3MBZA

Oxa-24 beta-lactamase complex soaked with 10mm sa4-17 inhibitor for 15min
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
243
Chain Sequence
b'HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Betalactamase OXA24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3mbzA00
2EXBA 3BLSA 2ZQ7A 5TFQA 5A91A 3N8RA 5EOEA 1YLYA 4PM5A 4X6TA 5M1AA 1NXYA 1K6SA 2ZQDA 4DDSA 4QD4A 1PI4A 1IYOA 5GHXA 2ZC4B 5I94A 2WAFA 2ZLYA 4K0WA 3SH8A 4X55A 3DWKA 2R9WA 1AXBA 1NYMA 2PU2A 4RX3A 3M6BA 4QY6A 4OQHA 4P6BA 3OPRA 4GDNA 3NDGA 3WRZA 1KGEA 2EX2A 3ZG0A 4K91A 4FD8A 5EOOA 4L0LA 4EUZA 1FSYA 2EX9A 5CTMA 3Q07A 1ZKJA 3VSKA 5FQMA 4DDYA 3WS4A 2HPBA 3NI9A 3VP2A 4P85A 1QMFA 4BENA 2X01A 4WMCD 4KZ7A 4E3OA 1GA9A 1K25A 5CTNA 4XUXA 4ZTKA 1CEGA 4KQRA 4X56A 5TR7A 4BJPA 1MWSA 3IXGA 4KZ8A 4LCLA 3SH7A 3VMAA 4E3JA 2H0YA 1E3UA 4MEZA 4RVAA 1O07A 1K4EA 3IXBA 1ZG6A 2I72A 5GHZA 3V39A 3OC2A 5HAPA 3E2KA 1JWVA 1YM1A 2WYXA 1ESIA 1YT4A 2DNSA 3N7WA 4HBTA 1JVJA 3HBRA 2X02A 3SS4A 2JBFA 1ONGA 4GNUA 4KZ6A 1IYQA 3GVBA 3Q1FA 3N4IA 2Y2NA 1TDLA 3DTMA 1YLWA 5M19A 4QJGA 5FI7A 1XA7A 1BULA 1W7FA 3VP4A 4Y0UA 4OKPA 4E3MA 1SKFA 4DRTA 1K57C 2XFTA 1PWCA 3SOIA 3A3EA 1N4OA 3NY4A 4ZAMA 5E2HA 1YLPA 3IH9A 1M40A 2X71A 4OPRA 4ZJ2A 3M2JA 3M6HA 3RXXA 4B88A 3CG5A 4EBNA 1XA1A 1XGIA 3B3XA 1ES5A 3G4PA 1S0WA 4ZJ1A 4GDBA 1MKIA 1VM1A 2Y2MA 3DWZA 4S2LA 4GB7A 5E2GA 4DKIA 3FYZA 5HFOA 5FAOA 3UN7A 1FSWA 5CEDA 1NYYA 3IF6C 3LCEA 1H8ZA 2FFFB 5FI6A 5HW3A 2WGWA 1K55A 1ESUA 3G35A 1JTDA 3M2KA 1KVLA 3WWXA 4DXBA 1L0EA 3GR2A 1WYCA 4NK3A 2XFSA 4R0QA 2HDUA 1L0DA 4R4SA 1ES4A 5E43A 3D4FA 4XUZA 3G30A 1BZAA 4GD6A 2XR0A 1JTGA 5CECA 1MXOA 1YMXA 2RL3A 2ZC5B 2A3UA 2J9OA 4S2NC 4N1XA 3OCNA 2Y2PA 4P0MA 3HLGA 1GCEA 4RX2A 5EVLA 1HZOA 1TEMA 2VGKA 3HUNA 4JKTA 4JXSA 3VSLA 1RGZA 2XDMA 4OLDA 1OMEA 5G18A 2XEPA 4EQIA 1XP4A 4R23A 4C75A 2EX6A 2JCHA 3A3JA 1Q2QA 4GOGA 4MBHA 3O87A 4EBLA 4JBFA 3PBRA 4OP5A 4WM9A 3ZFZA 1SHVA 1H8YA 5DF8A 1ALQA 5U47A 4WEJA 4S2MA 3AGFA 1QMEA 1W8YA 4KZ4A 1GHIA 1LI0A 5AQ9A 1XGJA 4X53A 3BFGA 3HUOA 2DRWA 4WEKA 5DTKA 3VFHA 4K0XA 4JF4A 4KZ9A 5FQQA 4OOMA 2HP9A 3BEBA 1EROA 3OPPA 1SDNA 2ZQCA 3UE0A 3UDIA 3HLFA 5AQ7A 4KZBA 1BT5A 2DCFA 4P87A 4Q8IA 5CHMA 3GSGA 3MZEA 1K54A 1I2WA 2V20A 3NDEA 1Y54A 5EVIC 3WRTA 2OSUA 5HAIA 1KDSA 1PZPA 1ERMA 4S2JA 4E6XA 1FCOA 1MWUA 5HL1A 3UY6A 4X69A 3Q7VA 4CJNA 2ZC7A 4S2OA 4QY5A 3UPOA 1KGFA 3O88A 5DTSA 2ZQ8A 4KZ3A 3VP1A 1K57A 2EFXA 1FR6A 1TDGA 2E8IA 5GLCA 1IKIA 3FV7A 4UAAA 1BUEA 1RP5A 3W4OA 3G2ZA 3HLEA 1XX2A 2J9PA 1E3UD 3IH8A 4S2KA 4E3KA 3AGDA 4PM9A 2XD1A 1NJ4A 1XKZA 2OV5A 1IYPA 2ZM2A 4KENB 3S1YA 4OVDA 5FI2A 3BECA 1HTZA 1PW1A 5CXWA 5FQIA 5FQKA 5HARA 3G2YA 2G2UA 1DJCA 3IXHA 2WZZA 1ERQA 3MFDA 1O7EA 4QB8A 1PIOA 3ISGA 3NC8A 4OLGA 1ES3A 4R4RA 4KQQA 1MWTA 2OLVA 3VOZA 2HP5A 1G6AA 3AGEA 3HLBA 3PBOA 2Y2JA 1L2SA 3CJMA 2IWBA 3ZGAB 1NZUA 1E4DA 1LL9A 1I2SA 2Y59A 3NIAA 2Y91A 4N1HA 4OOLA 4U0XA 5CERA 4WYYA 4PM8A 4LV2A 3S22A 1DJAA 2XF3A 2EFUA 3LEZA 3LO7A 3G32A 2B5RA 4EWFA 5EE8A 1FOFA 1J9MA 4R3BA 4Y0TA 4MLLA 2H10A 4N92A 4OH0A 3W8KA 5HAQA 4FCFA 3WS5A 2P74A 3VOYA 3ZCZA 3IHAA 1NRFA 3ITAA 1WYBA 4BL2A 1JWPA 5E2EA 3P09A 3TG9A 4WELA 3ZNYA 4IEDA 3A3DA 3A3IA 1ES2A 5DTTA 3ZG8B 1E25A 5FATA 3ZG5A 2J7VA 3IWIA 4DE1A 1KE4A 3HLWA 2H0TA 1MPLA 2C6WB 3PBNA 4B4ZA 4PM7A 1MBLA 4ZJ3A 5GL9A 2XQZA 4UA6A 4HEFA 5CEBA 4HESA 4WZ5A 2WKHA 3PBTA 3FKWA 4HBUA 4EV4A 4KZ5A 5KSCA 3BFDA 4KG6A 5CGXA 3MKEA 5F1GA 3CMZA 1FQGA 1RGYA 2QZ6A 3OZHA 3O3VA 1HD8A 2PBYA 1ZG4A 3MXSA 3O86A 3Q81A 1CI8A 3MXRA 4LCMA 1XPBA 4LV1A 2PU4A 3IQAA 2WKEA 2WGWB 4DE3A 3UE1A 1YLZA 1RCJA 3IXDA 3IWOA 3C4OA 5AQBA 5EVIA 3ZNTA 3BFCA 5L2FA 2JE5A 4IBXA 3A3FA 4OP8A 1K56A 3C4PA 3ZHHA 4JPMA 3Q82A 4JXVA 4WZ4A 5BOHA 3ZG9B 1KDWA 5GLDA 3HLDA 1BLHA 3BFFA 3SS3A 2Q9NA 4KG2A 5FQ9A 5CGWA 1YMSA 3W4PA 3LY4A 2WGIA 2BG1A 1K6RA 2G2WA 1KVMA 4O7DA 5TGFA 2WAEA 3IHBA 4YFMA 1KE0A 4DE2A 5FDHA 2Y55A 3UDFA 2JC7A 1I5QA 4OONA 1MWRA 1K55C 3RXWA 2V2FF 5F82A 5KZHA 5DF7A 3EQUA 1NZOA 4Z9QA 3UO9A 1K4FA 2P9VA 4GKUA 4F94A 3NCKA 3SS5A 1IELA 2WUQA 2Z2MB 3BM6A 1Q2PA 3GMWA 3ITBA 4ZBEA 2IWDA 3SH9A 3ZVWA 3Q7ZA 3P98A 1PZOA 4JF6A 4E3NA 3PBSA 3RJUA 4JLFA 1K38A 1PYYA 3QNBA 4UA9A 5CHJA 3GV9A 4KQOA 5E2FA 2XLNA 5GHYA 5FA7A 2GDNA 1TVFA 1CI9A 1N9BA 3BYDA 3G31A 4QHCA 1SDEA 4PM6A 4N9LA 1CEFA 3QHYA 2Y2KA 4OOYA 5A92A 3N6IA 1BSGA 3FZCA 1W79A 4OPYA 3V50A 4RYEA 1LHYA 2HDRA 2P9VB 3HVFA 3LY3A 1Z6FA 3OPHA 1PWGA 3UPNA 4BLMA 5DVAA 4IBRA 5FASA 4R1GA 4DF6A 3ZDJA 4C3QA 1IYSA 1KE3A 5M18A 2A49A 4FSFA 1FCMA 3IWQA 3NBLA 2V1ZA 3C5AA 3PAGA 1C3BA 1BTLA 3DW0A 2UWXA 1BLCA 2VGJA 3FWLA 5GLBA 3CZDA 3IF6A 3MKFA 2Y2GA 1ONHA 3N8LA 3OPLA 3Q7VB 4S2IA 1M6KA 2Y2IA 1BLSA 4Y7PA 4C6YA 2ZQAA 1PW8A 3HL9A 3OCLA 4N9KA 5FQJA 1G68A 4E3IA 4WMCA 4E6WA 2FFYA 3GQZA 4JF5A 3UPPA 1DY6A 4OPZA 4RA7A 2BLSA 4IVKA 2ZC3B 5J8XA 3ZVTA 5D3OA 1EWZA 1W5DA 5HX9A 3GTCA 4OQ0A 4S2PA 3TOIA 5JYPA 4GD8A 2ZC6B 3S4XA 5KSHA 1K54C 2HP6A 4OQIA 2QPNA 1H5XA 4S2NA 4U0TA 3C7UA 4WBGA 3V3SA 1IKGA 1GA0A 4M3KA 2IWCA 2XGNA 3N8SA 3IF5A 2ZM8A 2EX8A 2XH9A 1GHMA 1PI5A 4QU3A 3IF6B 4Y0OA 1GHPA 4GN2A 4LENA 5A90A 2WADA 3EQVA 2Y2LA 2Y4AA 3PTEA 3TSGA 4FH2A 1PWDA 5CHUA 2ZMAA 4MBFA 1KGGA 2XD5A 2XK1A 2QMIA 1L0GA 3MBZA 5AQAA 4JXWA 2OLUA 2WKIA 3WS0A 5IHVA 1NY0A 3G34A 4A5RA 4X68A 1FCNA 1S6RA 3MZFA 5EECA 2CC1A 1YQSA 5GLAA 1YLJA 5JYOA 4NETA 2Y2QA 3IT9A 3PBQA 3HUMA 5F83A 1MY8A 3MZDA 4EBPA 4BL3A 4E3LA 4PMAA 1JWZA 3I7JA 5A93A 2EXAA 3JYIA 4DE0A 1LLBA 2HDQA 4GZBA 5EPHA 5EVID 5FAQA 2RCXA 5CGSA 1U60A 1FR1A 1YLTA 3BRMA 4UHUA 2WGVA 3W4QA 1K56D 2H5SA 3UE3A 2Y2OA 1BLPA 2WZXA 3BLMA 4ZDXA 4KG5A 3QNCA 3V3RA 1VQQA 4MBKA 4ID4A 4BD1A 2Z2LB 5KMWA 2HDSA 2ZJ9A 4UA7A 1EI5A 4MNRA 5DF9A 1CK3A 3V5MA 4FH4A 3VP0A 1ZC2A 3UNWA 2WK0A 5FSRA 3VP3A 5FAPA 3WS2A 4JXGA 4XXRA 4U3TA 2ZQ9A 1LL5A 4IVIA 3BFEA 3UDXA 3FKVA 5F1FA 2Q9MA 4B4XA 4OQGA 3WS1A 4D2OA 1DJBA 4DXCA 1HVBA 1L0FA 3HREA 5EVIB 4OPQA 3GRJA 5CRFA 1IEMA 3C7VA 2ZD8A 2R9XA 1XXMA 2C5WB 2Y2HA 4LV0A 2J8YA 3E2LA 1SCWA 1W8QA 4YINA 2ZM0A 4KZAA 3VFFA 3ZG7B 4CPKA 4LV3A 1WE4A 4WZ5C 3HLCA 4BQMA 4H8RA 4PPRA 4BD0A 4R3JA 1LI9A 3PAEA 5EUAA
chains in the Genus database with same CATH superfamily
