO5A 4IK7A 1BCIA 1R5VB 3ES6B 4LCWD 2DYSB 3MV8B 4AJWA 3KL3A 4RIRB 1JZ5A 4OCSH 2E0PA 3E7JA 4P3WA 3V0EA 3ZDZF 4W81A 4KTEL 4Y88A 4DN3H 1MCEA 1T1XA 2A9BA 4UM9A 6PAZA 2H2SC 3RYMA 5KSAD 1XEDA 4HT1H 4NFDA 7FABL 1YNLL 3CN0A 4HS3B 2VXTL 1E4KA 2VITB 1RIUH 4TOYH 2PXYB 2HT3D 3RTQD 3SE9H 1YEGL 1HVXA 2HFTA 2Q86B 2WUCH 1E8ZA 3HNTH 4LGPB 5HDLA 5K33A 3TJPA 5GQBA 4G9FD 4Y9GA 4I0PD 2E59A 4Z0BH 3S8WA 3IXAA 2ZCKL 2C1PB 2GAZB 3NCYP 4PG2C 2P28B 4YBQD 1OP3K 4APXA 3BX7C 4D9LH 4GIPD 2Q2LA 3JTBA 2UXFA 4JFPB 4MBOA 3QFJD 4WTXA 3X12B 3PIQA 5ICXA 2F68X 2NR6C 2WOBA 3CH1A 3T0ED 3MVSA 4XNAA 1Z2KA 5KBKA 4FG2A 4BZ1H 5CEZD 4OM1L 1NGYA 1OIOA 1GPOL 2BNUA 1RK1B 3BCFA 3QNXA 4ODTH 1H8OA 3IAPA 5GRWA 3WJMB 3VFOB 4KXCA 3A6CL 5A2IH 2EO7A 1SGKA 4LLAA 5I73C 4MGXA 2XN9A 2PYEB 1QLEH 5DUML 4NQXA 5JHDD 1BM3H 4PEEA 1HXMB 3C6EA 3KCPB 3LN5B 3MHZA 3RZCD 1FUNA 2XKNA 1CZ8L 4GY4A 3NJNA 1G7HA 4U6HA 3ZKMC 2AJYL 4A55A 2AJUL 2WXRA 4BSVA 5EUOE 1I9IL 1P7QB 5E6SB 4DVBA 2FECL 4DETA 1TVBA 3IFNL 3HIZA 3NZHH 4N85A 3ZE1F 4ABQA 5J9PA 4GFTB 1ASQA 3QARA 4GKZA 3CBJB 2HTLD 3SYAA 4LVEA 1I3RA 2O5YH 4YPGA 3CBKB 3MRRA 3IAGC 4FNUA 3NFNB 1SFHA 3BLKA 4FNSA 3QZWA 5IGXL 3MFFA 2D7NA 4LPTA 3BZFA 3C60C 1QX1A 4HKZA 2HT4C 5EOCJ 4Z3IA 3DGGB 4M7KH 5EORL 2CE6A 2FT6A 5TH2B 2HH0L 1GMIA 4X2UA 1NOFA 1T7ZA 2EE0A 3HC2A 4GEIA 4JFHD 1RY7B 4XB3A 4MS8C 1O0VA 5EZIH 3INOA 3TCXA 1Y6NR 1LEKA 3UX9B 1D5IH 3IKKA 2VC2B 2XN1A 1EEYB 2R27A 5J13B 2VDMH 1J11A 3EH4B 5T8IA 4XP5H 4KY1H 3DVGA 2YKKA 5T5FA 3S36L 3SSGA 1RZIB 3TN0B 2C3XA 1IAII 4M5YL 4NI3A 2WUBL 1IAIH 4KDVA 4LBEB 4EDXA 1AC6A 3LQAL 1EZLA 3CVIH 4UAHA 3BD3A 4GEJA 3MLYH 1T20A 1L5GA 4PHZA 4YGVA 3VXUD 5GRZA 1CCZA 2EJ1A 4YHZH 4R5TA 3MCG1 4PCTA 3I50L 3X12A 4DKTA 2YGNA 4JFED 2XN0A 1IAOB 5CLXA 5IF0B 2OCJA 3F5WB 4ZMZA 5ETUB 1FC2D 2DAVA 3RZCC 2DMCA 3ILQC 3CZLA 1RK7A 1KGCD 1CGXA 2WV3A 3RWFA 5HI4C 1XIWC 4CN6A 1S78C 2NW3B 2JCCE 3RLSA 5A2KH 3SKOA 1PZSA 3T0BA 1WFOA 1XF2A 1YA5A 5CINL 4BZ2H 5D6CB 4IBVA 2VAJA 2HX7A 4DZ8B 4QIRA 1ZLWH 2YAEA 1TQVA 4FJ6A 2DJSA 4DN4L 3IGUA 3N42F 1AQDA 2DKSA 2ICWA 5E0QA 5SV3A 1UM6H 3MKKA 2ARJB 4QHLA 1AE6L 2H0PA 5INCB 1GIGH 2WB7A 1QASA 3O2VL 5C1MB 1SN5A 3WNOA 3HJ0A 1TFPA 5CMAA 4GP8B 2XX0A 5LB1A 4Q9CA 3HC3H 2R9HC 3V4VL 3B1UA 1FQ9C 4XNUL 3KPMA 4UB0L 2W5PA 5DRNB 4G71B 1PG7W 4QRUA 5D72H 2LFGA 5J6SA 4FTVD 3JV5A 1FAKT 1RUKL 3BZ4B 2A9CA 1MUJB 1UQSA 3DX8B 3EFFB 3TBCA 3J2PA 3V5DB 2VLRB 1M2VB 5C0AA 5E8OA 1VFAB 3CSTA 2MNJB 4R7NA 5T1KD 3RY6A 1H15B 3A4DA 1NIDA 1WWWX 