3MBWB

Crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
127
Chain Sequence
DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 27
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3mbwB00
3ABGA 2J56A 1PLAA 1NIAA 2N0MA 3OMNB 4AX3A 3NJHA 1MZZA 4W9ZA 1R1CA 4HIPA 3ASOB 3FSAA 1A3ZA 2EIMB 1JZJA 4GP4B 3PCYA 5D4HA 5I6MA 4WKXA 4YL4A 3NSFA 1JZEA 1SNRA 3IN2A 4HAKA 3SBRA 1CC3A 2VSKB 3FYIB 2AVFA 3FSZA 2CAKA 3OM3B 4PAZA 4FA7B 5I6NA 4M4RB 2UXGA 2DV6A 4A2EA 1JZFA 1SDDA 2UXVA 3SBQA 3BVDB 4KO7A 2XLLA 3FSVA 2HX9A 8PAZA 1E30A 1SHWA 2XX0A 4KO6A 4AI7A 4W1TA 3CZUB 3FPYA 2WO2B 4UANA 4DP1X 3DTUB 2CBPA 2FQGA 3WIAA 3NYKA 4WTQA 2XXFA 3GDCA 2J55A 2NRDA 3NP3A 7PCYA 1GR7A 5PAZA 2YARA 1ZDSA 4GYBA 1YLBB 2DYRB 1VLXA 1WS8A 4YSRA 2IDSA 2IDUA 2UX6A 1TEGA 2XYBA 3OMIB 5B1JC 4QLWA 3V9EA 4HCGA 4BK5C 1KYAA 4K9JA 3AY2A 2FQFA 3NJFA 4G71B 2B08A 1OE1A 3CVCA 1E5YA 2YAHA 1ZIBA 2BP0A 1SJMA 2GI0A 1PZCA 3ASNB 3UAAA 2VW7A 2FT8A 1PLBA 1WA0X 2VSMB 4AKOA 3QJUB 5I5JA 2ZONA 4HCFA 3OMAB 1ET8A 3S3DB 2PPAA 4GP8B 1QLEB 4TXVB 1PZAA 3X1EA 4YSPA 4F7KA 4X4KA 1F56A 2CALA 3NSDA 2FWLB 1GY2A 3S3CB 2PPFA 2VW4A 3AW5A 1WS7A 2AZAA 4QKTA 1NDTA 2I7OA 3MBWB 4BXVA 4JHVA 2FQEA 4DPAX 2HLEB 2XWZA 4BDVB 1KBWA 5I6KA 1SHXA 4G70B 1AS6A 3SBPA 3EH3B 1JOIA 5B3SB 2IAAC 1ASQA 2BP8B 4BWUA 3S8GB 1M57B 2PLTA 1NIEA 2R7EB 4N8UA 4DP4X 5ANHA 3NJJA 3NJGA 1AG0A 3ERXA 3NJKA 4JHUA 1FFTB 2IDQA 1WA1X 3PAVA 2HXAA 1BYOA 3FU8A 4Q8BA 3FU9A 1CUOA 1AG6A 1OCCB 2IDFA 4E9XA 1OCRB 4NAJA 4DP8X 3QJRB 3JTBA 3WI9A 4MFHA 4F2FA 1OV8A 3TU6A 5D4IA 2PCFA 3UADA 5EHFA 3U25A 5F7BA 4KO5A 4DPCX 1J9TA 3NJNA 1L9QA 3MX0B 2H47C 5I5MA 1BEXA 3AG1B 1JZIA 1AS7A 4KOCA 1ID2A 3DKHA 1UATA 1DYZA 2FT6A 2P80A 4FAAB 3EH4B 3T71A 3TBCA 1QNIA 4F2EA 3TBBA 2CUAA 2FNWA 3HEIB 3IN0A 7PAZA 1W8EA 4G7SB 1PZBA 1A4CA 2IDTA 4BWTA 1AIZA 1MDAA 2ZXWB 1AACA 2PP9A 1HAWA 2WO3B 2DYSB 3T6VA 2XV2A 1GS7A 5I5IA 4G72B 1GY1A 2YAMA 2MTAA 2GB2A 1B3IA 4NERA 2YAPA 5FC9A 3X1GA 2GC7C 3QJQB 1GYCA 1KDIA 1A4BA 1J9RA 1MG2C 2Y69B 1WA2X 3QQXA 4YSCA 4UAHA 2YAEA 1L9SA 1W6LA 2VMJA 1V55B 5TK2A 1NTDA 3ABLB 1AANA 4KNTA 4KNUA 1PLCA 1OE2A 2I7SA 3CG8A 3PXLA 2AANA 4JKNA 1E5ZA 2MRYA 1NPNA 1SFHA 1BQRA 3NSCA 2FJSA 5TK4A 2HX7A 2VW6A 1XB3A 2XUWA 2XX1A 4HALA 4P5SA 2AZUA 3N2JA 1IBYA 4BWWA 1N68A 1PMYA 2VM4A 1OCZB 2GSMB 3UACA 1FWXA 5B1KA 1AS8A 3IE9A 2PPDA 1HFUA 3EHBB 2GIMA 5I28A 1BXUA 2OV0A 4GXFA 5I26A 2BZ7A 4AZUA 4N4YB 2XVBA 2ZOOA 3QJTB 3HB3B 4ENZA 3NSYA 4KO9A 1SF5A 5LDUA 4E9YA 3ZDWA 1J5DA 1GS6X 3H4FA 2Q5BA 3DIVA 1IBZA 3RYMA 4HHWA 5AZUA 3NT0A 4E9SA 5B7FA 5IY5B 1NICA 4A2HA 1NINA 1ASPA 4PCYA 1GS8A 3CVBA 3CDZB 3WNJA 6PAZA 1JVOA 3WNIA 1CYXA 3V9CA 1EHKB 4AKPA 2HRHA 1TKWA 4A2DA 2BO0A 1RZPA 5PCYA 1AZCA 4A66A 1IKOP 3X1BA 4E9TA 4BDVA 1NIDA 2IH9A 2GBAA 2FQDA 4A68A 1PNDA 4Q89A 1AAJA 3QJSB 4YSTA 2XV3A 1JZGA 5B1BB 2Q9OA 3FYEB 4NB7A 3GYRA 2DY2A 2GHZA 2BP8A 1MG3C 4A2FA 2FTAA 4P5RA 3AZUA 2R7EA 1BQKA 3NJMA 4E9QA 4YSEA 2UXTA 1M56B 2BWIA 1PNCA 3AG3B 1L9OA 1KBVA 1ZDQA 2FT7A 4G7RB 1ADWA 2VM3A 1SFDA 1L9RA 2YQBA 1JXDA 1QHQA 3UAEA 1T5KA 6PCYA 2YAFA 3NP4A 1ET7A 1BQ5A 3T9WA 1J5CA 2HZHA 2CCWA 2BW4A 3T6ZA 1XMEB 4CSZA 5I6OA 2BHFA 4AKQA 1BXVA 1AZNA 3C75A 2EILB 1ILSA 3S3BB 4E9WA 3EF4A 1E67A 1GSKA 1E65A 1AQ8A 2H3XC 2EIKB 3NJLA 5A7EA 1L9TA 5AFAA 1SDDB 2JXMA 1XB6A 4BXSV 3G5WA 3FU7B 2DWTA 3ABKB 1RCYA 2UXFA 1ZV2A 2TSBA 1A8ZA 3PAUA 3IEAA 1URIA 5B7MA 1IC0A 3OQRA 2E86A 1SF3A 1L9PA 4DP9X 1NIBA 2IWKA 2PPCA 1KCBA 3ZBMA 1AZUA 3S8FB 1AZRA 2QT6A 1I53A 1RKRA 1ETJA 4RH4A 1PCSA 2OJ1A 2DWSA 2HRGA 2QDVA 1KGYE 2TSAA 3AG2B 1A65A 1JERA 1JZHA 4YVNA 3FU7A 2H5UA 1AZBA 1BYPA 1NIFA 3SQRA 3KW8A 1BAWA 3FQ1A 4ZK8A 2W8CA 2LLNA 4YSQA 1NZRA 1TU2A 3X1FA 3IBOA 1FA4A 3L45A 4DP2X 4YVUA 2QPEB 3H4HA 1J9SA 2BP0B 3TA4D 2YAQA 2W88A 4DP0X 4YSSA 1PF3A 1OCOB 2RACA 4L0PB 3H56A 1EZLA 4DP6X 5B1AB 1TEFA 3BQVA 1JXGA 4YSOA 1JXFA 1XB8A 4EF3A 2XU9A 2IWFA 1AOZA 2QPDB 4A2GA 4DP5X 2BW5A 1KV7A 2JFCA 1KDJA 1X9RA 2CJ3A 2UX7A 2XV0A 2I85A 3WKQA 2OCCB 3FQYA 2PCYA 4YSDA 1V10A 4M3HA 2YAOA 3T6XA 3N55A 2J57A 3QJVB 4E9RA 3UGEA 2EINB 2YXWA 3FSWA 1V54B 2BWDA 4HZ1A 5F7AA 2WSDA 1KCWA 2IH8A 3ABMB 3D12B 5I6PA 9PCYA 3WKPA 4DP7X 3PPSA 2BZCA 1ILUA 1J9QA 1ASOA 1DZ0A 1M9WA 4YSAA 2EIJB 1CURA 1BXAA 2PPEA 5B1JA 1X9UA 1OE3A 1HAUA 2YXVA 2PP8A 2ZWNA 2X87A 1NWOA 3GXUB 1GW0A 3ZX1A 3AG4B 3CDZA 3FPXA 4GY4A 2J5WA 2A3TA 4E9VA 1OF0A 3PLYA 2Y1AA 1PY0A 3FS9A 5E9NA 2P80D 2AFNA 2HX8A 3FQ2A 1NPJA 1ZIAA 4UF7C 3T6WA 4G7QB 4KNSA 1A4AA 2GC4C 1PAZA 2VN3A 3KW7A 1OOWA 4HHGA 1AR1B 4A67A 4KOBA 1ZPUA 2X88A 2B3IA 3CVDA 4DPBX 5I6LA 3TASA 3NJIA 3X2QB 1RZQA 1WAEA 3UABA 3WG7B 3EH5B 5D4JA 4YSUA 1MZYA 3QPKA 1N70A 4HCIA 1IUZA 2JKWA 3PAZA 3ZIYA 4CSPA 4GP5B 2IWEA 5AKRA 3X1NA 3FT0A 1NWPA 2PP7A 5B7EA 2QDWA 3OD3A 1W6WA 3JT2A 2XXGA 1CYWA 1JVLA 1ET5A
chains in the Genus database with same CATH superfamily
