3MBWB

Crystal structure of the human ephrin a2 lbd and crd domains in complex with ephrin a1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
127
Chain Sequence
b'DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Architecture of Eph receptor clusters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 27
structure length 127
sequence length 130
ec nomenclature
pdb deposition date 2010-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3mbwB00
4DP9X 5B1AB 3WNIA 3AY2A 2HX9A 1J5DA 2CCWA 1MG3C 2PLTA 4Q8BA 3UADA 1AANA 1HFUA 2EIJB 1ILUA 3TU6A 5B7EA 2LLNA 2PPAA 4A2FA 2PP8A 4YSOA 4DP7X 5TK2A 2FNWA 2Y69B 2AVFA 1BQKA 5D4HA 3ABMB 4KO6A 1N70A 4RH4A 5B3SB 1JXGA 5B7MA 4X4KA 2XYBA 3SQRA 1AS7A 1AZUA 2CALA 2YAMA 4K9JA 2BHFA 2BP8A 2VSKB 2FT8A 4DP4X 2Q5BA 3NSDA 3WI9A 2BW4A 3NSYA 1MG2C 1BXAA 2YXWA 2XV2A 4PAZA 2YQBA 1MZZA 2IH8A 3OMAB 2PCYA 1OE1A 1SDDB 3FQYA 2J56A 2EIKB 3EH4B 2FWLB 2OV0A 3AG3B 5I6KA 2AFNA 3OD3A 3KW7A 3NJGA 3WKQA 4HCIA 3PLYA 4WKXA 4KO7A 1EHKB 2J5WA 1AACA 1TKWA 4YSRA 3FQ2A 3NT0A 2EILB 2H47C 1KGYE 1A3ZA 2ZONA 4YL4A 2HRHA 2RACA 3FSWA 4JHVA 2VMJA 2N0MA 4KO5A 3T6XA 3ZIYA 2XXGA 3TA4D 1L9QA 3WKPA 3S8GB 2GIMA 2QT6A 1ZDSA 1XMEB 4DPCX 3AG1B 4DP0X 3BVDB 3T6WA 3NP3A 4YSDA 1GY1A 5F7BA 4E9SA 3S3DB 2MTAA 2PP9A 1JZIA 2WO3B 4N4YB 5I5JA 3HEIB 4NERA 1NWOA 2XUWA 3OQRA 1BEXA 2CBPA 2UXVA 4EF3A 1OCOB 2X87A 3CDZA 1GYCA 2BZCA 1DYZA 1PZAA 1WS7A 1ZPUA 1I53A 3T71A 1PF3A 2YXVA 1T5KA 3SBQA 4BWWA 3FT0A 2OJ1A 3D12B 4NB7A 4Q89A 1ASQA 3DKHA 5I6MA 1WS8A 7PCYA 1RCYA 1FA4A 3JT2A 1OE3A 1BQ5A 3WNJA 4QLWA 1QNIA 3FU8A 3IBOA 2VW6A 1J9RA 1BAWA 2BP8B 3ZBMA 3CG8A 3NJNA 4KOCA 5B1JA 1L9SA 1PZBA 4HIPA 1NWPA 6PAZA 1GR7A 3S3BB 2DV6A 3QPKA 1SF5A 3NJJA 2UX7A 1B3IA 2GC4C 2VW4A 2IDQA 2XVBA 3QJSB 1WA2X 1AG6A 2BZ7A 3S8FB 4AKOA 2FJSA 2ZWNA 1E67A 3FU9A 4E9WA 8PAZA 1AG0A 1PLAA 5D4IA 3IN0A 4GP5B 4HCFA 1KBWA 3PXLA 5PAZA 3X1FA 4E9XA 4F2FA 3T9WA 4YSUA 2P80A 1JZHA 2FQFA 4AZUA 3H4HA 2DWSA 5AZUA 3ASNB 3H4FA 5AKRA 3TASA 2VSMB 1XB6A 1GS7A 4KNUA 4A67A 3UAAA 3QJUB 2IH9A 5EHFA 3H56A 7PAZA 4GYBA 4DP8X 2B08A 4BK5C 1SFHA 3SBRA 1BXVA 1PCSA 1V55B 3X1NA 4YSQA 1GS8A 5TK4A 4ENZA 3QJRB 3EH3B 2W8CA 2Q9OA 4E9TA 4FAAB 1JXDA 3T6ZA 1JZEA 5FC9A 1AOZA 2FT6A 1NINA 2CUAA 3UABA 1RZPA 2HX8A 4L0PB 1KYAA 1BXUA 2PPEA 5LDUA 5F7AA 3NSCA 5I6OA 2H5UA 2AZAA 4A66A 3FQ1A 1AIZA 1IBYA 1GS6X 4DP6X 3CDZB 1MDAA 1V54B 4G7QB 1PNDA 3N2JA 4HHWA 1TU2A 4P5RA 3UACA 1X9UA 2FTAA 4WTQA 2IWKA 2QPDB 3TBCA 1ETJA 2YAPA 4W1TA 3RYMA 2I7OA 4BDVA 1AR1B 1OCCB 4N8UA 5I6PA 3EF4A 4F7KA 3OM3B 3NJHA 3DIVA 3HB3B 4G7SB 2DYSB 1AQ8A 4UF7C 3IE9A 1NIEA 1WAEA 2XXFA 3IEAA 1TEFA 4KOBA 3NP4A 4GY4A 4PCYA 2DY2A 3G5WA 3IN2A 3FU7B 1HAWA 3MBWB 1EZLA 5B7FA 3X1GA 2FQGA 1AZRA 3QJVB 4YSAA 2I85A 1YLBB 1JVOA 3PCYA 4JHUA 1W6LA 4TXVB 2XX1A 2XX0A 3PAUA 2UXGA 2BW5A 1AZBA 2FT7A 3X2QB 2TSAA 3U25A 2BWDA 2JFCA 4A2DA 6PCYA 4M4RB 1NZRA 1JXFA 1MZYA 1JVLA 2MRYA 1CURA 5B1JC 1XB3A 2XLLA 1J9QA 3UGEA 4UAHA 4HHGA 5D4JA 2YAEA 3FSAA 3FYEB 1OE2A 2HLEB 5I5IA 3ZDWA 2YAOA 2IDSA 2EINB 9PCYA 2XV3A 2PPFA 1NDTA 4FA7B 2XWZA 3OMIB 1L9TA 5I6NA 1W8EA 1NPJA 2YAFA 3CVCA 2OCCB 1M56B 1KBVA 1KCWA 4MFHA 4JKNA 4G72B 4AI7A 2VM4A 2AZUA 3QQXA 1V10A 2UXFA 2YAHA 1OCRB 4W9ZA 1VLXA 4BXSV 1GSKA 4YVNA 1JZGA 4YSEA 1OV8A 1RKRA 4BDVB 5AFAA 2JXMA 2EIMB 5I26A 2QPEB 4GP4B 3V9EA 3UAEA 2DWTA 4E9YA 1OF0A 2BWIA 2W88A 3WIAA 1E65A 2FQEA 2HRGA 4A2HA 3NYKA 1L9RA 3AZUA 4YVUA 1F56A 4QKTA 3CVDA 2QDVA 4M3HA 2IDTA 1A4AA 2FQDA 3S3CB 5E9NA 3GXUB 4AKPA 2VW7A 3SBPA 1J5CA 3PAVA 1NPNA 3NJIA 1ZIBA 2PPCA 3TBBA 2R7EA 1BYOA 5I28A 2X88A 1ASOA 1A65A 2YAQA 1TEGA 1ZIAA 2CJ3A 2IDFA 1J9SA 3ERXA 1ET5A 3GDCA 1ID2A 1M57B 1A4CA 1BYPA 3WG7B 1ET8A 2VM3A 3BQVA 2ZOOA 4GP8B 3DTUB 1E30A 2P80D 4YSPA 1FFTB 3ZX1A 3X1BA 1N68A 1AZNA 2UXTA 1URIA 2TSBA 4YSCA 4AKQA 2CAKA 2GBAA 3N55A 1E5ZA 2PCFA 3EH5B 1RZQA 1IUZA 2GHZA 2VN3A 1BQRA 4G70B 1UATA 2J55A 4G71B 1OOWA 1SFDA 3AW5A 5I5MA 2WO2B 1QLEB 5I6LA 3T6VA 2IWEA 4BWUA 3V9CA 3JTBA 3PAZA 3PPSA 5IY5B 3AG4B 3AG2B 4KO9A 4DP2X 1HAUA 2PPDA 3KW8A 1SNRA 3ABKB 1NIBA 1J9TA 4A2EA 2BP0A 2PP7A 5ANHA 1FWXA 4HAKA 3ABLB 1L9OA 2GC7C 4F2EA 3ABGA 3MX0B 1PY0A 1SF3A 3ASOB 1WA1X 1M9WA 1ADWA 2Y1AA 4HZ1A 4A2GA 4BXVA 4A68A 4HCGA 5A7EA 1GW0A 1ZV2A 3QJTB 2DYRB 2QDWA 4YSTA 1A4BA 1JZFA 3CZUB 2UX6A 4P5SA 1AZCA 1GY2A 2A3TA 2H3XC 1IC0A 1X9RA 2HXAA 1ASPA 1NIAA 4AX3A 3FYIB 1CC3A 2R7EB 2IDUA 1PLCA 1PZCA 1SJMA 1OCZB 1CYXA 2BO0A 5PCYA 1AS6A 1KV7A 4E9RA 2ZXWB 1R1CA 1NIDA 2XV0A 1PAZA 2HX7A 1NICA 1PNCA 2AANA 3NJLA 4HALA 2HZHA 1L9PA 4GXFA 2GI0A 1NTDA 2NRDA 1IKOP 4G7RB 4CSPA 2E86A 3EHBB 4BWTA 2GSMB 4E9QA 1ILSA 2WSDA 4CSZA 2XU9A 3FSVA 3NJKA 4DP5X 1SDDA 4ZK8A 1IBZA 3L45A 1PMYA 3OMNB 1QHQA 3X1EA 3NSFA 4YSSA 4NAJA 3QJQB 2J57A 4DPAX 1E5YA 2IAAC 1KDIA 1W6WA 1JERA 1PLBA 1WA0X 2B3IA 3NJFA 1ZDQA 4KNTA 1XB8A 3FS9A 1ET7A 1SHXA 2I7SA 4UANA 3CVBA 3FPXA 2YARA 3FU7A 2GB2A 4KNSA 3FSZA 4DP1X 4E9VA 1KDJA 3NJMA 1A8ZA 1NIFA 1CYWA 1JZJA 1AAJA 3FPYA 1SHWA 4DPBX 1CUOA 3C75A 2BP0B 5B1BB 1JOIA 1KCBA 1AS8A 2IWFA 3GYRA 2JKWA 1DZ0A 5B1KA
chains in the Genus database with same CATH superfamily