3MQ0A 3BLSA 5TFQA 3N8RA 1YLYA 2ZQDA 3HCYA 5DKKA 5I94A 3SH8A 3UB8A 3WRZA 3RH8B 4FD8A 4EUZA 3NI9A 5AVEA 4E3OA 2UV0E 1GA9A 4D60A 5TR7A 4KQRA 4KZ8A 4LCLA 4E3JA 1E3UA 2A2LA 4HP9A 5HAPA 1JWVA 1ESIA 1OJ5A 1YT4A 4Y17A 1IYQA 3GVBA 2HJEA 3N4IA 4R3AA 1TDLA 4H6JB 3VE4A 1BULA 2ZOHA 2XFTA 3KYEA 3BQAA 1PWCA 3NY4A 5E2HA 4DJ2A 4HJ3A 4OPRA 3M6HA 3B3XA 4ZJ1A 3DWZA 5EV0A 3IF6C 3FPWA 5HW3A 3LEQA 5I5LA 5DFYA 3KSIA 2DMWA 3TE8A 4XUZA 1XJ4A 3G30A 4II7A 3IX3A 4NXBA 3QP2A 2J9OA 4NXGA 4S2NC 3G6OA 3LIDA 2ZMFA 2Y2PA 3HLGA 2W3EA 3HUNA 4JKTA 3VSLA 1RGZA 2P04A 1IFQA 5G18A 2XEPA 4R23A 4JBFA 4OP5A 2PYPA 5KIZA 1H8YA 5U47A 1TF1A 3KSHA 3UB7A 4K0XA 4JF4A 5FL3A 1EROA 4L9EA 3V67A 3UE0A 3H82B 4GHIA 2V20A 2WKRA 3MXQA 4EESA 1Y54A 2KDKA 2OSUA 1PZPA 3EWKA 4E6XA 1FCOA 5HL1A 4CJNA 1KGFA 4KQDA 3LR3A 4EXOA 1K57A 3VV4A 1TDGA 4UAAA 1E3UD 2J80A 3TW8A 3EGXC 1NJ4A 5MC7A 4CLCE 1WA9A 4MMNA 2G2UA 5K5BA 1ERQA 1PRQA 1PIOA 4I39A 3U4LP 3ISGA 1ES3A 4AFIA 3ZYTA 5HWWA 2Y2JA 1L2SA 3CJMA 4OOLA 3R7WB 2O99A 5HSQA 2Y91A 5CERA 4G3VA 2CMNA 4MN7A 1DJAA 3LO7A 3LEZA 3G32A 4EWFA 4MLLA 4N92A 3MFXA 4OH0A 3W8KA 2INWA 3ZCZA 1NRFA 1WYBA 1VB6A 5E2EA 1N9NA 3PXPA 4L9GA 5FATA 5HD3A 2H0TA 2G7UA 1XJ2A 4B4ZA 4PM7A 1MBLA 4ZJ3A 3PR6A 4JGRA 4UA6A 5CEBA 4HESA 2JKRM 3MF0A 4EV4A 4Q0JA 5CGXA 3MKEA 1KOUA 3BWLA 1RGYA 5HWVA 3Q81A 4MN5A 4UEYA 2HJ9C 2PU4A 1T1CA 3LYXA 3IWOA 3ZNTA 3BFCA 2V1AA 4IBXA 1K56A 3KYZA 2IA2A 3HLDA 3SS3A 1YMSA 2BG1A 1K6RA 4IUHA 2WAEA 4YFMA 1LSWA 3UDFA 4OONA 5DJUA 1MWRA 5F82A 1K4FA 4GKUA 3NCKA 2A24B 3BM6A 3P98A 2OWJA 4I3JA 4HP4A 3PBSA 4YNRA 4RQ9A 3RJUA 3CPTA 1K38A 1PYYA 5E2FA 3S7PA 3BYDA 1N9BA 3T12B 4PM6A 4CQHA 4OOYA 3N6IA 1BSGA 5IS1A 1X0OA 2QKPA 2P9VB 2A49A 2V1ZA 3F1OA 1C3BA 3EEHA 2UWXA 1BLCA 3ICYA 3OPLA 3Q7VB 1V9YA 1PW8A 3IX8A 2VEAA 3FC7A 5FQJA 2FFYA 3GQZA 4OPZA 4RA7A 2BLSA 4IVKA 1LSXA 2KX6A 2ZC3B 2LB5A 5D3OA 5HX9A 4S2PA 3T1SA 3L9KA 2PD8A 2W1TB 4NXFA 2WADA 4HNBA 4KUOA 4MBFA 4BBTA 2WKIA 1NY0A 2V8FA 3G34A 4A5RA 1D06A 4X68A 2PRFA 2CC1A 1YQSA 5GLAA 1YLJA 4M4XA 3IT9A 2R78A 4ARZA 4HH3A 1NLZA 5F83A 4EBPA 3F1NA 5HPFA 4LRXC 2EXAA 4DE0A 3L7HA 5CGSA 1U60A 1FR1A 1YLTA 1K56D 4ZDXA 3T1QB 4ID4A 2V9AA 5KMWA 2ZJ9A 4MNRA 1ZTUA 3V5MA 3VP0A 1SKOA 2JKTI 3CHWP 5FAPA 4JXGA 4HJ6A 3FKVA 3LR5A 1DJBA 4DMZA 1L0FA 4G3KA 5EVIB 3GRJA 3CUEA 3C7VA 1IEMA 5EM1A 3QP5A 2C5WB 4LV0A 2J8YA 4YINA 2ZM0A 3VFFA 3ZG7B 4WZ5C 2VZWA 3PAEA 5EUAA 3NJAA 2ZQ7A 2HGVA 5EOEA 4X6TA 1NXYA 1IYOA 4HOIA 1DRMA 4MCWA 3DWKA 1NYMA 2PU2A 3M6BA 4QY6A 2D01A 4P6BA 3OPRA 3LR4A 1GSVA 2VV7A 1FSYA 5J3WA 5FQMA 4NXEA 1QMFA 4BENA 3CAXA 2FH5A 1CEGA 4X56A 1MWSA 2GJ3A 2H0YA 4MEZA 5C5KA 1O07A 1K4EA 3V39A 2I72A 3OC2A 1S4RA 4HBTA 2DNSA 4NEED 4PKYG 4I5SA 3UMDA 2JBFA 1ONGA 3KO6A 3DTMA 4QJGA 3E0YA 1XA7A 1W7FA 5HWTA 4ME4A 3S7OA 5HPIA 3T50A 4B88A 2EA9A 3CG5A 1Y4OA 4GDBA 1VM1A 2Y2MA 4DKIA 4ETZA 4Y3IA 1H8ZA 2FFFB 2WGWA 1K55A 1ESUA 3QP6A 1JTDA 3WWXA 4DXBA 4NK3A 2XFSA 2K31A 4LFUA 4WL9A 3ULFA 5E43A 1ES4A 3D4FA 3D9YA 1JTGA 1MXOA 1YMXA 2A3UA 3HJKA 2L0WA 3OCNA 3EOIA 3SW1A 4JXSA 2W3FA 1XP4A 3CWFA 4HQAA 3LI8A 4C75A 2EX6A 2JCHA 4GOGA 1VHMA 4WM9A 1SHVA 4S2MA 3AGFA 1W8YA 5TBMA 2QYBA 1GHIA 5AQ9A 2DRWA 3BEBA 2ZQCA 3KSFA 1BYWA 5HDCA 3T4QA 3HLFA 5AQ7A 2ZL1A 1BT5A 2VJWA 4P87A 5CHMA 4Q8IA 5EVIC 3WRTA 1LSVA 4S2JA 1MWUA 3LGOA 1G6OA 5HZHA 4QY5A 3O88A 3NOTC 3VP1A 2GX5A 2EFXA 2HZ5A 3W4OA 3FV7A 1BUEA 4FUWA 2J9PA 4B9OA 3IH8A 3AGDA 4PM9A 2XD1A 1XFNA 2OV5A 3B33A 2ZM2A 4GHIB 4OVDA 4UQIM 1VETA 5FI2A 1HTZA 1PW1A 1P9WA 5FQIA 2YKFA 4WLAA 3NC8A 5EFWA 3VOZA 2HP5A 4PHTA 3AGEA 3HLBA 3ZGAB 1E4DA 1OT6A 4N1HA 4R38A 4CLCA 4WYYA 3S22A 4EETB 2B5RA 4R3BA 5F69A 5F68A 1OTAA 5HAQA 5FEGA 4UQIS 3BY9A 3IHAA 3ITAA 1JWPA 3A3DA 4F3LA 4LRYC 1ES2A 3ZG8B 3UMEA 2OAQ1 4K08A 4DE1A 1MPLA 2C6WB 3E4OA 5L10A 1OPXA 5GL9A 2K7SA 3H9WA 5FDSA 2WKHA 4I3IA 1FQGA 4JGPA 1HD8A 2PBYA 4LCMA 2QJ5A 3MS6A 4LV1A 3IQAA 3UE1A 3IXDA 3C4OA 2PYRA 3C30A 2JE5A 3ZHHA 3A3FA 4X1MA 3SZTA 5DKLA 3UB6A 5BOHA 1KDWA 4KG2A 5CGWA 2G2WA 1KVMA 2BASA 1KE0A 4WUJA 5DJTA 3T4OA 5DF7A 4L9FA 4O01A 1Q2PA 4ZBEA 2PR5A 2V1BA 2O9AA 5CHJA 4KQOA 5FA7A 1T1AA 2GDNA 1CI9A 4QHCA 4KUKA 4N9LA 5A92A 3CITA 1STZA 4RYEA 1PNEA 2W1RA 4IBRA 4R1GA 4QPRA 4DF6A 4C3QA 1KE3A 4FSFA 3IWQA 4IUKA 2P08A 3PAGA 3CZDA 1ONHA 3CPTB 2Y2IA 2L4RA 1XJ3A 4Y7PA 4C6YA 3OCLA 3JVVA 1G68A 4E3IA 4JF5A 3ZVTA 4CLCD 1EWZA 4P6ZM 1W5DA 2ZC6B 3LFVA 5KSHA 1UWNX 4OQIA 2QPNA 2MJ6A 2Y79A 3V3SA 3F1OB 1GA0A 3IF5A 3IBJA 2EX8A 1GHMA 4Y0OA 4EEPA 1GHPA 4LENA 3O5YA 3PTEA 3MSHA 4EERA 4GS9A 2XK1A 1L0GA 5AQAA 3WS0A 2J3WA 2JKRI 5AJGA 3T4TA 4Y2FA 2WKQA 4X25A 2BTFP 4P6ZS 1PFLA 5EECA 1LL8A 3HUMA 1MY8A 3MZDA 3NOPC 4PMAA 1JWZA 1MZUA 3LIFA 5A93A 5EPHA 3VE3A 5A8BA 5FAQA 3EEAA 3BRMA 2WGVA 3LUQA 1BLPA 3BLMA 4KG5A 1A0KA 4EU0A 4UA7A 4WN5A 5HDSA 2O9CA 4HHDA 5DF9A 1S1ZA 2WK0A 3VP3A 3WS2A 2ZBBA 4U3TA 4HIAA 3H82A 4IVIA 3KSGA 1MC0A 4OQGA 4QWOA 4DXCA 4B93A 1VEUB 4OPQA 5CRFA 2ZD8A 1XXMA 2VLGA 4LLOB 1G5UA 4KZAA 2LB9A 1OJGA 4H8RA 2Z6CA 4BD0A 3T4KA 1LI9A 5IT5A 1TS0A 1SKOB 4DDSA 5F5YA 1N9OA 4QD4A 1PI4A 5GHXA 2ZC4B 2WAFA 2ZLYA 3U2AA 2R9WA 4R70A 1AXBA 2V8CA 4HJ4A 4RX3A 4BWIA 4GDNA 3NDGA 3MJQA 2EX2A 3ZG0A 4K91A 5EOOA 2JKFA 2EX9A 3Q07A 3IBRA 3VSKA 2FZ0A 4DDYA 2HPBA 3VP2A 4P85A 3D3OA 1K25A 5CTNA 4XUXA 3T4SA 2JHEA 3IXGA 2W0NA 4RVAA 1S66L 3IXBA 4JGQA 5GHZA 3E2KA 2WYXA 1EW0A 3N7WA 3PHYA 3HBRA 2X02A 3SS4A 4GNUA 4GW9A 4KZ6A 3LIEA 5FI7A 3VP4A 1SKFA 3QP4A 3SOIA 3NOUC 1N4OA 2X71A 4ZJ2A 3M2JA 2EWWA 2HF6A 1W63M 4HI4A 1XGIA 1ES5A 3G4PA 1MKIA 1H8MA 4S2LA 5HFOA 5FAOA 5CEDA 1NYYA 3F1PA 2J3TD 5FI6A 4PKYA 1KVLA 5TJJA 3P01A 3GR2A 1WYCA 3K3CA 1OTEA 4R4SA 3BY8A 3FG8A 1BZAA 1LT0A 2XR0A 5CECA 2RL3A 2ZC5B 3BW6A 4N1XA 1GCEA 3MQQA 2QHKA 1HZOA 1TEMA 2VGKA 1S4SA 4OLDA 1OMEA 4EQIA 3NHQA 3IS2B 3OOVA 3H7WA 1L3LA 1Q2QA 2A24A 5EVEA 4EBLA 3PBRA 1ALQA 2NUTC 4I3AA 4GCZA 1QMEA 2EWVA 4KZ4A 1LI0A 4X53A 3BFGA 3VFHA 4KZ9A 5FQQA 4OOMA 2HP9A 2JKTM 4EQ1A 4I38A 3UE6A 1AWIA 3MZEA 2M7UA 1K54A 3NDEA 5HDDA 5HAIA 1KDSA 2OAP1 3UY6A 4X69A 4Q0IA 5TBMB 3Q7VA 3MMHA 3UPOA 2ZQ8A 3TJZC 5GLCA 1IKIA 1ODVA 3OBFA 3G2ZA 3HLEA 1XX2A 4E3KA 2ZL1B 1XKZA 4JGOA 4KENB 3S1YA 3E4QA 3BECA 5CXWA 5HARA 5FQKA 5F6AA 4Y15A 2WKPA 3HJIA 3CUEC 2VX8A 3C8CA 1DJCA 2W1TA 3IXHA 1W63Q 1O7EA 4OLGA 4KQQA 3IX4A 3NECA 1CF0A 3PBOA 1D1JA 2Y59A 3NIAA 1LL9A 1I2SA 4U0XA 4PM8A 1FOFA 4Y0TA 3RTYA 2H10A 1YSQA 3WS5A 3PYPA 3VOYA 1Y28A 1P0ZA 1ACFA 4BL2A 4WELA 4IEDA 2ZOIA 5DTTA 4BMWA 1E25A 3ZG5A 2J7VA 3IWIA 1KE4A 5FEFA 3HLWA 4CLCB 2AVXA 3DBAA 3FKWA 4HBUA 1P9RA 4KG6A 5F1GA 3R4KA 2O0YA 3VOLA 2PHYA 3OZHA 1ZG4A 3O86A 3C38A 1CI8A 2VV8A 3MXRA 1P97A 4DE3A 1YLZA 4ESPA 5AQBA 5EVIA 5L2FA 2JKGA 1N9LA 4OP8A 4LPZA 3C4PA 3S7NA 4JXVA 1BLHA 3BFFA 4XT2A 5FQ9A 3GECA 2WGIA 1T19A 5TGFA 3IHBA 2Y55A 3DTKA 2JC7A 1I5QA 2XROA 1K55C 3RXWA 5KZHA 3EQUA 1NZOA 2VV6A 3SS5A 2PBDP 1IELA 2Z2MB 3ITBA 2Y8HA 2B02A 1PZOA 4JF6A 5L07A 2I9VA 4JLFA 3QNBA 4UA9A 5GHYA 2XLNA 3G31A 1XFQA 1W79A 4OPYA 4EEUA 3A0SA 3V50A 1LHYA 3UPNA 3LY3A 3HVFA 5FASA 1Z6FA 5DVAA 3ZDJA 1IYSA 2W27A 5M18A 3NBLA 5HL6A 1BTLA 3FWLA 4Q0HA 3IF6A 3MKFA 2Y2GA 3N8LA 3HL9A 4N9KA 4WMCA 4E6WA 2YKHA 3FPVA 5J8XA 4OQ0A 1OTDA 4S2NA 1H5XA 1NWZA 3C7UA 4WBGA 3OLOA 4M3KA 2XGNA 2ZM8A 4YWZA 2Z6DA 4GN2A 5A90A 4R6LA 3EQVA 1UGUA 2Y2LA 2Y4AA 2Q0OA 4BBVA 3QP1A 4FH2A 1PWDA 5CHUA 4DN0A 2QMIA 2VK3A 4FOFA 3MBZA 1FCNA 3MZFA 4GJ4A 3JPUA 5JYOA 2Y2QA 3PBQA 3LICA 4Z1WA 4NKPA 5G4YA 2PD7A 2B18A 3T4LA 1G28A 3I7JA 1LLBA 2HDQA 2XA7M 5EVID 4GS9B 3W4QA 4UHUA 4CLCC 3V3RA 4MBKA 4X1LA 2L1MA 3E98A 2Z2LB 2H28A 3T1RA 3CI6A 1CK3A 4FH4A 4FTXA 1ZC2A 