3MRDB 4PI0A 4L4VB 3ELQA 4TLSA 3ALWA 1ADQL 3S7GA 5IY5B 2MKLC 5D7JA 4AVIA 4FZEH 2AQ1A 4ZFZA 5D7IE 5GJTH 1BXUA 3MJ8A 4HUUB 3SBWC 3HC0B 1R3JB 1QSFB 2NT0A 4AQAB 3GI8H 4U49A 4QHNA 3OKOA 2WLIA 4KI5C 2ISDA 4OZGB 2FO8A 4J2XA 3JWDC 1KJ3H 5L6YL 4M5ZL 1Q1JH 1H5BB 2DWDA 3AACA 4U1MB 3VD0A 5DK2B 1UA7A 2CCLA 4QCIA 3GHBL 4YHLL 3L6FA 3SY0A 5EF0A 2AQPA 3WE1A 1QQDB 2YN3A 4HULB 4DP4X 5DHVH 4WEMB 1JNHA 3KYOB 4PB0L 1I75A 3G5WA 4UB0H 3TBSB 1P6AB 3QPQC 2EUXA 4IBUA 5GZND 4MWFB 2P8LB 3I9PA 1UWEH 2ZUYA 3KD4A 2BY0A 2VXQH 1KJMA 5BW7A 1M3IA 2PCPA 5IBLC 5BO1L 1WICA 5ICUA 4KKCC 1JERA 1SEBB 4L2YA 3O8XC 5E4OA 1OAJA 4JGJA 4Q58C 2EYSB 1ZGLP 3GB7B 1K85A 4IRSB 4E5XA 3WN6A 3HG5A 2P4AB 4N22A 3FO1B 4HS6A 4FMKA 3T3MF 1OCWL 4AT6B 1CS6A 4G43B 1XR9B 3A3YB 4IOFC 1NFIA 1X7QB 1Q72L 1UHVA 4B9FA 5F1OB 4XNBA 4L3EA 3RNQA 4YHIA 3QIUD 4P9HL 1DJYA 3QZLA 4H8HA 2A0LD 2DQTL 3U9PL 1M71B 1OY3B 1EJ6A 4FQLL 2YSSA 3AWEA 3Q48A 3UBFA 1V3MA 4PRHA 4XPHH 2K78A 2E46A 5B38A 1M7DA 1KSRA 1H6FA 5B3NA 5C0CB 2ESVD 4LT7A 2NY0D 5EFIB 5MENE 5CZVH 2OTUB 4N24A 1G6VK 2JI1A 2OMXB 4K71B 4FFWD 4Z5RA 5FB8B 1RZGB 4CW1B 1KJ2A 2UZYB 4WO4A 5CP7B 5DA4A 4KHXH 4OFYA 3IDYB 2P7TB 1A7RL 4G8GD 4F9PC 4M48H 4P23C 2YK1H 3VTAA 4J3VA 2BS71 2XN9E 4FX5A 3HOGA 5DU7A 3WJLC 3BRGC 3EYSL 3IDGA 5F7DA 2NLJA 2WVSA 1U36A 3C60D 4ZPTB 1UWXK 4I77L 3M86A 1AZBA 3BD5A 5K9KB 4TSAH 4QHPA 1N64H 4YOKA 5ICXB 1TETH 1XB3A 2ZXQA 2A6JA 1SYVB 4G1MB 4DP7X 2Q8BL 3CHPA 1ZVSA 3V0VB 3T1FA 3WS3B 4C55A 2PPDA 4YXKH 3FT9A 3IJ8A 2J56A 1WC7B 1N5AB 5EWIH 2RACA 4NIYE 4U6XA 43CAB 4BKLB 1LE5B 5DEGB 1KYOK 2IDUA 5JDSA 1CLZH 3FN9A 3AMKA 4HDIA 3MTXA 5IIEA 4OGXL 2WNWA 5HI5D 1UCBL 3REVA 1UA3A 1I8AA 4F93B 3P3UA 3OJVC 4H13C 4KJPC 2RMNA 3I9AA 3DX9A 3N1MC 4OGZA 4Z7QF 5BOPA 4KNTA 4XC1L 2Z0BA 3AVEA 2JTDA 2OP4H 1L0PA 5E4EB 3PXHA 4WTZA 4JFFB 5HHNA 3EZ8A 4EI5B 5I6MA 5IQ7L 4HUWB 1LE9A 3S88L 4YE4L 1KPRB 1RUMH 1MCWM 5DZOA 3JSSA 4HKXB 4PSRA 2G4GA 1FZJB 2HJFA 2W80C 3WCYA 2WZ0A 4H0IA 1CVSC 4LIQE 5T1KB 2VQ1B 2I9LB 3SKJH 2ZOLB 1W6WA 4GRLB 5MEOB 2D03L 5EU4B 2YEZA 1AO7E 1NZRA 2HH0H 4NO5B 1FHGA 4WIQA 5I1AA 2VLRD 4JFPA 4TVUA 4FNLH 2GUOB 1WZMA 5IG7B 3SCMA 3NCWA 3D0AA 5KVGH 2CJUL 2A2QT 3RWDA 2G3XA 4Q6IC 5A6LA 5D1ZB 2J1ZA 1BBDH 1J8HB 4UQ3B 5BVJB 4OF3A 3GS0A 2N1KA 5EEWA 5BRZE 2CO4A 3KDMB 1XX9C 4ISVA 3BH8B 3ILDA 3PQYE 3QDHA 2WD0A 15C8L 4NO0A 4BWUA 1EHXA 3RKPA 3GO1L 3UO8B 1MI5A 4BSJA 2AKRB 2ZWNA 5FHAH 5KUKA 1F4WL 4GUCA 1WGOA 1G9HA 3P3YA 4Q6IA 2H6UA 4GKZB 4EIBA 1WC7A 2XVBA 1KGCE 