3MBZA

Oxa-24 beta-lactamase complex soaked with 10mm sa4-17 inhibitor for 15min
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Betalactamase OXA24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/hydrolase inhibitor
total genus 76
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3mbzA00
3C4OA 1HTZA 3HUMA 4S2NA 2Z2MB 4YINA 4QB8A 2Y2JA 3WS5A 1G68A 1W8QA 2P74A 4OP5A 2WUQA 5TFQA 3N4IA 3MZFA 4E3JA 2XF3A 3IQAA 2Y2QA 2WZZA 4RX3A 3AGDA 4B4ZA 5E2HA 3HUNA 1YMSA 2ZC7A 5CGSA 3OPPA 4KZ9A 4JKTA 3M6BA 3W4OA 3W4QA 4C3QA 5CHMA 5FAPA 1IEMA 3S22A 2PU2A 2XK1A 4KZ3A 2I72A 4FSFA 5EVID 5FI6A 4OPQA 5GL9A 4NK3A 3PTEA 3V39A 3Q07A 1BUEA 4RVAA 4BL2A 4UA7A 5E2GA 3VP2A 1PIOA 1WYCA 2Y2OA 2OLVA 1CK3A 1HVBA 2C6WB 4WM9A 4OKPA 5CERA 4C75A 3G2ZA 4OQHA 1GCEA 3VFFA 3HL9A 3G31A 4PM5A 4LV1A 3UPPA 4R3JA 3OC2A 4LV2A 5FAOA 2FFFB 4MBHA 5FI7A 2ZM0A 5D3OA 3GR2A 1VM1A 4PM9A 2WAEA 5EECA 1BLCA 3ZCZA 1L0FA 5HAQA 1H8ZA 2QMIA 3NY4A 3N6IA 4B4XA 3CJMA 2XDMA 2PBYA 4S2LA 4WZ5C 3ISGA 4OP8A 4R23A 1NJ4A 2WGIA 4OOLA 4WZ4A 4X55A 4WEJA 3IF6C 2RCXA 3WRTA 2XLNA 1SHVA 3ZNYA 2JBFA 1C3BA 2X02A 2ZLYA 4IVIA 3IF6B 1ERQA 3GVBA 2J7VA 1O07A 3VOYA 1ES3A 1WE4A 2HDRA 5KSCA 1QMFA 2ZMAA 4PMAA 2ZC6B 4OPZA 1NYYA 1PZOA 4GZBA 1IELA 4P0MA 2EFXA 5DVAA 5M1AA 4FCFA 3MXSA 1EROA 4K0WA 1MWRA 3C5AA 4DE3A 1AXBA 1MXOA 2WAFA 3CMZA 4DXCA 5GHXA 2UWXA 1K38A 3ITAA 4M3KA 2HPBA 1WYBA 1K6SA 1KGEA 3UDXA 3HLEA 4IBRA 4OLGA 2Y2IA 4BJPA 3UPOA 3M2KA 4JXWA 2BG1A 2CC1A 1K57C 4E6WA 5CEDA 1FR6A 2DCFA 3Q1FA 4E6XA 3EQVA 3WS4A 4ID4A 3VSLA 3TSGA 1CI8A 1PWGA 3NCKA 3QNBA 4Y0OA 2HP6A 3IH9A 2H5SA 3A3JA 1YLZA 3BFGA 3C4PA 5DTTA 5E2EA 4ZJ3A 4BENA 2DNSA 4S2JA 3UE0A 2ZD8A 4RYEA 3O87A 4PM8A 2Y2HA 2ZC3B 1E3UD 1XA7A 3N8RA 2WKEA 1LL5A 1W5DA 2X71A 1PYYA 2Z2LB 1S0WA 1ONHA 4E3OA 5JYOA 1HZOA 2EX8A 2ZM8A 3IXGA 1Q2QA 1LI0A 3RXWA 3GMWA 4U0TA 2HDSA 4GN2A 3ITBA 4N1HA 1K55C 1FCOA 2JE5A 1PWDA 3O3VA 5FQKA 3UDIA 1NZOA 1YMXA 4N9LA 5CECA 5CTMA 4P87A 1J9MA 4S2IA 3WS0A 4Y0TA 5A92A 