1QNZH 3LS4H 4PG2A 4Y16A 4MX7A 5ESQB 5CZVH 3GC3A 1B0IA 3LH2H 2BFVL 4N1HB 5D55A 3RIKA 2Y5EA 5I66A 2PABA 4Z5RB 1XIWC 4FYSA 1EFXD 2W59A 1HFUA 1S9YB 3CVIL 3BAEH 2WTRA 4OLZL 3OZKA 5C0BE 4JO4L 1NAMA 3ZT6A 4R4BB 2VWEC 4LCYB 4OZGB 4DFIA 4LHUB 4YSOA 4JAMB 1XR9B 5DC0A 3DBSA 5HHQB 4DVRL 2EH8H 5KOVC 1PIFA 5C0FB 1VEOA 2N7AA 1LLAA 3HG0A 1OAZL 1QWHA 5DJAA 3Q7JA 4PJ8C 1F4YH 1TMQA 3X11A 5I8KL 4ZUVB 2WN2A 1AQMA 1MI5E 3MA7A 4HGWA 4ODXB 3VXNA 1QA9A 3FOLB 3UC2A 4NKOB 4I4WA 4IRZL 3B9DA 5FCUL 1PZ3A 5D72H 4E68A 1AOHA 2JJSA 3MYJA 3JWNE 4PB9H 4KJPC 4IU2A 3WI9A 3S37X 1UJ3A 3HR5A 4JFXA 2AV1A 1SVCP 4JKPL 4KC3B 1SYVB 1JL8A 4PS4L 3UAFA 2JELH 1FC2D 1KGXA 4K8RL 3T0EA 1ECZA 4HCIA 5IVXE 3NVQA 2XWDA 4WFHE 4OB5H 3WMPA 5H37H 1BVKA 5KSAA 3K81A 3TBTB 5DQDL 4ZS6C 2XBZA 4FHJA 5BRZD 1KGCD 3ARGD 4LDOB 2YXFA 3BLPX 3FSWA 1GGBL 4OSUL 4UQBA 1JGIA 5LQBH 3AWEA 2IGFL 3VD2A 1URLA 3NIDB 1DCLA 3N9GH 4QXGL 3AG1B 4DGUA 2YK1L 4JB9H 2C1OB 3MV7A 3HB3C 4PS7A 2E7LA 2EYSA 3BVDB 1M7IB 4JZNB 3NP3A 3R06B 4HFWA 3VQMA 3KYKL 3LNGA 3EYVB 4LP8A 4MQSB 1JNHB 5JOPD 1G6RL 1BBJA 2HTLD 5JPMB 2ZXGA 2FBRA 4FXKA 1F5WA 1TJHL 4HMEA 1RHFA 4LCWA 5GSVA 4F80A 2F2HA 4LSTH 5IB5B 1OCOB 3P9WB 5FUZH 3VXTB 5L4MA 1IC7H 5C0EA 4K2UL 2E7HA 3OLGA 4YNYB 1YG9A 1KBKA 2HFEA 3H9SE 1GCFA 2WLHA 3IDNB 4IRZA 4YBHA 2EYRA 4LK4A 5EBLA 4D3CH 4DVBB 1XGUA 1DJYA 4Q6IA 3C87A 1DO6A 4PJAB 2G3NA 4M7JL 2IBBA 4UYPA 2OXGB 2BRRH 2XXCB 1RZFL 5HDBE 1DN0B 4BH8B 4WWKB 3JT2A 5H2BB 3UIYA 3WEXB 2ZWSA 1NUDA 3IDYC 5FUOL 1QNIA 4ZSOB 1E27A 3O2DL 2C3WA 1XXFC 3P77B 5F9WB 1JZ5A 3U7YL 1MJ8H 2F74A 4LOEA 1CDGA 4IBSA 3EOBB 4HIPA 2X89A 4J6IA 4U3CA 5DJYB 5SX5H 3V0WL 2DV6A 3INUL 3WSQL 3LPPA 1ONQB 4K7PL 5FK9A 1A4JB 2FJSA 4ZPVA 4X4YB 1XCQA 43CAB 3GQFA 4ADJA 1AG0A 2NTFB 2LU5A 2H3NA 1CGVA 4ETQA 3S3SA 4HUWB 3V4UH 3FH5A 1ZLEA 4M8QA 4KGLA 4MMXB 3H3KA 1W72B 5DJZB 1TZOA 2IANE 1MHCA 2R4SH 3KDPB 4JEGB 1LP9B 4PN6A 5E51A 4EZJA 1G6RA 5GGSA 3POHA 1P7QB 2DMKA 5EIQA 2OI9B 2X41A 3QEHB 4RMWA 4OV6F 1RUAH 1WAAE 1OQOA 1NGPH 2KDYA 3GLZA 3GSXB 4MGXA 4LLVA 4XI5D 5EOTB 4CVZA 3G6DH 3WTVA 1UA6H 2HG0A 3KPOA 5BVPL 4JM2A 4YHPB 2PYED 5E7BA 3BWAA 3JVFC 4PJIB 4NSKB 2KZBA 1UWGH 2J44A 1XH3A 3AXLA 4HOZA 2FX9H 4APQD 3I02A 1Y1DA 4R83A 3RZWA 4A66A 4FTVB 3UTTA 4TULL 4FFZL 2QMJA 4NYLB 5ICYA 3LKPB 3O2DA 1N3NA 1RK1A 1RK7A 4QDGA 3LKNA 3JV6A 2HJLA 5HHNA 1SYSB 5I71C 2ETWA 1OALA 1OVZA 3EFOB 4L18A 1QSEE 4N0FB 4DUVA 5GS1B 3KXFA 5TPWL 1DE4A 1CU4H 1KIUB 1LK2B 1IGJA 1U91B 2AK4E 1ACZA 4YXHH 4PJFA 1MCSA 3F05A 4YE4H 3B2UC 5BS0A 4N25A 3W38A 5EWIH 1M42A 1U8PA 3NP4A 2IH1B 4GY4A 4I7ZC 5MEOA 2QKSA 2G0LA 2WLLA 4TQIA 3FB7B 3IN2A 4I85A 2F0CA 5IHZB 2Q20A 1IL1A 5F7NC 4UTBA 2LAGB 2ZT9C 3RI5F 4FNRA 1R3JB 3EYUL 1QLRB 2OMVA 3ZDXF 3L13A 5ISZB 1ES0A 1QW8A 2QKIB 4P5TD 3IPEA 2CSPA 3V0FA 4Z7WE 2XFXA 3MZTA 4EIUA 1B0RA 4UZSA 3KYMA 1TQBC 3NFPA 5T1KA 5C3IA 3HG2A 2C9XA 4XCYA 1NZRA 3FQNA 5EULV 4PRDB 4B9JA 2Y3NA 2MIZA 1ZGLA 4GW1B 2WBJA 4WO4D 3TO2B 5I19H 4GSDL 4AGLA 2BM3A 3VGDA 5GGRA 4NPJA 4Q2ZB 1EEYB 4QRPD 3O3BB 3SDXE 2PW2A 3JWOL 3TO4A 3NPSC 3Q1SL 3MRKB 1BLNA 2ZAGA 4GQ9H 1UWYA 2VQ4A 3M45A 3ELQA 3N43B 4TYUA 5FGBC 3MAWA 4HF5H 1KJ2H 3B7TA 1H3PL 1W8EA 4FTDA 2CO6B 4YK4C 3WTTA 1T3FB 1YDPB 2QQNL 3KLAB 1N0XH 3FZUD 3L7EB 1KTBA 4AM0B 4JFEB 1BAFL 1P2CA 2CGYA 4U6YB 1WBXB 3UO1H 4P4KB 4CSSA 4E41A 1DBMH 1WSST 4PW9A 4Z0BH 1ZLUK 2AZUA 1BFTA 1U8QB 1TZAA 4LARL 1FZKB 1B6DA 3VXMA 4CU6A 2NY0D 4OJCA 1P1ZB 3CX5K 5M95B 3S7GA 1RIUH 3GNMH 4Y88A 5AFAA 3CCHB 5MEPB 4XNDA 3FB8A 3L5JA 4S0TD 5HGDA 2ATKA 1E65A 4HP5A 1WVZA 1CFSA 1FP5A 2XPYA 2P8LA 2OTWA 1UD8A 4YVUA 3BP5B 1AR1D 5KBLA 4XCNA 4TSBL 4XO5A 1AGDB 1EHLH 2CO7B 4K5OA 3MRHB 3QUXA 3RWEB 1VESA 4WI3A 2JKLA 1VFBA 2AK1L 4ZO7A 1BJ8A 4BZ1L 4GBXB 1P4LB 4NQED 3LH8A 2R7EA 1I75A 1UD5A 2R0ZH 4QRQA 1BYOA 2O30A 2VXSL 1AFVH 4JFDD 1A65A 3C6SB 1DVFB 1YPZF 3BPCA 1H6EA 3SGJA 3ULUE 1A14L 4RESB 1X5AA 4OI8A 2V3EA 2V5TA 2B77A 3VVVA 4MNHA 4N6RB 1P4UA 4X4ZA 2V9UA 3Q44A 2J20A 4S0HA 4Y4FC 1KJVB 2BCKA 1T0MA 4NQDA 5E5RB 1MNUH 4NZJA 1I9EA 3O0RH 4YMPA 4H20L 4KQ3H 1FFTB 3ZX1A 5GRJL 3PHQA 2DEYX 4YHLH 2Y2WA 4UT7H 5DO2C 2F5BH 3ZE2E 5IFAL 4NEHB 5JXEA 3ULVE 4X80L 4LLAA 2BOBA 1B2WL 3Q2CA 3A4FA 5FR3A 4B3EA 5I1EH 4RAHA 4MDIA 5IESH 1E5ZA 3MV9A 4IIQC 5DJ2A 2GHZA 3DX2A 3OWRA 1F41A 3TJPA 1T20B 4QCIB 3WHXA 2IPKA 5JHBA 3HIZA 2Y9RT 4PGEB 3VRJB 1QSFA 5MEQA 5I15H 2QVFB 4Z3TA 3SCMC 1CQKA 1I9RH 3PABB 4DKEH 3HJ0A 2RIKA 5KYNA 1C1EL 5ETUB 4KMTH 4PV9B 4PLNC 3BRFA 4N1CA 5EN3A 1Q94A 4FNLH 2MKWA 2E6PA 5IW6B 3F7RA 4QNPF 2FAUA 4BZ1A 2OMUA 3ABGA 1F58H 4AENB 2Z1PA 2ZYSA 2AV7A 2SEBB 3QW9A 4JVUA 5HVHB 1WA1X 1H5BA 4TUOB 4A2GA 5L8LB 4HCGA 1CR9H 1AGFB 2ZNWA 4YSTA 4FLSA 4WENB 3KPNA 5CGMA 4X8JB 1U93B 4QOKD 4MAZA 3C6LB 2BS9A 1ACCA 1C8PA 1IC0A 7CGTA 3CJJA 3QDGD 1R3LB 4H2AA 5GZOD 4FG0A 2HKAA 5FIEA 5CIPB 3KBEA 2FR4A 1U2YA 5A7BA 3ZN6A 1U4EA 1T1ZA 3R4DA 4JDEA 1FZJA 5D1ZC 5HJGA 2X2JA 4UV4H 1NDMA 4CC4A 5KZCD 1MJUH 1NICA 3DVIA 4MSWA 3OSKA 4CRPA 3O3AA 4N90E 1ZHNA 1KTCA 3IJHB 4MJ5A 4AEHH 1QBAA 1X7QB 4PJGA 4RISH 4G7RB 2R59A 1XGQA 2HAZA 4TV3A 5EFIB 5CZRA 4NZDA 3T3PB 5J1SC 3QH3A 2NYYC 5F0PB 3CPLA 