4F9LA 4L1DA 2J56A 1OB1A 1JP5A 5DJ0A 4ETYA 4I13B 1R1CA 1NDMA 4N90E 4PJFF 3IFNH 2PO6D 3NIFE 3N40F 4ZXBA 5T5FH 3S9DB 2CDEA 5IBTL 5EZJB 3KWUA 2CBMA 5IQLA 4Y4HC 4HDIB 4WO4D 4WGVB 3DHPA 5TPWH 3KLDA 4IBYA 1Q9KA 3FQUB 3TBYB 1RI8A 2IPUK 1JSYA 2DJ4A 2CKBL 3KPRE 1SDDA 2QKIB 4XMXA 4GS7C 1M2OA 4UCFA 2BVEA 5TDNA 5DUPL 3D39B 4ODHH 4N9OB 2XLLA 4LL1A 2UWEE 4HUNB 2PYFB 3LEYH 1M6UA 3LMJL 4P2OA 5TQ2L 4DN3H 1GZPB 3MU3A 4JREC 1UHVA 4XRCB 1WBYA 4LSTL 3RURA 1UOKA 5MEOB 3IU3B 3C09B 1I31A 5B1CA 4AT6A 3CFUA 1U8JB 5ITFB 3BAJA 1SDAB 2K1MA 3BGMA 5C92A 3QZWG 2BFGA 1LP9F 4FCHA 1A4KA 3ZSSA 4JKLA 4R7DB 2IDUA 1UENA 1ACYL 1CR9H 4IW4C 5E4EC 5F72S 5B1JC 4JKWA 2CUMA 1UKSA 2BVPA 4Q6IA 3F6JA 4OIAA 3RVTC 3ESOA 3E9UA 4U2YA 4P3DA 1QD0A 1TEYA 3HOGA 4OF6A 2D9QB 4ANKA 4HUWB 3W56A 4OIIL 2IH1B 4ZOBA 1QBLL 3QWNA 1D5ZA 2FLBT 4P4RA 1ZT4A 3WNLA 5J9PA 3HVNA 1K4CB 1F4XH 2FX9L 1CF1A 2CALA 2NY5H 1RP8A 4X9IA 2CMRL 4JB9H 4YDMA 4L3ED 1MIML 5ESVA 3C2AL 1R3LA 5CZVL 4ES8A 3VUAA 1VZGA 3HIZA 2WLLA 4ZO9A 1QQDB 4YDIL 2CCLA 5G4NA 2IAMC 3NRPA 2WYTA 5BRZE 2XQBH 4PJCF 4P5TB 2HJLA 3B83A 5HJDA 4J3WA 1QPPA 4QRTA 4L4VB 4U1LB 3B9EA 1M57B 5F7EL 2J71A 2R7EB 2XV6B 5DD1H 2H8PB 3ATDA 1J1XL 5L6YL 2Q3AA 3DSFH 4ZFQA 1U2HA 4N5UA 1N0XH 1HX0A 2EYTB 2HXAA 3HAEA 4X6BB 2R29A 4TF4A 3SZ6A 2AK1L 5DUJA 3LDBB 4TSAL 5ENWB 3I6LE 1UZGA 4WNSA 1VADB 1Q72H 5H4YA 5F6HI 1TLKA 1T4WA 2K7PA 4GPVA 4DUXA 4LSRL 2P46B 4NAJA 4M9PA 5C09A 4JFEE 3HS0C 5IMOB 3G6JB 3QIUA 2OS7A 3F7KA 5A2JH 5T1LA 4IBZA 3TV8A 2UZXA 5T1KB 1G0XA 3IDJA 2YMOA 4LOFA 3W0WA 2QGBA 5I75B 4AVJA 1PKQB 1XGTA 1IAOA 3DHJA 1JZIA 3H54A 3LCYA 3PRZA 4FXLA 4IQHA 4PRDB 3T3MF 1A6VL 2OQJA 3FO0H 1GKEA 2C9UA 4ZDHA 3T8VA 3FHAA 3LRHA 4BK8A 4BQ8A 2AEIT 1HESA 2CO1A 2XN9E 4KKRA 1PYWB 1WDAA 5E24E 1YA5A 4JLRA 3HNVL 2XWBA 2OL3H 3DETC 2CUAA 3NZ8A 4A7VA 4G7VL 3AACA 4G7SB 5AB2A 2EDEA 1TIUA 5A16B 1D5BB 4LNRB 1CTMA 3K1KC 3WY1A 2HFEA 5FHBL 2FWOB 3RWFB 1VZIA 3EO9H 4PJBB 4N1HB 1GS7A 1UFGA 2Y7QB 2H2PD 3O2WH 4JFYA 4M9OA 5LBGA 1TVBB 2WLIB 5DK0B 2XWEA 4XCNA 1ZLVH 1RERA 3Q1EA 1BD2B 1G9ML 4H0LC 2DBLL 4IBLT 1DVQA 1HILA 2BFVL 2Y72A 4GKSA 3UTQB 1G84A 5I6XB 2GC7C 3ZT5A 1B3JA 1NCBH 1SVCP 1KDIA 2D2OA 3GHEL 5E6UB 1XHHA 1J9RA 3TN0D 2HLAA 2P8LB 3MUGB 3QHZL 5D2NA 3P0YH 3TZVA 5TGBB 1GRWA 4OFQA 4JFPA 4N0CD 3MRKA 3AB0B 1AANA 1LWRA 3ABLB 4HJ0C 4K3HA 2H2SC 4PJGB 1O7DC 1NANH 1OE2A 2AABH 4D9RE 5E94B 4EE2A 3QUYA 3UC2A 4RIRB 5GIRB 1WFIA 1E28A 3BP5B 1S8DA 2E7BA 2EDFA 4ZO6A 2ZKWA 4XBEL 1JNHB 4ZPVB 1QPKA 1I1FA 1I7TB 3MRJB 2X9ZA 4KXCA 3IDIA 4HJ1A 4HALA 4K07A 5IBLC 3RGVB 3VRJB 1HHGA 1E8XA 2VM4A 4B9IA 3QJHA 3L3HB 4NQUA 4UTAA 1RVFL 2J25A 4N90D 1X5GA 4Q0XL 4GUPA 1EEZB 4AY0A 5DS8B 3KYMB 4PLKD 3V8OA 4Z3GA 5C2UB 3QSKB 4IS6B 5HYEA 5D72L 4LEEA 3D07A 4RGNC 4XO3A 4U3XA 3T65B 5AALA 1CGWA 2VE6B 3KPRD 4ZW8A 3V0WL 3C5JB 5KBPA 4XMVA 1MCWW 1P7QA 3TCLA 3K6SA 2AS5M 3ME0B 4E9YA 4DQAA 1CFSB 4JGMA 2IEPA 3IGAA 5FLVA 4JO3H 3KYNA 3RFZA 2WWMC 1DUZA 4HUCA 5TE7L 3NRFA 1DO5A 3QUGA 4ZMWA 1WWAX 2Y4SA 4K7PY 2QADC 4RMVA 5D7IA 3FFCA 4QRUA 5IVZB 3RRQA 1UTDA 5DHVB 2BNUA 1OM9A 4JFVA 3SKMA 1HTYA 2V4LA 5F1KC 3WNPA 1EHKB 3DNKA 1PDKB 1FV1A 4XPGH 5FUOL 3LXUX 3SO5A 1IKOP 1TZHA 5I82A 5IBTH 4ZNEE 5CKAA 1JPFB 1DP0A 2QV4A 4MVBC 5J3HD 2ARWA 2B2XL 1X5ZA 4XVOA 2NW3B 3QJSB 2EE3A 4L37B 3ULUE 1H6FA 4X98A 4LHUD 1D6VL 3LQAL 5DUPH 1KULA 4ORGA 5LAXB 1BQKA 2JQMA 3QQNA 5D7LA 2CGZA 3QS3A 4JFFA 1KBVA 5T3XL 3CBJB 1D5RA 3MRBB 4J23A 4LSTH 4NHUB 5AVUB 1LWHA 2H41A 2GSIB 3H9HB 1TTUA 4D7BA 1XEDA 2WXKA 1SLWA 4LCWE 5K93A 3T6ZA 4YHPB 2GJRA 2XPGB 3W9EB 1U8IA 4P46C 3VX1A 2KBGA 4IOSA 1DQJA 2ESVE 5BRZD 4N2HA 3V4VH 3H0TB 4OQTL 2FEJA 5KG9A 5C07B 4JFSA 2B14A 3OAZH 6FABL 1G7IB 4U1SA 3FQNA 3QUXA 4K2UL 2GIYA 5JW4N 2E7HA 2QJDA 3G6AB 2F74A 1ZS2A 2Q0ZX 1G6RB 3V4PA 3OQRA 4XE0A 1QBLH 1HL5A 4G8EA 1P5UC 4OF7A 2PPCA 2FX9H 4Q14A 4TVUA 4KUCD 1CDJA 1TPXB 5AOJA 4ZSOB 1HSBA 2WQAA 3L5WA 4NM4L 4RX4D 4WO0A 3ARPA 3T0EE 3C87A 4QRBA 1I9JL 3R7QA 3H9ZA 3KPPA 4JFED 1MIMH 1KJVB 3MRDA 3QDJB 1AQKL 3C2AH 1RJYB 3HS8A 4N0FA 5CZVH 4ZS6C 1UYWL 5JXED 2W38A 4YDIH 1G0YR 2DQCL 2GAZB 4TQIA 2W9LA 4FG6D 1CVSC 2JIXB 3QHFL 3BW9B 4Y2OA 2NXZB 4LB8A 4XR8C 4BFEA 5F1NA 3DPBA 1EZVY 2LFGA 3B7YA 1LXMA 4A7UA 1J1XH 4X4ME 3TO2A 1NAKH 4XN8A 5JDSB 2XN9D 3AY4C 4XI5C 1U95A 1C12B 3ARGD 4JM4L 2QQKL 4X6DE 4QRSB 2VLRA 1AKJA 3QEHA 3F7LA 3RWJA 1OEZW 2CR3A 5J6HA 2QFPA 3BLBA 5IMMA 5GGRY 2AK1H 4X6CE 2Q6WA 4PGBA 3HG4A 3S5YA 4TSAH 2D0FA 3QIWD 1OT2A 4FXKC 3U9WA 5DVLA 2WOBA 3VI4F 4J3BA 3S96B 1IM3B 4JDVA 3OC5A 4HIIA 2ERJB 5I1LB 1UGNA 1J8HA 2CJ3A 2GBVA 4Y7OC 5E2VL 4JPKL 3UEZA 3WS3A 2GHWB 3WHXA 4Z7WB 1DQVA 4OLYH 2AMGA 4UINL 2LW3A 3FQYA 3FMGL 3MO1B 3M07A 3SDCD 1IGTA 2PTTB 4MCMA 3WKYA 5L8JB 4PJHF 4M29A 5D70L 3FCTA 5CN2A 1KJ2B 3IETB 4GQPH 4M02A 1HOEA 2P5EB 2R59A 3Q8FA 3CZKA 4RMSA 4XXCC 4Y1AB 4I7ZC 3STZB 4E5XG 1PX3A 2CH8A 4DHLA 1CE6A 2X1OA 2WKLA 2J8HA 4NZRL 4JG1L 3GMRB 5D1XC 3CFJA 5DYFA 5I6PA 5MEPB 3ULVF 4QGTA 2ATPA 3LRGA 3UBGA 2AQQA 2EIJB 3HNVH 3RVXC 4FQCL 2VIRA 4HH8A 4D9RD 3U82B 5CLYA 2WXLA 1WBXA 4G7VH 3FFDB 4N8PA 4DAGL 1EEQA 5HDBE 4ATTA 2IXQB 3L2NA 5FHBH 3P0VH 1LMIA 4G6AC 5GGUB 3ZL4H 3ZSTA 2MTPA 1WWBX 1AQMA 3SB3A 3D85B 4HUXB 3DV4A 3K6NA 5FGCB 2Y1AA 3BP7B 1G9MH 3EYOB 4ILDA 4M48L 2DBLH 4NHCL 4IHBA 3SDAB 2G5BB 2E6JA 3UBXG 1K6QH 3GHEH 2FATL 2WINA 2B5IC 1AOHA 