1OTIA 4ZRRA 2VKSA 4O8GA 3UB9A 3BFEA 4B4XA 3WS1A 4D2OA 3T1XA 4GLQA 2VA0A 1OT9A 2R9XA 2XA7S 2Y2HA 1ZHHB 3E2LA 1H3QA 1SCWA 1NRJA 4HY8A 3HLCA 4YOFA 4PPRA 1MKMA 2GNXA 4R3JA 2Y2KA 4KZBA 2IWBA 3SH7A 2EXBA 5A91A 4PM5A 5M1AA 1K6SA 4K0WA 4X55A 1J3WA 3LI9A 4Y13A 4OQHA 2KLIA 1KGEA 4L0LA 1YKDA 5CTMA 1ZKJA 3C2WA 3WS4A 4H6JA 2X01A 4WMCD 1DP8A 4KZ7A 4ZTKA 4BJPA 3VMAA 2W3DA 1ZG6A 1YM1A 2OOLA 4MN6A 2JN7A 2O9BA 1TD5A 1JVJA 5AVFA 3S7QA 3Q1FA 2NUPC 2Y2NA 5M19A 1YLWA 4Y0UA 4OKPA 4E3MA 4DRTA 1K57C 3A3EA 1FILA 4ZAMA 4MDZA 1YLPA 3IH9A 1M40A 3RXXA 4EBNA 4NG2A 1XA1A 3D72A 1S0WA 4GB7A 5E2GA 3FYZA 3UN7A 4G3WA 1FSWA 3LCEA 3G35A 3M2KA 2PAVP 1L0EA 4R0QA 2HDUA 1L0DA 4GD6A 4Y5FA 4P0MA 4RX2A 5EVLA 1YSPA 2ACGA 2XRNA 2M7VA 4ARZB 2XDMA 3F1PB 3F1NB 4LGWA 3A3JA 4MBHA 4LRZE 3O87A 1F98A 1OTBA 3ZFZA 2VGLM 5DF8A 4WEJA 1DP9A 1XGJA 3HUOA 5DTKA 4WEKA 1F5MA 3OPPA 1SDNA 3UDIA 2J3TC 3EGDC 5EM0A 3H7WB 2DCFA 5J4EA 3GSGA 1I2WA 1D7EA 2PDRA 4BBUA 1ERMA 1Z09A 2VGLS 2ZC7A 4S2OA 5DTSA 4KZ3A 3NULA 1TS6A 1FR6A 2E8IA 1RP5A 4S2KA 3R7WA 1IYPA 1JNUA 1T1BA 3G2YA 2WZZA 3MFDA 1TS7A 4QB8A 2QJ7A 4R4RA 1MWTA 2OLVA 1G6AA 1T18A 3ZQ5A 1NZUA 4LV2A 2D02A 2XF3A 2EFUA 5EE8A 1J9MA 3CLOA 4IHQA 4FCFA 2P74A 3P09A 3TG9A 3ZNYA 1YPRA 3B42A 3A3IA 1FIKA 2HV1A 2V0UA 2QWSA 5DFXA 1GSWA 3KYQA 3PBNA 4PAUA 3DTIA 2XQZA 2ZMVA 3DTEA 4HEFA 5HD5A 4WZ5A 3PBTA 4KZ5A 5KSCA 3BFDA 3A0RA 3CMZA 2QZ6A 3O3VA 3P7NA 3MXSA 1XPBA 3A0VA 2WKEA 2WGWB 4HH2A 5G4ZA 1RCJA 1VEUA 4JPMA 3Q82A 4WZ4A 3ZG9B 5GLDA 2Q9NA 3W4PA 3LY4A 2B95A 4O7DA 4DE2A 5FDHA 1HLUP 3QP8A 1TS8A 3K3DA 1S67L 2V2FF 3MQOA 4Z9QA 3UO9A 4IJGA 2P9VA 4F94A 3W2ZA 2WUQA 3GMWA 2IWDA 3E4PA 3SH9A 3ZVWA 3Q7ZA 4XT2B 2E8JA 4E3NA 4WF0A 2W3GA 3GV9A 1TVFA 1SDEA 2KOIA 1CEFA 3QHYA 3B47A 3DAVA 1CQAA 2W3HA 3FZCA 2HDRA 4BLMA 3BJNA 1PWGA 3OPHA 1F2KA 1CJFA 4ETXA 1FCMA 2PT7A 3C5AA 2K2NA 1IOUA 2M1CA 3DW0A 5GLBA 2VGJA 4S2IA 1M6KA 1BLSA 2ZQAA 3K2NA 4O0PA 3UPPA 1DY6A 1V9ZA 1F9IA 3GTCA 3TOIA 5JYPA 4GD8A 3S4XA 1K54C 2HP6A 3LR0A 1VETB 4U0TA 4E04A 1IKGA 2XSSA 2IWCA 3N8SA 1UWPX 2XH9A 5IU1A 1PI5A 4QU3A 3IF6B 2PR6A 4EUVA 3GDIA 3TSGA 1YAXA 2ZMAA 1KGGA 2XD5A 4JXWA 2OLUA 5IHVA 1SZVA 1S6RA 1S1YA 1H0MA 3KX0X 4NETA 4EW7A 4BL3A 4E3LA 2P7JA 3IS2A 4F3LB 3RFBA 3JYIA 4GZBA 3BQ8A 2RCXA 2H5SA 3UB5P 3UE3A 2Y2OA 2WZXA 5CX7A 3QNCA 2GZAA 1XJ6A 1VQQA 4BD1A 3MR0A 2HDSA 1EI5A 3LIBA 2V0WA 3UNWA 5FSRA 4XXRA 5J7EA 2ZQ9A 1LL5A 1NLYA 3UDXA 5F1FA 2Q9MA 4DJ3A 5L8MA 1HVBA 3HREA 1K0KA 1GSXA 5L09A 2OWHA 3TRCA 3T4JA 1W8QA 4CPKA 4LV3A 1WE4A 3LIAA 4BQMA 1DP6A 3JVUA 5LBRA
chains in the Genus database with same CATH topology
2EXBA 3BLSA 2ZQ7A 5TFQA 5A91A 3N8RA 5EOEA 1YLYA 4PM5A 4X6TA 5M1AA 1NXYA 1K6SA 2ZQDA 4DDSA 4QD4A 1PI4A 1IYOA 5GHXA 2ZC4B 5I94A 2WAFA 2ZLYA 4K0WA 3SH8A 4X55A 3DWKA 2R9WA 1AXBA 1NYMA 2PU2A 4RX3A 3M6BA 4QY6A 4OQHA 4P6BA 3OPRA 4GDNA 3NDGA 3WRZA 1KGEA 2EX2A 3ZG0A 4K91A 4FD8A 5EOOA 4L0LA 4EUZA 1FSYA 2EX9A 5CTMA 3Q07A 1ZKJA 3VSKA 5FQMA 4DDYA 3WS4A 2HPBA 3NI9A 3VP2A 4P85A 1QMFA 4BENA 2X01A 4WMCD 4KZ7A 4E3OA 1GA9A 1K25A 5CTNA 4XUXA 4ZTKA 1CEGA 4KQRA 4X56A 5TR7A 4BJPA 1MWSA 3IXGA 4KZ8A 4LCLA 3SH7A 3VMAA 4E3JA 2H0YA 1E3UA 4MEZA 4RVAA 1O07A 1K4EA 3IXBA 1ZG6A 2I72A 5GHZA 3V39A 3OC2A 5HAPA 3E2KA 1JWVA 1YM1A 2WYXA 1ESIA 1YT4A 2DNSA 3N7WA 4HBTA 1JVJA 3HBRA 2X02A 3SS4A 2JBFA 1ONGA 4GNUA 4KZ6A 1IYQA 3GVBA 3Q1FA 3N4IA 2Y2NA 1TDLA 3DTMA 1YLWA 5M19A 4QJGA 5FI7A 1XA7A 1BULA 1W7FA 3VP4A 4Y0UA 4OKPA 4E3MA 1SKFA 4DRTA 1K57C 2XFTA 1PWCA 3SOIA 3A3EA 1N4OA 3NY4A 4ZAMA 5E2HA 1YLPA 3IH9A 1M40A 2X71A 4OPRA 4ZJ2A 3M2JA 3M6HA 3RXXA 4B88A 3CG5A 4EBNA 1XA1A 1XGIA 3B3XA 1ES5A 3G4PA 1S0WA 4ZJ1A 4GDBA 1MKIA 1VM1A 2Y2MA 3DWZA 4S2LA 4GB7A 5E2GA 4DKIA 3FYZA 5HFOA 5FAOA 3UN7A 1FSWA 5CEDA 1NYYA 3IF6C 3LCEA 1H8ZA 2FFFB 5FI6A 5HW3A 2WGWA 1K55A 1ESUA 3G35A 1JTDA 3M2KA 1KVLA 3WWXA 4DXBA 1L0EA 3GR2A 1WYCA 4NK3A 2XFSA 4R0QA 2HDUA 1L0DA 4R4SA 1ES4A 5E43A 3D4FA 4XUZA 3G30A 1BZAA 4GD6A 2XR0A 1JTGA 5CECA 1MXOA 1YMXA 2RL3A 2ZC5B 2A3UA 2J9OA 4S2NC 4N1XA 3OCNA 2Y2PA 4P0MA 3HLGA 1GCEA 4RX2A 5EVLA 1HZOA 1TEMA 2VGKA 3HUNA 4JKTA 4JXSA 3VSLA 1RGZA 2XDMA 4OLDA 1OMEA 5G18A 2XEPA 4EQIA 1XP4A 4R23A 4C75A 2EX6A 2JCHA 3A3JA 1Q2QA 4GOGA 4MBHA 3O87A 4EBLA 4JBFA 3PBRA 4OP5A 4WM9A 3ZFZA 1SHVA 1H8YA 5DF8A 1ALQA 5U47A 4WEJA 4S2MA 3AGFA 1QMEA 1W8YA 4KZ4A 1GHIA 1LI0A 5AQ9A 1XGJA 4X53A 3BFGA 3HUOA 2DRWA 4WEKA 5DTKA 3VFHA 4K0XA 4JF4A 4KZ9A 5FQQA 4OOMA 2HP9A 3BEBA 1EROA 3OPPA 1SDNA 2ZQCA 3UE0A 3UDIA 3HLFA 5AQ7A 4KZBA 1BT5A 2DCFA 4P87A 4Q8IA 5CHMA 3GSGA 3MZEA 1K54A 1I2WA 2V20A 3NDEA 1Y54A 5EVIC 3WRTA 2OSUA 5HAIA 1KDSA 1PZPA 1ERMA 4S2JA 4E6XA 1FCOA 1MWUA 5HL1A 3UY6A 4X69A 3Q7VA 4CJNA 2ZC7A 4S2OA 4QY5A 3UPOA 1KGFA 3O88A 5DTSA 2ZQ8A 4KZ3A 3VP1A 1K57A 2EFXA 1FR6A 1TDGA 2E8IA 5GLCA 1IKIA 3FV7A 4UAAA 1BUEA 1RP5A 3W4OA 3G2ZA 3HLEA 1XX2A 2J9PA 1E3UD 3IH8A 4S2KA 4E3KA 3AGDA 4PM9A 2XD1A 1NJ4A 1XKZA 2OV5A 1IYPA 2ZM2A 4KENB 3S1YA 4OVDA 5FI2A 3BECA 1HTZA 1PW1A 5CXWA 5FQIA 5FQKA 5HARA 3G2YA 2G2UA 1DJCA 3IXHA 2WZZA 1ERQA 3MFDA 1O7EA 4QB8A 1PIOA 3ISGA 3NC8A 4OLGA 1ES3A 4R4RA 4KQQA 1MWTA 2OLVA 3VOZA 2HP5A 1G6AA 3AGEA 3HLBA 3PBOA 2Y2JA 1L2SA 3CJMA 2IWBA 3ZGAB 1NZUA 1E4DA 1LL9A 1I2SA 2Y59A 3NIAA 2Y91A 4N1HA 4OOLA 4U0XA 5CERA 4WYYA 4PM8A 4LV2A 3S22A 1DJAA 2XF3A 2EFUA 3LEZA 3LO7A 3G32A 2B5RA 4EWFA 5EE8A 1FOFA 1J9MA 4R3BA 4Y0TA 4MLLA 2H10A 4N92A 4OH0A 3W8KA 5HAQA 4FCFA 3WS5A 2P74A 3VOYA 3ZCZA 3IHAA 1NRFA 3ITAA 1WYBA 4BL2A 1JWPA 5E2EA 3P09A 3TG9A 4WELA 3ZNYA 4IEDA 3A3DA 3A3IA 1ES2A 5DTTA 3ZG8B 1E25A 5FATA 3ZG5A 2J7VA 3IWIA 4DE1A 1KE4A 3HLWA 2H0TA 1MPLA 2C6WB 3PBNA 4B4ZA 4PM7A 1MBLA 4ZJ3A 5GL9A 2XQZA 4UA6A 4HEFA 5CEBA 4HESA 4WZ5A 2WKHA 3PBTA 3FKWA 4HBUA 4EV4A 4KZ5A 5KSCA 3BFDA 4KG6A 5CGXA 3MKEA 5F1GA 3CMZA 1FQGA 1RGYA 2QZ6A 3OZHA 3O3VA 1HD8A 2PBYA 1ZG4A 3MXSA 3O86A 3Q81A 1CI8A 3MXRA 4LCMA 1XPBA 4LV1A 2PU4A 3IQAA 2WKEA 2WGWB 4DE3A 3UE1A 1YLZA 1RCJA 3IXDA 3IWOA 3C4OA 5AQBA 5EVIA 3ZNTA 3BFCA 5L2FA 2JE5A 4IBXA 3A3FA 4OP8A 1K56A 3C4PA 3ZHHA 4JPMA 3Q82A 4JXVA 4WZ4A 5BOHA 3ZG9B 1KDWA 5GLDA 3HLDA 1BLHA 3BFFA 3SS3A 2Q9NA 4KG2A 5FQ9A 5CGWA 1YMSA 3W4PA 3LY4A 2WGIA 2BG1A 1K6RA 2G2WA 1KVMA 4O7DA 5TGFA 2WAEA 3IHBA 4YFMA 1KE0A 4DE2A 5FDHA 2Y55A 3UDFA 2JC7A 1I5QA 4OONA 1MWRA 1K55C 3RXWA 2V2FF 5F82A 5KZHA 5DF7A 3EQUA 1NZOA 4Z9QA 3UO9A 1K4FA 2P9VA 4GKUA 4F94A 3NCKA 3SS5A 1IELA 2WUQA 2Z2MB 3BM6A 1Q2PA 3GMWA 3ITBA 4ZBEA 2IWDA 3SH9A 3ZVWA 3Q7ZA 3P98A 1PZOA 4JF6A 4E3NA 3PBSA 3RJUA 4JLFA 1K38A 1PYYA 3QNBA 4UA9A 5CHJA 3GV9A 4KQOA 5E2FA 2XLNA 5GHYA 5FA7A 2GDNA 1TVFA 1CI9A 1N9BA 3BYDA 3G31A 4QHCA 1SDEA 4PM6A 4N9LA 1CEFA 3QHYA 2Y2KA 4OOYA 5A92A 3N6IA 1BSGA 3FZCA 1W79A 4OPYA 3V50A 4RYEA 1LHYA 2HDRA 2P9VB 3HVFA 3LY3A 1Z6FA 3OPHA 1PWGA 3UPNA 4BLMA 5DVAA 4IBRA 5FASA 4R1GA 4DF6A 3ZDJA 4C3QA 1IYSA 1KE3A 5M18A 2A49A 4FSFA 1FCMA 3IWQA 3NBLA 2V1ZA 3C5AA 3PAGA 1C3BA 1BTLA 