4J3OH 4UOJA 1MRDH 1HXYA 2KQMA 1OK0A 4UNVA 1BFOB 4NUGL 4NIKB 4Z3GA 5EOCL 3VQ2C 3P4OB 1G6VK 1EJFA 2KLRA 2WVUA 3EBHA 4YIQB 1JUFB 2EUVA 3DVFA 1JERA 4Z7QF 3VWJA 1ZWIA 1RP8A 2OZ4H 1KC5H 3U6RB 1FVDB 4GXVL 2G5RA 4O00A 3FPXA 2X1QA 4YBQD 4JKLA 4MXVE 4JGUA 4M6OH 5KN5B 3W2DL 1E3XA 3BGAA 1LDSA 1D5ZB 3CX5J 4OQTL 1ZVYA 2JCCF 4NHUA 4NQSA 3GTVA 3RZCD 2IAMB 3C75A 1CDCA 4F2MA 5CN3A 5B1BB 2X9WA 1ZLVK 4LNRB 1DLHB 4PJXA 3ZTJG 2K6ZA 5C6PB 4KI5E 2H9GB 4P9HH 4JZJB 2GFBB 1TXKA 5F44A 4W68A 4G6AD 5CNHA 5FV1L 3GJFK 4KJQC 4MCYB 4AGQA 3TV3H 2IEPA 2IV9A 3WFBL 3T0EE 5F1KC 1AANA 4WNQA 3QG7L 3RFZB 3ZQ9A 2Z65C 2C3HA 4PJDB 3PWUB 3MUZ1 4WJ5B 2PPAA 2FH6A 4QRUA 3MXVH 4EI5D 5E1AB 3HC4L 5D7LD 2GBTA 5ETUA 3E38A 2JB5L 1BQKA 3ZMNA 3MLSL 2KT6A 4PUBL 1V3KA 3SKOB 5JW4M 3W39B 3FB6B 2Q8AH 2W65B 5D1QD 2MJWA 1IU1A 2AGJL 2Z4QA 2VC2B 2CALA 2JQAA 3MV7E 5JUEL 2YPKB 4Z78B 4C57C 4CJ1A 5JZ7D 2V33A 4Z8FL 2CDFA 2XKSA 3SKNB 4WW2C 2K7QA 2VR5A 5ILTL 3S35L 5F3BA 3BAKA 5C8JA 1H3VA 1LWJA 5KS9B 1WFIA 2EYTA 1PVHA 4LCWE 3APNA 5EBWB 5AW6B 4K7FB 2FHBA 4F7TB 4C54A 3DX3A 1FNSL 5IT2H 4KK8D 2XQYG 5KTEH 3HZMB 3QYNA 1NM4A 1Q9LA 8FABA 4FZ8H 2I32A 4DETA 3PGCB 2N3JA 2GW5A 2VMDA 3WS6C 5I0XA 2MPVA 5FFOA 3G7TA 3MRBB 2XQYA 4K71C 3C5ZC 1IB5A 3DV6B 4PG9B 3BGFB 3TA4D 4OGAC 1L9QA 1T80A 4A7SA 1D5BA 3K6SA 1KTKE 4NWUH 3NABH 2X4TA 1ND0A 2A2QT 5JQIB 1EJ8A 1RPQA 1T1WA 1N9PA 4MWFA 3SO3C 5HY9B 4MD4A 3BEVA 1UXSB 4HJJH 5T3ZL 3VA6A 1NC2A 4P59L 1XMWA 3VFUA 1Y6NR 2EXYC 2BDNH 3QRBA 3FUFA 3QARA 4KZCA 4NZTH 5EB9A 4QRAA 1G43A 4CILA 5MI0B 3LB6C 2X87A 1WF5A 3VFGH 2FX8H 1NC4A 3BN3B 2OYPA 2B5IC 5DS2A 3CNKA 4WUKH 1YEWA 2DJSA 1WT5A 2Y25A 3VXRA 1YN7B 5FDWA 4LO9A 1UZGA 3HE7D 3VX1A 2J8UB 3M1OA 4JG0L 3CLEL 1ETZB 3U82B 4LSUL 3ML8A 5E8DH 1ZJAA 5IMOB 1DQLL 2WAHA 1VEMA 3MR9A 1OE3A 1TZGL 4L4VB 4D8PB 1PAMA 5E5MA 4FL4B 4JFZH 1X44A 2V7HA 3A22A 3P02A 1DCEA 2ZOLA 3SGDH 5KBNC 3HBZA 1CMOA 3T0VA 3ZE1F 4BFGA 2LT9A 1KEML 2DWEA 4GUPB 4P5KB 3VJ6A 3QPQC 1S7RB 4RIRB 5MP6L 1AC6A 4PJCB 2VZOA 1MIEL 4NO0A 1XIWB 5KANG 2ICWI 2ZE0A 3UTTE 2XVBA 2BVYA 4P4RA 3ULVH 3WTXA 3AMLA 1YMMA 2JJVA 3COOA 3PP3K 3U0WL 4DN3L 5D5MA 3X1FA 4PWJA 2WBKA 5DXWA 2CRIA 3I9IA 4DGIL 4YSUA 4H7VA 4P23A 3OKMB 4PJ8B 1CFNB 4TTDD 2CIKA 4ZUSB 4XP6L 5LGJB 4OZIB 3PFQA 1C12A 2NY4D 5IHBA 4GT0A 4XP5L 2W9LA 4A67A 1SY6A 3QSKB 4RQQA 3KXFE 2VJ0A 4XPAL 1FL3B 4Y5XC 4EN3A 4DP8X 3ZKXC 3LKQA 1VGKA 3AQYA 4HS8H 1NBZA 5T8IA 2OSWA 4CJ0A 1ZT7A 4B9GA 1V55B 1X7SA 4PJFE 1DBJL 5I1DB 5BS0E 4H1LB 3QDMD 1IC5H 5BXFB 5EU6A 5A2JH 2QFPA 3B37A 2YJLA 3MLZL 2CUMA 1ANUA 3DHMA 4G80B 2Q3XA 4FG4A 5C09B 1OM3L 4RMRA 4HUVB 1UKSA 5TDPA 5E03A 3ZRCC 1MCQA 4MA1C 4J3OC 4Y5YC 4CVUA 1T03H 2OJEB 5IVOA 3WJLA 4HXAL 2H5UA 3RWHB 2QQKH 3FT2B 3OZLA 2E5EA 4I1NB 4S10A 3CDZB 3DMMD 4G42B 2DW5A 3AM8A 3O3EB 4N8VB 5DFAA 1WUZA 3QUML 3FU3A 3Q6GL 1EHXA 4P5MA 2WQ8A 4A7GF 3TBCA 1IVLA 4HIIB 2FJFB 4FDWA 2J21A 3BKJL 3SO5A 4PRPB 3EF4A 3D1MC 1VPOL 2AEQL 3HB3B 1OD7A 2XZCH 5LNEA 4AW4A 5F1NA 1M2VB 1RUMH 1KN4H 4P9HC 4JN2A 5JOFA 3DETC 4FYRA 2DY2A 3PHOB 4R26H 4NFCA 1KULA 1S9VA 1YCSA 2X1WL 3GPSA 3O9WA 4HFUH 4XTRC 1QZ1A 5I76A 2ZJSH 3NACL 1Z7JA 2FQGA 3OHMB 1SXSA 4E41E 4J4PD 4Y2DA 3CQQA 2OR7A 1I7UB 2I5YH 4OCNC 1MFDH 2VXQL 2CNYA 4TXVB 5SWSB 3EW3B 2YD5A 4FQ1L 5LCVL 3VXME 1NAMH 1KTLA 4X6DB 1FLTX 3GM0A 4Y4KB 4XPHH 1H8LA 2NW3A 1NFIB 3IDYB 1GHFL 3B4NA 4HGKC 2ITFA 1KNOA 3C2SA 4ZS7L 3T0AA 4AG4L 1MW1A 5EU5A 1DEEB 2PXYD 3LNEA 4Q6KA 3N85L 3QJHB 5E8PB 4F8OA 3W0WB 5JPMA 1KFAL 4FC3E 2E59A 2FJGB 4TQEH 5DDHB 3ZDWA 4ADIA 1IZKA 2PN5A 1HQRA 3G5XB 4OKVB 1E9OA 5L8JB 1PKOA 2OCJA 2PPFA 1P6WA 3N41F 3BE1H 1A1OB 2Y6SD 3KYOA 3QUMA 4CVXA 2UY7B 2DQDH 1OAJA 4XZUB 1IGCH 1UD3A 3GSVA 2XYCA 2NR6A 4X99A 1NMCC 4BFNA 4YZWA 2IPTH 3ZR5A 1LGVA 2UXFA 2YAHA 4HSQA 3VFMB 3KE0A 4ODWB 1CB4A 1Z3GL 4NQDE 4FFYA 4ZQKA 3QYMA 3V9EA 2DM3A 5C9KA 2WWNA 3PJSB 2XIDA 2CQVA 1EFXA 1AD9B 2BY1A 3PHSA 2HRGA 4J3WA 3GSNA 5JYMA 3VI3B 1VZIA 1YAIA 2JQZA 2PF6A 3G6AA 5A2KH 5AW3B 1WYJA 2WLZA 3OAYH 1J8HD 2AXHA 4IM8A 2DWDA 3QUZD 4QKTA 5BQDA 5LCVA 3MV9E 4DCQB 5GS0C 4O2FA 3MV11 3OPZL 1IJ9A 1VHPA 2XNAA 2XWBB 2BIOA 3SJVD 4YHNB 4KJYA 1HEZB 3F64A 2PPCA 5CKAA 3TBYA 1QSFE 2YRLA 1V7ML 5I8KH 5KVMC 3NEEA 4AMXA 3BO8A 1CGXA 1Z6JT 4KKNA 1A7PH 1D6EB 5I71B 5CWSB 1FZOB 4POYA 4IRZH 5C0CB 2RMNA 1UOVA 5C0NC 2IQAA 4M62H 4DIXA 3RIFK 5J4MA 1PTZA 2VM3A 5CILL 4PTTA 1IAOA 1J8SA 5L2KD 2RAMA 4FD0A 1E30A 1HIML 2X4QB 2Z7YA 3ATEA 4JKPH 5EBGA 3PWNA 3RAJH 1H3TA 1S9XB 3CIAA 3LXBA 5EZOH 4PV8B 3DYOA 4U3SA 1S7WB 3DX7A 3T2NH 3LMJL 4JPVH 2DWXA 4LP5A 1ORQB 2YQGA 5IB1A 2Y6TE 3TEXA 2J73A 2NX5D 1BOGB 4YSCA 3DJRA 4WEEA 5BRZA 3ARGA 3H7BA 3EH5B 2WGNB 4MXQD 5J12C 1XSOA 3NIGF 5HDQL 3LZFL 4P05A 3H3PL 4LVEA 4Y9FA 1JDCA 4J3BA 4LSQH 2OMYB 5BRQA 3D39D 4GEJA 2COVD 3CFDB 2GJ6B 4HWNA 5E6SB 1CFQB 2BSSA 3HI5H 5FGCB 5TQ0H 4H25B 3MRDB 3MV8B 2XRAH 4XNQA 4CMMB 2VE6A 2K45A 2PPDA 4FXGA 3KYKH 4P0DA 3ZDZE 1QUNB 3FQWB 4PJGE 1HI6B 4P2RB 1KB5L 2K3TA 5KVFL 2K6YA 1H0DB 1PY0A 3ASOB 4H8HA 4P49A 5FLUA 2ZKYA 4YXLL 5AAWA 2R0WL 4OCSH 5GGSY 1ADWA 1S3RA 4YK4B 1CG9A 4Q14A 3RY6A 3BXNA 2DLFH 4IMLA 2HG5A 4IRSD 2EUWA 3X3FL 