5SX4I 5C0RH 3GTVA 1G0DA 3MRPA 4ONGL 3TYGH 3HUJB 2CNYA 5HJ3A 1E6OH 5T1MA 3B2MA 1SPDA 3BH8A 5HGHA 3MRMA 2VSCA 4NQVB 1WEJL 3NDZE 3L2MA 3CV5A 3DMMC 5IIEA 3GSNA 1TFPA 1OAJA 2VMFA 2ZOKA 5D4JA 1MZYA 4F8OA 2FH6A 3PAZA 3ZDYE 3QZMA 1WCBA 1S7VA 1HHKA 2CJTA 4XBEH 5GS1C 3ULSA 5C3LD 2R29L 3V10A 5HHNB 1KJMB 2MCAA 1KG0A 4TLTA 4ONFL 1QW9A 1WZKA 4RGMC 1A1OB 4LOEA 4S1SL 2BK8A 3GMNB 3F12A 4IGBB 3SDXF 1RVFH 3U7WH 3X13A 5DQ9A 3ZYOA 4GG6A 1J5HA 1KTBA 4Q0XH 4Z7UF 3HNSH 2CIKA 1E43A 5DI8B 5DRZA 3PE9A 1CICA 4OZ4A 1JYVA 4NT6B 1KYFA 1QLRB 1UJ3C 4LSSL 3SSGA 4OAWB 3RIFF 2FX8L 2HRPH 3FB7B 4MLIA 4PJ9B 4J3OG 2BOCA 4UZGA 1JV2B 3ULUD 4XOEA 4K7FA 3V0WH 4D0CB 3A0OA 2BY1A 4RDQF 5C0NC 1UADC 3ARDD 1TTBA 3FUMA 4WW1B 1V05A 5K1JA 1A7PH 2HCZX 3FCSA 1KJ3L 1AC6A 1XL4A 2OXGB 3D4CA 3WJJC 3S37X 1ACXA 3FPYA 2X3AA 2WBJB 2HVBA 1EJ8A 5HY9B 1HZLA 1UEMA 4U6HB 2B1HL 1IT9H 2XC8A 7PCYA 1A7QL 1GR7A 3FOMB 3PNWB 1ZHNA 4LCWD 2QKIA 3ZTJG 2HTLD 3JXAA 2Q2EB 4I2XB 1U8NB 2XQYK 4KJWD 2I07A 2IDSA 2XT1B 1E5UI 1EEUA 1ED3A 4OBRA 3X3FL 3VFWA 4DNLA 3L95B 3B5GA 5I1IH 2E8ZA 4IMKA 4PREB 1EBPA 4I18B 1KCVL 4TSCH 1I8KB 1U8JA 2BP0A 2ZXDA 2MOQA 3AXIA 4M56A 3QXVA 5BMFL 5ITFA 3M88A 2FT8A 4FOMA 3VI3F 4AE0A 2PXYB 2R23A 3OMAB 4U1HB 1NGYB 3M7OA 1QLEB 1PZAA 3CH8A 1QFWI 1WPCA 1R0AL 1ADQH 3GBMH 1T0PB 1RIVH 3NSDA 4U33A 2FWLB 1IM9A 1FG2B 1KOAA 3T0ED 5JHDB 2AZAA 4FLSA 4AJVA 5CCGE 4FYSA 1F3DJ 4GKNA 4YAQB 1CFMA 5A2IH 2WD0A 1FVDA 2XWZA 1GXEA 2C4FU 1MVUB 2R1YA 2W65A 4MJJA 4UTAL 4YEEA 3VXRA 1R75A 1VRSA 3F58L 4I8DA 4LVNB 5INCB 3FRPA 4ODVL 2FR4B 5IB3B 5CGYC 3UTTA 4OJFL 2EVJA 2EDJA 2CM5A 2FVNA 2ZCLL 3SCMD 3WAKA 4QF1B 6FABH 1RSFA 4QXGL 1A3LH 3O8XC 3P3UA 4JHWL 5DSCB 1EANA 2DQEH 3S4SB 2ZWSA 2BPBA 4BA0A 3CN4A 2EDTA 2DQJH 1F18A 1VGKA 2Z31C 5JUEL 5LGJB 2XPZA 5L0QC 1AZVA 4X4YB 1OAKH 3ARRA 4XPTL 1TSRA 4JW3A 4PRIE 1U3NA 2VZUA 4XWGL 1AG6A 5ALCH 1MF2H 1KYOK 4U1LA 4LESA 3QIBB 3OR6B 1AQKH 5D9SA 4F2FA 1KLGA 1RUAH 3QDMA 3ZOAA 5AG8A 4CC1A 4ZW3A 4NQQA 3SPVB 2DQCH 3VFPA 1YPZF 2WIIB 5F7BA 4P9HC 5C0EB 3QHFH 3SGJA 2EYTA 1WF5A 5FECA 1Q9OB 1MW3A 4Y4KB 4HG4J 5HI3D 1I3GL 2B1AL 15C8H 4S1QH 3HE6C 2BSBA 3PHQB 4B9GA 3BYTA 5JOFA 3VQLA 4NNYA 3EH1A 2XWDA 3HR5B 1B9KA 2YJQA 2ATAA 4KZDL 1MWAH 2EKSA 3FH8A 4Y2DC 5ABDE 5KYWB 3H9YA 3SBWC 4OF8A 2A6KB 3LHPH 4LP5A 4ZO7A 1JDCA 4XN7A 1R46A 3KMDA 2XKUA 1QACA 1KPUB 2DD8H 3RL1A 2P5PA 2P26A 3TC9A 3KAAA 4AH2B 4WHYH 1C7TA 1ODAA 4HEPG 4JPKH 1L6ZA 3JWDL 3RJQB 1UWXH 2J4WL 2JB5L 4HD5A 4B9YA 1HL8A 1I7ZB 3KPOB 1CGXA 4YFLI 4QNPF 5C08B 2VISB 5D70H 2XSKA 3QJQB 4YLBA 1VIWA 1NL0L 4AEFA 1T0MA 5DRNA 5FW7A 3QARA 3KXFE 1D5BA 4AL8L 1BZ7B 1S7TB 2DIBA 2DPKA 3DX0A 3RNKB 1EMTH 2K6YA 5E6IB 2AJ3A 4XMTA 4PJBA 3R4RA 2Y7QA 3LRKA 3CSFA 4FQCH 1S3KH 1MI5E 1TVBA 5D71L 3CDFA 3MCKA 2W81C 3V4PL 2YGOA 1KIUB 2A9ML 2G30A 4DAGH 4ODTH 1JCKA 3UTQA 1OP3K 2VDKH 2B15A 2EECA 3BOVA 2ENJA 2QTEA 2R15A 4J3TA 5CP3A 3WIIH 2P8LA 2WUCL 1MPAL 5F88B 3UACA 5F9JA 2X44D 3IJHA 4M48H 4Y4FD 4PJGA 3OLEA 3ZVVA 3QCUL 5JYMA 4GXFA 1P4LB 2FATH 1INQA 4RIRA 5GIRA 3AS2A 3BP5A 5IMLB 5CMAB 1D7FA 1T3FB 1I7TA 1D9KB 5AVQB 3C60C 2I9TB 3ZGHA 3VRJA 2GJ6B 3BO8A 3HC4H 5JW4M 2YKLL 1ITBB 4MNQE 4Y5XA 3EGSA 1XIWD 4DKFL 5I8CA 3NFNB 3L3HA 2VJ0A 4MDRA 2VXSL 1MH5A 5ES4B 3HAEH 3DX7B 1EEZA 1NICA 4OZFB 4FTVB 3S98A 2Z92A 3KYMA 5F7DB 3BZEB 4GRWB 1DBAH 1T80A 1GZHC 2FGWL 4ONFH 1NMCC 4NQDE 2OXHB 3P77B 6PAZA 1CYXA 4UOW0 2VE6A 1CF8L 3C5JA 4I9XA 4G9FA 4OCYH 4AQ1C 5LNEA 5IZ7A 4DSYA 3KVQA 1CFSA 3CVHA 2OK0L 1UWEL 3H3KA 2FQDA 4QPEA 5KJ4A 4WWKC 2FX8H 2BJML 5G55A 5D8JH 3QFJA 4YSTA 3SKNB 3VFRA 4WUKL 1Z1WA 4FP8L 2V2WB 2Q9OA 3OAUL 2BSCA 3R8QA 3BP6B 3LEVH 5IK3B 1F90L 3ISWA 2BOLA 4YSEA 1M56B 1EA9C 5B3JE 1PDKA 1CI3M 2QSQA 4HJIA 1JWSA 4OZHB 1DVFA 4F8TA 5B4MD 5I24A 1A6UL 5FFGA 3UAEA 2IGFH 4XNUL 3T1FA 4DZ8B 1A7QH 2AQSA 4AW7A 4ABQA 4PEEA 4TUJB 2W95A 4UIKL 3HKFA 1Z0NA 1N26A 3C75A 4NKQB 3WN5C 3KDMB 4NQSA 2DRUA 3W81A 1NGQH 4E9WA 1LNUB 5GGQH 4R84A 2YN5A 4YN3A 2XN2A 1MFBH 4P04A 5IHLB 5TF0A 1AQ8A 2P8MA 3GPEA 5DHXB 1UB5A 3MX0A 4B5ZA 4NHUA 2EDQA 3NCFB 1DEDA 3NABH 4XMZA 4P2CG 1WBZB 4HF5L 5BMFH 3CC5B 2R0LH 4TNFA 4UIMB 2Z93A 1LE9A 4HSCX 4YHPA 2XPGA 1SF3A 3AXLB 1M1XA 1A7BA 1JUFB 3QP3A 4QRPE 3GSNL 2HFFB 2DQGL 1R0AH 3WELA 3JWNG 1CDCA 4HWEL 5DJCB 3E2HC 1JDDA 3BUIA 3QEQE 3KPSA 3PWVA 2F8VA 4LLVB 1LDPL 3U9PL 3WENA 5E0QA 3QUZD 2Z34A 3BE1L 3TO4C 4YVNA 4WU7B 4PRNB 3V0GA 1BYPA 4NI6A 4UTAH 2R2HA 1QVOB 3G6AA 1MCJA 1BAWA 1XQ4A 3O9WC 5KVDL 2JJTC 3F58H 3BVUA 5C97A 4ODVH 2ZIDA 4CVWA 1Z9OA 2D7PA 2DH2A 2YD1A 1LJMA 2NX5E 2WWOA 4CMMA 4JZJC 3VB8A 5E9DD 4QXGH 3CLWA 4M8UA 4ZSOA 2D4DA 4MNGB 4PI2A 4M5YL 1FPTH 3QFDA 4UYQA 5IQ7L 3ULVC 4HJ0D 3CPUA 3O6LL 2Z4TA 5KZCB 5B1AB 4ZZKA 1YRKA 5JQIB 2VABA 5JUEH 5KS9B 5E2WH 2FB4H 2HT2D 4JPVH 3REWB 2BW5A 3MOAL 5IROD 5AVYB 1GGCL 5GRJH 3ZW3A 1K3IA 3KL0A 1F1DA 5AAWA 4HIHB 1X5AA 2WQUA 3BFWA 3FONA 4XOAA 3WKQA 3HG1A 1GKOA 3E3QC 2MHAB 1PEZA 1UH3A 1C12A 1IQDA 4UV4H 2XJKA 4KI1A 1WJ3A 5ECJE 1XX9C 3ARXA 1IAII 3ILPA 4KK8D 1ZRUA 3PHAA 2WSDA 2B1AH 2X4OA 1MCBA 4WV1A 2B16A 3S96A 2IPUG 1UEYA 1FZMB 3ATEA 1NQBA 1ES0A 