3DW0A 2UWXA 1BLCA 2VGJA 3FWLA 5GLBA 3CZDA 3IF6A 3MKFA 2Y2GA 1ONHA 3N8LA 3OPLA 3Q7VB 4S2IA 1M6KA 2Y2IA 1BLSA 4Y7PA 4C6YA 2ZQAA 1PW8A 3HL9A 3OCLA 4N9KA 5FQJA 1G68A 4E3IA 4WMCA 4E6WA 2FFYA 3GQZA 4JF5A 3UPPA 1DY6A 4OPZA 4RA7A 2BLSA 4IVKA 2ZC3B 5J8XA 3ZVTA 5D3OA 1EWZA 1W5DA 5HX9A 3GTCA 4OQ0A 4S2PA 3TOIA 5JYPA 4GD8A 2ZC6B 3S4XA 5KSHA 1K54C 2HP6A 4OQIA 2QPNA 1H5XA 4S2NA 4U0TA 3C7UA 4WBGA 3V3SA 1IKGA 1GA0A 4M3KA 2IWCA 2XGNA 3N8SA 3IF5A 2ZM8A 2EX8A 2XH9A 1GHMA 1PI5A 4QU3A 3IF6B 4Y0OA 1GHPA 4GN2A 4LENA 5A90A 2WADA 3EQVA 2Y2LA 2Y4AA 3PTEA 3TSGA 4FH2A 1PWDA 5CHUA 2ZMAA 4MBFA 1KGGA 2XD5A 2XK1A 2QMIA 1L0GA 3MBZA 5AQAA 4JXWA 2OLUA 2WKIA 3WS0A 5IHVA 1NY0A 3G34A 4A5RA 4X68A 1FCNA 1S6RA 3MZFA 5EECA 2CC1A 1YQSA 5GLAA 1YLJA 5JYOA 4NETA 2Y2QA 3IT9A 3PBQA 3HUMA 5F83A 1MY8A 3MZDA 4EBPA 4BL3A 4E3LA 4PMAA 1JWZA 3I7JA 5A93A 2EXAA 3JYIA 4DE0A 1LLBA 2HDQA 4GZBA 5EPHA 5EVID 5FAQA 2RCXA 5CGSA 1U60A 1FR1A 1YLTA 3BRMA 4UHUA 2WGVA 3W4QA 1K56D 2H5SA 3UE3A 2Y2OA 1BLPA 2WZXA 3BLMA 4ZDXA 4KG5A 3QNCA 3V3RA 1VQQA 4MBKA 4ID4A 4BD1A 2Z2LB 5KMWA 2HDSA 2ZJ9A 4UA7A 1EI5A 4MNRA 5DF9A 1CK3A 3V5MA 4FH4A 3VP0A 1ZC2A 3UNWA 2WK0A 5FSRA 3VP3A 5FAPA 3WS2A 4JXGA 4XXRA 4U3TA 2ZQ9A 1LL5A 4IVIA 3BFEA 3UDXA 3FKVA 5F1FA 2Q9MA 4B4XA 4OQGA 3WS1A 4D2OA 1DJBA 4DXCA 1HVBA 1L0FA 3HREA 5EVIB 4OPQA 3GRJA 5CRFA 1IEMA 3C7VA 2ZD8A 2R9XA 1XXMA 2C5WB 2Y2HA 4LV0A 2J8YA 3E2LA 1SCWA 1W8QA 4YINA 2ZM0A 4KZAA 3VFFA 3ZG7B 4CPKA 4LV3A 1WE4A 4WZ5C 3HLCA 4BQMA 4H8RA 4PPRA 4BD0A 4R3JA 1LI9A 3PAEA 5EUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXB A;  3BLS A;  2ZQ7 A;  5TFQ A;  5A91 A;  3N8R A;  5EOE A;  1YLY A;  4PM5 A;  4X6T A;  5M1A A;  1NXY A;  1K6S A;  2ZQD A;  4DDS A;  4QD4 A;  1PI4 A;  1IYO A;  5GHX A;  2ZC4 B;  5I94 A;  2WAF A;  2ZLY A;  4K0W A;  3SH8 A;  4X55 A;  3DWK A;  2R9W A;  1AXB A;  1NYM A;  2PU2 A;  4RX3 A;  3M6B A;  4QY6 A;  4OQH A;  4P6B A;  3OPR A;  4GDN A;  3NDG A;  3WRZ A;  1KGE A;  2EX2 A;  3ZG0 A;  4K91 A;  4FD8 A;  5EOO A;  4L0L A;  4EUZ A;  1FSY A;  2EX9 A;  5CTM A;  3Q07 A;  1ZKJ A;  3VSK A;  5FQM A;  4DDY A;  3WS4 A;  2HPB A;  3NI9 A;  3VP2 A;  4P85 A;  1QMF A;  4BEN A;  2X01 A;  4WMC D;  4KZ7 A;  4E3O A;  1GA9 A;  1K25 A;  5CTN A;  4XUX A;  4ZTK A;  1CEG A;  4KQR A;  4X56 A;  5TR7 A;  4BJP A;  1MWS A;  3IXG A;  4KZ8 A;  4LCL A;  3SH7 A;  3VMA A;  4E3J A;  2H0Y A;  1E3U A;  4MEZ A;  4RVA A;  1O07 A;  1K4E A;  3IXB A;  1ZG6 A;  2I72 A;  5GHZ A;  3V39 A;  3OC2 A;  5HAP A;  3E2K A;  1JWV A;  1YM1 A;  2WYX A;  1ESI A;  1YT4 A;  2DNS A;  3N7W A;  4HBT A;  1JVJ A;  3HBR A;  2X02 A;  3SS4 A;  2JBF A;  1ONG A;  4GNU A;  4KZ6 A;  1IYQ A;  3GVB A;  3Q1F A;  3N4I A;  2Y2N A;  1TDL A;  3DTM A;  1YLW A;  5M19 A;  4QJG A;  5FI7 A;  1XA7 A;  1BUL A;  1W7F A;  3VP4 A;  4Y0U A;  4OKP A;  4E3M A;  1SKF A;  4DRT A;  1K57 C;  2XFT A;  1PWC A;  3SOI A;  3A3E A;  1N4O A;  3NY4 A;  4ZAM A;  5E2H A;  1YLP A;  3IH9 A;  1M40 A;  2X71 A;  4OPR A;  4ZJ2 A;  3M2J A;  3M6H A;  3RXX A;  4B88 A;  3CG5 A;  4EBN A;  1XA1 A;  1XGI A;  3B3X A;  1ES5 A;  3G4P A;  1S0W A;  4ZJ1 A;  4GDB A;  1MKI A;  1VM1 A;  2Y2M A;  3DWZ A;  4S2L A;  4GB7 A;  5E2G A;  4DKI A;  3FYZ A;  5HFO A;  5FAO A;  3UN7 A;  1FSW A;  5CED A;  1NYY A;  3IF6 C;  3LCE A;  1H8Z A;  2FFF B;  5FI6 A;  5HW3 A;  2WGW A;  1K55 A;  1ESU A;  3G35 A;  1JTD A;  3M2K A;  1KVL A;  3WWX A;  4DXB A;  1L0E A;  3GR2 A;  1WYC A;  4NK3 A;  2XFS A;  4R0Q A;  2HDU A;  1L0D A;  4R4S A;  1ES4 A;  5E43 A;  3D4F A;  4XUZ A;  3G30 A;  1BZA A;  4GD6 A;  2XR0 A;  1JTG A;  5CEC A;  1MXO A;  1YMX A;  2RL3 A;  2ZC5 B;  2A3U A;  2J9O A;  4S2N C;  4N1X A;  3OCN A;  2Y2P A;  4P0M A;  3HLG A;  1GCE A;  4RX2 A;  5EVL A;  1HZO A;  1TEM A;  2VGK A;  3HUN A;  4JKT A;  4JXS A;  3VSL A;  1RGZ A;  2XDM A;  4OLD A;  1OME A;  5G18 A;  2XEP A;  4EQI A;  1XP4 A;  4R23 A;  4C75 A;  2EX6 A;  2JCH A;  3A3J A;  1Q2Q A;  4GOG A;  4MBH A;  3O87 A;  4EBL A;  4JBF A;  3PBR A;  4OP5 A;  4WM9 A;  3ZFZ A;  1SHV A;  1H8Y A;  5DF8 A;  1ALQ A;  5U47 A;  4WEJ A;  4S2M A;  3AGF A;  1QME A;  1W8Y A;  4KZ4 A;  1GHI A;  1LI0 A;  5AQ9 A;  1XGJ A;  4X53 A;  3BFG A;  3HUO A;  2DRW A;  4WEK A;  5DTK A;  3VFH A;  4K0X A;  4JF4 A;  4KZ9 A;  5FQQ A;  4OOM A;  2HP9 A;  3BEB A;  1ERO A;  3OPP A;  1SDN A;  2ZQC A;  3UE0 A;  3UDI A;  3HLF A;  5AQ7 A;  4KZB A;  1BT5 A;  2DCF A;  4P87 A;  4Q8I A;  5CHM A;  3GSG A;  3MZE A;  1K54 A;  1I2W A;  2V20 A;  3NDE A;  1Y54 A;  5EVI C;  3WRT A;  2OSU A;  5HAI A;  1KDS A;  1PZP A;  1ERM A;  4S2J A;  4E6X A;  1FCO A;  1MWU A;  5HL1 A;  3UY6 A;  4X69 A;  3Q7V A;  4CJN A;  2ZC7 A;  4S2O A;  4QY5 A;  3UPO A;  1KGF A;  3O88 A;  5DTS A;  2ZQ8 A;  4KZ3 A;  3VP1 A;  1K57 A;  2EFX A;  1FR6 A;  1TDG A;  2E8I A;  5GLC A;  1IKI A;  3FV7 A;  4UAA A;  1BUE A;  1RP5 A;  3W4O A;  3G2Z A;  3HLE A;  1XX2 A;  2J9P A;  1E3U D;  3IH8 A;  4S2K A;  4E3K A;  3AGD A;  4PM9 A;  2XD1 A;  1NJ4 A;  1XKZ A;  2OV5 A;  1IYP A;  2ZM2 A;  4KEN B;  3S1Y A;  4OVD A;  5FI2 A;  3BEC A;  1HTZ A;  1PW1 A;  5CXW A;  5FQI A;  5FQK A;  5HAR A;  3G2Y A;  2G2U A;  1DJC A;  3IXH A;  2WZZ A;  1ERQ A;  3MFD A;  1O7E A;  4QB8 A;  1PIO A;  3ISG A;  3NC8 A;  4OLG A;  1ES3 A;  4R4R A;  4KQQ A;  1MWT A;  2OLV A;  3VOZ A;  2HP5 A;  1G6A A;  3AGE A;  3HLB A;  3PBO A;  2Y2J A;  1L2S A;  3CJM A;  2IWB A;  3ZGA B;  1NZU A;  1E4D A;  1LL9 A;  1I2S A;  2Y59 A;  3NIA A;  2Y91 A;  4N1H A;  4OOL A;  4U0X A;  5CER A;  4WYY A;  4PM8 A;  4LV2 A;  3S22 A;  1DJA A;  2XF3 A;  2EFU A;  3LEZ A;  3LO7 A;  3G32 A;  2B5R A;  4EWF A;  5EE8 A;  1FOF A;  1J9M A;  4R3B A;  4Y0T A;  4MLL A;  2H10 A;  4N92 A;  4OH0 A;  3W8K A;  5HAQ A;  4FCF A;  3WS5 A;  2P74 A;  3VOY A;  3ZCZ A;  3IHA A;  1NRF A;  3ITA A;  1WYB A;  4BL2 A;  1JWP A;  5E2E A;  3P09 A;  3TG9 A;  4WEL A;  3ZNY A;  4IED A;  3A3D A;  3A3I A;  1ES2 A;  5DTT A;  3ZG8 B;  1E25 A;  5FAT A;  3ZG5 A;  2J7V A;  3IWI A;  4DE1 A;  1KE4 A;  3HLW A;  2H0T A;  1MPL A;  2C6W B;  3PBN A;  4B4Z A;  4PM7 A;  1MBL A;  4ZJ3 A;  5GL9 A;  2XQZ A;  4UA6 A;  4HEF A;  5CEB A;  4HES A;  4WZ5 A;  2WKH A;  3PBT A;  3FKW A;  4HBU A;  4EV4 A;  4KZ5 A;  5KSC A;  3BFD A;  4KG6 A;  5CGX A;  3MKE A;  5F1G A;  3CMZ A;  1FQG A;  1RGY A;  2QZ6 A;  3OZH A;  3O3V A;  1HD8 A;  2PBY A;  1ZG4 A;  3MXS A;  3O86 A;  3Q81 A;  1CI8 A;  3MXR A;  4LCM A;  1XPB A;  4LV1 A;  2PU4 A;  3IQA A;  2WKE A;  2WGW B;  4DE3 A;  3UE1 A;  1YLZ A;  1RCJ A;  3IXD A;  3IWO A;  3C4O A;  5AQB A;  5EVI A;  3ZNT A;  3BFC A;  5L2F A;  2JE5 A;  4IBX A;  3A3F A;  4OP8 A;  1K56 A;  3C4P A;  3ZHH A;  4JPM A;  3Q82 A;  4JXV A;  4WZ4 A;  5BOH A;  3ZG9 B;  1KDW A;  5GLD A;  3HLD A;  1BLH A;  3BFF A;  3SS3 A;  2Q9N A;  4KG2 A;  5FQ9 A;  5CGW A;  1YMS A;  3W4P A;  3LY4 A;  