3D3VB 5GISH 5E2WH 3MBED 4KROC 1AXTL 1FSKC 1I85C 3EO0A 4KZEH 1N6QL 3ECBB 1F00I 3HPJA 5FUOH 4QT5B 2ICWJ 4OVUA 3O2DH 2FJHA 1OGPA 3LZRA 4IOFD 4WW2F 1TQUA 1ZHLA 5CHNA 3QXDB 1R1CA 2V17H 3KCWA 2FSEB 5C08B 1PJ9A 4F2ME 3I3BA 4JDZA 3U7YH 3BKMH 4UNIA 4ES8A 1LD9B 4WTXA 4PJXE 3DJZA 3LKOB 3WSQH 3BZ4B 3K6OA 4WDIB 4WVRA 4AT6B 1EWHA 4M4PA 4M48H 2GI0A 1WG3A 4AVKA 5JHDD 2FL5B 2BH0A 2B9BA 1XCTB 4MNGB 3GMOB 5DFVC 3RWIA 3VFVB 2E7MA 3CN1A 4K7PY 4MRBA 4WO0A 5K9QG 4ZX3A 2AJUL 2VUOA 2Q8BL 1CICB 5D9SA 3Q8EA 4CU7A 4UTBH 1BXXA 3REVA 2DOCA 1BM3H 3ZGIA 4ZTOL 5DRWB 3CUPB 1BWWA 5HI3D 2IXQB 1OSYA 3CVBA 1KG0B 1WITA 4PY7A 1DBAL 2BS71 4PJEA 3AUVA 4Q9RH 4Y4FB 1IM9D 4UUJB 5GIRB 4YGVA 1KDJA 3UEQA 4GUQA 1JZJA 3ULSB 3QR2A 1RL1A 1I8IA 4APQA 1G5GA 3N6YA 4ORGB 7FABH 1AXSB 4AY0A 2LE9A 2MQGA 2V2WB 3NCMA 3WTYA 4JFYA 2M8XA 2GTWA 4JGJA 4GSXA 5FO2A 4HOXA 1S7TB 2Z92A 3EYFA 4K3GA 5DRXA 4K15A 1FVCA 2WO4A 4FQCH 2JJSC 4YDVB 3V79C 4G7YH 5HHOB 3L6FA 3QUKA 1QR1A 3VG9B 1UJ3C 1CI3M 3IFPA 2WLIA 4KI5C 2H0JA 3KHOA 4PRBA 3VH8G 3LXAA 4N6QA 1ZS8A 2EDTA 5GGRY 4GG6B 1RLWA 4P57A 1WWAX 3SCMB 3GKWL 5J1TC 2ICES 4HZAA 4HBCH 2J5LB 3OGCB 2R56L 4TLKA 4C55A 4Z77B 2WQRA 3QUGA 1NBQA 4JLRB 3VH8A 4AIOA 4F7MB 1I1AC 4HPYH 1GYWA 5B3SB 2X7LB 4ICWA 3IDGB 4U6XA 1SJEB 5DZLA 1HHGB 1UD2A 4FEIA 2AERT 2WUCH 1N12A 2VITB 4H88L 3N50A 3BKCL 4BZ2A 1A9EA 3I2CL 1G7QB 2PO6C 3WY3A 4P5TA 1KV3A 3JXAA 3EYUH 2E7LC 4U1LA 2VMCA 3K2UL 2FBOJ 4N28A 1NFKA 2PCYA 1P9MC 4NNXB 3V6OA 5DQ9B 1EBPA 3TS8A 5K9OB 1RSFA 2QBWA 1N26A 3FOMA 3FONB 4A39A 3B7RL 4QXTA 3VXRE 4WO4A 5BO1H 1MWAH 3DHUA 2J5WA 4DPRA 2W9DL 1YECH 4YSRA 3NEXA 3QGVA 4XBMA 3QQ4B 3Q3GB 4QRPA 2GUYA 5D1ZB 4PSPA 2VR8A 4K3DL 2D8KA 4Q6IC 3Q1SH 3UDWA 1IFHL 1ACYH 3ZE0E 4I0PD 1GIGL 4ELKB 3GRBA 3L5WA 3VFRA 5F7HA 4OD2B 3D6GA 4GQZA 5I1GL 3KYNB 4I5BA 5FOJA 2BVQA 1WC7A 3DSNB 4U7KA 3F7PC 3HEIB 5E6UB 3GJEB 4TRPH 2KUTA 3UJIH 5M94B 3L1GA 1YMME 4TUJA 1UT2A 1CGYA 3ZVVA 3GIVB 3HRPA 5D5ME 1WIOA 4Z95L 3TYFB 1WS7A 1UXWB 1HZHH 4GKNB 1P7KB 4B9CA 3T71A 2FWOB 3OL2A 1FG2A 3DK0A 1E4KC 3CPUA 4U6TA 3T1FB 1F45A 3VRIA 5D8JH 5DCCA 4CADA 4F7PB 5IB2A 3F5WB 3QRGH 3AB0B 3D12B 4NB7A 2VDOL 2LW3A 3RDTD 4C83B 1RURL 4D9RD 2VR4A 2GTZB 5IM7A 3S0PA 5IK3B 5IQLA 5H4YA 4AC2A 3RWCA 4QLWA 4UILL 4RAUA 5EU6E 2ZKWA 3A47A 4HKBB 3GMNB 2CDEA 2VJXA 4OM1L 1FFNA 4F7CB 1WFTA 4NQEA 2AK1H 2UZXA 4MBRA 4PRIB 4IRJC 1S78D 4BZ1H 4JFDA 1MCFA 4WGWB 1PLGL 1GR7A 1KJ2B 2WINB 1A1NA 2JLPA 3DXAB 1B3IA 4IQHA 3AMKA 4FULA 3KNBA 3TN0C 2ZWNA 5I23A 1A14H 3C5SB 3ARBC 5IWLC 4CC1A 5IHUL 1YA5A 3P30H 5IGXL 4GKZB 2L0DA 1WHOA 4I48B 5C3LD 1FGNH 4XPBH 4ZFFA 2CJUL 5C0BB 2B4CC 1A25A 3H4FA 2BC4B 3DHPA 3SY0A 1PEZA 3JT0A 4FI7A 3QI9B 5AZ2L 3MNZB 3FT9A 3UAAA 4I0CC 3TURA 3FFCD 1T83C 3U2SA 2AKRB 1GS8A 2BP5M 4LU5H 2W8CA 1MI5B 1QZNA 3JTTB 4MMYB 1PZUB 1FFOA 2IADB 3L16A 4X7SH 2JKSA 2WMPB 5FC9A 5A16A 2DICA 3LQAL 2CUAA 4XBPB 2UZIL 3CVHL 3S5LB 4AQ1C 1JNLH 2BRQA 1DQDL 3F7YA 1GW6A 2MKLC 3QNXB 4JGMA 4Q9BA 4QRFA 3VFTA 3OX8A 2FSDA 1EIBA 3NSCA 5F7AA 4EDWL 4XBGA 1CWVA 3ALXA 3FU0A 4N2AA 4QF1A 1I1FA 1MCOH 1U8KA 4NKDB 3BAYA 5IJDC 3VGGA 2CIIB 2QSTA 4H13C 1ED3A 1M6UA 1VZGA 2DIEA 1C1EH 3ZKMD 1I7RA 4D9LL 2XZQL 3D0VA 2B0SL 4K71B 2EIZB 1MFVA 5DHYA 1R3KA 2E9IA 3IRCA 3S98A 2RALA 3IWUA 2RFXB 1EJ6A 1KIRA 4PP2A 4ZPTA 1IIIA 2C3VA 2M83A 2WXLA 3SO3B 3O3DA 1HILA 3LVTA 3GSOA 4IW4C 4LSPL 5EZJB 5HYQB 2EDJA 4QOKA 5I18H 3DHJA 2VN6A 4NKIH 3EDEA 4W70A 5GZOA 5I0YA 4GINA 3VGHA 3UBXB 1MVUA 3QXUA 4LASH 3OAZH 3MJ7A 4PCYA 3AJ7A 3CH1A 1OT1A 3GSUA 4BFIB 4Q9QH 4X6BB 4XP1L 1AYOA 1TTAA 2KQNA 2B5IB 4FFWC 1NGXB 3ZDYF 2C26A 2FDBP 1INQA 4OUOA 4YSAA 2DQGH 2I85A 4RFOH 1UWFA 3ZMRA 1KOAA 3ILDA 5TE4L 1P4IH 2GJRA 3MLYL 3ZTJH 3FQXB 4JR9L 4J7RA 4MCMA 1IEBB 2Z31D 4WI0A 5EBMB 1JF1A 2VAAA 1M9SA 2DQFA 3MRFB 2LR4A 3QDJD 1I8MA 1FLRH 9CGTA 3PGFL 1K8IA 5KSVB 3QXWA 3GMQB 1GZHA 1TVHB 2XKNB 1XSJA 4H40A 3TJEH 1UXMA 3BZEB 5HDBB 3QK0A 5C7XL 4ONOA 1KZYA 4TQHA 4N0CD 1OTUC 2O26U 2DJ4A 1SQMA 2X70A 3N5AA 3O8XB 2IFGA 4NUGH 4YR6B 4HEPA 1VACA 1Y07A 3Q6FB 4L0ZA 1TJMA 2N1KA 3TV8A 2BSTB 5LN4A 2F18A 3N1MC 3TPUA 4JO3H 5DWUL 4AYSA 1CD1A 1ADQA 1OK8A 4HIXL 5FO9A 5HJ3B 4X7EC 2B1HH 3E7JA 3CMOL 2X4SA 2A5UA 3QUXC 5H8DA 4MFHA 5FDYA 5GGVL 4JKNA 3ESPA 3A6CH 1EVUA 3MFFA 5AWNL 3L4TA 4Y9GA 4M6ML 4FG6D 5FA3A 5KUMA 3WUWA 3EO9H 5F1OB 4K94H 3ZKXB 4MAUH 3HN3A 2IANB 3BT2H 1OV8A 1LQSR 3EADA 3ZZSA 5CP3H 2X6AA 5ITBL 3HAEG 4OGXH 4E9YA 5I8OH 5B3JE 1ZGLM 1OPOA 4JJ5A 3P9LA 4KTDH 4OD1L 4L8SC 2I07B 1MWOA 2A38A 2BINA 5D7JC 3WFBH 3WS3A 4M7KL 4A7UA 5DD3H 2F54D 1ZCRA 5IW1B 3NFSL 1TETL 3C5XA 4MA1B 4Y5YB 4EI5A 4XCFL 4EPSA 4M3HA 3SPCA 1KGCE 2IDTA 5BRZE 2OSLA 5D7LA 1ZMYA 3HAEA 4G1MA 5E9NA 1K4CB 5JXEC 1Q9OA 1NCTA 1Q0YL 2WOYA 3S4SA 1UH3A 4N3TA 4QHNB 4KU1A 5D1QA 5ALBH 3MLSH 3TBBA 4FQXC 3ARYA 3P0GB 3WN5A 3ZTEA 2AGJH 2CUIA 5TFSL 1LNUB 3BCFA 1U3JA 2FRGP 4XAWL 3UJJL 5JOPE 5T3XD 3WCYA 2WJ7A 1QFOA 2X0UA 5F1IA 3US0A 1LE9A 3GDCA 2LVEA 2A99A 5EZPA 3POCA 3V95A 3ROLA 4WU7A 3QO0A 4X9GA 1QSEB 2MSPA 1XVSA 4CMHC 1BQHB 4O2EB 2FEEI 1U8MA 2XG5A 1AZNA 1FNSH 2NPLX 2AK4B 3TBSB 3D85B 2W07B 3TTSA 2CR6A 1SMDA 3KPMA 5FHBL 4G83A 