3GRWA 2WXMA 4FABH 1TPXB 5FIEA 5D70H 2DF3A 2PWGA 3VDBA 3D9AH 4NAQA 4I3GA 1IGCL 2EYRA 2O1AA 4WVRA 3GRBA 5B4MC 3MRLA 3O9WD 1Z9SB 3O2DL 4Y2LA 4CC0A 1DBBL 1U92B 2QTVA 4DHLA 4HIEA 5AAMA 1TSRA 2QKSA 4LPUA 3VMNA 1GY1A 3Q8FA 1A21A 2R2BA 1GR7A 2VLRA 3DYPA 5B8CC 3TIEB 1DLFH 2CGYA 2YGQA 1F4HA 4R4ND 4J6IA 4M7LH 2IH3B 1QUNA 3FT1A 4QRUB 5HXMA 1XH1A 2AI0H 2N7SA 5CCJA 5LXVA 1AD0B 1ND0A 5GS1B 1E9QA 5F9WB 2C1PA 2GAZA 2OXHB 4AYGA 3LPGA 5HYSB 2KDYA 5FOBA 1KCRH 1A9EA 2I9LA 4F2MA 2WVVB 3C5ZA 2MCPL 3NABH 4Q4IA 3SGKA 3FB8B 3GDCA 4XCFL 2Q6WA 3L1FA 1LO3L 3ARFA 3VD9A 3A23A 4BEIA 3O2WH 4Y1AB 3SDCB 2YXWA 4ZPVA 1E3FA 1EBPA 2YZ1A 2X7LA 5HGHB 4L1TA 4OGYL 1L7TL 2OTWA 4HU8A 5KYYB 1JWUA 4GKSA 1OSZA 3FK3A 1UWXH 3NQKA 4NJ9H 4F3FB 4NUMA 1SHMA 4LXFA 2OZNA 4DEPC 3HMXH 3C5ZC 4IGBD 1KCLA 3DX7A 1PIFA 4HJGB 2X6MA 2V3FA 1D7DA 4XHJC 1JF1A 1UUSA 5CUSL 4GINA 2V2TB 3RGVA 2ICES 4JCWA 3AU0A 1G6RA 1YPZB 4LRIC 4O02B 1RSFA 1U0QA 3NFNA 2ICEB 4MSWB 3MYZA 4O58H 5AVYB 2AJ3B 3F65A 4PJBE 1S9XB 3TCLB 3QIWA 1CE6A 1DBML 2YRZA 3J8F7 3OXSA 5L2KD 4YSUA 1GS8A 2A4ZA 2A74B 5EF3A 4OZ4B 3ARBC 2H26A 2BSDA 3QEQE 1PZCA 3A6BH 1UD2A 5HHOE 3HVNA 4RGNE 1E5AA 3KH3A 2E4FA 2EYSA 1Q9LB 5BRQA 1B2WH 4MJ6B 4ZG1A 4ABUA 1B4RA 2DBLH 2BERA 2GQHA 2WQUA 4HUMB 2BIQA 4EOWL 1NBVH 1OXYA 2XC8A 5KTEH 1HH9B 1JZIA 1W72L 2W91A 4XNZC 1ONQB 1OTSC 1A6ZB 3FTZA 2EVHA 3UL4A 2J1YA 4LL1A 2WLLB 4D0CA 3H42H 3PXJA 5IB4B 4XB7A 4Z7OF 4XNUH 1NWPA 1YEEL 4JQIH 4PWFA 3QDJA 5DS2A 2CMRL 2OZ4L 2QHRH 3QQ4B 4LLYB 4E9LA 5GS0D 4DOHE 1RJLA 4P2OD 4F9PA 2LU5A 1UZGA 1DVFC 5EORH 1D7FA 1TENA 3EF4A 4PRHB 1Z66A 2EO1A 1ZCRA 1ICTA 4Z7QE 3VMOA 4XPTH 2PO6B 3LXUX 2AXFA 1OPGH 2ADGB 5C9JA 4CILA 3QUMB 5ETUA 2Y36H 1AJ7H 1EHLL 2XTJB 3N41B 3B2PA 1R5IA 1NCDL 1IQWH 2B15A 3VRIB 2VDKL 1O5PA 1TQWA 1QEWB 4CC4C 1FNGB 2KZWA 4XX5A 2EE9A 2XXMB 1FL3A 2Y69B 1BZ7B 1MH5A 2IADA 1YN6A 1FZKB 3CFDA 3P30L 3P4NB 2YO3A 5EOCL 1U8HA 4FQJH 2XN9D 3L3KB 1KNOB 4X5LA 1ORQA 4X50A 2VZ1A 3FB7A 4JPIA 1F00I 1ZA3A 2VM4A 2GSMB 1IC4L 4PLNC 5C0JB 5I1LB 2DYRB 4DCQA 5BZXA 2ZJSL 1AIFB 1KFGA 4Y5VB 3U4AA 3QFDB 1D5RA 1KIRB 3B8YA 2Z6FA 1Q90A 3P9MA 4LF3B 1A0QL 2R56H 4KBPA 3WI9A 2X4QA 4HJUA 4MA3A 3JTTA 1VGKA 2O5ZL 3MLSH 3RIFF 4GAYB 4NNPH 3OKNA 5TFSL 1TQSA 5JDJA 5EO0B 4YJZL 3AS0A 3BP6A 2SODB 1BFTA 5ACZB 1SYSA 3OXSB 3BEVB 4YAQB 4LLMA 4AZ8A 2HVJB 1R3IH 4PRNA 5TGBA 2OMNA 4QNPE 2DQCL 5I6XC 2HZHA 4JRLA 2ZSVB 4BA0A 3WD5H 4OU3A 4CVXB 1HEZA 1AMXA 3IKCB 2IEPA 2B7DT 4NM8H 2XA8L 2H3XC 5DTFB 5K9QG 4HVBA 