2WGI A;  2BG1 A;  1K6R A;  2G2W A;  1KVM A;  4O7D A;  5TGF A;  2WAE A;  3IHB A;  4YFM A;  1KE0 A;  4DE2 A;  5FDH A;  2Y55 A;  3UDF A;  2JC7 A;  1I5Q A;  4OON A;  1MWR A;  1K55 C;  3RXW A;  2V2F F;  5F82 A;  5KZH A;  5DF7 A;  3EQU A;  1NZO A;  4Z9Q A;  3UO9 A;  1K4F A;  2P9V A;  4GKU A;  4F94 A;  3NCK A;  3SS5 A;  1IEL A;  2WUQ A;  2Z2M B;  3BM6 A;  1Q2P A;  3GMW A;  3ITB A;  4ZBE A;  2IWD A;  3SH9 A;  3ZVW A;  3Q7Z A;  3P98 A;  1PZO A;  4JF6 A;  4E3N A;  3PBS A;  3RJU A;  4JLF A;  1K38 A;  1PYY A;  3QNB A;  4UA9 A;  5CHJ A;  3GV9 A;  4KQO A;  5E2F A;  2XLN A;  5GHY A;  5FA7 A;  2GDN A;  1TVF A;  1CI9 A;  1N9B A;  3BYD A;  3G31 A;  4QHC A;  1SDE A;  4PM6 A;  4N9L A;  1CEF A;  3QHY A;  2Y2K A;  4OOY A;  5A92 A;  3N6I A;  1BSG A;  3FZC A;  1W79 A;  4OPY A;  3V50 A;  4RYE A;  1LHY A;  2HDR A;  2P9V B;  3HVF A;  3LY3 A;  1Z6F A;  3OPH A;  1PWG A;  3UPN A;  4BLM A;  5DVA A;  4IBR A;  5FAS A;  4R1G A;  4DF6 A;  3ZDJ A;  4C3Q A;  1IYS A;  1KE3 A;  5M18 A;  2A49 A;  4FSF A;  1FCM A;  3IWQ A;  3NBL A;  2V1Z A;  3C5A A;  3PAG A;  1C3B A;  1BTL A;  3DW0 A;  2UWX A;  1BLC A;  2VGJ A;  3FWL A;  5GLB A;  3CZD A;  3IF6 A;  3MKF A;  2Y2G A;  1ONH A;  3N8L A;  3OPL A;  3Q7V B;  4S2I A;  1M6K A;  2Y2I A;  1BLS A;  4Y7P A;  4C6Y A;  2ZQA A;  1PW8 A;  3HL9 A;  3OCL A;  4N9K A;  5FQJ A;  1G68 A;  4E3I A;  4WMC A;  4E6W A;  2FFY A;  3GQZ A;  4JF5 A;  3UPP A;  1DY6 A;  4OPZ A;  4RA7 A;  2BLS A;  4IVK A;  2ZC3 B;  5J8X A;  3ZVT A;  5D3O A;  1EWZ A;  1W5D A;  5HX9 A;  3GTC A;  4OQ0 A;  4S2P A;  3TOI A;  5JYP A;  4GD8 A;  2ZC6 B;  3S4X A;  5KSH A;  1K54 C;  2HP6 A;  4OQI A;  2QPN A;  1H5X A;  4S2N A;  4U0T A;  3C7U A;  4WBG A;  3V3S A;  1IKG A;  1GA0 A;  4M3K A;  2IWC A;  2XGN A;  3N8S A;  3IF5 A;  2ZM8 A;  2EX8 A;  2XH9 A;  1GHM A;  1PI5 A;  4QU3 A;  3IF6 B;  4Y0O A;  1GHP A;  4GN2 A;  4LEN A;  5A90 A;  2WAD A;  3EQV A;  2Y2L A;  2Y4A A;  3PTE A;  3TSG A;  4FH2 A;  1PWD A;  5CHU A;  2ZMA A;  4MBF A;  1KGG A;  2XD5 A;  2XK1 A;  2QMI A;  1L0G A;  3MBZ A;  5AQA A;  4JXW A;  2OLU A;  2WKI A;  3WS0 A;  5IHV A;  1NY0 A;  3G34 A;  4A5R A;  4X68 A;  1FCN A;  1S6R A;  3MZF A;  5EEC A;  2CC1 A;  1YQS A;  5GLA A;  1YLJ A;  5JYO A;  4NET A;  2Y2Q A;  3IT9 A;  3PBQ A;  3HUM A;  5F83 A;  1MY8 A;  3MZD A;  4EBP A;  4BL3 A;  4E3L A;  4PMA A;  1JWZ A;  3I7J A;  5A93 A;  2EXA A;  3JYI A;  4DE0 A;  1LLB A;  2HDQ A;  4GZB A;  5EPH A;  5EVI D;  5FAQ A;  2RCX A;  5CGS A;  1U60 A;  1FR1 A;  1YLT A;  3BRM A;  4UHU A;  2WGV A;  3W4Q A;  1K56 D;  2H5S A;  3UE3 A;  2Y2O A;  1BLP A;  2WZX A;  3BLM A;  4ZDX A;  4KG5 A;  3QNC A;  3V3R A;  1VQQ A;  4MBK A;  4ID4 A;  4BD1 A;  2Z2L B;  5KMW A;  2HDS A;  2ZJ9 A;  4UA7 A;  1EI5 A;  4MNR A;  5DF9 A;  1CK3 A;  3V5M A;  4FH4 A;  3VP0 A;  1ZC2 A;  3UNW A;  2WK0 A;  5FSR A;  3VP3 A;  5FAP A;  3WS2 A;  4JXG A;  4XXR A;  4U3T A;  2ZQ9 A;  1LL5 A;  4IVI A;  3BFE A;  3UDX A;  3FKV A;  5F1F A;  2Q9M A;  4B4X A;  4OQG A;  3WS1 A;  4D2O A;  1DJB A;  4DXC A;  1HVB A;  1L0F A;  3HRE A;  5EVI B;  4OPQ A;  3GRJ A;  5CRF A;  1IEM A;  3C7V A;  2ZD8 A;  2R9X A;  1XXM A;  2C5W B;  2Y2H A;  4LV0 A;  2J8Y A;  3E2L A;  1SCW A;  1W8Q A;  4YIN A;  2ZM0 A;  4KZA A;  3VFF A;  3ZG7 B;  4CPK A;  4LV3 A;  1WE4 A;  4WZ5 C;  3HLC A;  4BQM A;  4H8R A;  4PPR A;  4BD0 A;  4R3J A;  1LI9 A;  3PAE A;  5EUA A; 
#chains in the Genus database with same CATH topology
 3MQ0 A;  3BLS A;  5TFQ A;  3N8R A;  1YLY A;  2ZQD A;  3HCY A;  5DKK A;  5I94 A;  3SH8 A;  3UB8 A;  3WRZ A;  3RH8 B;  4FD8 A;  4EUZ A;  3NI9 A;  5AVE A;  4E3O A;  2UV0 E;  1GA9 A;  4D60 A;  5TR7 A;  4KQR A;  4KZ8 A;  4LCL A;  4E3J A;  1E3U A;  2A2L A;  4HP9 A;  5HAP A;  1JWV A;  1ESI A;  1OJ5 A;  1YT4 A;  4Y17 A;  1IYQ A;  3GVB A;  2HJE A;  3N4I A;  4R3A A;  1TDL A;  4H6J B;  3VE4 A;  1BUL A;  2ZOH A;  2XFT A;  3KYE A;  3BQA A;  1PWC A;  3NY4 A;  5E2H A;  4DJ2 A;  4HJ3 A;  4OPR A;  3M6H A;  3B3X A;  4ZJ1 A;  3DWZ A;  5EV0 A;  3IF6 C;  3FPW A;  5HW3 A;  3LEQ A;  5I5L A;  5DFY A;  3KSI A;  2DMW A;  3TE8 A;  4XUZ A;  1XJ4 A;  3G30 A;  4II7 A;  3IX3 A;  4NXB A;  3QP2 A;  2J9O A;  4NXG A;  4S2N C;  3G6O A;  3LID A;  2ZMF A;  2Y2P A;  3HLG A;  2W3E A;  3HUN A;  4JKT A;  3VSL A;  1RGZ A;  2P04 A;  1IFQ A;  5G18 A;  2XEP A;  4R23 A;  4JBF A;  4OP5 A;  2PYP A;  5KIZ A;  1H8Y A;  5U47 A;  1TF1 A;  3KSH A;  3UB7 A;  4K0X A;  4JF4 A;  5FL3 A;  1ERO A;  4L9E A;  3V67 A;  3UE0 A;  3H82 B;  4GHI A;  2V20 A;  2WKR A;  3MXQ A;  4EES A;  1Y54 A;  2KDK A;  2OSU A;  1PZP A;  3EWK A;  4E6X A;  1FCO A;  5HL1 A;  4CJN A;  1KGF A;  4KQD A;  3LR3 A;  4EXO A;  1K57 A;  3VV4 A;  1TDG A;  4UAA A;  1E3U D;  2J80 A;  3TW8 A;  3EGX C;  1NJ4 A;  5MC7 A;  4CLC E;  1WA9 A;  4MMN A;  2G2U A;  5K5B A;  1ERQ A;  1PRQ A;  1PIO A;  4I39 A;  3U4L P;  3ISG A;  1ES3 A;  4AFI A;  3ZYT A;  5HWW A;  2Y2J A;  1L2S A;  3CJM A;  4OOL A;  3R7W B;  2O99 A;  5HSQ A;  2Y91 A;  5CER A;  4G3V A;  2CMN A;  4MN7 A;  1DJA A;  3LO7 A;  3LEZ A;  3G32 A;  4EWF A;  4MLL A;  4N92 A;  3MFX A;  4OH0 A;  3W8K A;  2INW A;  3ZCZ A;  1NRF A;  1WYB A;  1VB6 A;  5E2E A;  1N9N A;  3PXP A;  4L9G A;  5FAT A;  5HD3 A;  2H0T A;  2G7U A;  1XJ2 A;  4B4Z A;  4PM7 A;  1MBL A;  4ZJ3 A;  3PR6 A;  4JGR A;  4UA6 A;  5CEB A;  4HES A;  2JKR M;  3MF0 A;  4EV4 A;  4Q0J A;  5CGX A;  3MKE A;  1KOU A;  3BWL A;  1RGY A;  5HWV A;  3Q81 A;  4MN5 A;  4UEY A;  2HJ9 C;  2PU4 A;  1T1C A;  3LYX A;  3IWO A;  3ZNT A;  3BFC A;  2V1A A;  4IBX A;  1K56 A;  3KYZ A;  2IA2 A;  3HLD A;  3SS3 A;  1YMS A;  2BG1 A;  1K6R A;  4IUH A;  2WAE A;  4YFM A;  1LSW A;  3UDF A;  4OON A;  5DJU A;  1MWR A;  5F82 A;  1K4F A;  4GKU A;  3NCK A;  2A24 B;  3BM6 A;  3P98 A;  2OWJ A;  4I3J A;  4HP4 A;  3PBS A;  4YNR A;  4RQ9 A;  3RJU A;  3CPT A;  1K38 A;  1PYY A;  5E2F A;  3S7P A;  3BYD A;  1N9B A;  3T12 B;  4PM6 A;  4CQH A;  4OOY A;  3N6I A;  1BSG A;  5IS1 A;  1X0O A;  2QKP A;  2P9V B;  2A49 A;  2V1Z A;  3F1O A;  1C3B A;  3EEH A;  2UWX A;  1BLC A;  3ICY A;  3OPL A;  3Q7V B;  1V9Y A;  1PW8 A;  3IX8 A;  2VEA A;  3FC7 A;  5FQJ A;  2FFY A;  3GQZ A;  4OPZ A;  4RA7 A;  2BLS A;  4IVK A;  1LSX A;  2KX6 A;  2ZC3 B;  2LB5 A;  5D3O A;  5HX9 A;  4S2P A;  3T1S A;  3L9K A;  2PD8 A;  2W1T B;  4NXF A;  2WAD A;  4HNB A;  4KUO A;  4MBF A;  4BBT A;  2WKI A;  1NY0 A;  2V8F A;  3G34 A;  4A5R A;  1D06 A;  4X68 A;  2PRF A;  2CC1 A;  1YQS A;  5GLA A;  1YLJ A;  4M4X A;  3IT9 A;  2R78 A;  4ARZ A;  4HH3 A;  1NLZ A;  5F83 A;  4EBP A;  3F1N A;  5HPF A;  4LRX C;  2EXA A;  4DE0 A;  3L7H A;  5CGS A;  1U60 A;  1FR1 A;  1YLT A;  1K56 D;  4ZDX A;  3T1Q B;  4ID4 A;  2V9A A;  5KMW A;  2ZJ9 A;  4MNR A;  1ZTU A;  3V5M A;  3VP0 A;  1SKO A;  2JKT I;  3CHW P;  5FAP A;  4JXG A;  4HJ6 A;  3FKV