3MLUH 4L9DA 2B7DT 5I1LA 1MCSA 4KK6C 4ALAH 5I16A 2ARJB 3ZHDA 4GI6A 2Q86B 4OCSL 4IJ3B 5C0BA 1E4KC 1U8CB 3LKRB 2PP8A 4WI7A 2ARJQ 4OZIF 5EULV 3FXIC 2H1XA 2ICWA 3DIFB 2P5EA 4Y9GA 2ZP0T 4L1SA 4BRJA 2NZ1A 4ELME 2H26A 2YC1B 3JWDH 2VL4A 3CU7A 2J4WH 2JB5H 4Y1AA 4WGWB 5ANMB 2C3XA 2OJZL 2UY7B 2A3TA 1WC7A 4E9LA 1MJJA 1AVAA 1JF5A 1ONQB 3D08A 3F83A 4GG8A 4UZUA 5HHXH 1BJ1J 4HKBB 4YHZL 4MTMA 4HUVA 5D5ME 4XT1C 1KLFA 3LS5L 4M7JL 4EUPB 4FS0A 3K72A 4Z7VF 1VEPA 4FNRA 2NR6A 4K94L 1AO7A 4YHIA 3JYBA 1U8MA 4KNSA 3PY9A 1OW0A 1UUSA 4Y8AA 1RD6A 5JOPE 4YK4C 4GO6B 5E5UB 3SQOH 4AL8H 1OLZA 4ZFGL 2DMBA 2B3IA 3PGDB 2IXQA 1P0SE 2QPUA 3MJ8A 3PJNA 1CTOA 4CAGA 4V1DA 3S35L 4NXKA 1G7HA 1J48A 4JMNA 3RUGF 3D85A 4MNQD 1WFOA 3Q5OA 3TA3B 1UM4L 3WG7B 4D9QE 1XEUA 5D71H 4NFDA 5H35A 4NO3A 3ZIYA 4XMLL 2A9MH 1U3ZA 2K6WA 3AAZB 3AVEA 2YD6A 4NZUH 1A14L 3SDAA 1VPOL 1DJYA 2EE2A 5F0MB 3LQMA 1XH3B 2D7MA 5DVPA 3DOSB 5GRVL 4NQDD 2WUCH 4D0DB 3G5YB 1MPAH 3HUJA 3WY2A 2PCPB 3D52A 2QQQA 3GBDA 4K8RH 4R6UA 5AYUL 3O3EB 3ASOB 4F58H 3DURA 3WLBB 4HAGA 3LN5A 3LZNA 1A3ZA 1JTPA 3GZKA 5I6MA 5E8PA 5J11B 1JK8B 3QCUH 4ZMYA 3SGKC 1WSST 5BUAA 1QI5A 3KPQB 3IN2A 5I66A 2XQ0A 1X5YA 3FTUA 5D1QB 2CAKA 1GVIA 4O2CB 3U46A 1FL5A 4M4RB 3NFSH 3GXFA 4LLQA 1TR7A 1JPGB 2PO6B 3I75B 3BVDB 4L8BB 1MCKA 4KO7A 1A1OA 4EO5A 1Q1JL 2OI9C 2VXSH 1E30A 4KMLB 4WO4B 4RAVB 4ZI8A 3L16A 5DI8A 5J8OA 3STLA 4NOFA 4R4NC 1QLRA 4ACPA 2FGWH 4K23H 2WNGA 5I0WA 3LQAC 4LL9A 3I2CL 1MFVA 4JR9H 4MA8L 3ZHFA 2J5LB 4C59B 4NEHB 3QJFA 4XPBL 1YEGH 4U7SA 5ETUB 3UL4A 1G5AA 2OK0H 1E4HA 2CK2A 3FTVA 1FL6B 3G08B 4Z5RB 1TEGA 4IU3A 4YPGA 3AM8A 4JM2D 2BJMH 2G2RB 4IKNA 4LPWA 3AY2A 4WUKH 4Z7OF 2W07A 2WBJA 5HY9A 5DZ9A 1J12A 4JFXB 3NH7L 4YC2C 5IJKA 2YN3A 3WNOA 3HZKB 3GUTA 1F90H 2ADGB 3PNWA 3FOMA 1J0ZA 3F85A 4UM9D 12E8L 5GJSH 4I2XA 3KLKA 1U8NA 4QRPD 3S97C 3D50A 4YSPA 3DUSB 3BXNB 1KBBA 5E6YA 5ACMA 2D2CC 3N1FC 4IOFC 4FERA 4UI2A 1FH5H 3L95A 3QEQD 3S3CB 3CFEA 4MZIA 1WS7A 4KBPA 4QKTA 2BZDA 4UIKH 4BXVA 2A9NL 4ZQKB 5I1AB 4OLXL 3BN9D 1I8KA 4BDVB 1SHXA 3OKYA 2YRLA 1P6FA 1F97A 3WDJA 3U9UB 3EH3B 5BJTB 1NGYA 2FECI 3RB7A 2QPSA 4N2EA 5BZDB 1EERB 2G3XA 2NX5D 1X5XA 2Y25A 5IB2B 4L3EB 4F9LC 4P2AA 1QFWM 2CJSA 4LCIL 2DDQH 1AG0A 3NJKA 4FI8A 4IRSC 2IDQA 4ZXBC 4E0RA 5C86A 4F24A 3BH9A 2BSED 2ZWYA 3BVVA 3TFBA 5BCAA 2WQRA 3BKYH 3MLYH 2J8UB 1OIOA 1TCRA 5INCA 3EKCA 3KM2A 1HHHB 1A2YA 3GBLA 1OAXL 3OR7B 3R7RA 1TTAA 1PZ3A 4QF1A 5LLIC 3JTBA 4LQFH 2OYKA 4KROD 3KEDA 2DMCA 3WMQA 1U3YA 2BDNL 1IARB 3MNMA 3E7JA 3MA7A 4GSDL 4HW6A 4P5KB 5KVDH 3GXTA 2FDBP 4HBCL 3NJNA 5GXBB 2G9HB 5LGJA 1BEXA 3QI9B 2QGDA 3UERA 2APTA 4WHCA 3WFBL 1E9QA 3VXNA 5EWIL 2OYLA 4M5YH 1H3GA 2HG0A 3GM0A 1DYZA 3ML8A 3O6LH 4U3SB 3QIBA 3OR6A 2NXYD 4YX2H 3C9NA 1N9PA 3IM1A 5DF0A 2WIIA 1CLYL 5MERB 5BXFB 5JHMA 4Q6IC 2XZCL 3MOAH 4PJDE 5IW3A 3FQWB 1GGCH 4MD0B 4QAMB 5EB9A 1AQDB 3LN4A 1RV6X 3TVMA 4KJQD 4HD9A 1UQSA 2DWDA 4XNZB 1LO0L 4AVKA 4ODWB 4HS3A 2OULB 3C08L 3PWNA 1W80A 4MBOA 2VNCA 2A6KA 1M4KA 2D31B 2AJUL 4M8VA 5BW7A 3RU8L 2HH0L 2Y06L 1SOSA 4Z7NB 3VXMA 5FUCE 3VE0A 3QQXA 1TVHA 2ICCA 3FTSA 5DEGA 5C8JB 5JOPD 3FF7A 1BV8A 5JDJA 4XP6L 3GSWA 1SVZA 1C5BL 3I6KB 5EFIB 1SN0A 4FHKA 4MSWB 4A1RA 4D9QD 3KPOA 3KS0H 4XCYB 4GT0A 3F8UB 4UU9A 1QLFB 5DC0A 1NDGA 1BQRA 3TN0B 1IC5H 3VWJC 5C08A 2AXFB 1CXEA 2VW6A 5JQ6L 1QP1A 1XAKA 4FCAA 4BQ9A 1CFTB 5DD0L 5IREA 3QCTH 3O3DB 4LCCB 5HHOA 1EFXA 2N1KA 4WWOA 3VH8G 2H6OA 2YSSB 6TAAA 1S7TA 2OJZH 1NC2A 3OGCB 1OCZB 4KFMA 2KH2B 1BVLB 2QVKA 4KI5C 4YHZH 3OX8B 5BOZG 1BMGA 4PHZA 4M7JH 2WXHA 3A4FA 5JW5B 2CHDA 1JZ7A 4Z0XB 2OR8A 2OJEA 2V9QA 4KZ0A 4JFDA 3WE6B 3AFLA 3K74B 4ZFGH 3M1OA 3P2TA 3QJTB 1PX4A 4KO9A 1WAAF 3AU0A 3NIFB 2O5YL 3QIUC 4LRIC 4XVSH 5F88A 4EKJA 3Q8CA 4NNXA 4ZD3L 3VFGL 2AI0L 1GYWA 3NT0A 4E36A 3MODL 5SV3A 4F1SA 4DIXA 1VPOH 5TDOB 4C4KO 3ZT7A 1P4LA 3DECA 5D7JA 1INEL 3KPRB 5KAQF 5L9DL 2WXNA 3PP4H 1T3FA 5KOMC 1MVYA 3N43B 5AYUH 2UWEB 3VFMA 4AK1A 3MRNB 2F0CA 4R7VA 4A2DA 5FO9B 1IE5A 3D0VB 4FXGA 3X1BA 4G43B 5AOIA 3VGDA 3BIKA 4JFOA 2IH9A 4BEIA 4WZ9A 2ZKYA 1RY7B 1DBJH 4JJHA 4P23D 5I71C 1NCAH 1JPTH 3GMOB 2OR9H 5CGYD 3BWSA 3DX7A 3US1A 4NQEA 1UXWB 3BZEA 2L7QA 3GYRA 3MRFB 3GHBH 2VDPL 4F15B 3BRFA 1CL7I 2XKNB 3SY0A 3O8XD 3GJFK 3AZUA 2A6IA 2OXHA 3P77A 3QBTB 4X7FC 1Q1JH 2Y6SD 1EBAA 1QA9B 4UV7L 2HJFB 4TNWF 1UVQB 5I1CH 4IRJD 2WTRB 1NCNA 1D3CA 3MRIB 1WT5C 4A6YA 5EEUA 2DWXA 2X12A 4LHUB 3GFUA 5F97E 3V0FA 1OKEA 1QG3A 5FYKH 4JPIB 3Q1SL 2FBOJ 3SKNA 3TZVC 1CQYA 2V2WA 1AMXA 1F3JA 3F00A 3G6JF 4PD4J 4Z7AA 1QR1B 2G0LA 4QYOA 3ATFA 3KJ4C 3QUYC 4XZUB 1E67A 4IEFB 4L1HA 1U3JA 4WI2A 2Y1VA 1LYQA 4YGAB 1CGUA 1L9TA 3K4AA 3FBQA 2VDRB 3MBEB 1MLCB 4R2GD 2QLVB 1JWMB 2QELA 1JF1B 1A8ZA 4TUJA 4H44C 12E8H 3AQDA 5C7ZA 1MW0A 1YMHA 5BRZB 1TU2B 2QTVA 4MMXB 5EOCJ 2JMRA 1LNUA 3GZQA 1AZRA 4R97B 4Q9QH 2R83A 4PBWD 5E7BA 5I0ZA 2UYLB 5HVGB 1YY8A 2WMPA 1PCSA 3H7BA 2WVUA 2VR6A 5CHNA 1ZA3B 2VTFA 2HRGA 5EC2A 3QUHA 4UOZA 4I1RA 5CP3H 4PG9A 3BN3B 1CBVL 4FL4B 3QUKB 3CC5A 3CJJA 1BIHA 2BHZA 4Z1PA 3D9AL 4G6KH 1VB9A 3RFZC 1RULH 2LLNA 3ML9A 2KC0A 1JUFA 1P7KB 2HFFA 