4L1SA 4WWID 2WKOF 3SDDB 5LGHH 3SYOA 1H5BC 1B6UA 1A7QL 2A4ZA 1UATA 5EU7C 2R0LH 5EPMB 3FN0L 3R0MA 3IJYA 4N24A 4LLQB 5AVWB 3MOAL 3LN4A 3BVUA 2IBGA 3RKDD 1IQDB 3PDGA 4XO4A 2AABL 4Z7WB 3TFKC 1OIOA 1U3ZA 2FB4L 3BD5A 4HIHB 1FGVL 2V8MA 2C1PB 5IJKA 1NIBA 4RMQA 3MLVH 3P9MB 1SY6H 2ATPB 1R5VA 2CGRL 4GFTB 1BAGA 3RVWD 5I30H 4AIZA 4S1QL 2RTTA 4PLJD 4X5XA 1CYGA 1W0VB 1LEKA 2YUXA 2XWXA 2UWEF 1SGKA 2EE9A 5A7EA 3OJVC 5FW6A 1CIUA 3HE7A 4HPOH 3SDXB 2QLYA 2ZOWA 1ZV2A 3QJTB 2X2YA 2VLLA 3UZVA 4A6YL 4HIJA 3GZKA 3IRPX 2OW7A 3FH8A 1RIVL 3MUHL 3WGVB 3GMLA 2HT2C 4JHWL 5ABAA 2VLRD 4D0DA 1KPUA 1SEBB 2VERN 3EIFA 4NZ8A 4AJWA 2IH3B 4PJEE 1TQCC 1A6WL 1IGYA 3RL2A 1YMHA 5DTFA 4MDRA 4J6RL 4E9RA 2VABB 2ZXWB 4HWEH 2IAMD 5ABDE 1HL9A 3QXTA 4KVCL 1MIEH 4GXUM 5CEYB 2MH4A 1UYWL 2A1WL 2J1KA 3WAJA 5JO5A 2GIXA 2BS8A 1NEZG 1GZQA 2E9JA 3IMVA 5E0FA 2EDMA 2WHVA 5J6HA 5EEZA 3BVXA 3U0WH 3QEUB 1I8KA 2X2UA 4DP5X 4CN6A 5DGRA 3GS0A 4AGOA 1NEZA 3PIQB 1KDIA 1E3ZA 1TIUA 3NJFA 1ZDQA 1AJ7H 3QDMA 1UEYA 1XV8A 2CLRA 4HJGB 1AQDA 1DBJH 2VQ1A 3O4OC 3ES6A 2R39A 1T6WA 2GB2A 1FHNA 3KJ4B 5DJXB 4E9VA 2YKLL 4JFFD 5DR5H 4UQDA 4DN4H 2AXFA 3JWDL 1QKZH 1O7SA 1VSCA 2ARJA 1FAIL 2K8MA 3GLEA 4XRCA 1OM3H 3KEDA 1V5JA 4N2GA 1HINH 2Y06H 4NDMB 1K2DB 3ZRFC 2DD8H 2BY3A 3DMMA 4MD0A 3FO1B 3UTQB 2YWZA 2OPCA 4HCRL 1X6NA 1M3JA 3V6OE 3WGUB 3ZE2B 3APFA 3JSSA 3O6KL 4JRLA 2R2BB 5J12B 3QIWD 5EOQL 4GNKB 5KYXB 5EC2A 3QUMH 3OPUA 3Q6GH 3V6FB 3OR7A 2A9MH 3MRPA 4JN1H 5AKTA 2B14A 2VR6A 1DFXA 2LLGA 2HT4C 3ZL2A 1KCSL 1JF5A 1OY3B 4QRPE 3BUYB 5J89A 3M1CA 1M7DB 5HDWA 1VFOA 5D4HA 3U79A 3PV7A 1PZ2A 4GLRI 5FLVA 4K94C 4IOIB 4QGYA 1TZIA 3F83A 4CKVX 4L37A 3T2QA 3MRGA 2YC1A 2ZZUT 3GSQB 4FFYH 5DJDA 1CL7I 5G4OA 4DP4X 3F7VB 3WU1A 4RA0C 3FH7A 3GSNH 3RGVC 3GIZL 4BJLA 2XV2A 3PNWB 4I0KA 4OF3A 1KXTB 3D4ZA 2EADA 2EUZA 1NCCL 1TR7A 1L9MA 4GKOA 3E8VA 4KROB 1AHKA 2OV0A 2Y7LA 1FSKB 2HWZH 3AG3B 3DECA 3EF7A 2PTUA 5I1KH 2CRYA 3QHTC 5E1GA 2PXYA 2EP6A 1TKWA 1CZ8H 1MLBA 4F33A 2NYKA 4H5SA 3SGKA 3B2PA 2OBGA 4R2GB 1R5WA 2RACA 4UQEA 3RL1A 1Y6MR 1IEAA 3L4VA 2K0RA 2XHNA 5CSGA 3L3JB 1A7RL 4M7LT 5BV7L 4FGMA 2NY7L 5IMMA 4XNMB 1I9IH 2WWKO 4NQEE 4PYHA 4X9BA 4DP0X 4F92B 3L3DA 3IT8D 2P5WB 1A8JH 4JFDE 1JNNH 1LE5B 4D94A 4NOBA 2I60L 2XQBL 3IBEA 2FIKA 1M7XA 5I16A 4QHMA 4MX7B 3LKSA 3VD1A 2GHWB 3S9DB 2UXVA 4WK4B 3BUDA 5TQ2H 1DYZA 1ZPUA 1Z3GH 2WTRB 3DSFL 4PJ8D 1NAMB 3JUZA 2Z4TA 1T5KA 4YBLC 2DF3A 1NCHA 2GJPA 3TVMA 4LCUB 1FNFA 3RTLA 1BMWA 3VD0A 1OLLA 1YQVL 3U9PH 1J8HA 3V5HA 2MCMA 4YDNA 5DJAB 7PCYA 4MCZA 3X11B 1NANI 4FQHA 3V4PH 4JW3A 3MA7B 1SOKA 4HGWB 3SGEI 3VXNB 1EO7A 1JPSL 1J9RA 1IM3D 1QA9B 1T0OA 1VCAA 4MHHI 4I4WB 4OTXL 3SJVA 3OPZH 1UVQA 3MYJB 3HRZC 4IU2B 4ES9A 1NGQL 1J0JA 5D1XC 1UJ3B 1RP9A 3L3GA 3HR5B 1GC1H 1XTLA 4JFXB 1V7MH 4CSTA 2UX7A 2VW4A 1WA2X 5EA0L 2BZ7A 1X6LA 3QIBD 4ZS6D 1UD6A 1LQBC 4X9FA 3QC5X 1M2OA 3T0EB 3MREB 4F2FA 3H0TA 5L2KA 2APXA 2NYZA 3DRQA 4KTYA 1N0LA 1AP2A 5KSAB 4PRPD 2GIYA 4N0RA 4O58L 1XB6A 4HT1L 3KLHD 2ADGA 2FE0A 2NX5A 4FKKA 4UDTB 3UYPA 1QFPA 3LMJH 1N5YL 1B4RA 2D7QA 4QOKE 3S37H 5AUMB 3NJXA 1HTYA 5C0IA 3CHRA 4JFPA 4B0MM 1ETB1 4AVHA 2EYSB 1BVOA 4I3GA 4HFWB 4N9GA 1OSPH 4EZLA 2O4EA 4XVUC 3D39A 4HUKB 3TA3C 1BBJB 1X5IA 4JFUA 4ANKA 5LDUA 2OS7A 4FXKB 5IBLC 1XL4A 3AS2A 5E8EA 3FQ1A 5GSVB 5SWSD 4OCLC 3O9WC 4HA1A 5C0EB 4WNJA 2HFEB 2IFFH 2FNBA 2AEWA 2WKGA 4PH8A 2EYRB 5EBLB 3HC2A 2IQ9H 4Q6IB 4ATTA 3QHZH 2C9QA 2YBGA 2ZWKA 3BT0A 4F57H 4U4BA 4N2HA 5I0VA 1PQZA 4YXLH 1CXIA 1VDGA 4IRSA 5IJVA 4G6KL 3R8BB 4PJBF 5EC1B 5D71H 2CO2A 1TLKA 2H1PL 2XTLA 3X3FH 3BCDA 3MBEA 2CMRL 1A5FH 4XWOC 5JHAA 5I17A 1JZ4A 3TONA 4UMSA 4BV1A 2F74B 1PZSA 4OIIL 4LGSB 3SKMA 1A22B 2DJUA 3BIBX 5J13C 1TJGL 3QJVB 3K6IA 2NNRA 4ZPVB 5D2LF 1XCQB 2H3NB 2DDQH 4ETQB 3E6HA 1X3DA 2UXGA 1SPDA 1MFEL 4M8QB 4HJUA 4W9FC 2VH5L 2NR6C 4XMPL 4LHUG 4XVOA 2DLGA 1IAII 2DJMA 5JHDA 5JPNA 1JVLA 5B1JC 2G60L 2Y7SA 1J9QA 4XVTL 5GGSB 1BZ9B 5CEZD 3BI9X 2QVIA 2ZKHL 3IVKB 2VN5A 1UT1A 4TLSA 1JTOA 5F8RC 5AW8B 5HHQA 4YDLC 4K9EL 2AJUH 1J05B 1R3IL 1VADA 5D7LE 5I2IA 3KPOB 4BZ2H 3ZSSA 1NDTA 3ARFC 4TVPH 1UGNA 1XR8B 4ZUVA 1KTDA 4WHCA 5DK0B 3WDIA 1KCVL 5D1QE 5IQNA 4ONGL 2NQ3A 3AXLB 1XH3B 1IM9A 2A6DA 3L9YA 3I02B 2HJKB 3KD4A 1FE8L 1QP1A 3UTTB 3W37A 3DI2B 1L9NA 5HGAA 4F1SA 3V0IA 5ICYB 4KKZA 3K72A 5I1HH 1RK1B 1A2YB 3MLUH 4MQXC 1VZHA 3TZVC 5HHNB 2HJLB 2QVKA 4LRNH 2E7CA 3B2UD 4FLRA 1P7HL 2UZPA 4F93B 2JXMA 4LGPB 2QPEB 2W60B 1VCBC 1DE4B 2Y5QA 4XCCL 5FHAH 2H3KA 1IGJB 2VDRL 1ZVHA 2EVGA 2B2XH 5D70H 5DRZA 1JF6A 4PJFB 3TBTA 2AAVA 5KBPA 2N56A 3FRPG 3VI4F 3QIUD 2WLLB 3GKWH 3K3QA 2R56H 4DEPC 4TLTA 1LO0H 3EYSL 1CK0H 4AOFA 1IL1B 2R29A 3QUYC 1LK3L 1W72L 2E27H 2X4UA 1OARH 4TUUA 2OMVB 3FRPA 4JZNA 5EO9A 4X7DC 1ES0B 1EFQA 1G7MA 1JNHA 5CAYB 2XFXB 4R0LC 2V2XA 1B0RB 1KBBA 3EYQC 3KYMB 3NFPB 3NSXA 3QNZA 4NRZA 2Y72A 4QJ3B 5T1KB 2VDQL 2QR0A 3I2CH 4XCYB 3FQNB 3BFWA 3WG7B 1BYPA 3C2AL 2NUTA 2JH2A 3RB5A 3VXTA 1ZGLB 1MFCL 2WBJB 4YNYA 2VGLM 5DEZA 4M8VA 4IBWA 1BREA 4NO5A 5EZIH 3GBMH 5GGRB 1DQQA 1HL8A 2CJSA 2PW2B 2XQ0A 2B9AA 2MNJB 2FEDC 1BLNB 4QHUA 3D3VD 1GC1C 2OP4L 1DN0A 3J27A 4JL2A 5H2BA 