2X9XA 1QSEB 1T4KA 3LKOB 5IMMA 1EDHA 3NJXA 4N5ED 4PJEA 3DX2A 2PW1B 3L4UA 4NZ8A 3TOPA 5T1DH 5E1AA 4JG0L 4Z8FL 1LK2A 5IB5B 2P43B 3MJ8B 3ZZQA 3FT3B 3ZJAA 4UZSA 2ZZUT 3ULUF 4EDWH 1HZKA 1T0NB 3MBWB 4KC3B 5CFHA 2JKTM 5E9DE 3QJHB 1J10A 1SNRA 2MIZA 3QUZB 4LVHC 4O00A 4P9HC 4PJFE 3RDTC 1OAYH 1SLXA 3AABA 1I8MB 1ZJBA 2JQZA 5DJ8A 4PCYA 4FRWA 3U1SL 1S9VA 5CN1A 2QMJA 3VFUB 2H7WA 1DQQA 4TSBH 5TK4A 1HZHH 4UCFA 3BVNB 4FOMA 3V52H 3ZZ1A 4L9LB 4L8SC 4E41A 2IQ9L 3WYRA 2BW4A 1ED3B 2G60H 1K8DB 4YDIL 1GJUA 3BEWB 2Z7UA 4GJTB 4M00A 1AZCA 1VA9A 4WU7A 4FP8L 5ITBL 1RUAL 1OLZA 3JV6B 3HN3A 4DTGL 2G5BA 3DX1A 4XBGB 5DEFB 3L3HB 2ZQKA 3KLKA 2YAHA 4ZFGH 2C9UA 2JQMA 2V7HA 4KKZA 3QCTL 4PJ6A 4NHUB 3L3IA 1CI3M 1ZV2A 1CICB 1JTOA 2YPVA 2PCYA 1G1CA 5JMRA 3L3KA 4HCRL 2B77A 2DDQH 3TBWA 5BXFB 4HIIA 2QGEA 1MCOL 3O8XD 1RH8A 2VLKE 4N2AA 1AACA 2AP2A 3V6FB 4H44C 2DI7A 4TQHA 3W82A 1QSVA 5ABDE 3GNMH 4YDMA 3KWUA 3Q1SL 2VDPL 2A74C 4PJBB 2FHCA 3U7YH 3VSVA 2H47C 4L3AA 3NPZB 5GRUH 3S0PA 1F11B 3Q06A 1BQKA 4HUVA 4JG1L 2FEJA 4K7FA 4LSTL 4AKQA 4H8WL 2XA3A 4IU2B 4PJ9B 3UBXG 5AAWC 4H20L 1JFQH 3Q8AA 2DQHH 3UAJC 3WMPA 3SE6A 1LVEA 4O4YL 3ULUL 4KRLB 3C5XA 3UGUA 2Z4TA 4ZFQA 2JB5L 5FEBA 1C5DB 3EDDA 2CRMA 3MMEB 1LO3H 1U21A 5T1LD 4F7TA 2F7PA 1ETA1 1H3XA 1KBVA 4QRTA 4AGPA 1B4JL 4MZ2A 3GRGA 3W38A 2XZCH 5D1XC 3PNRB 4NZJA 1BZDA 1XGYL 2PF6A 2B2XL 4QKXB 5IB2A 3E6FB 2QQKH 3ISYA 1NFAA 1XCXA 5GGUA 1P2CA 4MBRA 3GFUA 1EO5A 4RFOH 2IH3A 3GZKA 2D7OA 3FUMA 1CFMA 4UNIA 4JO4L 4Z77B 1YUHA 2AK4A 1BXAA 3LY6A 3EJTA 1I1YA 3QW9A 5F89B 2VWEC 1QACA 2QPFA 3HG4A 4X6CB 2A9DA 3GSOB 3KM1A 4Z7WF 3CDFA 4NQEA 4Z3FA 4IRZL 3KWVA 3AS3A 1H0DB 1KULA 1PD1A 1A8ZA 1MIEH 3VWKD 3LYRA 2NOYA 4UAOB 3DX3A 4YHML 3ARGB 1INDL 3TU6A 4L8DA 4KI5E 5DZAA 3ZHKA 4B50A 4KKLC 1ZT4B 1C5CH 5CIPH 2NQ3A 1G7MA 5KVDE 4TVPD 3IJEB 4FQHA 3EFDH 4KTYA 4PV9A 4JFXB 1JWUB 2DEWX 3BUYA 1NLBH 1UG9A 2E9JA 3DIDA 3HE6D 2Y7LA 1HDMB 4M6ML 2OI9C 3DX9B 5FYJL 5PCYA 4D9RD 2ZXEB 3B7UX 2VLMD 5HJ3A 2VXUH 2CHWA 3V4VB 4PJDE 2D9CA 4V2BA 4JFYA 4JHZA 3MOBH 4PR5B 3FMGL 4XXDB 1W0VB 3EYFB 1A25A 4EDXB 2A83B 2AJ3A 4RAHA 3CBRA 4QYOB 1QRNA 3VTMA 1KIPB 4UT6A 1ZWIA 2ICWB 3MUZ1 4ILDA 4NZTL 3GSNB 1OCOB 1A7PL 3ZHFA 2OJZH 1KLUB 2ORBH 3IJ7A 3UZVA 2ADFH 1ZHNA 1N0XL 3KPSB 3NSJA 4KX7A 1M7IB 4I2XB 1OAXH 1YC8A 3EXJA 5GSVB 4BQBA 1OTTC 1IT9L 1MIMH 3FNKA 1NCAL 3FUJA 2X2JA 2YPLB 4KI1A 2ZUWA 4NBYB 3CFUA 2AGJL 4YC2B 3ZTDC 4TNEA 5E8OB 2HG5B 4G59C 3O6LH 2VOTA 2XWCA 4KJQC 5ALBL 4N25A 2OPCA 2AXFB 