1YEEL 3AU1A 4HA1A 4JFEB 1G5GA 1YEIL 5DJCA 3UTSE 5CLWA 2TRYA 5D96B 3SDDA 3E8VA 5J7CC 4MDIB 4KKLD 4LCIH 5ESAB 2ZX5A 1QKZL 1X5MA 4HXBL 4FULA 2YD4A 2ZCZA 5C9JB 2QVIA 1QVOA 4U1JB 4CKQA 2XNAB 4Z23A 4G59C 5CR8A 5GRZA 3B7RL 5MI0B 4J3UA 1BQHA 4OJCA 4XN2A 2ADFH 3KHQA 4CMHC 4GRMA 1FZJB 5J13C 3MV7A 5CSBA 2XN9B 3ARGB 5F2FA 2BDNH 5I74C 4JO2H 2P49B 4MNGA 1MFCH 1TF4A 1EDHA 2OLDA 2CK0H 1NGZA 1MQKH 5I17A 1IGMH 4APXB 3QIWB 4WI3A 3CVHH 4M61B 1LK3H 1A8JH 4O02H 4GINA 1JRHL 4OI7A 1HIMH 3RHWK 5I1EL 3PXJA 2BLFA 1KLUB 4HZ1A 5FYKU 5CBEA 3WFBH 3MCLL 5HJGA 1N8OE 3HHSA 1QO3A 1N5YL 3ABMB 2XWCA 3C60D 4HSAC 4X4ZA 4HOXA 3KLAB 1R5IB 3PPSA 3SDCB 4HIHA 2QSCL 2VDMH 2Y36L 1KXHA 1BW8A 1DBMH 4HEMA 2PPEA 3IJ7A 3TBTB 4OLWL 3BGFC 4H8WH 2X87A 1RHHB 2XZCH 3MLRL 1ZSDB 1CFVL 2DLHA 3KJ6L 3PPEA 4M1DH 2DJSA 4ONOA 5DGRA 5KW9L 3QUXC 2NZ9D 4HQQH 4Q4IA 3SE3A 2TRHA 3RBGA 1IAIM 4F7PB 1IMHC 4OTXL 1LO0H 1GYVA 3FS9A 2A83B 3GJEA 3TBWA 4A38A 1HZKA 3QJOA 2ARJA 1L6XA 3QQ3B 5CN1A 1N59A 2AJUH 1GMEA 2Q86A 3RU8H 4G8GE 2BVQB 1U6AL 2Y06H 1D5MA 1I8IB 4RLDA 2VWEE 3VXQA 1MDTA 3IFPB 2VO5A 3T04D 4A67A 2ICES 2O30A 4OF3A 4XNMB 1UZ8A 4AYSA 4XP6H 1C5BH 2YC1A 4FNQA 3N0AA 4KVCH 1DSFH 3LRLA 4AUUA 2GFBA 1XZ0B 2HG5B 5ANMA 4C47A 2UY7A 5F7UA 2AMUA 4FNTA 3THML 4AG4L 4GP5B 5KSUB 4KTGA 2PP7A 4LO9A 4NO2B 1EHLL 4IIQB 2ZOLA 2IGTA 4PJEF 1IGFL 2ZD0A 2YPVA 4PRPE 5JQ6H 5IBUB 3MOBL 5DD0H 2CO7B 4MRBA 2CDFA 1LO5B 5E23A 3F5WB 4PY8J 3HE7C 2OMWB 4LPCA 4M00A 3ZMRA 3AS3A 4ORZC 5D93C 1FH2A 4M8RA 3EGDB 4IMLB 4JRLA 2EIMB 1CLZL 2V9RA 3PCYA 1DLFL 3MV8E 3TA3A 1FQ9C 1K5NA 1UUNA 5IT2L 3SBRA 4XP9L 3NTCH 4C56A 1F6AB 4MS8D 2E7LA 5FM4A 3EZJB 4U7KA 3RWEB 4Y7MA 1QEXA 1BJ8A 1U93B 2A4EA 4L3CB 2GCYA 2RFXB 3W5MA 3G5YA 2MQ3A 3HHMA 2NUTA 4R7LA 1O6VA 3WLBA 1Q38A 5G5DB 1E8ZA 1QWUA 3CZSA 3LPOA 1X5KA 4DQOL 3IKKA 4PY8I 4UMGA 1INEH 1KPRB 1YEJL 4DP1X 5L9DH 3ELQA 2HWZL 5FO7B 4F5CA 2XBTA 2AJVL 1AC0A 4J8RB 5E5MA 3ARDB 2FHCA 5PAZA 2WZ6A 4K5MA 4DO4A 4NWTH 4A04A 3PGCB 2TAAA 1KB5B 4WO4A 1GZQB 2C1OA 4M43H 4XMPL 3GIVB 4AQAA 2V7HB 1OAUL 2VDPH 1HS6A 4LCWB 5IOPB 3W37A 1OGAE 4KHXH 5LJYH 1QFOA 3D0LB 2GPZA 2JNZA 4I0KA 4KRPD 5JPMA 4D7PA 3HRZB 1MCHA 1CG9B 1E90A 1YEKL 2ESVB 3O6FB 2LU4A 2AVGA 4IBUA 1JL8A 4RBPK 1FL6A 4ADIA 2COQA 3TCXA 1E4XL 4Z5RA 3MZTA 4GAYB 5KSAD 1RZJC 2IWGA 3E80A 2G2RA 5MENA 2IQ9L 3Q1SH 3T2OA 1MQ8A 4WI0A 3ROLA 3MROB 1RLWA 1GGIL 3CXDH 1PQZB 3FB8B 4IU2B 1DBBL 2N56A 2VXTH 4Z7WF 4PJ8D 3IPEA 2ADGA 3ARZA 5IVNA 2L7EA 3U7YL 4N28A 5DYOB 4XHQA 4JDTL 3T0EB 4UT6A 1C7SA 4DVBB 4KKAC 2M8XA 3UTSD 2ICEC 3L9RB 1J05B 4L2LA 4OD3H 3NJJA 1MFDH 3OV6A 5K9KB 2V3FA 1FFTB 5I1HL 2NY4C 1N2RA 3MYJA 4Z3IA 1SEBB 4MXVE 4GKZA 3SCMB 4ODBD 1L7TL 4XN1A 2IBGA 5TDPB 2H9GA 5BJTA 4B9CA 4W81A 4WHYG 5IG7A 5K9QG 5L2KE 3IFLL 3TPUA 1OSYA 2QFRA 2IDFA 5BZDA 5CFHA 5HI4C 2LE9A 4GBXD 2VR7A 3BWAB 4X6DB 5C7XH 1NM4A 1CBVH 2MJWA 2E27L 2JKSA 3D9AH 4X6CB 1NFDE 5EHFA 4OKDA 2VZOA 2XFXA 4PRHA 5AVSB 3CBRA 4FQJL 1F1AA 4NBYB 3RKPA 3RZCA 3K46A 4LCVA 5E2TL 1YEEH 1ETB1 3HZYB 3UMTA 1GMIA 2F68X 3ZE1E 2YSTA 2ENSA 2KI6A 1Z32X 1HHHA 1AHMA 1Y0LB 4LVEA 3Q5TA 4Q4EA 1HE7A 2JI2A 1BAGA 1H5BB 2EH7L 2FT6A 2CRYA 2QKIC 3LS4H 4HXBH 4M7LL 3VWKA 1D5IL 3VD0A 4AGPA 3ARBD 1SLXA 3S48A 3CIAA 4IKJA 4P2QE 3I9IA 4L1TA 2MMXA 4C83A 3UO1H 4A6YL 2B9BA 3QI9A 4YZFF 4IMKC 3L4ZA 3GMLA 1PLGL 4W9KC 3C09C 4ZMLA 3EOBA 4NCC1 4JPQA 2AC0A 2C4XA 4S2SB 4U3SA 3L4TA 3NZUA 4PV9B 4P57B 3UBXB 1BX2B 4Y9BA 1BLNA 3IJYA 2XY1A 1JRHH 4CJ1A 1VGEL 1KFGA 4G8GD 5EIIG 5HDBB 1ORQB 2XWJB 1TXKA 3VQ1C 1QHPA 1KGCE 1RUPL 4YLQT 3AWEA 3MCLH 3RVWD 5MERA 1N5YH 5HGDA 4PUBL 5IW1A 1RZGB 2J1ZA 2FJGB 2XTLA 4TLKA 3VA6A 2E5EA 4HHAB 4S0SD 5KVMC 1X44A 2QSCH 3PV6B 5DLML 5JA9A 4LSPH 3VD3A 3GSRA 5ADOH 2EDWA 1TQSA 3O41B 5GZOD 3DC0A 3C8HA 3W0WE 3B9DA 4K94C 4KK9D 5I1DA 2V2TB 3BQUA 4AYBA 3MLRH 4LSVL 1ZVSB 3KJ6H 4PRPD 2JLPA 1C08B 5KW9H 3UP1A 1B4JL 2RA1A 4M8QA 2YZ1A 5GHWL 5C8JA 1TQUA 1DL7H 2R2EA 5DJXB 4QHKJ 2BIHA 4OTXH 3VFTA 4JG9A 2X2YA 4F37F 2NY2D 4JDZB 2EXSA 5B1KA 3IE9A 3ZDYB 35C8L 3FT3B 1BBJB 3MV8D 4MSWA 2NW2B 4I1NB 5T3XD 4F33B 2BIOA 1KUMA 4XCYA 1FNAA 3NG5A 1OP5K 4DPRA 1IBDA 5DZAA 2D7TL 3OZKA 4DKDC 1E7UA 2WXGA 4P5TC 2AXFA 2BRRH 3ESNA 3KD4A 2Q1EA 1ZLUH 1SVBA 2D3JA 3VFVB 3O3DA 3VTAA 4PI0A 4Y4FB 4N85A 3ZDWA 2YSSA 1HL9A 3DUUB 1KN4L 1EVUA 3VXOA 2Q5BA 3CH1B 3THMH 5CJQL 2M83A 2OPCA 3OX8A 3QRBA 3FCGA 5J89A 2EYRB 2WHVA 1EHLH 1OL0A 4QHKI 5JW5A 3LDBC 4Z0XA 5IVXA 4Z76A 5D2NE 5CR1A 4RRPM 4F7TA 4DEUA 3CDGB 2FYVA 2VB5A 1XIWB 3U2IA 1DLHB 4A66A 1DLFH 5AVTB 4HPYH 3RAJH 3VYNA 4FQLL 2X4UB 4Q89A 1YC7A 5DMIH 2IOMA 2QHLA 3EGXB 4H25B 2MPVA 4JANB 1RZ8A 5I75C 5TDOA 1IE4A 2IO5A 3NN8B 4M1GL 1OGAD 3LEXB 3A6CL 2AV1A 5AB1A 1RP9A 4O9HH 2UZYA 1AD0B 3QZWA 3NJMA 5AAMA 4E9QA 1VFMA 4OSUL 2EQDA 4BRVA 4ZXBD 5FO9A 3WEXB 2FH8A 4L3FA 5TE6H 4DQOH 4G43A 1B4TA 4MMZA 4JEGB 3TM6A 2X4SB 3GEFA 1JXDA 3L2LA 4GRLA 1T21A 1T5KA 4FZEL 3UZQA 1ITCA 1I1YB 4JK0D 4XCCH 1SN2A 4GLRH 1AP2B 2ETWA 1FG9C 2MNJB 2CCWA 1AFVL 1P1ZB 1T83A 4UQ9A 5J1AB 1DJZA 3O3BB 4WNQB 4HETA 1UXMA 1HSAA 3ARED 3OZ9L 3GSOA 2F8XC 1OVZA 4UBDC 3MJGX 4P2OD 2HJFA 