2W9DH 1XT5A 3KLSA 2P44B 2PW1A 2J55A 4OGYL 3R7QA 3S36H 4ZTEA 1P2CB 5FYJL 1MRFH 2V37A 3GTTA 1K5WA 4I0PA 4E41B 5HDRA 3MRIA 2XDHA 1KGJA 4M29A 4PB0L 1A1MB 2P7TA 1MCEA 3VXMB 4LFHD 3FQUA 4NRYB 3VD4A 4X5WA 1N18A 4X6EA 1TEYA 5F70A 4R8WL 2IOIA 5TE6L 3ABLB 5HGDB 3K2MC 5HBBA 2ATKB 3PHAA 3BDYH 1CFSB 3FO0H 2IOMA 2OTWB 2P8LB 4AH2A 1E4WH 3SE8H 3WD5L 4XCNB 5G4NA 3P2BA 1SUJA 4EMZA 2QDWA 2ATAA 2XTJD 3ZYZA 3RDTA 1HWWA 3QUXB 3QEHA 4NKMB 1DL7H 4MMZC 1MWAB 3GSXA 4BQ6A 5F7EH 1G7LA 2WB1A 1RURH 5JORA 2V4LA 3QDME 2R7EB 4QRQB 1BD2D 2CRZA 4TNVF 1JCVA 2PR4L 4Y4FD 4BFEA 4BHUA 4U0RC 1KV7A 2V9RA 4UILH 3BPCB 4PJIA 4NSKA 3S34L 4XI5C 4OM1H 4MNHB 4EI6B 2BCKB 4NQDB 1T0MB 4ZMLA 1DVZA 1PLGH 3N1GC 5T1MA 5E94A 3LKPA 3CFNA 1NH6A 3PHQB 4APQC 2DZEA 2C7FA 4JO1L 2GSMB 4XB8A 5LVEA 5IHUH 2BOBB 2WSDA 4YN3A 4XPFH 1SYSA 4Z6AT 4OCRH 2X9XA 3DGGA 3ZTNH 5GS1A 4MDIB 3CHQA 5DJ2B 4JUTA 3H2PA 4NP4L 3FFCA 2IAAC 5AZ2H 2GK0A 2FHCA 3N04A 4NM4L 3WHXB 2IPKB 2DM7A 5ACZA 4JPIB 3TCXA 1KIQB 1CLYL 2JF1A 3GUFA 5DLMH 4ZFZB 3DIDA 1G9NL 4ELMA 1DQJA 4U6VH 5IHZA 4BSWB 1F18A 4WAFA 1AAJA 3NDZE 1T89C 5L9DH 4X5LA 4CMHB 3VFNA 2QV2A 5HSFA 1RZ8A 3D4YA 4XBEL 1DSFL 3R7RA 3APDA 4KQ4L 4RWHA 2HLFC 2OMUB 2I69A 1TJIH 3CN0A 5KJRH 3B5HA 1HHHA 1IBHA 3AY2A 1H5BB 2HX9A 3QCTL 2W91A 4FX5A 3ILPA 1MG3C 2PLTA 4P5TC 3KPNB 5DZOA 5DHEA 1WIPA 4L8BA 4Q2ZA 3TYGL 1ADQH 1EEYA 4LL1A 5D1ZD 1K5NA 1RI8A 2PP8A 3UO8B 4A2FA 5HYSG 1E40A 1DJSA 2XQYK 3L95A 2FR4B 3ETSA 2KDGA 3I6LD 2FX7H 4CU8A 3VW3H 1T1ZB 2VDKL 1WTGT 2LFEA 4JDEB 2AJVH 3SQRA 1YDPA 4DW2L 2YAMA 3G3LA 5HYSA 4AM0A 1NDMB 4QRRD 5DUPL 2CGZA 4UOW0 4MSWB 3O3AB 1FCGA 2WC7A 2WCSA 4B9KC 4EKXA 1ZHNB 3ZDZB 2Q7NA 4MJ5B 3VFWA 2ICEA 3P0VL 2F53B 4PHZA 3JYBA 1BVNP 2WWMC 1XGQB 1SDAB 3DBXA 3U7WH 2BVEA 1JNJA 2Z31A 3MRQB 3MLYH 3CCHA 3QDJA 1HXYB 2EEXA 3RG1C 3G6JF 3HAEH 2EO9A 5SWZD 3MVSA 1EHKB 1FHGA 5AVYB 4ZFOA 5I8CA 3NIFF 3VWJB 4XX1G 1UZ6F 2VZSA 2XOTA 1J8HE 3KVQA 3MMEA 3LRHA 1BYNA 2LGNA 4G3YH 5IVNA 3U30C 5BNXD 5EN2A 2CO7A 3RIFF 1T1XB 1XH0A 4YHKL 4LOUD 1SMOA 1AR1C 4GBXA 4QRBA 3SJVE 1ZDSA 3VWKD 4KJQD 4F2MB 2PWFA 1B4TA 4NIYE 1DLFH 3AXIA 2F08A 4PJXB 1A7NL 4LRIC 1QFUH 2VR3A 5GJSL 3CMOH 1PJWA 2DQEH 4BA8A 35C8L 1RZ7L 1PU0A 1FNAA 1ZAGA 2XUWA 5DT1H 1JI1A 3TH2T 1UA3A 4R7XA 5L2KE 2CCLA 4PM1A 5GPRA 4HUXA 4NZUL 3LRGA 1MFUA 4QRUB 1E4XL 3O4OB 4CVWA 2HH0L 1URZA 4EN2A 2YGOA 3GS7A 2A7BA 2F54A 4GMTL 4M1DH 1ASQA 2NX5E 1N6UA 4L1DA 4OD1H 1N5AA 1WS8A 1I82A 4M7KH 2X2HA 3TT1H 3UERA 3VYOA 4EDXA 2VTFA 3R1GL 2Z4QB 1TETH 3WNJA 1LEGB 2HFFA 2OFQA 4FQLL 4QCIA 1IKNA 5EIIB 4HK0A 4U1HA 4UQ9A 3LHPH 3OSVA 3VRJA 1C5CL 3MDJA 1Q0YH 5J6SA 3D39E 4M00A 4JPKL 3EJYC 4NZRL 2HSIA 5IFHL 3SE6A 4K3EH 2CBTA 4N2LA 4OZHF 4ZRGA 3PABA 2ROXA 5C92A 5HHPA 3MBWA 3NJJA 4IGBC 2EVJA 1AG6A 2Z8VC 1FFPA 1FJ1A 2MNUA 4XAWH 3OMZA 1DANT 3UJJH 4GP5B 2YPVL 1ZKAA 4NI3A 5IW6A 3C5ZD 1SOSA 1Q9LB 4HUUB 2SEBA 1KLFA 4H0GA 4AXWB 2ZXQA 1F4WH 4PWIA 1CLZH 4M5SA 4XNUL 4APXB 3WKYA 4PGJA 4Z7NE 1RUQH 2E46A 5EHFA 1RUPL 1E4HA 3C60C 4GYBA 3ZL4L 2EZ0C 3QUHA 5IR1B 5EOCJ 1J1XH 3FNKA 2NY1D 4BK5C 4EIBA 3O41A 3CDFA 1AI1H 2WVSA 2O5ZH 1D5BB 4TPRH 3EO1A 3K6SB 4E9TA 2X4TB 3IAGC 1GJIA 5E9DD 2EH7H 5JIMA 1ND0B 3WO3B 2EKJA 4U31A 5I8EA 1AOZA 4MD4B 4QUOA 2K4AA 1BXUA 3FN0H 3EJSA 5J1AA 4ZTPL 5AVXB 5BRPA 5GZOC 2NNAB 3QFDB 2YSSA 3EOAA 5FA4A 4HISA 1J18A 1NC4B 4HWBH 1X7QA 1FGVH 4HHWA 1TO4A 4AYBA 1VF5C 3UIZA 2DQHL 3CC5A 1MY7A 3VXRB 5FDWB 5C86A 3EDJA 1O7DC 4ANXA 5DVKA 5JHDE 2K9FB 1WAPA 2R51A 4HKZB 1CLOL 4B7LA 4DTGL 1CE1L 2I7OA 3HI6H 4XMUA 3QNYB 4MA7L 4OU3A 4LKCB 4KTGA 3T77A 3KS0H 3QPQD 3QCUH 1QFWH 2VN4A 5FV2A 1YAZA 5E5MB 4UF7C 1A7OH 1JSYA 2V7HB 2G2PA 3IGKA 2CWRA 2YPVA 2M1KA 2RJMA 1WAEA 2ZOLB 1RV6X 3RNKA 1F90L 2VLRA 3U6RA 1FVDA 3ZE0B 5HD8D 2DWEB 2NOYA 3NCJL 3RBGA 2K1MA 4JHWH 4NO0B 1D5ZA 5CZXD 3NOIA 3SPVA 1HAWA 4P4RB 2IAMA 4D9QD 5DRNB 2IPUK 4YBLB 4PJ7F 4XMXA 4YBQC 4ZFGH 1IGMH 2XX1A 1CE6A 4JZJA 2GFBA 2BWDA 4G9FD 5T1DL 4AL8C 3HUJF 3RZCC 4MCYA 2CIKB 3L2NA 5E2UL 3TGXA 2A1WH 2XY1A 4HIQA 1C12B 4PCTA 3BIKA 2YQ3A 1H6UA 3RFZA 1YYMH 2NXYC 3HMXL 3RPIA 1VGKB 1NBZB 1ZT7B 5FWQA 5JOEA 1I4FB 3HRZB 5D1XB 2BCMA 3UPCA 3RJQB 5EU6B 2H1LM 1SXZA 2EC8A 2VYRE 5D6DA 4HLZH 3OMIB 1QG3A 1F11A 3DYMA 4DHLA 3OKDB 5J56B 4Z78A 4JFFA 4JPSA 4ODVL 4XMKL 1QFHA 3SKNA 4E5XA 3VX0A 4OD3L 4JMXA 1YUKB 3WN5C 1FAIH 2FATH 4P5MB 2BVTA 5JW4R 5JZ7C 3NIFB 1JZ3A 3QIWA 4ZYKB 1EEUA 4ODSL 2W88A 2D7OA 2PMZA 5F1NB 2K6WA 1GH7A 3GSRA 1JRHL 1RULL 1MREL 1D9KD 4ABVA 5I74C 3AS3A 4X5QA 4I89A 3DDFA 2R1XB 1NUNB 3AC0A 3US9A 3I84A 4AQEA 1T7ZA 4FHBD 4GMSL 4GUCA 2Q76B 4FP8H 4AKPA 1F8TH 1KCSH 1S9VB 3OHXA 1YPZA 2H2SC 3O9WB 4BFRA 5I76B 4JY6A 4GO8A 2W9EL 4LAQH 4ZOAA 2NCEA 4TUKH 1MY5A 4Y2DB 4ABQA 1CDBA 1UH2A 3LTVA 4WHYG 3ZLQC 2ITDB 3GI9H 1U21A 2D7TH 3L3HB 3WFDL 2G2NA 2NW3B 3KHQA 3FUEA 5ALCH 4BUGA 1KNOB 3EJZD 5EU5B 4GP8B 3FUKA 3T2OA 5L88L 4JG5A 4YSPA 2G3MA 3QJXA 3CXDL 1UD4A 1N68A 3BKYL 3C08L 5KVEE 1Q1PA 1YN7A 2A9CA 2OW6A 4N8PA 3KWWA 4Q7DA 1NMAH 5TTRA 3M17A 1HQRB 1XH2A 1M3IA 1PKQB 1E9OB 2PWGA 3KCPB 2FVNA 1ETZA 2R1WB 5CCKL 2W0FB 3QUMB 4D9RE 1O7VA 3KYOB 2GBAA 4CVXB 2Y07H 4FFVC 3PDOA 