A;  3LR5 A;  1DJB A;  4DMZ A;  1L0F A;  4G3K A;  5EVI B;  3GRJ A;  3CUE A;  3C7V A;  1IEM A;  5EM1 A;  3QP5 A;  2C5W B;  4LV0 A;  2J8Y A;  4YIN A;  2ZM0 A;  3VFF A;  3ZG7 B;  4WZ5 C;  2VZW A;  3PAE A;  5EUA A;  3NJA A;  2ZQ7 A;  2HGV A;  5EOE A;  4X6T A;  1NXY A;  1IYO A;  4HOI A;  1DRM A;  4MCW A;  3DWK A;  1NYM A;  2PU2 A;  3M6B A;  4QY6 A;  2D01 A;  4P6B A;  3OPR A;  3LR4 A;  1GSV A;  2VV7 A;  1FSY A;  5J3W A;  5FQM A;  4NXE A;  1QMF A;  4BEN A;  3CAX A;  2FH5 A;  1CEG A;  4X56 A;  1MWS A;  2GJ3 A;  2H0Y A;  4MEZ A;  5C5K A;  1O07 A;  1K4E A;  3V39 A;  2I72 A;  3OC2 A;  1S4R A;  4HBT A;  2DNS A;  4NEE D;  4PKY G;  4I5S A;  3UMD A;  2JBF A;  1ONG A;  3KO6 A;  3DTM A;  4QJG A;  3E0Y A;  1XA7 A;  1W7F A;  5HWT A;  4ME4 A;  3S7O A;  5HPI A;  3T50 A;  4B88 A;  2EA9 A;  3CG5 A;  1Y4O A;  4GDB A;  1VM1 A;  2Y2M A;  4DKI A;  4ETZ A;  4Y3I A;  1H8Z A;  2FFF B;  2WGW A;  1K55 A;  1ESU A;  3QP6 A;  1JTD A;  3WWX A;  4DXB A;  4NK3 A;  2XFS A;  2K31 A;  4LFU A;  4WL9 A;  3ULF A;  5E43 A;  1ES4 A;  3D4F A;  3D9Y A;  1JTG A;  1MXO A;  1YMX A;  2A3U A;  3HJK A;  2L0W A;  3OCN A;  3EOI A;  3SW1 A;  4JXS A;  2W3F A;  1XP4 A;  3CWF A;  4HQA A;  3LI8 A;  4C75 A;  2EX6 A;  2JCH A;  4GOG A;  1VHM A;  4WM9 A;  1SHV A;  4S2M A;  3AGF A;  1W8Y A;  5TBM A;  2QYB A;  1GHI A;  5AQ9 A;  2DRW A;  3BEB A;  2ZQC A;  3KSF A;  1BYW A;  5HDC A;  3T4Q A;  3HLF A;  5AQ7 A;  2ZL1 A;  1BT5 A;  2VJW A;  4P87 A;  5CHM A;  4Q8I A;  5EVI C;  3WRT A;  1LSV A;  4S2J A;  1MWU A;  3LGO A;  1G6O A;  5HZH A;  4QY5 A;  3O88 A;  3NOT C;  3VP1 A;  2GX5 A;  2EFX A;  2HZ5 A;  3W4O A;  3FV7 A;  1BUE A;  4FUW A;  2J9P A;  4B9O A;  3IH8 A;  3AGD A;  4PM9 A;  2XD1 A;  1XFN A;  2OV5 A;  3B33 A;  2ZM2 A;  4GHI B;  4OVD A;  4UQI M;  1VET A;  5FI2 A;  1HTZ A;  1PW1 A;  1P9W A;  5FQI A;  2YKF A;  4WLA A;  3NC8 A;  5EFW A;  3VOZ A;  2HP5 A;  4PHT A;  3AGE A;  3HLB A;  3ZGA B;  1E4D A;  1OT6 A;  4N1H A;  4R38 A;  4CLC A;  4WYY A;  3S22 A;  4EET B;  2B5R A;  4R3B A;  5F69 A;  5F68 A;  1OTA A;  5HAQ A;  5FEG A;  4UQI S;  3BY9 A;  3IHA A;  3ITA A;  1JWP A;  3A3D A;  4F3L A;  4LRY C;  1ES2 A;  3ZG8 B;  3UME A;  2OAQ 1;  4K08 A;  4DE1 A;  1MPL A;  2C6W B;  3E4O A;  5L10 A;  1OPX A;  5GL9 A;  2K7S A;  3H9W A;  5FDS A;  2WKH A;  4I3I A;  1FQG A;  4JGP A;  1HD8 A;  2PBY A;  4LCM A;  2QJ5 A;  3MS6 A;  4LV1 A;  3IQA A;  3UE1 A;  3IXD A;  3C4O A;  2PYR A;  3C30 A;  2JE5 A;  3ZHH A;  3A3F A;  4X1M A;  3SZT A;  5DKL A;  3UB6 A;  5BOH A;  1KDW A;  4KG2 A;  5CGW A;  2G2W A;  1KVM A;  2BAS A;  1KE0 A;  4WUJ A;  5DJT A;  3T4O A;  5DF7 A;  4L9F A;  4O01 A;  1Q2P A;  4ZBE A;  2PR5 A;  2V1B A;  2O9A A;  5CHJ A;  4KQO A;  5FA7 A;  1T1A A;  2GDN A;  1CI9 A;  4QHC A;  4KUK A;  4N9L A;  5A92 A;  3CIT A;  1STZ A;  4RYE A;  1PNE A;  2W1R A;  4IBR A;  4R1G A;  4QPR A;  4DF6 A;  4C3Q A;  1KE3 A;  4FSF A;  3IWQ A;  4IUK A;  2P08 A;  3PAG A;  3CZD A;  1ONH A;  3CPT B;  2Y2I A;  2L4R A;  1XJ3 A;  4Y7P A;  4C6Y A;  3OCL A;  3JVV A;  1G68 A;  4E3I A;  4JF5 A;  3ZVT A;  4CLC D;  1EWZ A;  4P6Z M;  1W5D A;  2ZC6 B;  3LFV A;  5KSH A;  1UWN X;  4OQI A;  2QPN A;  2MJ6 A;  2Y79 A;  3V3S A;  3F1O B;  1GA0 A;  3IF5 A;  3IBJ A;  2EX8 A;  1GHM A;  4Y0O A;  4EEP A;  1GHP A;  4LEN A;  3O5Y A;  3PTE A;  3MSH A;  4EER A;  4GS9 A;  2XK1 A;  1L0G A;  5AQA A;  3WS0 A;  2J3W A;  2JKR I;  5AJG A;  3T4T A;  4Y2F A;  2WKQ A;  4X25 A;  2BTF P;  4P6Z S;  1PFL A;  5EEC A;  1LL8 A;  3HUM A;  1MY8 A;  3MZD A;  3NOP C;  4PMA A;  1JWZ A;  1MZU A;  3LIF A;  5A93 A;  5EPH A;  3VE3 A;  5A8B A;  5FAQ A;  3EEA A;  3BRM A;  2WGV A;  3LUQ A;  1BLP A;  3BLM A;  4KG5 A;  1A0K A;  4EU0 A;  4UA7 A;  4WN5 A;  5HDS A;  2O9C A;  4HHD A;  5DF9 A;  1S1Z A;  2WK0 A;  3VP3 A;  3WS2 A;  2ZBB A;  4U3T A;  4HIA A;  3H82 A;  4IVI A;  3KSG A;  1MC0 A;  4OQG A;  4QWO A;  4DXC A;  4B93 A;  1VEU B;  4OPQ A;  5CRF A;  2ZD8 A;  1XXM A;  2VLG A;  4LLO B;  1G5U A;  4KZA A;  2LB9 A;  1OJG A;  4H8R A;  2Z6C A;  4BD0 A;  3T4K A;  1LI9 A;  5IT5 A;  1TS0 A;  1SKO B;  4DDS A;  5F5Y A;  1N9O A;  4QD4 A;  1PI4 A;  5GHX A;  2ZC4 B;  2WAF A;  2ZLY A;  3U2A A;  2R9W A;  4R70 A;  1AXB A;  2V8C A;  4HJ4 A;  4RX3 A;  4BWI A;  4GDN A;  3NDG A;  3MJQ A;  2EX2 A;  3ZG0 A;  4K91 A;  5EOO A;  2JKF A;  2EX9 A;  3Q07 A;  3IBR A;  3VSK A;  2FZ0 A;  4DDY A;  2HPB A;  3VP2 A;  4P85 A;  3D3O A;  1K25 A;  5CTN A;  4XUX A;  3T4S A;  2JHE A;  3IXG A;  2W0N A;  4RVA A;  1S66 L;  3IXB A;  4JGQ A;  5GHZ A;  3E2K A;  2WYX A;  1EW0 A;  3N7W A;  3PHY A;  3HBR A;  2X02 A;  3SS4 A;  4GNU A;  4GW9 A;  4KZ6 A;  3LIE A;  5FI7 A;  3VP4 A;  1SKF A;  3QP4 A;  3SOI A;  3NOU C;  1N4O A;  2X71 A;  4ZJ2 A;  3M2J A;  2EWW A;  2HF6 A;  1W63 M;  4HI4 A;  1XGI A;  1ES5 A;  3G4P A;  1MKI A;  1H8M A;  4S2L A;  5HFO A;  5FAO A;  5CED A;  1NYY A;  3F1P A;  2J3T D;  5FI6 A;  4PKY A;  1KVL A;  5TJJ A;  3P01 A;  3GR2 A;  1WYC A;  3K3C A;  1OTE A;  4R4S A;  3BY8 A;  3FG8 A;  1BZA A;  1LT0 A;  2XR0 A;  5CEC A;  2RL3 A;  2ZC5 B;  3BW6 A;  4N1X A;  1GCE A;  3MQQ A;  2QHK A;  1HZO A;  1TEM A;  2VGK A;  1S4S A;  4OLD A;  1OME A;  4EQI A;  3NHQ A;  3IS2 B;  3OOV A;  3H7W A;  1L3L A;  1Q2Q A;  2A24 A;  5EVE A;  4EBL A;  3PBR A;  1ALQ A;  2NUT C;  4I3A A;  4GCZ A;  1QME A;  2EWV A;  4KZ4 A;  1LI0 A;  4X53 A;  3BFG A;  3VFH A;  4KZ9 A;  5FQQ A;  4OOM A;  2HP9 A;  2JKT M;  4EQ1 A;  4I38 A;  3UE6 A;  1AWI A;  3MZE A;  2M7U A;  1K54 A;  3NDE A;  5HDD A;  5HAI A;  1KDS A;  2OAP 1;  3UY6 A;  4X69 A;  4Q0I A;  5TBM B;  3Q7V A;  3MMH A;  3UPO A;  2ZQ8 A;  3TJZ C;  5GLC A;  1IKI A;  1ODV A;  3OBF A;  3G2Z A;  3HLE A;  1XX2 A;  4E3K A;  2ZL1 B;  1XKZ A;  4JGO A;  4KEN B;  3S1Y A;  3E4Q A;  3BEC A;  5CXW A;  5HAR A;  5FQK A;  5F6A A;  4Y15 A;  2WKP A;  3HJI A;  3CUE C;  2VX8 A;  3C8C A;  1DJC A;  2W1T A;  3IXH A;  1W63 Q;  1O7E A;  4OLG A;  4KQQ A;  3IX4 A;  3NEC A;  1CF0 A;  3PBO A;  1D1J A;  2Y59 A;  3NIA A;  1LL9 A;  1I2S A;  4U0X A;  4PM8 A;  1FOF A;  4Y0T A;  3RTY A;  2H10 A;  1YSQ A;  3WS5 A;  3PYP A;  3VOY A;  1Y28 A;  1P0Z A;  1ACF A;  4BL2 A;  4WEL A;  4IED A;  2ZOI A;  5DTT A;  4BMW A;  1E25 A;  3ZG5 A;  2J7V A;  3IWI A;  1KE4 A;  5FEF A;  3HLW A;  4CLC B;  2AVX A;  3DBA A;  3FKW A;  4HBU A;  1P9R A;  4KG6 A;  5F1G A;  3R4K A;  2O0Y A;  3VOL A;  2PHY A;  3OZH A;  1ZG4 A;  3O86 A;  3C38 A;  1CI8 A;  2VV8 A;  3MXR A;  1P97 A;  4DE3 A;  1YLZ A;  4ESP A;  5AQB A;  5EVI A;  5L2F A;  2JKG A;  1N9L A;  4OP8 A;  4LPZ A;  3C4P A;  3S7N A;  4JXV A;  1BLH A;  3BFF A;  4XT2 A;  5FQ9 A;  3GEC A;  2WGI A;  1T19 A;  5TGF A;  3IHB A;  2Y55 A;  3DTK A;  2JC7 A;  1I5Q A;  2XRO A;  1K55 C;  3RXW A;  5KZH A;  3EQU A;  1NZO A;  2VV6 A;  3SS5 A;  2PBD P;  1IEL A;  2Z2M B;  