2MCMA 3UTPD 4BH8B 4HV8A 3MRIA 5IQMA 5FF6A 1W72B 4XMPH 4DEWA 5I6XC 1KCKA 4XMKL 4N5EC 3UZVA 3E9TA 4KVNL 4A2LA 2XRAL 1OGPA 4JPIA 2UXFA 4DCQB 4BFIB 3PAUA 3BVNB 4LAQH 2CIIB 5I0DA 5B7MA 3AB0C 4HZLB 4BGLA 3OKDA 4HCRH 4XBGA 1QR1A 2WK2A 5KSBE 4MJIE 1E4XH 5KN5B 3D2TA 3NEOA 4LGRB 4QTHB 4XZUA 3OL2A 4YWGL 4X99B 5FAAA 2EYSB 3CIQA 3VSUA 3HA0A 2P8PB 2PYEE 1XGPB 4N3TA 4RH4A 2C34A 5BQ7A 2YPVL 2AJYL 2XFGB 2Y2TA 1HKFA 3X14A 3VGFA 1DBBH 1JZHA 3OKKB 4HMDA 3RGVC 1KXQA 3MBEA 3FU5A 1MLCA 2GVYA 1PBYA 1TYJA 1ZLSL 1JWMA 1CXLA 1JF1A 1XVSA 4JFFE 4PRIB 5F89A 5E0FA 2OMXB 3U7YH 4YSQA 3P4OB 2D7OA 4JDTH 1TU2A 2HN7B 4N2MA 3IBOA 4LDEB 3QUZB 3GINA 1N5AB 1F13A 4ZNCD 3IRCA 1P6WA 1RZ7H 4XWOC 2EJ1A 4YFLF 5DUML 3HC2A 4WW2B 4YSSA 2EC9T 5LCVH 3L13A 3VNYA 1FO0B 3NVQA 1JGDA 3FHQA 5IMKB 4FFWC 3W11D 1G1CA 5IB4B 3QNXA 4ETQA 2AW2A 1CXIA 3DBSA 1FZOB 3M1BA 2KYIA 4APQA 4OQ1A 1XB8A 2I9LB 3GRGA 4P3WA 4X83A 5AW6B 3DO7B 2JCWA 3CPLB 3VU1A 3IFLH 2F7PA 4NBZB 2LAAA 3REVA 3WSQH 2ADYA 2BVUA 4YO0B 2D0GA 1C16A 4JFEA 3MUUA 5EO1B 4W93A 1GHFL 5DURD 2E27H 3GD1C 4KFZC 4KI5D 3HW7A 3C8KA 4LKCB 2A74A 4QWWD 5EV7A 3WD5L 4OKVA 5F0LB 5C9JA 5FLUA 3L7FA 5E2TH 3MXWL 4BIKA 1NC4A 5F7AA 1KGCD 3KLQA 4G1MB 4GSQA 2Q10A 4PGCB 3SD5A 1QMUA 9PCYA 4ENED 1IBGL 1YYML 2E0PA 2EH7H 4KJYA 4M7LH 3QIUD 4Y16D 3ARGA 1J9QA 1I7RA 4QRQB 4R3SB 5T1LD 2QQNH 2OMTA 4GSUA 5GRWA 3GSXB 3W0WD 1BGXL 1HAUA 1HI6A 2YXVA 3LVEA 4EDWH 4YBQC 3LKQB 1T0NB 3TBVA 5MHSE 4A6YH 3UO8B 3FUEA 1V7ML 3JV6B 4GRWF 4TNGA 1PLGH 3VFNA 3K71A 4XOBA 1KB9K 2Y7LA 5DD5H 3LZLA 4JMXA 4XZ4A 1MI5B 1N7MH 1XF3B 2F7IA 1R5IA 2ITDA 3KLAA 1KV3A 3MRQB 2MKWA 4JY4B 4DVRL 1N6VA 3IAGC 1QTPA 1NPJA 2HVKB 1VGEH 1OARH 2WLZA 3L1EA 4YHLL 5ESQA 4Y2NA 4GQRA 4ZOEA 4J3VA 5F1OB 3TBTA 4QAWA 1RHHA 4BCXA 2X7LA 4DFHA 4PUBH 1DR9A 1ZPUA 4UT6L 5LDSA 4J3SA 2XICA 2DTML 5DLMH 4ABUA 3NJIA 1EXUA 4F7PA 5HHQB 4POYA 2E59A 2C5DC 1ZAGA 4OZHF 1U2YA 5AWNL 1KBPA 3QQ3A 4OI9A 1MSPA 3MR9A 4WUUA 4GAAA 3IF1A 1XR9B 3U36B 1B4JH 4C4UA 3O3AB 1TPXC 4N6RB 1ML0A 4MNQB 2JK5B 4XNMA 2G60L 4O51A 4N86A 4LLUA 35C8H 4KITB 2NMSA 5L2JB 1JZDC 3RWIB 1M71B 3UJIL 1SLUA 3FT4B 2VSKB 2VZSA 4N2NA 2D7TH 3ILEA 4XVJL 1UG9A 4RAUB 4FLRA 4NQDB 4IIQA 3CFNA 4FI6A 1LQSR 4J27A 1F3RB 3I3DA 2NXZC 1NCJA 3FTXA 3EYFA 1YJDC 5KTEH 4GKOA 4PJAF 2HVJB 1KN4H 5EU7C 1H15B 2IQAB 5CJQH 2ATKB 5DHEA 3EGDA 4IMLA 1G7PA 3Q5YA 3MRGA 2KLSA 1KIPB 3FUFA 1JBJA 3BPNB 3WIAA 1AGFA 1F6AA 2BIMA 2J55A 2X4QA 5DRXB 3RNQB 2W9DL 2XWRA 3MGOA 2ERJC 3RWEA 3KPLB 5EBMB 1U8KA 1IFGA 2R9HC 1IL1B 3CNKA 3LV3B 2OSLB 3QYMA 4PTUB 3A21A 2XVKA 2F1AA 3OMIB 3FCUB 3Q05A 1K4DB 4GH7B 4JUTA 1KFAH 5G5DA 4R7XA 2MOGA 4F3FA 2EO1A 3TT1H 1UD8A 3OWRA 3IVKB 3WGVB 1EDQA 1YNTB 4LF3B 4NN7B 3PHOA 4M1GH 2AKRA 4NRZB 3MLSL 1JK9B 1SJMA 2YO3A 1FZKA 5F7YC 5J57B 3WDIA 4GG6E 3JV4A 4X5QA 5KVDE 4N8VB 1E2ZA 1P9MC 1ET8A 3FT2B 2PPAA 4JM2B 1CLOL 5KS9F 4TXVB 2KZBA 4MJID 5KYUB 2WOYA 2ZOTA 2AQTA 3KGRA 2NR6C 1V7NH 2VH5L 3VSQA 4BUGA 4F7KA 3KLHD 1KB5A 1OW0C 2PR9A 4CDHA 5A3IC 2ZWKA 2PYED 3O6MH 4U3CA 4WKZA 4HC1A 5KYYB 5HXMA 2V7HA 5F71A 1AFVH 4Y5YB 1GGBH 4LCWA 5IOPA 4UM9B 4FKKA 5BOPA 2HLEB 2HYMA 4WJ5A 4OCWL 4AIZA 4QRPB 1T1WB 4RQQA 1IAKB 1LD9B 3HRZA 4P4KD 5D7LD 3U4EA 1CG9A 1NUFA 4JFFD 1V5JA 4W9FC 2ESVA 3O6FA 1QWHA 3BPOB 3QHTC 3QEQB 2VUYA 3SDAC 1I1AA 2IVFC 5EPMA 4XN4A 3VGAB 2B1OA 3EJYC 4KVNH 3ZKMD 3V0HA 3MROA 3EDFA 4YIQB 4JCLA 1W0WB 1NBYA 1PQZA 4JHZA 2WZ0A 4NQTA 3HLAA 1BYOA 2VJ8A 3JYCA 5EC1B 2Q76A 5F44A 2JCCF 2NX5B 4Q8BA 4F91B 3Q9QA 1TQTA 2FRGP 1RU9L 5DYOA 5DHDA 43C9B 5C2BL 2YPVH 4E9XA 1AE6L 2AJYH 4DVBA 3HCVB 1N18A 1HU8A 3L9RA 1XF2A 2N01B 1W16A 3PL6D 4YFEA 1CO1A 1DVZA 1T66D 1YUKB 3L3GB 4IGBC 4NPKA 4C55A 4LSDA 2DICA 3QPXL 1Z3RA 4N0RA 4PJIF 4UILL 3WCYA 4MA1B 1BLIA 2OA9A 5ILTH 2V8LA 3MRLB 1SEBA 3B9VA 3OPZL 4XOCA 4G3YL 5DJ6B 1Q9LB 1HYRC 4KROB 3KCWA 4PJ9C 3QQ9C 4XNYL 4HK3N 1A1NA 1E2WA 1MUJB 4J1UB 1U21A 1HEJC 1E3ZA 3LNHA 2Z9TA 1BP3B 3IKCB 3VXRE 2IALB 2ITEA 3CX5K 4HJGA 4RZCB 2XA3A 3DJRA 5MHSD 4F7EA 3UTTE 4KY1H 3HC0B 4IHOB 4E5XA 5DJYA 3FTZA 1I7UB 2WBJC 3PU7A 3UAJC 4AIEA 3B9KA 2NXYB 2DLIA 1GHFH 1W0YT 4GOSA 5F7LB 5DHYA 5CBAA 1FCCA 1KB3A 3LPWA 1H5BA 3WD5H 4HFUL 5FHAL 4CC0A 4ELMB 1OF2B 3QB7C 4FDWA 2Y69B 2Y5EA 4AUYA 4FLOA 5ITBL 4K4KA 4EVNB 3GSUB 2YEZB 1FVCB 2J43A 1P7HL 1IBGH 4PJXE 2ISDA 2CPCA 3O0LA 4I18C 3QGVA 3QDME 2VR9A 2XOTA 2X1WL 3PXHA 4KTDL 1MEXH 5D5MB 3ZQWA 4S2SA 1J88A 4JZNB 1BGXH 1S7XB 4NLAA 4R0LB 3UBXA 4YNYB 1FAIH 2DQUH 2PXYC 2FJSA 4O2FB 4UOW1 5A6IA 4A7QA 5J6GA 1V7MH 2VKXA 3MJWA 4JAMB 4HGKC 5I15L 3QK0A 5DEFB 1BECA 2NT0A 2BSDA 3QAQA 2BERA 1RZGA 3HB3D 2VDRL 2GSMB 3MUY1 4DVRH 4RA3A 4HHAA 3BCFA 3PV6A 1T2QH 1EJ6A 3L6FB 2HJKB 3A47A 2XN0A 4YHLH 1RJLA 3AC0A 4OI8A 3O41A 4NENB 4DGVL 5L88L 2V2TA 1H3XA 3ZE0F 4LVNC 4XN9A 5FYKE 1ZVSA 3IMBA 1U8LB 4YH6A 3NSYA 4TNEA 4FXTA 1F4YH 4R7NB 2X3BA 1F0LA 2EXYC 1TDQA 3IDNB 5DJXA 3GWJA 2FJFB 3WS6A 3CFDB 3EOTL 3E6FA 4K73A 3TEWA 4JDZA 1FRGL 1CBJA 1IBZA 2FIKA 3AQXA 5CCJA 1O75A 4ECNA 1BBJA 3NEXA 4IM8A 2NW2A 3K5SA 4Z9KB 4EZKA 1I8AA 1ZE3H 2QGCA 3ZMEA 4AGQA 4LHQB 5C1MB 3X12B 4EXKA 3WL9A 4GMSH 