1YEIH 1RZQA 3EGSA 1EDQA 3GPEA 1JZDC 4R5VA 4D8PA 4RMBA 4GJTB 3AQXA 1ZOXA 5TD4A 4RWYL 3U1PA 1OOWA 4LLYA 4N2NA 1UWEL 3GSVB 5K1VA 4R5XA 2XZAL 4KRLB 3RIAK 2E7DA 4KVPA 4X99B 4PJIE 1FN4B 1A7RH 4MLSA 2NY7H 2C9PA 2VSCA 5DC4B 2AQPA 1J5OL 4RFEB 1HAUA 1Q72H 1C5BH 3HG1D 1IILE 4L9LC 4XN2A 3P3SA 1RJCA 3IM1A 4ZQKB 4YDLB 3SQOH 1DBBL 4ZQTA 1Y18A 5GS0D 4PRAB 4UTCA 5KSBF 1EFXB 3GSNB 3DROA 4PJ8A 1K6QH 2VR7A 3G6AB 4H1LG 4IKNA 2O6DA 4ABUA 3SBWC 5CJOH 3ARZA 2DWDB 3FTYA 1S7SA 4ORZC 5AVSB 4NGHL 2Z0BA 2YRZA 2E4TA 3HOGA 3FFCE 2FUQA 1B0WA 4HC1L 4O2FB 4X6CF 4R4FH 2F58H 4P5SA 5EZLB 2Q3ZA 4TTDC 4PJ6A 4KJYB 5BXFA 2HXAA 25C8L 3TBYB 4PP1C 1DQML 3WNOA 1IM3A 3BO8B 4JJOA 4G80A 3TZVB 4ELME 4NRXA 1AS6A 2QPSA 5HPOA 3WFCL 4XN9A 2V9QA 4JHAL 4NS0A 4RGOL 2YEZB 2AANA 2F1BA 4P04A 3QIBA 2FK9A 2X1OA 3GO1L 3O3EA 3BH4A 1RHHB 1SBSH 4PEEA 1L9PA 4GXFA 3PWNB 1I3GH 5GRVL 5KVDL 4WI5A 1Z32X 1ACXA 4TSCL 1OGAD 4U3SB 4HIIA 4OM0H 2EXSA 2FJFA 3LEXA 4YE0A 2Y0SA 4DEPB 5IB1B 3WIFB 3DMMC 4PRPA 6TAAA 3LEVH 1IAIH 1QHQA 2BXZA 1A9BA 4M93C 5BRZB 2EDWA 2Q0ZX 3H7BB 3QJQB 4O58H 1NCIA 4MZ2A 1HEHC 3RTQC 4R0LB 4M9PA 2ZWZA 4UYQA 3HG5A 2JCCA 1XB8A 3FQ4A 4GO6B 3GZOA 1L3NA 4YHOH 5FM5O 2BSSB 2ENQA 3P2DA 1CIDA 2ADIA 3MQIA 3GXDA 4PRNB 4HMDA 4IBQA 3V4PB 2GG1A 4XNQB 1JGLH 1FPTL 4R96A 2VE6B 2ZOTA 4M1GH 5CEZL 5JHLH 4PJ5D 3HUJB 2C5DC 4HC1A 5GS2D 5LAPA 2YUWA 5F7UA 5SWSA 2R4RL 1KEGH 4KK5C 1KY6A 3BGMA 4M5YH 4B6ZA 3W5MA 1IT9L 2BX5A 2XT1B 1KGYE 3HNTL 4WJKB 4DP9X 4QYAA 3A4EA 4LE8A 4J4PC 3QDJE 4KROD 2A6IB 5CJXA 1AGCA 1CG9B 2QQQA 2WXIA 3BXNB 1TO5A 3GXFA 3Q5TA 1MDTA 2HG5B 4Q8BA 5INDB 2OR8A 1ILUA 3W0WA 2LLNA 5JMOC 3QQ9C 5AW5B 5KW9L 4JDTL 4OKVA 3EO0B 3SPVB 2W92A 3K8KA 1EUUA 3HPJB 3QAQA 3OXSB 1QR4A 1NCUA 3CN4A 1U92A 2HFGH 3ZJAA 1I1RA 2XYBA 1QFWM 1TVDA 4XX1E 2GTQA 1HH6A 2G75B 4JDZB 5AAMC 3FO2A 4AEEA 2D7PA 2P5WD 4DK3A 3LS4L 1IE4A 2DMHA 1UTDA 4F15C 3US1A 5DFVD 1EZUA 5CZVL 3Q8FA 1MAJA 3BLKA 3DTDA 3LSOB 2O5NA 1SXNA 3A23A 1MG2C 1BXAA 3K46A 3P4MB 3BAEL 4PAZA 2J3SA 4MB5A 2WK2A 4JBSA 4TSAL 3P69A 1U95A 2YMOA 1F2XK 4L5FL 1ITCA 1MFEH 3RWIB 1KF9B 4AYGA 5KAQF 5D6CA 2EH8L 2F15A 3FCTB 4XMPH 3UC0H 1ROWA 4POUB 3EHBD 1AIFA 5D9SB 2YZ1A 5A6LA 3ULUF 3REVB 1F4YL 2R29H 1IAKB 2OL3A 3LYRA 2G60H 3WLBA 2F54E 3BIAX 2DMCA 4X50A 3BZFA 4WHDA 3ISRA 1TLMA 4DCQA 2IVFC 3NUKA 1C16A 4JKKA 4C4UA 3ARDD 2B15A 4PJEB 2N0MA 3BEWA 5D72L 3T2LA 1YZZA 1TCRB 2PYEB 4X7CC 2V5MA 4PB9L 2XWBA 5CCHE 4PBXA 5T5FH 1HEZA 1J88A 1I8IB 3QUZC 3AACA 4APQB 2G4EA 1XQ4A 5E8NA 2K3HA 3D87B 4C56D 4JFYB 2DTSA 2ZXAA 2GTWB 1YY9C 1FZOA 1E8WA 2Z92B 3EYFB 5DRXB 5T3XE 2YD0A 1FVCB 4NERA 1ZY9A 4W93A 2O6PA 3BVNA 5JQHC 1NWOA 2HRPH 1PG7X 1QR1B 1AR2A 2PWDA 3IFPB 2WLIB 3K5SA 4PRBB 4BUHA 5EG6C 1YEKL 1ZS8B 4F58H 1I1AD 3UJTL 2FLRT 1UT9A 4P57B 4BK8A 5IJBC 3GRGA 4GUOA 5LQBL 2P26A 1DBKH 3K74B 3S5YA 4C8XA 1OAYH 2OULB 3OC8A 1U8NA 1BOGA 3N9GL 5TF0A 1S8DA 2VDRH 4XMZA 3VH8B 4JB9L 4G8EB 4OR1A 5KJ7E 3QIUA 4U6XB 3PWPB 2PO6D 2Z64C 4Y2NA 4AUUA 3RWGA 3FU8A 2HVKB 3PQYD 2X6MA 1RZJH 1G1OA 2OMYA 4JHBA 1W0YT 4HLEA 2FUTA 3EYSH 1CFQA 4LSTL 2VOTA 2FYYA 2ZCHH 3KVDD 4H25A 4LCCA 4OLEA 1N7ML 4JO8A 4P5TB 1IC7L 4D7BA 1MELA 3HI1A 4N0UA 4FNQA 4U1LB 5KVEH 1PW3A 3P3RA 2B1OA 5EUKA 5EIVA 5C0RH 5KYYA 2EDLA 1J10A 4E9WA 4D3CL 2EVIA 1QUNA 4R7NA 5D4IA 5CF3A 5K5YA 1HI6A 3FOMB 5HP5A 3SE3C 2A77H 2VDQH 4QXTB 3NBNA 2BRRL 4BQBA 1H0DA 3CV5A 4WO4B 3HW7A 3C2AH 3N40F 4IJ3C 5FGBA 1N19A 4EZKA 4QRPB 3PXJA 3C8HA 3O81A 4XP4H 4NJAH 4HJTA 4WU5A 2VRAA 4XH2A 1EK3A 3D3VA 1MJ8L 3VE0A 4MYPA 4J8RA 2VLRE 2GUOB 1BZ8A 1JFHA 5HHVH 3SQBA 1E5CA 1EMTH 4OQ1A 4O2CA 1FH2A 1DJIA 1G94A 3CFKA 3L5WB 1H8NA 1JZEA 1ZLSH 3VFRB 3ZDXE 5ID0A 2NCMA 2YKKA 1MCNA 1KYAA 4I5BB 2XC8A 2WLJA 3MBEC 3BVWA 3MN8A 3QXDA 2ZX8A 3DK2A 3O6LL 4HBQA 3V4UL 3VB9A 4B9IA 3IKKA 4TUJB 1HJCA 1LD9A 2NY0B 2AVGA 4A7GA 2R4SL 3LKOA 3IXAA 1KPRA 4DP6X 4WDIA 1UM6L 4IOFC 3ME0B 2C9RA 5CCJA 4IYKA 4YHMH 1JV5A 1FG2B 4CADB 5CMAA 4FLHA 5IB2B 4TNEA 3FT3A 4R7VA 1R46A 2OCFD 1A3LL 2R69H 4AV0A 3BHBA 3G6DL 5I6PA 1AR1B 4CL7A 4IRJD 4Z7UF 5IM7B 1NLDH 2R27A 5B39G 4POZC 1T0PB 3PJLA 4RAUB 1HE8A 1UWGL 2FX9L 3TN0D 2BJMH 2IXQA 3LPOA 2VKWA 1FFNB 4WI4A 4NQEB 3EFDL 3ARBD 1BD2A 1VIWA 4Y4FA 4UUJA 4JFDB 1XX9C 4KDTC 3UTOA 5B39A 2F1AA 4JFFE 1YEJH 4QO1A 5B7FA 4M7ZC 3RNQA 3RHWK 3PDDA 2IG2H 3EFFB 2GJZA 3KNBB 1YN6A 4ZAKD 1OAUH 1FNGB 5DQJA 1BHGA 2EEDA 3G04A 3S34H 4CW1B 2WXPA 2A6JA 2P28B 3VFSB 1E3FA 3U25A 4MB1A 4ZFFB 1AHWC 2Q6WA 2ZX5A 4IIQA 1CU4L 5ICXA 5HHOA 3SY0B 4Z23A 3UGXA 2CKBA 3MKGA 4NC1C 4YXHL 5I6XC 4YE4L 5CLYA 3TC9A 2H6OA 5EWIL 3MJWA 4ZUWA 2GBVA 4CC0A 3U2SB 1SMAA 1GL4B 3T8VA 2IALA 2PWEA 4FQIH 1FFOB 1UOWA 2R2HB 3D52A 4JLRA 3D09A 3EJTA 1YPZE 3HC3L 3C09C 3F7YB 5IW3A 4B60A 4KXZH 4ZX4A 5DZVA 3OX8B 5FECA 4XBGB 3L4ZA 3EDDA 4QF1B 1I1FB 1U8KB 1Z5HA 1EX0A 3HE6C 5AYTA 1XF4A 3R4RA 4M3KB 5CJQH 2VM9A 1ED3B 3KZ8A 3QQXA 1J7VR 3GHEH 1X4XA 3K1DA 3D0VB 4XMLL 3UCQA 4U1NA 5DHYB 1DSFH 1R3KB 1P5UC 4I3SL 4YVNA 4XMWA 5K9OA 1G7IA 1HNGA 1H19A 4PCSA 4PP2B 1KIRB 4ZPTB 3NZUA 4XOCA 4FADA 1RPKA 4GQ9L 1HILB 3A3YB 4QOKB 3IWVA 3DPBB 4FFWD 1KJ2L 4HF5L 5A2FA 4I88A 5AW1B 2VISB 4LT7A 3Q3GA 