1RZ7H 5FYLD 4IMLA 3T4YA 2JI2A 5BCAA 2PPAA 3NJFA 1KLGA 5ISZE 4M6MH 1CFSB 1Y0LA 3D18B 3OB0H 1TQCB 2B1HL 1WP6A 3UTZB 1KMGA 1TQTA 2AQQA 4OJAA 4HD5A 1ZPLA 3HEIB 3V4PH 1QSFA 2AEWA 3CZJA 1RLBA 3UH8A 3JVFC 4WK0B 4OZHF 4JFFE 1QP1A 5AYQA 3T71A 2BCKA 3I6GB 5C8JA 5EC1B 1MFAH 2FX8H 2WIIB 3RKDC 4E42A 1KC5L 2J8OA 1C08B 2XCMC 4HIHA 4Z7WE 3NYKA 3WGUB 1J0ZA 2APBA 2WXPA 3M17A 4MAYD 4MD0B 5MEQB 1H15A 2VO5A 1D5XB 3T2NH 3MJWA 1T0PB 5E00B 3MUGB 2YN5A 4KXAA 2WXKA 3FQRB 1GC1L 2YXMA 2KQNA 3HMXA 5JIQA 2F7OA 2GJ6B 3ZGHA 3DHPA 3B3BA 3UTQB 1C9SA 3VFMA 3V5HA 3FQXB 3RQ3A 1X4XA 1FVEA 4UIKL 1SEBA 3DWTA 3L3OC 5BRZA 1FIGL 3VD2A 4H0GA 5E6ZA 5HTSA 1FNEB 1QW9A 1PSKH 2XZCL 3CG8A 2L7JA 4L29A 2WSDA 3QI9B 4KTDH 5EOQH 4ENZA 2VDQH 4LHUB 5ISZA 3MJ9H 1MJ8H 2WN2A 4KKNA 4X7FC 5C09A 3UTOA 5HPOA 5JNYB 5TGBB 3IPFA 2CIKB 3IWVA 4JG9A 3UZEA 3WFCH 3WMQA 3U25A 2X2HA 3O6FD 1QQDA 3JVGC 1DBKH 3GKWH 1NAML 3BMWA 1IFHH 5CSZA 3FF7A 1RZ8A 3MNZB 4MRBA 4JY5L 1Z7JA 4G5AA 3PE9A 5IQLA 3DLQR 4XOEA 5AZ2L 2F74A 3RTQB 2ODHA 1BX2A 2J6EA 5I1IH 3PYCA 2A6IB 1ACZA 3UAJD 4Y4HB 5CKGA 5I1JH 4AYEC 3OXRA 3MRNA 2IWFA 4NC1C 1IKOP 5FXCH 4WNJA 4NXSA 1KCKA 4ANUA 4K7PX 4TUOB 4YDVA 2XIIA 4JFHE 3T5WA 1TJHL 3W0WA 4IRZA 5CM1A 5H35A 4RWYL 4L4VD 3H3PL 3WAJA 4X98B 4TVPE 3W11C 4QTHA 4Z7VE 5FCSH 1NOAA 3QK0A 2Y7QB 3DOSA 1CXFA 1JNHB 3KYOA 4KPHL 3ML9A 1X9RA 1WIPA 2PP7A 3LPPA 4OLVL 3GBLA 1W72H 3MR9A 4NKDA 1CDIA 3G9VA 4PGCB 4FTVB 2PCPB 4L4JA 3CSFA 3WXWH 1G87A 3NG5A 1BAFL 4PS7A 4KUZH 5DJ0B 3O0RH 2WP3O 2JSFA 2Q1EA 2BY3A 4PJ9D 3IN0A 3FTVA 5LDSA 1OT4A 4UV7H 4WFEE 5DUBA 5DWPA 1WWBX 2ITCA 3HN5A 4Q89A 2DICA 4PBWD 2VAAB 4XHQA 1KCWA 4CW1A 1AFVH 1WWCA 3N5AA 2BVQB 2YOCA 3S98A 5CEZL 3VXNA 3O3DB 4HISA 2XU9A 3MLWL 2C4FT 3QULA 4RMVA 3BUBA 3M45A 1J7VR 3ZL4H 3PWLA 1ESOA 1QLFA 3PL6D 3O8XB 1AJ7L 5I9QC 1CO1A 4HJJL 5E5LA 1S3KL 4ODVL 2F0CA 4S1DD 4I1PA 5I0XA 3EYQC 5JOFA 2ATPB 2OR8A 3HMWH 4PG9B 2Z4QA 2BOBA 2AANA 5GHWL 1S7UA 4W9JC 1OAQH 5T1MB 5I18H 1DBJH 1I85A 3TLRA 1T66C 5D7JB 3FQTA 2DEXX 1I53A 1P4BL 5IJDC 4HS3A 5F8QC 3ARDA 2YZ8A 3EHBD 4NM8L 5DO2C 1RZFH 1VPOH 2MTPA 4G5ZH 4LLUB 2XFGB 5FF6A 3AGVA 1QI3A 2R83A 3HE6A 4I5BA 1A14L 1CLOL 3DARA 4FS0A 4ES8A 5L9DL 2D7TL 2AS5M 3CH8A 1FDLH 3UO1H 1NFKA 5AAWA 3AWGA 4BWWA 3MO1A 3UTTB 4X7TA 2ATAA 1BVKB 1A7NH 1F2QA 1AR1D 2ZX5A 2XWBB 5EU6E 3F6LA 3PFQA 3T8XB 3V0FA 1D7BA 2NLJB 2WXOA 3GXIA 2FLRT 2AV1A 1N4XL 1HOEA 3KW7A 4WUKH 4F7PB 1T2QH 2BVPB 5D93C 1B6DA 3VA6A 4CMHC 5AD0B 4E0RA 1H6TA 4ODSH 2F53D 4JHAL 