5GZND 2NLJB 3VYOA 4P49A 2A5UA 2NY3B 3NCCB 3GLDA 3MQIA 1TKWA 4JKPH 1NCUA 3QIBC 2CR0A 5AB0A 2LU7A 2ZICA 3BAWA 5AZEH 1XF5A 1XGRB 3CH1A 3S34H 1PNDA 1LEGB 1LE5B 4XVJH 4NSKB 4ICXA 2H6PB 4Y4KC 5GGSY 3VCLB 1OWWA 2ENQA 1NUDA 4OZGB 4A2FA 5DJDA 4MWFB 5CN3A 3BKCL 3OAYH 4MXQD 1HH9A 3CDGA 4GMTL 1A1MB 1LO4L 1FFQA 2BWIA 2EXWD 4P23B 1ZDQA 2FT7A 1CICD 4I85A 1MHCB 4I0PD 5BW7C 1L9RA 1KT2B 2J8UF 2X4UA 2OBGA 5TJWK 1MRCL 3P4MB 5JZ7D 1ET7A 2ZJSL 3EJUA 4CVUA 4JANA 3PREA 5EU6E 2W9DH 1A3RL 3CDYA 2A99A 4YBHA 3LEXA 3GMQB 1KCLA 4IRJB 1AD0A 2A9BA 3CHRA 3AT0A 3GSQB 4CVXA 3FTGA 2M26A 1KSRA 1E65A 4UM8B 2H3XC 3U1QA 4L8CB 2EIBA 3SJVE 3LKPB 3DVFA 2DQMA 2JXMA 2M1KA 1MWOA 3MLSH 1MY7A 4POZD 1EEYB 2FD6L 3WTWA 1AP2A 1RCYA 2Z7UA 4QCIA 1E27B 1P1ZA 4G9FE 2AF2A 3IEAA 4N2DA 3DX2A 4WNQA 3QXAB 3P9MB 4QY8B 2DBJA 3MZGB 2R1WA 1MCNA 4NJ9H 4U1KA 3V52L 4OLZH 5EUKA 1AZUA 3S8FB 1N67A 1E4WL 4K9EC 3QFJE 1W72A 1IJ9A 3SE9L 4R2GB 1PZUB 2TSAA 1L0QA 2AQ3A 3ZU8A 1A6AB 3GSVB 3EYVA 4TSBH 1EO5A 2KZWA 1AZBA 1A9EA 1X6LA 4IYKA 4ZAKA 3SYOA 2DIJA 5DFAA 3DPDA 3H9SE 1T7VA 1FNEB 1KENH 1NANI 4HZLA 5D7SL 4KGLA 3FTYA 5C70A 5JIPA 5FX3A 3H8NA 2RCSH 3D4ZA 3T3ME 5KN5A 2HKHL 2PW2B 3F6LA 4XXDB 1AGEB 5KYNA 1IM9D 2EYSA 5DK2B 1GGTA 4AUJA 1KGWA 1RZKH 4ZMVA 4HUMB 1D9KC 1OCOB 4L0PB 5E56A 4OT1L 3OKKA 5AQ0A 2BWQA 3DYMA 2DI7A 2K9FB 3VXRD 4O58L 4QRRA 1CDBA 2YMXL 4M3KB 1QPXA 4PRIA 1RU9H 2OMXA 3KCPB 4UDUB 3UTTD 2HN7A 1VFBA 2Y5TA 3QUZA 3FBKA 4RMTA 4L8SB 5DJ2B 2AV7B 5IWLA 5DRWA 1HEZB 2W9EL 3NCEB 2HLFD 2ZF8A 1TO5A 4POUB 5IMKA 5KANI 4JQIA 5IB4A 2EDRA 4UILH 5ICXB 3IGUA 4E9RA 4DW2L 1AGBA 3OXSB 4PJDB 1FZOA 4PP2A 3G5ZB 3EG9B 5JPNA 1ZANH 1E5AA 4HEPA 4ZYKB 3DO7A 1WZ1H 3KPSE 3P02A 4BZ1A 2IH8A 3GTNA 1OSZB 3OKNA 2H1PL 3KPMB 3ZZLA 4Z3EA 3QDMD 2BZCA 3NIFF 1ASOA 3DV6B 4DH2A 1CURA 4Z77B 2Q87A 1XGZA 4JL2A 2MCPL 1X9UA 3FW6A 1NGXB 2ZWNA 4BKLB 1NCWL 4IK7A 1CGVA 1OAYL 1IEBA 1X3DA 1YNLH 2AEQH 3CUPB 1QZNA 5IROA 4C4KT 3U0PA 2Z7WA 1O6TA 1IGCH 1JGUL 3BKML 4XO4A 1KB5L 5CU9A 5DVKA 4XNXL 3CDZA 4HC1L 2N7BA 3OGOE 1NH6A 3GXPA 2UWEF 1SQMA 3GUFA 3NCBB 4JZOA 4RSYA 3IMRA 4Y1SA 5EUOA 3BRDA 1TTFA 4QRQA 3VXSE 3FUNA 4XC3L 4CC4A 1NFKA 2DH3A 2ZXAA 4YE0A 5ACZB 1B0WA 4DOHE 2B9AA 3NMEA 1FVEB 4CL7A 1KZYA 2Y0SA 4ZUVB 1T0NA 2XG5B 5FYKD 1KPVB 1RUML 3KXFA 5IV2B 2AGJL 1CXFA 3P11L 1AH1A 1HDMA 3KR3L 3JV6A 3MLTB 1ZA6A 2VERN 2AQ2A 3WAJA 3TASA 4KTDH 3JV0A 3HG1E 3C6SA 1RZQA 2J2ZB 3R8BB 3EH5B 1GGYA 1UM5L 4F9PA 1MI5A 3MRQA 1XF3A 2ROYA 1YHPA 3EO1B 1QEWB 3CLEL 1SYSB 5E1QA 4PGZA 4FNLL 2SODB 1WITA 1ET5A 2IV8A 3SDDC 1A7NL 1FNLA 4YDNA 2H45A 4UTBH 1G7QB 4B7LA 3ZDXE 2EVFA 3MJ9H 2O5XH 1XR8B 4WQOA 4GP4B 3QNYB 4WKXA 1B2WL 1HEHC 2FZ3B 3V4VB 5C0BE 4PMFA 5HVFB 2WXFA 4DGVH 5L88H 4MASA 1AIFB 4F7CA 5CEYB 4EI6B 1LWJA 4JG0H 2XWTB 4HISA 4MJ2A 1EX0A 4OCRL 2VZ1A 4PAZA 4FA7B 3K8LA 1RXLA 3ETSA 3P3RA 2NY1B 4NN5B 1JZFA 2WXPA 3L4YA 3U36A 5EO9A 3KPNB 4WFHE 1BFTA 2FSDA 2OMVB 1FRGH 5CAYB 5DD6B 1AI1L 4AI7A 1GAFL 2Z8VC 4W1TA 3SPHA 3MRRB 2WANA 3FT4A 1AO7E 2CBPA 2P5WE 3GHPA 3MLXL 1T4KB 3FO1B 4PS8A 1QSVA 3SIKA 4FFZA 2CG9X 2X4RB 4RAUA 5KBMA 1P5VB 4NQDA 5EU6D 3VD5A 4WF7A 1Y1UA 2F5AH 4JKMA 4V1DE 1ZDSA 5ISZA 3H2WA 3FU3A 1YLBB 1WIUA 1V8HA 5L4IA 2HVJA 2DQFB 1BQLL 1H15A 2A77L 2XG4A 5D7KE 5KOVC 4KUCF 5SX5H 1KYAA 3BVXA 4YXKH 4BD4A 1KIPA 1K85A 3SJVD 2LLLA 2VLKA 1ROCA 3JVGA 5I30L 3BKCH 4KKBD 3QXDA 2VW7A 2VZTA 4AKOA 4FFWD 4G9FD 3OHXB 5I5JA 3KPLA 5EBMA 3JTTA 4EN3A 1S9YA 2VDOL 1S5HB 4BFNA 4EQ2A 4PTUA 1I8UA 1VEOA 1CLCA 3B3IB 4IJ3C 4O5LH 4QLRA 1K4DA 2C9SA 3T4AB 3ZQ9A 4ZMPA 3QFJD 1MRCH 4OLUH 2BXYA 3IJ9A 2PPFA 2ZJSH 1QNZH 4KRPB 1R3JA 1A3RH 2EEDA 2GK0A 4LF3A 5KVGL 3HN3A 4PVBA 3R06A 3B56A 4CGUB 5LHDA 4JS7A 3FZUD 4NRZA 2C1PA 1JK9A 2Y7MA 4HXAL 4G70B 3BIAX 3FQTA 3UP6A 5KSAB 3GMPB 1DVFD 4BHUI 4WCYH 2DAVA 2OP4H 3BPLB 3QNFA 1FL3B 4XNQB 2IAAC 2ZQKA 4Y19A 1BM3L 1NGWB 1DCLA 4MCYA 5KYYA 3D4GA 4PJ8B 4M6ML 5K9QI 5M7QA 3BEWA 2MQ0A 3ZZQA 3PAVA 4IDJL 1NJ9A 5F0JB 3TA3C 4A7GA 4D8OA 3RTQB 1LD9A 3UBFA 4EIGB 5HYFA 4ISVA 3WTTA 1HXMB 1CDYA 4S10A 1E4WH 2AJSH 1OXYA 4P2YA 3ESUF 4UT7L 3UTSB 4S0HA 3VI4E 4LP4A 1DJXA 4FA6A 4ELDA 3SE9H 4RISL 2YPKB 2E7LC 4N1EA 3WJMA 5A2FA 5BUPA 1PG7L 4NKIH 3L3KB 3U1PA 4TNWK 3U4BL 2XVGA 1KF9B 3DJTA 4XCFL 3EJZD 1W0WA 2VDNH 3CXFA 3H3PH 4CU8A 1LVEA 5I5MA 5J11C 4PFEA 5EC1A 2WLKA 5HGBB 4WJG3 4GBXB 3MGTB 3MHZA 3Q2NA 3KPSD 3TX4A 2WVTA 3RWGA 4OCXH 2RH0A 3EADA 1X7SA 5IFJA 4OT1H 2X1QA 5BVPL 1L0XA 5A1AA 5CCKL 4ZMNA 2PO6C 2DI8A 3BSHA 1BOYA 3GPSA 4KPHH 4N20A 4O58H 1VJSA 2CHWA 3WUWG 3EBHA 4OCLC 4MDJA 4WO4C 1AIZA 1OP9A 4CA4A 2ZXWB 5DJ6A 1JNJA 4GAJL 4KQ3L 3P2DA 1A6WL 4Y9CA 3VFSA 1FIGL 2P43B 1FLTX 3S36H 5E08H 1GY1A 4OFYA 2J5LC 1G9NL 2APWA 3ARBB 1ZLEA 3BZ5A 4NERA 5FYJL 4J1UA 5JIKA 1TZIB 3X1GA 4G42B 3VACA 3P40A 1HHIA 4DW2H 4UDTB 2Z91B 2FEEL 4LFHG 4QHLB 2P47B 4BZYA 5B3NA 2Z4QB 5B8CB 3BAIA 4KU1A 4NO0D 2BC4B 1VFAB 4NUJB 4XBMA 2NXZD 2V3DA 3ZUCA 1Z3GL 2H1PH 1I7UA 3D09A 2Q7AA 1N12A 3ROOA 5FKPB 3HG1D 1E9PB 1Z9PA 4XAWL 4OH2A 4G8GB 2MRYA 2ZAGA 1BMZA 1UT2A 1NCWH 5E8EB 1RK1B 3QG6B 4M4PA 3SGEI 3D25A 4HUUA 5I5RA 4GW5B 3ULUF 