4Y19D 5D1ZA 4O51A 3QDGB 3NK4A 1F56A 4KH9A 2KPNA 1N0XL 2HKHH 1MVUB 3UO1L 1OXYA 2G3ZA 3MJ7B 1INDH 3CH1B 3GSUB 4UIKL 4IKKA 5DHXB 5SX4H 3FCGA 5AG9A 3D4GA 3VM7A 3GINA 3MGOA 3P3YA 4ODHH 4ELKA 3VYNA 4DWHA 2VDKH 5KYUA 2QSQA 3BISA 5KZCB 4QRRA 5LDSA 1WZLA 3L1OL 1RIUL 4X4XA 1MW2A 2LHAA 4QNPE 2WVVB 4WI0B 4NT6A 1JF1B 5LXVA 5DUPH 2C4FT 1FVEB 2DQFB 2VWEE 3ERXA 2ZWLT 4QIRA 1KZQA 1I8MB 1OB0A 1M57B 3GIVA 5JA8B 1K8IB 3RPKA 5DZPA 1BF2A 4M61A 5KOMC 1UXWA 5GXBB 4GKNA 1KWGA 1EHLL 2XA8L 3UAJC 3F85A 2D0HA 1FRGH 1SVBA 5SWZA 1RZJC 4UT6H 1MIMH 3F5WA 2XN0A 1P0SE 2X70B 2NY3C 4N2BA 1URIA 1P5VB 5J3HC 1UEMA 2JKNA 4N5ED 5BVJA 3GLDA 2R0ZL 4P3WA 1AFVL 1I8UA 1CD1B 5FO9B 3LX9A 5T3XH 2VJ8A 2XWJB 1PSKH 2WO2B 3VWKA 3RZCB 3IPFA 3DVGA 3MNVA 1SJHB 1MNUL 4RBPH 1KJ2A 2WINA 3BAWA 5FA3B 3O0RL 3WUWB 3WNKA 3BFQG 4UZGA 3FHAA 4KQ3L 3S8WA 5D7JD 2TRYA 1MRCH 3KW8A 1A7NH 1SNRA 4UT7L 2F5BL 1J9TA 5CN2A 3C5SA 3LS5H 1JWMA 5I0ZA 3WEBA 2AP2A 35C8H 2VRKA 5I1EL 5LLIC 4YHYB 3L4XA 5SWQB 1TTRA 5FM4A 3WHE1 5IESL 3WS3B 4UOZA 5KEZA 4E0RA 4NC2B 5I1IH 3KM2A 1S7UA 4Z7QE 4PRPE 5DEJA 1U36A 4IKJA 4EI5B 3C5JA 1CS6A 4FQXD 1ZLWH 2OSLB 5D7LB 3HAEB 3IGFA 4G1MB 1CVSC 3S5LG 1XF5A 2WP3T 4QJ4B 1XGPB 5FF6B 2HH0H 4AIXA 3CZUB 5I15L 5ABZA 1TOXA 3OKEA 3S4SB 1U30A 3MLTA 4F8TA 5D1QB 3CLWA 4WW2A 2JCCE 1H3GA 2ESVD 2IADA 1F3DH 3WN5B 4FNPA 2WMPA 1G9HA 1XD0A 4JM4H 4JQIA 4KMTL 3S5LA 2FGZA 4FNLL 4KKPA 1W2KT 3D4CA 5HYSB 1RVFH 1LE9B 2HTKC 2PCPA 4HZLA 1XWVA 2HX7A 4NZRH 5SWSE 3UH8A 4HKJA 4YXKH 3LXCA 4WU7B 3ROLB 3WS6A 3ZKQD 2VXVH 5I74B 3LNIA 1NAKL 3WV0A 1J0IA 4LLUA 1CR9L 1CTOA 2WQUA 3LHAA 1FFRA 2NRDA 1FBIH 1U8MB 3C5ZA 1WICA 1KJMA 5FM5M 3HC0A 4PTUB 1SDDA 4ZK8A 3KPMB 1IBZA 5ACLA 1FI8C 2ZICA 3O6MH 3W0WE 4Z9KB 1D5MB 1OP5K 4U1GC 3CBKB 4XNUH 5HYQA 3QISA 3ZUCA 1GPOH 4FMVA 5KVDE 1JE6A 1ZGLP 3QS3A 4JG1L 1QI5A 5E9DA 3HVDA 1MJUL 3LN4B 5HGGS 4BFIA 4X6BA 5CBEA 1J48A 4PWEA 4AEHL 4RISL 3L5XL 2R0KL 4NNYB 4H8QA 5IQ9B 2CO1A 4KGJA 3RKPA 1R5VB 3ATFA 4QHPA 1OGTA 1MRDL 2DQIH 4AIZB 1XCXA 3HLAA 2IWFA 5ESAA 2J1XA 4KV5F 5IHWA 4OLYH 3FU5A 1LEKB 2BHZA 5DHDA 1TVBA 3BSGA 3L4UA 2ICEC 4FA6A 3ZW3A 2CCWA 3HE7B 6CGTA 1TVHA 2DQHH 3NK3A 5CEZE 1KC5L 3UZVB 4XOEA 2EIJB 1I3RA 4HIJB 4LLMA 3GMLB 2E76C 4M6OL 4D0DB 2KS0A 1KPUB 1RMFH 1SJVA 2ZXDA 4JKMA 2B1AH 1OT4A 3Q6FA 4BIKA 3JV5A 3RL2B 1YMHB 2BSTA 2ORBH 3CU1A 3MUY1 5DTFB 4P2CG 2XN1A 3QZBA 5HJ3A 1AS7A 2BFGA 3MOBL 4P9HL 4WQOA 2BP8A 2N1TE 3U1SH 4TKWA 3N42F 3KPQA 4PLKC 4XO9A 3TV3L 3T3MF 1J0ZA 4EXPX 2BNUB 2WXOA 5JO5B 4J5VA 2BW4A 4Y5XA 1GZQB 2A73B 3CZFB 4ATWA 5LBSA 4CNIA 2IH8A 3RVVC 1I8KB 1ZT4A 2OYKA 4G9FA 3FT1A 5IHHA 4J3OG 3AXHA 3J07A 3MXVL 4FOMA 3MNWB 4Q74A 2NY4B 5L4IA 4G5AA 4J39A 2ADJB 5GRWA 1ZT1A 2I07A 1NEZB 2R9HD 4NC0B 5E2UH 4AMKH 4ZMQA 3UYOD 1AACA 3N44B 2Q8AL 2MCG1 2DH3A 4Y5YA 2H47C 3RWJA 3ZE1E 2W80C 5JIKA 4YL4A 2CLRB 5DJ0A 3B8SA 3WELA 1AQDB 4L2YA 2VQ1B 5AB9A 3T0DA 1TZHB 2OMZA 4L5FE 3CGTA 2KKQA 3A4AA 4O02H 4H8WH 2AXFB 1QQDB 2ARJB 1D5IL 1OANA 3U4BH 4XRCB 1L6PA 3ZZ1A 2EC9U 4HJ1A 3M86A 5CCGE 4AJYV 5DMYA 1BVLA 3ZYIA 3DMMB 1BQHG 1TYRA 2NY6C 4MD0B 4N0UE 4E42A 4X6FB 32C2A 4ODVH 4QHKI 4ZO8A 2HT4D 2ALAA 4ABWA 2ZAIA 4FZ8L 4GQRA 3ARXA 5EC2B 5J6GA 1HXMA 2YJQA 5E56A 3OR7B 1BQHA 4AVIA 3G5VB 4DH2A 1WBZA 4D8OA 1IGFH 3SBQA 3S97C 3TBSA 2QMKA 1S46A 4W9EC 2D9QB 5CLXA 1D9KA 4XMTA 5I6MA 4NWUL 4A7QA 3D3VE 1BBDH 2X38A 4N3UA 3UGUA 4PJGF 2PCFB 1RZKH 3IJ9A 3RGVD 3KPLA 1H6TA 2VLME 2ZF8A 4FJZA 5IMLB 5AG8A 3VG0H 4L37B 4P3DB 3MRGB 2YC1B 2BDNL 2IDCA 1A9VA 4YHZL 3E2HC 4KOCA 1IQDA 1GAFH 3WFZA 4F5CA 3ALWA 3VFGL 2FX8L 1C7SA 4Z18A 5TGBA 4OF7A 4HIHA 5AB2A 4JY5H 4M9OA 3X14B 2EVHA 3S8FB 3QJSB 2VLJD 5EMYA 4X7TA 4AKOA 4PREA 3NAAH 2ATPA 3SSGA 1PLAA 3HKZA 5BZWA 3RKDC 2ILLA 2IWGA 2HMIC 4XNZB 4PR5A 5DVNA 1L0XA 2F5AH 3IGAA 4N2DA 1TKWB 2LQRA 1MW3A 4F33B 5A6MA 1WFOA 2YA2A 4UWQB 4JFZL 1MF2H 4XO3A 5DUMH 3M7OA 3BKYH 3C08H 5AALA 2WANA 4Z1PA 2XTJE 4PLJC 4OV5B 1E6OL 2J12B 3CZJA 1IEAB 2QEJA 1QASA 1X7TA 2NUPA 4ENZA 5LHDA 1UC6A 3EH3B 3WXWH 2BVUA 4LIQH 4FAAB 1SN0A 1BD2E 5AYQA 1HZKA 3T6ZA 3L3DB 4L1BA 3ULVL 2FT6A 5TH2A 3SIKA 3A5VA 2FIKB 4ALAH 5E24E 3LKSB 4OF0A 2R23A 4J2XA 2ZG1A 5E6ID 2WTPA 2ZUVA 3HG1A 1V54B 4ILDA 4IS6A 1J5OH 4P5RA 1ZXQA 4JREC 4V11A 3BPLB 2GT9A 3UBFA 4XC3H 5HHOE 2KZ1B 4HS8L 4LQFH 3VCLA 4DKFH 1J9CT 3EH1A 4JE4B 3GI8H 1V05A 4H8UA 1J8HB 1IC5L 3V5HB 3TTYA 3QUZB 3NJHA 4MCZB 3IDMA 4FQHB 5D1XD 1A6TA 1T22A 3VA2C 4N20A 2F9BT 2WWOA 3CK0L 2J8OA 3PIQA 4V2CB 5CZKA 3W81A 1T03L 1NCNA 4WEMB 4HC1H 3VGFA 4BSVA 2FGWL 3I3EA 1UVQB 4FHKA 4HJGA 2QQKL 3V0AC 2VLKD 4BE5A 3L3GB 3AS1A 4LEEA 1UACL 1BJ1H 2WKLA 4WWNA 1HHIA 1ZVNA 1V3LA 3PF2A 3SDCD 4HK3J 3X3GH 5IBUG 5D6DC 4R9HA 3WFCH 4B3VA 1N67A 4HQQL 2QSVA 3WTWA 4JHAH 15C8H 1NGZA 1ZV9A 3LRMA 3PL6C 2Y3AA 4NDMA 4PGCA 3H0TB 4JE0A 2CLVA 3BC9A 4KDWA 1N0LB 2V5RA 4OCXH 3MCKA 4PGBA 1AP2B 3KBFA 1DSYA 1GCYA 1OGAA 4V33A 5E1QA 4GAGH 2J2ZA 1JZ2A 2ADGB 1OKEA 4PMEA 5KVDH 1I31A 1Q0EA 2ED8A 1RUML 3A67H 2NX5B 1KN4L 3I50H 4KRNA 4L4TD 3UYPB 2WXQA 3QAZC 3FYEB 3TA3D 1EEZA 4RX4D 1GOFA 2AEIT 5FPIA 4M7LL 4R26L 1Q9KA 2BVPA 1Z9OA 1N2RA 1MJ7L 3BUYA 3EGXB 5IBLD 5KUKA 1M7DA