3WSQH 3QDMB 4X6CE 4IKLA 4N4YB 3EBAA 1PD6A 2XWEA 5JIIA 1BSIA 1UXLA 1IGIH 3HLKA 3SJVD 3CSPA 3ZO0A 3T8VA 1HCZA 1IGJB 4JFWA 4NZUH 4XAWH 2KL6A 4MMZA 3VXTB 3VQMA 1KBBA 1EMTL 1FIEA 4JFVA 1MHEB 4WI5A 2IIJA 3ZGIA 3HMXL 1I3RB 2WZPA 3AWFA 3DO4A 5DUBB 5I15H 1J05B 1EBAA 4WHCA 3MV9A 2IAMC 4LZKA 3VCLB 4PJGF 2PR4L 3F84A 3HNSL 1BP3B 2WJ7A 5LDUA 1A6TB 2H9GA 1CD1B 1DQVA 5FW6A 1KACB 1KTLA 1Q0XL 2CLZA 2X28A 4GQZA 4IS6B 3N06B 2WTRA 2MOGA 4RMSA 1F45A 4PR5A 5JIKA 3PP3K 3IRPX 1J8SA 2EIZA 1F4YL 4JM4H 1KXVC 1FV1A 1XGQB 4KDWA 1FNSH 3FQ1A 1LGVA 3DOHA 1FSKB 3EDFA 1KJ2H 2DIJA 1ZLVH 1M56B 3OL2A 1REIA 2FX9H 4A37A 4Y7MA 3PWPE 3LEXA 4JPKL 1PU0A 1RZGA 2DBLL 2AMGA 2CO1A 3JWDH 1GS7A 3POCA 4B41A 1GSMA 3UYOD 5AZEL 2MPAH 3QHZL 1E9PA 4DQAA 4P2QD 5EEYA 1IGFH 3ZMRA 3VWJA 5CWSA 1RUQH 4CUCA 1SN0A 2FJGA 1MY5A 3GNML 2Y72A 1PKQA 2R15A 3QS3A 5I9QB 4J1UB 4ODHL 3EDKA 1KDJA 3MLRL 3PABA 5DFVD 1NGPH 2LOEA 2X70B 3P4OA 4BSVB 3V9EA 4NCC2 9CGTA 5AKRA 1ES0B 5CJQH 1MN4A 2PTTA 3T1FB 4AQ1B 5EEUA 2Y24A 1QYGL 3BWUC 3HPJB 3HUJE 1U8IB 1UJ3A 2FD6H 4GAJL 4OF0A 2BVPA 3EJCA 4K9JA 5JPNC 1BF8A 2ZCLH 4EZLA 3RI5F 5I1DA 3RIKA 2R69L 3NZUA 3B9AA 1DANT 1Q9WB 2EE2A 1JZDC 4B5EA 3MPCA 5C0BA 1WUNT 3L5XL 4LLDB 4HCGA 3CPUA 2XZAH 2QTEA 2WK2A 4HIXH 1I7RA 2VKXA 3X3GL 2GCYB 2UY6A 1LJMA 4CSZA 1E4XI 4GW4B 5TF0A 4XMUA 2VMJA 4DVRH 4N26A 2ZX9A 4XNQA 2F54D 2YUWA 4I18A 1JRHH 5DHVA 3ZU8A 4HHAA 5DUPL 5E00A 1E6OL 1IE5A 1VCBC 4ELDA 1CLCA 3PQYA 2W60A 5CN3A 1LE9B 4MSWA 1CE1L 4NRXA 5CKAA 2CRZA 4HGWA 2BNRE 1V3LA 3H56A 5DD1H 4LOVA 1L3WA 3L08A 4W9FC 4OZ4A 1M05B 4M61B 3LRSA 3OPZH 4M8VA 4EDWL 1N2RB 1EUTA 2V17L 5JQ6L 1BF5A 4CN1A 3PRZA 3HG1D 1YQ2A 3E6HA 4B0MB 4XCEA 4XZ4A 3APCA 3MREB 2UWEA 4RMUA 3O6FC 3JWOC 3KPRD 2R4RH 3BISA 5D96C 3F58H 4XMZA 2IAMD 5E6IA 4TTDC 4GSUA 1DBBH 5EPMB 5DJ2B 2V0AA 1LMIA 1VKXB 2WLLA 4JEGB 4LBAA 4M6OH 2UZXB 5GRVL 5L7XL 1IILE 5BJTB 3ESMA 3K6SA 2AQSA 2X4OB 3P2BA 4BM7A 2HLAA 4CJ1A 4LLYA 3D4ZA 3JV4A 3ZDYE 1RAMA 4Q9BA 3O81A 5B22A 1BAGA 2I85A 3F01A 3QZBA 4S2SB 2XBTA 3LHPL 2ZYRA 3TC9A 3UDWC 8CGTA 3NA9L 3OJ2C 1A65A 4AL8C 2F54A 43C9B 3HNVL 4ZUVB 4OVUA 4MDJA 4OCXL 2B14A 2HRHA 4X9IA 1GH7A 2O6FA 1OM3L 2DV6A 3N44F 1ZLSH 2ZP0T 1AR1C 4MCMA 5D5MA 3QEUB 3AZUA 5EOCH 1JZ2A 3MLUL 4RCAA 2AW2A 1BBDL 4C4KO 4RRPG 4A38A 5C0BB 1VEMA 2GTWA 3WFDL 1U2CA 1XGUA 3NGBC 5G5DA 1CTOA 1QFUL 1ZA3B 3MRLB 4PJCA 5HYSG 4NNYA 3K6OA 1ZWIB 2IDSA 2ZP8A 2CQVA 4PI2A 1EK3A 3BLBA 4FNPA 4XVSL 4TUJA 4LCCB 4UDTA 1Z9OA 3PGDB 1R5IB 3QFJE 4MAUL 