4YHOL 3BKMH 2E7MA 1JGUH 4ELMA 5E4AA 2WVVA 4AXWB 2AZUA 3CSTA 2NQCA 3TNMA 1JVKA 1W72L 4JN1H 5CZXD 4EVNA 1M7IB 1JS4A 4GXUM 3SDXE 1IGJB 1Q0XH 2R9HD 4QXWA 3F7VB 3TP4A 1XD0A 2FBJH 3OQ3B 4R8WL 5C0BD 3D2UA 2ORBH 1P53A 4JBSA 4PRPB 1JPEA 4FG2A 5KUMA 4K3DH 1S7XA 2Y6TE 2Q8AH 4I0CC 4AZUA 4ELKA 5EO0B 4OGYL 1HH6A 2EAEA 4P9ML 1S9KC 4PB0L 1RUMH 4DEPB 3G5XB 1U91A 2NY2B 4A7SA 4FQ1H 3GKWL 5DEFA 1X5HA 2VN5A 4NP4L 3APMA 3MV8B 4KMTL 2BSRB 3H4FA 4WFHD 4HJJL 4X4XB 4XBPB 4UOJA 3SGDI 4M3JA 1C8PA 5E51A 2Z7ZA 3MFFB 4JRWA 3VM5A 5DZNA 1PKOA 3CLEH 2HJKA 2NR6D 3QEGL 1AO7D 1ASPA 5EZLA 1GJWA 1KCUL 4PGDA 3VXME 1P4BH 3UYPA 4HP5A 1NCCL 1GIGL 1MIEH 3I3EA 4LARL 4R4BB 4WENB 3CFCH 1QSFA 4RDQG 4P59H 4EI5A 3KWTA 4V1DD 1U8LA 2H3NB 4G6JL 4N9GB 2BO0A 3FB5B 5JLZB 5PCYA 3D85D 3DUHA 3VO0A 4R7NA 3QZBA 1JI1A 5JO5B 1B2WH 3IDNA 5IHZB 2BM3A 1ZXQA 3CFDA 5HHME 2FAUA 3HBGA 5D7KD 2YD2A 4B9ZA 1F58L 4FYTA 4JQIL 1FFPB 2E9WA 2ZG3A 3L81A 4LSQL 4OCRH 4PCSA 1TZ8A 3A6BH 1IC7L 3QI9C 1J8SA 2AJZA 3QAZB 4XO8A 1ULVA 4X9FA 2BP8A 2NDFA 5HHOE 2MSPA 5IB5B 1U36A 3MREB 4ANUA 3VB9A 4BZ1L 1QI4A 2F5BL 3LY6A 2NTFB 2NLJA 4P5MB 3RVUC 1HK6A 4FQIL 4W9IC 1KCSL 1GAFH 1NFIB 1ADWA 2E6PA 2DB8A 3SQBA 1HINH 4NQXA 1JNNH 4QIRA 1L7IH 4S0TD 4J39A 3GNML 1XGRA 1AMYA 3GQFA 3MLXH 2YJLA 3JQOB 4R4FH 3ZY7A 2A7BA 1OGAB 4JFDE 1OB1B 4NSKA 2H6PA 1QWNA 1X5FA 2HZHA 3EDDA 4Z8FL 3VCLA 4RGOL 4UNVA 3B2VL 7FABH 5GS0L 5DJZB 3C5ZD 4X6DF 4F27A 9CGTA 4DESA 2CDEB 1Q94B 4MWFA 4XNZC 2A77H 4X6CF 4N68A 5T33H 4LK4A 1A1MA 4P23A 4I3SH 1Q9KB 5C0AA 1MHCA 1BYNA 4X8GA 5ICUA 4HKJB 2O6DA 2FHBA 1SDDB 1EO7A 1MWAB 1NAMA 1XB6A 2KUTA 2EDDA 3DDFA 2DWTA 1JG9A 3AREB 2H2PC 1LMKA 3S35X 1F00I 4P2OB 3PG2A 4JO4H 2Z1KA 1T7YA 3DX4A 3GMQA 2VDOH 2DM2A 1EJOL 1FBIH 5ERWB 3RDTB 4BFFA 1JNLL 1WBYB 1UKQA 4H1LH 4N2IA 3K2UL 3TN0C 1RKRA 2WBJD 3BGMB 1Y07A 5KVGH 2PWFA 3VFUA 3WTYA 4LHJB 1A4KB 4LCCC 4N0CC 2WKOF 4JJ5A 1EEYA 5EU5B 3WHE0 2WWKO 2OL3A 1TNMA 5BNXD 4NZTH 1E3XA 2BVPB 3QXAA 2LU3A 2W8CA 3P9MA 4QY8A 3CDCA 5HDBF 2J44A 5IEKA 1I9RL 4N2FA 4P3DB 1BM3H 3GZOA 2QPEB 3PWLB 2DM3A 4MBRA 3V5DA 3FU0A 2NY0C 4M6MH 5H8DA 1WISA 1NFDB 2ZKHH 2WYIA 4UMSA 2IPKA 3Q13A 1R19A 1ZT4B 3BQVA 3O4LE 5J9PB 2VDKB 3DO4A 3ZE1B 4PLKC 4UT7H 4N2OA 2M2DA 4YHML 1N10A 1T89A 4RISH 2CGYA 2XDHA 4PRBB 2ZZUT 3FNKA 3LX9A 3UJTL 4FC3E 3LYRA 4Z0BL 3MMEA 4FFZL 4UQDA 4B97A 2EUXA 5DK2A 5E5RB 2VYRE 4TKWA 3U4BH 2WLLB 2ZE0A 4XCFH 4YSDA 3N1GC 2UZIL 3FUIA 5AAMC 2DLFL 4P2QB 1QX1A 2GUOA 2YD9A 1S78D 2ROXA 2HJLB 2ZOUA 4WI8A 3FFOA 2GIXA 3A3YB 4GRLC 4JY5L 4XP1L 4LU5L 4KC3B 1GPOL 4X8CA 4XMWA 4FX5A 5DURB 1IFHL 1T83C 4DJMA 5BVPH 4F15C 2X6AA 4NNPH 4L8SA 2AV7A 3HAEB 4H40A 1Z6JT 4FQXB 3T4YB 5FKAA 5J3HC 2X4NB 4H20L 2NCMA 1KBGL 4YHKL 4PJDA 1KC5L 1RSYA 4GAJH 4KQ3H 3BT2H 3EG9A 3G5ZA 2Y5QA 3QIUB 1E40A 4Y16B 4FGMA 4BV1A 5T1LB 4GY4A 3CGTA 1G9NH 1F5WA 2UZXB 1OSZA 2NDGA 2WIMA 1BBDL 3QIBD 3IDJB 1I85C 4HIJA 5FYJH 1TJHL 3W0WB 2F19L 4F8NA 5ICYA 4X5WA 2YGNA 5SX4H 1SLVA 1XGTB 1IAOB 4NYLB 2LABA 1NGXA 4BKLA 1EH9A 3PJSA 4HHGA 3VW3L 4KDTA 4ZDHB 4PS4L 1MJ7L 4BUHA 4N0UA 3VH8A 3GM8A 2EDMA 3MV7E 3DX1A 3TVMD 2J21A 2A0LD 1R3IL 2WXMA 4JLRB 2XWBB 3MBEC 1UA3A 1O9ZA 4JL1A 4XAWH 3S88H 4JFUA 3NZ8B 4YDLB 2AEPL 5I71B 1UACH 3GXIA 4WSKA 1J1PH 2YOCA 3CLFL 2QDWA 1VERA 4YHOH 4MMXC 4WFGE 1M2VB 2L04A 4S1DD 4KTEH 4WK4B 3VXMD 5ACZA 1KTJA 4R97C 1I8LA 3OLIA 5CSZA 1V3MA 1PLAA 4JFYB 2OKMA 1KPVA 3VG0L 1YEDA 4XCNB 5FIEA 3CD4A 3RZWA 2ZXGA 4GKSB 4L9LB 2J2ZA 4FL4C 1BZ9B 5HHMD 4DETA 2GI7A 2R56L 3LRSB 2DIAA 4UQCA 4XX1E 3O0RL 4HAKA 4TOYH 5C08D 2HLAB 4P9MH 2X6VA 1SYSA 5D2NB 5JXAL 3PHSA 1CPUA 3QXUA 2DV6A 3DHUA 2WP3O 3HS9A 1CS6A 2UXVA 3V8CA 3MRKB 5HHOD 1EFXD 3FJTA 4KAQL 3FB6A 5D96C 1NC2D 4KMTH 1H19A 3MNVA 1G7QA 5JXEC 3CZFA 1E28B 1S8DB 2E56A 1O6SA 2J88L 3FCBA 5JA8B 3CZUB 3QNYA 4FG6C 5JW3L 3V4VA 1IKNA 4XX1G 2EEAA 1XH2A 2WO2B 3QC6X 4UANA 1KCUH 3DTUB 2ZCKL 1AIFA 1GIGH 1XAUA 4JFDD 2XXFA 5MI0C 2XWTA 2J6EH 3LNGA 1QFUH 2MFNA 3QJHB 2R0KL 2X05A 1H3WM 1I3UA 5D1ZA 1VFOA 5C0DA 4GUPB 2CHZA 3ARGC 2KDGA 3GS7A 3KPNA 3VNZA 3WXWL 1T7ZA 4JQIH 2YLKA 5DD6A 4XN5A 3QIWC 4N24A 3CE1A 3NFPA 4G7YH 5D7JD 1IC7H 2X2HA 3FN3A 3KH3A 4JFQA 3TCLB 5E00A 4BZ1H 2GI0A 2X4RA 4IDLA 4MD4A 5FYJU 1P5VA 3IGAB 4WW2F 3K2MC 4L18A 4G8IA 1I1CA 3KYNB 3FQ4A 2YQ2A 3SDCC 2WNKA 1UD2A 3RIAK 4U0RB 3TEUA 1RPKA 2GBTA 5GGRA 1BXXA 1J11A 3NCYS 5JMRA 4C56E 3ZZ1A 3V6FA 1U8QB 1QBMH 4QRUB 4NQED 4WGKA 5JW4R 3SKMB 1HKLL 5IR1A 4Z8FH 1OSPH 4RGOH 4JHVA 3B2VH 3ZYIA 4DPAX 3BD4A 3EYQC 5I6KA 5KSBB 4WEBH 4MJIB 3LEYL 4EZLA 3WYRA 3ZK0A 4QYAA 4J2XA 1TITA 4DN3L 4JCWA 1S5HA 2PYEB 2R69H 5EF3A 2EDKA 1G7MB 3BZFA 4A63A 3QYCA 2JJUA 3NPSC 4UQ2B 4F5CE 4LBAA 3T4AA 4BWUA 1JPSH 3S8GB 4ORGB 2PCFB 1U4EA 2PUQT 4H4NA 4DP4X 2UV3A 4P4KB 2V17H 4NWUL 4W6XB 4KX9A 3KWXA 3LD8B 2O26U 4JFFB 2X1PA 4ZJ9A 1F3DH 1EJOH 1R33A 2E47A 4WEEA 2BOBA 4NC0B 3O4LD 4BM7A 1IBFA 3GMPA 3K2UH 2D0HA 3KPTA 3N5AA 4XNQA 4IIQC 4JQXC 1OCRB 4CDGC 4Q56A 4YHNB 3T77B 3CHPA 1VCAA 3P4NB 1X7TA 3QORA 5EOTA 3CCHB 1OAZL 2R2CA 1BDYA 1WWCA 1YQ2A 4ADGA 3NZSA 4YR6A 2CA3A 2HTKD 3LKOB 3LJ3A 2H47C 2FLRT 3RTQA 5IJCC