3ITB A;  2Y8H A;  2B02 A;  1PZO A;  4JF6 A;  5L07 A;  2I9V A;  4JLF A;  3QNB A;  4UA9 A;  5GHY A;  2XLN A;  3G31 A;  1XFQ A;  1W79 A;  4OPY A;  4EEU A;  3A0S A;  3V50 A;  1LHY A;  3UPN A;  3LY3 A;  3HVF A;  5FAS A;  1Z6F A;  5DVA A;  3ZDJ A;  1IYS A;  2W27 A;  5M18 A;  3NBL A;  5HL6 A;  1BTL A;  3FWL A;  4Q0H A;  3IF6 A;  3MKF A;  2Y2G A;  3N8L A;  3HL9 A;  4N9K A;  4WMC A;  4E6W A;  2YKH A;  3FPV A;  5J8X A;  4OQ0 A;  1OTD A;  4S2N A;  1H5X A;  1NWZ A;  3C7U A;  4WBG A;  3OLO A;  4M3K A;  2XGN A;  2ZM8 A;  4YWZ A;  2Z6D A;  4GN2 A;  5A90 A;  4R6L A;  3EQV A;  1UGU A;  2Y2L A;  2Y4A A;  2Q0O A;  4BBV A;  3QP1 A;  4FH2 A;  1PWD A;  5CHU A;  4DN0 A;  2QMI A;  2VK3 A;  4FOF A;  3MBZ A;  1FCN A;  3MZF A;  4GJ4 A;  3JPU A;  5JYO A;  2Y2Q A;  3PBQ A;  3LIC A;  4Z1W A;  4NKP A;  5G4Y A;  2PD7 A;  2B18 A;  3T4L A;  1G28 A;  3I7J A;  1LLB A;  2HDQ A;  2XA7 M;  5EVI D;  4GS9 B;  3W4Q A;  4UHU A;  4CLC C;  3V3R A;  4MBK A;  4X1L A;  2L1M A;  3E98 A;  2Z2L B;  2H28 A;  3T1R A;  3CI6 A;  1CK3 A;  4FH4 A;  4FTX A;  1ZC2 A;  1OTI A;  4ZRR A;  2VKS A;  4O8G A;  3UB9 A;  3BFE A;  4B4X A;  3WS1 A;  4D2O A;  3T1X A;  4GLQ A;  2VA0 A;  1OT9 A;  2R9X A;  2XA7 S;  2Y2H A;  1ZHH B;  3E2L A;  1H3Q A;  1SCW A;  1NRJ A;  4HY8 A;  3HLC A;  4YOF A;  4PPR A;  1MKM A;  2GNX A;  4R3J A;  2Y2K A;  4KZB A;  2IWB A;  3SH7 A;  2EXB A;  5A91 A;  4PM5 A;  5M1A A;  1K6S A;  4K0W A;  4X55 A;  1J3W A;  3LI9 A;  4Y13 A;  4OQH A;  2KLI A;  1KGE A;  4L0L A;  1YKD A;  5CTM A;  1ZKJ A;  3C2W A;  3WS4 A;  4H6J A;  2X01 A;  4WMC D;  1DP8 A;  4KZ7 A;  4ZTK A;  4BJP A;  3VMA A;  2W3D A;  1ZG6 A;  1YM1 A;  2OOL A;  4MN6 A;  2JN7 A;  2O9B A;  1TD5 A;  1JVJ A;  5AVF A;  3S7Q A;  3Q1F A;  2NUP C;  2Y2N A;  5M19 A;  1YLW A;  4Y0U A;  4OKP A;  4E3M A;  4DRT A;  1K57 C;  3A3E A;  1FIL A;  4ZAM A;  4MDZ A;  1YLP A;  3IH9 A;  1M40 A;  3RXX A;  4EBN A;  4NG2 A;  1XA1 A;  3D72 A;  1S0W A;  4GB7 A;  5E2G A;  3FYZ A;  3UN7 A;  4G3W A;  1FSW A;  3LCE A;  3G35 A;  3M2K A;  2PAV P;  1L0E A;  4R0Q A;  2HDU A;  1L0D A;  4GD6 A;  4Y5F A;  4P0M A;  4RX2 A;  5EVL A;  1YSP A;  2ACG A;  2XRN A;  2M7V A;  4ARZ B;  2XDM A;  3F1P B;  3F1N B;  4LGW A;  3A3J A;  4MBH A;  4LRZ E;  3O87 A;  1F98 A;  1OTB A;  3ZFZ A;  2VGL M;  5DF8 A;  4WEJ A;  1DP9 A;  1XGJ A;  3HUO A;  5DTK A;  4WEK A;  1F5M A;  3OPP A;  1SDN A;  3UDI A;  2J3T C;  3EGD C;  5EM0 A;  3H7W B;  2DCF A;  5J4E A;  3GSG A;  1I2W A;  1D7E A;  2PDR A;  4BBU A;  1ERM A;  1Z09 A;  2VGL S;  2ZC7 A;  4S2O A;  5DTS A;  4KZ3 A;  3NUL A;  1TS6 A;  1FR6 A;  2E8I A;  1RP5 A;  4S2K A;  3R7W A;  1IYP A;  1JNU A;  1T1B A;  3G2Y A;  2WZZ A;  3MFD A;  1TS7 A;  4QB8 A;  2QJ7 A;  4R4R A;  1MWT A;  2OLV A;  1G6A A;  1T18 A;  3ZQ5 A;  1NZU A;  4LV2 A;  2D02 A;  2XF3 A;  2EFU A;  5EE8 A;  1J9M A;  3CLO A;  4IHQ A;  4FCF A;  2P74 A;  3P09 A;  3TG9 A;  3ZNY A;  1YPR A;  3B42 A;  3A3I A;  1FIK A;  2HV1 A;  2V0U A;  2QWS A;  5DFX A;  1GSW A;  3KYQ A;  3PBN A;  4PAU A;  3DTI A;  2XQZ A;  2ZMV A;  3DTE A;  4HEF A;  5HD5 A;  4WZ5 A;  3PBT A;  4KZ5 A;  5KSC A;  3BFD A;  3A0R A;  3CMZ A;  2QZ6 A;  3O3V A;  3P7N A;  3MXS A;  1XPB A;  3A0V A;  2WKE A;  2WGW B;  4HH2 A;  5G4Z A;  1RCJ A;  1VEU A;  4JPM A;  3Q82 A;  4WZ4 A;  3ZG9 B;  5GLD A;  2Q9N A;  3W4P A;  3LY4 A;  2B95 A;  4O7D A;  4DE2 A;  5FDH A;  1HLU P;  3QP8 A;  1TS8 A;  3K3D A;  1S67 L;  2V2F F;  3MQO A;  4Z9Q A;  3UO9 A;  4IJG A;  2P9V A;  4F94 A;  3W2Z A;  2WUQ A;  3GMW A;  2IWD A;  3E4P A;  3SH9 A;  3ZVW A;  3Q7Z A;  4XT2 B;  2E8J A;  4E3N A;  4WF0 A;  2W3G A;  3GV9 A;  1TVF A;  1SDE A;  2KOI A;  1CEF A;  3QHY A;  3B47 A;  3DAV A;  1CQA A;  2W3H A;  3FZC A;  2HDR A;  4BLM A;  3BJN A;  1PWG A;  3OPH A;  1F2K A;  1CJF A;  4ETX A;  1FCM A;  2PT7 A;  3C5A A;  2K2N A;  1IOU A;  2M1C A;  3DW0 A;  5GLB A;  2VGJ A;  4S2I A;  1M6K A;  1BLS A;  2ZQA A;  3K2N A;  4O0P A;  3UPP A;  1DY6 A;  1V9Z A;  1F9I A;  3GTC A;  3TOI A;  5JYP A;  4GD8 A;  3S4X A;  1K54 C;  2HP6 A;  3LR0 A;  1VET B;  4U0T A;  4E04 A;  1IKG A;  2XSS A;  2IWC A;  3N8S A;  1UWP X;  2XH9 A;  5IU1 A;  1PI5 A;  4QU3 A;  3IF6 B;  2PR6 A;  4EUV A;  3GDI A;  3TSG A;  1YAX A;  2ZMA A;  1KGG A;  2XD5 A;  4JXW A;  2OLU A;  5IHV A;  1SZV A;  1S6R A;  1S1Y A;  1H0M A;  3KX0 X;  4NET A;  4EW7 A;  4BL3 A;  4E3L A;  2P7J A;  3IS2 A;  4F3L B;  3RFB A;  3JYI A;  4GZB A;  3BQ8 A;  2RCX A;  2H5S A;  3UB5 P;  3UE3 A;  2Y2O A;  2WZX A;  5CX7 A;  3QNC A;  2GZA A;  1XJ6 A;  1VQQ A;  4BD1 A;  3MR0 A;  2HDS A;  1EI5 A;  3LIB A;  2V0W A;  3UNW A;  5FSR A;  4XXR A;  5J7E A;  2ZQ9 A;  1LL5 A;  1NLY A;  3UDX A;  5F1F A;  2Q9M A;  4DJ3 A;  5L8M A;  1HVB A;  3HRE A;  1K0K A;  1GSX A;  5L09 A;  2OWH A;  3TRC A;  3T4J A;  1W8Q A;  4CPK A;  4LV3 A;  1WE4 A;  3LIA A;  4BQM A;  1DP6 A;  3JVU A;  5LBR A; 
#chains in the Genus database with same CATH homology
 2EXB A;  3BLS A;  2ZQ7 A;  5TFQ A;  5A91 A;  3N8R A;  5EOE A;  1YLY A;  4PM5 A;  4X6T A;  5M1A A;  1NXY A;  1K6S A;  2ZQD A;  4DDS A;  4QD4 A;  1PI4 A;  1IYO A;  5GHX A;  2ZC4 B;  5I94 A;  2WAF A;  2ZLY A;  4K0W A;  3SH8 A;  4X55 A;  3DWK A;  2R9W A;  1AXB A;  1NYM A;  2PU2 A;  4RX3 A;  3M6B A;  4QY6 A;  4OQH A;  4P6B A;  3OPR A;  4GDN A;  3NDG A;  3WRZ A;  1KGE A;  2EX2 A;  3ZG0 A;  4K91 A;  4FD8 A;  5EOO A;  4L0L A;  4EUZ A;  1FSY A;  2EX9 A;  5CTM A;  3Q07 A;  1ZKJ A;  3VSK A;  5FQM A;  4DDY A;  3WS4 A;  2HPB A;  3NI9 A;  3VP2 A;  4P85 A;  1QMF A;  4BEN A;  2X01 A;  4WMC D;  4KZ7 A;  4E3O A;  1GA9 A;  1K25 A;  5CTN A;  4XUX A;  4ZTK A;  1CEG A;  4KQR A;  4X56 A;  5TR7 A;  4BJP A;  1MWS A;  3IXG A;  4KZ8 A;  4LCL A;  3SH7 A;  3VMA A;  4E3J A;  2H0Y A;  1E3U A;  4MEZ A;  4RVA A;  1O07 A;  1K4E A;  3IXB A;  1ZG6 A;  2I72 A;  5GHZ A;  3V39 A;  3OC2 A;  5HAP A;  3E2K A;  1JWV A;  1YM1 A;  2WYX A;  1ESI A;  1YT4 A;  2DNS A;  3N7W A;  4HBT A;  1JVJ A;  3HBR A;  2X02 A;  3SS4 A;  2JBF A;  1ONG A;  4GNU A;  4KZ6 A;  1IYQ A;  3GVB A;  3Q1F A;  3N4I A;  2Y2N A;  1TDL A;  3DTM A;  1YLW A;  5M19 A;  4QJG A;  5FI7 A;  1XA7 A;  1BUL A;  1W7F A;  3VP4 A;  4Y0U A;  4OKP A;  4E3M A;  1SKF A;  4DRT A;  1K57 C;  2XFT A;  1PWC A;  3SOI A;  3A3E A;  1N4O A;  3NY4 A;  4ZAM A;  5E2H A;  1YLP A;  3IH9 A;  1M40 A;  2X71 A;  4OPR A;  4ZJ2 A;  3M2J A;  3M6H A;  3RXX A;  4B88 A;  3CG5 A;  4EBN A;  1XA1 A;  1XGI A;  3B3X A;  1ES5 A;  3G4P A;  1S0W A;  4ZJ1 A;  4GDB A;  1MKI A;  1VM1 A;  2Y2M A;  3DWZ A;  4S2L A;  4GB7 A;  5E2G A;  4DKI A;  3FYZ A;  5HFO A;  5FAO A;  3UN7 A;  1FSW A;  5CED A;  1NYY A;  3IF6 C;  3LCE A;  1H8Z A;  2FFF B;  5FI6 A;  5HW3 A;  2WGW A;  1K55 A;  1ESU A;  3G35 A;  1JTD A;  3M2K A;  1KVL A;  3WWX A;  4DXB A;  1L0E A;  3GR2 A;  1WYC A;  4NK3 A;  