2X4RA 5JLZB 3MQIA 4H2AA 1J12A 3KYMA 1I3UA 4KO6A 2CR6A 5I24A 1E0OB 2HJLA 3BP6B 5ACZA 4IGBB 1LTXA 1I1FA 3T0AA 5IFAL 4CKVX 2GC7C 3WD5L 2BLFA 2TAAA 2VDRB 3N6YA 4KV5F 4XCCH 2QSVA 4B60A 4KOBA 3GMMB 2C3WA 1EFQA 2YEQA 5IMKB 3KBFA 1VZHA 5EU6A 4DK6A 2H6PA 5B8CA 1AIFA 1SUHA 3R06A 5ESQB 3PWJA 4NQDE 1YPZE 2WYHA 3BRDA 1WEJH 4I3SL 3N2JA 1RV6X 1GVIA 4IOFD 1U8OA 4PGBB 3G6JA 5DO8A 4NQED 3VVVA 4R0LC 4I87A 2XOTA 4NKMA 2JCCA 1E28B 1L9PA 4OFQA 25C8H 4TM9A 1CU4H 1TKWA 4F2EA 1HSBA 1V3KA 3MJGX 3L54A 3G6DH 2O6CA 2XN2A 3SDDC 4AEFA 3COOA 4JX0A 4BCZA 3MRPB 4ENED 5FA4B 1QD0A 2ZSWA 4G6KH 3D1MC 5CJXA 1ZA6B 1YC7A 3OC5A 2DLIA 4UBDD 5IROA 3UTSB 1PLAA 2OI9B 3MXVL 4XP6L 5L0QC 1KFAL 4DWHA 2BC4B 5D9SB 2ICEA 3EG9A 1BIIB 3OR6A 4AV4A 1U8JB 5HHQB 3EO0A 4P2RD 1KN2H 5FV1L 1CDBA 1NCTA 1T2QL 3LRLA 2IH1B 2YGOA 4JDZB 2OR7A 1SBBA 4UIMB 1JZFA 2PO6D 1RFDL 2WZ5A 1KFAH 3GUTA 3IJHB 3BKML 1J1XL 3RL1B 4Z3TA 1CMOA 5DMIL 2RFXB 3ZTNL 3OX8A 1BVNT 3D51A 2GSGB 4K5PA 1AC0A 1PL3A 5I1CH 1NCWL 2W59A 4PP1D 4YX2H 4M7JH 4YSSA 1DBAH 1DN0A 2DYPA 3QDGB 4KNUA 1WFJA 4MB3A 4QOKE 3BZ5A 4G8EA 5B7EA 1VADA 1A7BA 4TUKH 5E8PB 3ZBMA 3ULVH 2R2HA 1JL8A 5E1AB 1PDKB 3OD3A 3D30A 3N85L 3QRFM 1MAMH 5JYLA 4AGNA 4MAUH 1DO5A 5B1KA 1OAZH 2O5XH 3TS8A 1KLFB 2B3IA 2VQ1A 3QUYC 4NC2B 3P3RA 1RVFL 1J8HD 1DCEA 2BOCA 3N40F 2N01B 4HJJH 2IAMA 4K3HA 1JWMB 1IBGH 4YX2L 4YVNA 3NIFE 1DQQB 5J1SC 4MHHG 1X9LA 3ULUC 2PMZA 2C1OA 5F1NB 2ZAHA 3NQIA 3FOLA 4NXKA 3VRJA 4XP5L 4TNGA 1L0YA 3VE0B 1CIDA 2PYFA 4KKRA 4TPRH 2CLVB 3NCJH 4ZTEA 2LABA 2BP0A 1NTDA 3Q2WA 5FGCE 4G6ML 3D85A 4M7LT 4NP4L 4Y4FD 3FUKA 3JBG7 5T3XD 5C7ZA 3K6DA 2DIBA 1NPNA 2BDNL 1A4KA 2YFNA 3G5XB 3IMBA 4PS4L 4ISVB 2GJRA 5EDXA 5B7MA 3CVCA 1BAFH 3REVB 5JORA 2AFNA 3TO2A 1TQUA 3QXAA 4DZBA 3T3ME 3RVVD 2XFXB 3TEZA 1H3WM 4FQXB 5BQDA 1H0DA 1W0YT 3DURB 1A6AA 2R2EA 3H4HA 3PAVA 2EICA 4MCNA 3KPNA 1IM9D 1ZS8B 4L5FH 1FO0B 4X9YA 1FG9C 4OZIE 4UYPA 3O4LD 1CE1H 1NDMA 2BP8B 2Q76A 3ASWA 3NCXA 3O2DA 3QQ3A 4R84A 1BOGB 3T65B 3ABMB 3KWWA 1PZBA 3H0TB 2D31A 3HB3B 1TVBB 1FORH 2UUDH 2AAAA 2EDHA 3ZQ9A 2CBQA 4ZUSB 3WKYA 1OGAB 3CSGA 5BZZA 3F3HA 3E9UA 1UKQA 5GZOC 1KELH 2W60B 4EE2A 5HDQH 3OJDA 4M7ZB 3CQQA 2X9ZA 4B96A 3IJSA 5AEAA 5IOKA 1AZZC 4HC1H 2UWEE 2PYEA 4Y2DD 1PZAA 3TO4B 4JHUA 3HPLA 4JO1L 2AEPH 4F5CE 3T6QC 3KBEA 4UM9B 3BDXA 1LEIB 2CBTA 2GUOA 3K2IA 4H7VA 3LEVL 5D8JH 3GDBA 5ABZA 4NZFA 4Z78A 4GO6B 3NEOA 2AQRA 4BFEA 4R8WH 2VDNL 1J5DA 5IB2B 5KS9F 3L4WA 4QGYA 3MO1B 2E7HA 4NT6B 3EH5B 5EBWA 5C0ND 