2XFS A;  4R0Q A;  2HDU A;  1L0D A;  4R4S A;  1ES4 A;  5E43 A;  3D4F A;  4XUZ A;  3G30 A;  1BZA A;  4GD6 A;  2XR0 A;  1JTG A;  5CEC A;  1MXO A;  1YMX A;  2RL3 A;  2ZC5 B;  2A3U A;  2J9O A;  4S2N C;  4N1X A;  3OCN A;  2Y2P A;  4P0M A;  3HLG A;  1GCE A;  4RX2 A;  5EVL A;  1HZO A;  1TEM A;  2VGK A;  3HUN A;  4JKT A;  4JXS A;  3VSL A;  1RGZ A;  2XDM A;  4OLD A;  1OME A;  5G18 A;  2XEP A;  4EQI A;  1XP4 A;  4R23 A;  4C75 A;  2EX6 A;  2JCH A;  3A3J A;  1Q2Q A;  4GOG A;  4MBH A;  3O87 A;  4EBL A;  4JBF A;  3PBR A;  4OP5 A;  4WM9 A;  3ZFZ A;  1SHV A;  1H8Y A;  5DF8 A;  1ALQ A;  5U47 A;  4WEJ A;  4S2M A;  3AGF A;  1QME A;  1W8Y A;  4KZ4 A;  1GHI A;  1LI0 A;  5AQ9 A;  1XGJ A;  4X53 A;  3BFG A;  3HUO A;  2DRW A;  4WEK A;  5DTK A;  3VFH A;  4K0X A;  4JF4 A;  4KZ9 A;  5FQQ A;  4OOM A;  2HP9 A;  3BEB A;  1ERO A;  3OPP A;  1SDN A;  2ZQC A;  3UE0 A;  3UDI A;  3HLF A;  5AQ7 A;  4KZB A;  1BT5 A;  2DCF A;  4P87 A;  4Q8I A;  5CHM A;  3GSG A;  3MZE A;  1K54 A;  1I2W A;  2V20 A;  3NDE A;  1Y54 A;  5EVI C;  3WRT A;  2OSU A;  5HAI A;  1KDS A;  1PZP A;  1ERM A;  4S2J A;  4E6X A;  1FCO A;  1MWU A;  5HL1 A;  3UY6 A;  4X69 A;  3Q7V A;  4CJN A;  2ZC7 A;  4S2O A;  4QY5 A;  3UPO A;  1KGF A;  3O88 A;  5DTS A;  2ZQ8 A;  4KZ3 A;  3VP1 A;  1K57 A;  2EFX A;  1FR6 A;  1TDG A;  2E8I A;  5GLC A;  1IKI A;  3FV7 A;  4UAA A;  1BUE A;  1RP5 A;  3W4O A;  3G2Z A;  3HLE A;  1XX2 A;  2J9P A;  1E3U D;  3IH8 A;  4S2K A;  4E3K A;  3AGD A;  4PM9 A;  2XD1 A;  1NJ4 A;  1XKZ A;  2OV5 A;  1IYP A;  2ZM2 A;  4KEN B;  3S1Y A;  4OVD A;  5FI2 A;  3BEC A;  1HTZ A;  1PW1 A;  5CXW A;  5FQI A;  5FQK A;  5HAR A;  3G2Y A;  2G2U A;  1DJC A;  3IXH A;  2WZZ A;  1ERQ A;  3MFD A;  1O7E A;  4QB8 A;  1PIO A;  3ISG A;  3NC8 A;  4OLG A;  1ES3 A;  4R4R A;  4KQQ A;  1MWT A;  2OLV A;  3VOZ A;  2HP5 A;  1G6A A;  3AGE A;  3HLB A;  3PBO A;  2Y2J A;  1L2S A;  3CJM A;  2IWB A;  3ZGA B;  1NZU A;  1E4D A;  1LL9 A;  1I2S A;  2Y59 A;  3NIA A;  2Y91 A;  4N1H A;  4OOL A;  4U0X A;  5CER A;  4WYY A;  4PM8 A;  4LV2 A;  3S22 A;  1DJA A;  2XF3 A;  2EFU A;  3LEZ A;  3LO7 A;  3G32 A;  2B5R A;  4EWF A;  5EE8 A;  1FOF A;  1J9M A;  4R3B A;  4Y0T A;  4MLL A;  2H10 A;  4N92 A;  4OH0 A;  3W8K A;  5HAQ A;  4FCF A;  3WS5 A;  2P74 A;  3VOY A;  3ZCZ A;  3IHA A;  1NRF A;  3ITA A;  1WYB A;  4BL2 A;  1JWP A;  5E2E A;  3P09 A;  3TG9 A;  4WEL A;  3ZNY A;  4IED A;  3A3D A;  3A3I A;  1ES2 A;  5DTT A;  3ZG8 B;  1E25 A;  5FAT A;  3ZG5 A;  2J7V A;  3IWI A;  4DE1 A;  1KE4 A;  3HLW A;  2H0T A;  1MPL A;  2C6W B;  3PBN A;  4B4Z A;  4PM7 A;  1MBL A;  4ZJ3 A;  5GL9 A;  2XQZ A;  4UA6 A;  4HEF A;  5CEB A;  4HES A;  4WZ5 A;  2WKH A;  3PBT A;  3FKW A;  4HBU A;  4EV4 A;  4KZ5 A;  5KSC A;  3BFD A;  4KG6 A;  5CGX A;  3MKE A;  5F1G A;  3CMZ A;  1FQG A;  1RGY A;  2QZ6 A;  3OZH A;  3O3V A;  1HD8 A;  2PBY A;  1ZG4 A;  3MXS A;  3O86 A;  3Q81 A;  1CI8 A;  3MXR A;  4LCM A;  1XPB A;  4LV1 A;  2PU4 A;  3IQA A;  2WKE A;  2WGW B;  4DE3 A;  3UE1 A;  1YLZ A;  1RCJ A;  3IXD A;  3IWO A;  3C4O A;  5AQB A;  5EVI A;  3ZNT A;  3BFC A;  5L2F A;  2JE5 A;  4IBX A;  3A3F A;  4OP8 A;  1K56 A;  3C4P A;  3ZHH A;  4JPM A;  3Q82 A;  4JXV A;  4WZ4 A;  5BOH A;  3ZG9 B;  1KDW A;  5GLD A;  3HLD A;  1BLH A;  3BFF A;  3SS3 A;  2Q9N A;  4KG2 A;  5FQ9 A;  5CGW A;  1YMS A;  3W4P A;  3LY4 A;  2WGI A;  2BG1 A;  1K6R A;  2G2W A;  1KVM A;  4O7D A;  5TGF A;  2WAE A;  3IHB A;  4YFM A;  1KE0 A;  4DE2 A;  5FDH A;  2Y55 A;  3UDF A;  2JC7 A;  1I5Q A;  4OON A;  1MWR A;  1K55 C;  3RXW A;  2V2F F;  5F82 A;  5KZH A;  5DF7 A;  3EQU A;  1NZO A;  4Z9Q A;  3UO9 A;  1K4F A;  2P9V A;  4GKU A;  4F94 A;  3NCK A;  3SS5 A;  1IEL A;  2WUQ A;  2Z2M B;  3BM6 A;  1Q2P A;  3GMW A;  3ITB A;  4ZBE A;  2IWD A;  3SH9 A;  3ZVW A;  3Q7Z A;  3P98 A;  1PZO A;  4JF6 A;  4E3N A;  3PBS A;  3RJU A;  4JLF A;  1K38 A;  1PYY A;  3QNB A;  4UA9 A;  5CHJ A;  3GV9 A;  4KQO A;  5E2F A;  2XLN A;  5GHY A;  5FA7 A;  2GDN A;  1TVF A;  1CI9 A;  1N9B A;  3BYD A;  3G31 A;  4QHC A;  1SDE A;  4PM6 A;  4N9L A;  1CEF A;  3QHY A;  2Y2K A;  4OOY A;  5A92 A;  3N6I A;  1BSG A;  3FZC A;  1W79 A;  4OPY A;  3V50 A;  4RYE A;  1LHY A;  2HDR A;  2P9V B;  3HVF A;  3LY3 A;  1Z6F A;  3OPH A;  1PWG A;  3UPN A;  4BLM A;  5DVA A;  4IBR A;  5FAS A;  4R1G A;  4DF6 A;  3ZDJ A;  4C3Q A;  1IYS A;  1KE3 A;  5M18 A;  2A49 A;  4FSF A;  1FCM A;  3IWQ A;  3NBL A;  2V1Z A;  3C5A A;  3PAG A;  1C3B A;  1BTL A;  3DW0 A;  2UWX A;  1BLC A;  2VGJ A;  3FWL A;  5GLB A;  3CZD A;  3IF6 A;  3MKF A;  2Y2G A;  1ONH A;  3N8L A;  3OPL A;  3Q7V B;  4S2I A;  1M6K A;  2Y2I A;  1BLS A;  4Y7P A;  4C6Y A;  2ZQA A;  1PW8 A;  3HL9 A;  3OCL A;  4N9K A;  5FQJ A;  1G68 A;  4E3I A;  4WMC A;  4E6W A;  2FFY A;  3GQZ A;  4JF5 A;  3UPP A;  1DY6 A;  4OPZ A;  4RA7 A;  2BLS A;  4IVK A;  2ZC3 B;  5J8X A;  3ZVT A;  5D3O A;  1EWZ A;  1W5D A;  5HX9 A;  3GTC A;  4OQ0 A;  4S2P A;  3TOI A;  5JYP A;  4GD8 A;  2ZC6 B;  3S4X A;  5KSH A;  1K54 C;  2HP6 A;  4OQI A;  2QPN A;  1H5X A;  4S2N A;  4U0T A;  3C7U A;  4WBG A;  3V3S A;  1IKG A;  1GA0 A;  4M3K A;  2IWC A;  2XGN A;  3N8S A;  3IF5 A;  2ZM8 A;  2EX8 A;  2XH9 A;  1GHM A;  1PI5 A;  4QU3 A;  3IF6 B;  4Y0O A;  1GHP A;  4GN2 A;  4LEN A;  5A90 A;  2WAD A;  3EQV A;  2Y2L A;  2Y4A A;  3PTE A;  3TSG A;  4FH2 A;  1PWD A;  5CHU A;  2ZMA A;  4MBF A;  1KGG A;  2XD5 A;  2XK1 A;  2QMI A;  1L0G A;  3MBZ A;  5AQA A;  4JXW A;  2OLU A;  2WKI A;  3WS0 A;  5IHV A;  1NY0 A;  3G34 A;  4A5R A;  4X68 A;  1FCN A;  1S6R A;  3MZF A;  5EEC A;  2CC1 A;  1YQS A;  5GLA A;  1YLJ A;  5JYO A;  4NET A;  2Y2Q A;  3IT9 A;  3PBQ A;  3HUM A;  5F83 A;  1MY8 A;  3MZD A;  4EBP A;  4BL3 A;  4E3L A;  4PMA A;  1JWZ A;  3I7J A;  5A93 A;  2EXA A;  3JYI A;  4DE0 A;  1LLB A;  2HDQ A;  4GZB A;  5EPH A;  5EVI D;  5FAQ A;  2RCX A;  5CGS A;  1U60 A;  1FR1 A;  1YLT A;  3BRM A;  4UHU A;  2WGV A;  3W4Q A;  1K56 D;  2H5S A;  3UE3 A;  2Y2O A;  1BLP A;  2WZX A;  3BLM A;  4ZDX A;  4KG5 A;  3QNC A;  3V3R A;  1VQQ A;  4MBK A;  4ID4 A;  4BD1 A;  2Z2L B;  5KMW A;  2HDS A;  2ZJ9 A;  4UA7 A;  1EI5 A;  4MNR A;  5DF9 A;  1CK3 A;  3V5M A;  4FH4 A;  3VP0 A;  1ZC2 A;  3UNW A;  2WK0 A;  5FSR A;  3VP3 A;  5FAP A;  3WS2 A;  4JXG A;  4XXR A;  4U3T A;  2ZQ9 A;  1LL5 A;  4IVI A;  3BFE A;  3UDX A;  3FKV A;  5F1F A;  2Q9M A;  4B4X A;  4OQG A;  3WS1 A;  4D2O A;  1DJB A;  4DXC A;  1HVB A;  1L0F A;  3HRE A;  5EVI B;  4OPQ A;  3GRJ A;  5CRF A;  1IEM A;  3C7V A;  2ZD8 A;  2R9X A;  1XXM A;  2C5W B;  2Y2H A;  4LV0 A;  2J8Y A;  3E2L A;  1SCW A;  1W8Q A;  4YIN A;  2ZM0 A;  4KZA A;  3VFF A;  3ZG7 B;  4CPK A;  4LV3 A;  1WE4 A;  4WZ5 C;  3HLC A;  4BQM A;  4H8R A;  4PPR A;  4BD0 A;  4R3J A;  1LI9 A;  3PAE A;  5EUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...