2WXIA 4IRJA 4Y2OA 1JZ4A 4ZNCD 4L9LA 5AKSA 2UZXA 4AGLA 2F19L 4S1SH 4HOXA 1QHPA 3KYNA 2X4OA 1LO5A 1NCAH 4NO0B 4Y19E 5IFJA 4HOWA 5KVDL 1JK8A 4OZGF 2YFOA 2R1XB 2QQQA 35C8H 5EPMA 1S5HB 4EAEA 5IUSA 3SE9L 2LV4A 1E2VA 3BDYL 3L3DA 2R7EA 3QDMA 4JJ5A 2BIIA 4AE1A 4WUUB 4UQDA 4EPSA 1RK1A 5AFAA 3AXLB 7PCYA 3K4DA 4N0YL 5IKCA 1FORL 3HZVB 4XP9L 3S5ZA 4AUYA 3VH8G 4XN2A 4O5LH 5DD0L 2O93L 3O6FA 3F5WA 4ZUVA 1T80A 2EDOA 4LIQH 4Y9BA 2XXGA 3KGUA 1KLUA 4JRYA 2FBJL 2OBGA 3QUMH 5KOMC 3UZVB 5CD5D 2JKSA 2EE3A 3LB6C 2YBGA 4MXQD 5IJCC 1FFQA 1RULH 4HUXA 4OV6F 4YK4B 1P9MA 3SPCA 5IROD 3EW3B 3H6JA 1YEIH 3LIZL 5C7XH 4CDGC 2GG1A 2PW2B 1YNKL 3M1CA 4XMLL 1DSFH 4XO8A 4MDJB 2K45A 4M8UA 4ODBD 3H1ZA 5I8CA 3HB3C 1KB9J 3BVVA 1YN7B 1YZZA 1TCRB 4A6YH 1AGCA 2HG5A 2ZKMX 3C8HA 4IS6A 1U8LB 3ILPB 4MLIA 2E7MA 1G7QA 1NDGB 2P9RA 1JHTB 1U4FA 4J3BA 5D1QC 5H2BB 1Z9PA 2JLPA 4RX4A 2WBWB 4QOKD 3B83A 3QRBA 3QWQB 3JT0A 1NCNA 4PLJC 2VB5A 4G8GA 2EABA 5KSAA 3SKOB 1CB4A 1CICC 1GGTA 1IBGL 3UTQA 1AQKH 4NOBA 2H2SD 1PZ2A 1TZ8A 3O4OC 5E9AA 4N2DA 3KYMB 5IQ9B 3CN2A 2WHVA 3GSVA 5J6HA 4UU9A 4ZUUA 1ZKAA 3MRDA 3ZO9A 3FCBA 3N40P 2FJGB 4J3OD 4N2OA 4BH8A 3LMJH 4L0YA 3KPPA 1RJZB 3OB0K 4UT9L 1JPTH 3M17B 4MD0A 1S7QB 1MHPL 4A66A 4J1UA 5BV7L 3GMNB 5F89A 3S96A 3DK0A 4AW4A 2KC0A 4L4TD 4NZRL 2ROYA 2XWRA 4WI0B 4IRJB 4M5TA 1DQLL 3SPVA 4WGWB 5DHMC 1WBXB 2CGZA 5GGVH 4UZUA 2G0KA 1NKGA 4N2HA 4PLOB 3BUIA 1ILUA 3IF1A 2HLEB 4HK3J 5E51A 3SDAB 4FXKC 1TTRA 2XVKA 4CGTA 4Q14A 4G5ZL 2J88L 4J28A 2BNQD 1IC7L 1N6UA 1U8OB 4PGBA 1G7MB 4U3SA 3TCLA 4B9YA 2ZUSA 8FABB 3TX4A 2Q8AL 1N0LB 5LWYH 2XV0A 2FWLB 4QHLB 5INCA 4OZGE 3LQMA 1FCCA 2BC4A 4JO3H 2FSDA 5D9SA 1Z5LA 4YK4C 1U8CB 2HVBA 4IGBC 3MAWA 3FAXA 3WTYA 5IQNA 3RWHA 4QHNB 1Q94B 2GK0B 1DDHA 3WIIH 3MA7B 4DGYL 3WTWA 3TONA 5AYUH 3BJ91 1N19A 1P53A 4CSSA 1J8RA 4NNXA 5H4YA 1MWAB 5IVNA 2X4UB 4PJHE 5IJBC 1KB9K 1WO2A 1MJ7L 2N0MA 1QFHA 1LD9A 2VLRE 1ADQH 3ARXA 1FN4A 2ESVB 1E27B 3FQWA 2CDFA 2RBLA 3HRZA 5T3ZE 4JRXD 4JW3A 3CX2A 3MTRA 4XNYH 5JZ7C 2Y06L 1AS7A 1A7NL 5AOJA 5BQ7A 4BK4A 4WFGD 2Y2YA 4XMVA 3KR3L 3PGFL 4AEIL 1G1KA 4G7QB 4L23A 1BWMA 3MACH 3P9WB 1F3JA 1XD0A 4ERSL 1ZSHA 2D0FA 2ARJQ 5JHLH 3VXUB 2EDRA 2EECA 3DVNA 2ATPA 1A7OL 1NCCH 1YN6B 2GI0A 3MA9H 1MKFA 5I8KH 4PS4H 2JKNA 2R39A 3GMNA 3QZPA 2JCCB 4LKCA 2YD3A 2BOCB 3SE4C 3ARDB 2W94A 4BD4A 1PQZB 4YVUA 3DVIA 2GSIB 3Q2CA 1QI5A 4JG5A 1JXGA 5HVHB 3SDAC 2EXYC 3QR2A 1QFWL 4QCIB 5EO1B 4F7EA 3ZIMA 4EN3C 1NGQL 4JZOA 1EO7A 1JDCA 3VG9B 4H4NA