4WZ5A 1YLJA 4BL3A 1JWPA 5CGXA 3MZEA 4QY5A 5CGWA 4HBUA 5FQIA 1SDEA 1XPBA 3BYDA 3IF6A 4X6TA 2ZQ7A 3ZNTA 2ZJ9A 1ERMA 4Y7PA 5FASA 5HFOA 1FCMA 3HLCA 4X53A 2WK0A 5GHYA 3ZG5A 4FH2A 3UDFA 2EX9A 3P09A 1M6KA 2A3UA 1PW8A 3IWOA 1MWUA 4RX2A 5AQ9A 5CXWA 4OH0A 1JWVA 1N4OA 5HW3A 4GKUA 3S4XA 4IVKA 3QHYA 4BLMA 2IWBA 4UHUA 3SS5A 3NIAA 1BT5A 4S2OA 1FR1A 1LL9A 4DE0A 3LY4A 2H0YA 5A90A 3CG5A 1K54C 1O7EA 3DWZA 1MPLA 3HVFA 4QD4A 3VP3A 1K57A 4KENB 2DRWA 3UO9A 4JXSA 1JVJA 2XQZA 3ZFZA 4UAAA 2JCHA 4JXVA 1KGFA 1S6RA 2Y2NA 5EOOA 3VP4A 3BLSA 3IXBA 5F1GA 4EBPA 1XP4A 3N8LA 3FZCA 3BFCA 3IXDA 3IH8A 5DF7A 1K4FA 3UY6A 4R0QA 3TG9A 5L2FA 1YLYA 1Q2PA 3OCNA 3ZG0A 1TVFA 1IYOA 4KG2A 1U60A 3MFDA 2V20A 3UPNA 4DDSA 5KSHA 1ES5A 2P9VA 2ZQAA 5FAQA 3WS1A 3MKFA 4LCMA 3O86A 5EUAA 5HX9A 1K4EA 3ZGAB 4F94A 2XEPA 3HUOA 5I94A 3AGFA 5HL1A 3IF5A 3IWIA 1SKFA 4WMCA 4U3TA 4E3KA 4A5RA 3GSGA 1GA9A 2Q9NA 4QHCA 4RA7A 5GLDA 1XGJA 2R9WA 4EUZA 1KE0A 1FCNA 2Y2KA 5EVLA 3PBQA 5EPHA 3IXHA 3OZHA 3A3IA 1RCJA 4N9KA 5JYPA 3SS4A 3BFDA 4LV3A 1MY8A 3UE3A 1I5QA 2E8IA 1PI5A 3PAEA 3ZVTA 3RXXA 1L2SA 3G30A 4Q8IA 5FSRA 4EQIA 4GDNA 2ZQDA 3D4FA 4WEKA 2A49A 1CEGA 4S2KA 3LO7A 1YQSA 5DTKA 3IHBA 4CJNA 1XGIA 4XXRA 1RGZA 5HAPA 5F1FA 4HEFA 4S2MA 1ESIA 4JBFA 1TEMA 5HAIA 5AQBA 5EVIC 1YLWA 4ZJ2A 4N1XA 4QJGA 2G2WA 5EVIB 4EBNA 4KZ5A 4E3NA 1BLSA 2Y55A 5FATA 4EBLA 3V3SA 1BLPA 4OLDA 3SH7A 1IYSA 3FKVA 5J8XA 3G2YA 1GA0A 3G4PA 4CPKA 4JF4A 1PI4A 3Q81A 4JPMA 3A3EA 2X01A 5CRFA 1K54A 5CEBA 1CI9A 1EWZA 3Q7ZA 4PM6A 1XXMA 2H10A 2WZXA 4IEDA 3V50A 4DKIA 1DJCA 3GTCA 2XD5A 3VP1A 3HLGA 1FSYA 2Y91A 3BFFA 2C5WB 5FQJA 3OPLA 1CEFA 4OQGA 3PAGA 4YFMA 3WS2A 2P9VB 1LHYA 1G6AA 4GNUA 4X56A 4GB7A 1MKIA 5U47A 2V2FF 2XD1A 4XUZA 3Q7VB 1W79A 4E3MA 1W8YA 2WGWA 2XGNA 1H5XA 3PBOA 2IWDA 1ZKJA 3O88A 3ZDJA 3DW0A 3N8SA 2RL3A 1L0DA 1RP5A 1K56A 2ZC5B 1ZG4A 2EXBA 2OSUA 3C7UA 5AQAA 4B88A 5AQ7A 1DY6A 4BQMA 3HBRA 1NYMA 2Q9MA 1NY0A 4XUXA 4GD6A 4E3IA 3WRZA 2Y2MA 4GDBA 1JTGA 4KG6A 4BD0A 3MXRA 5KZHA 4MEZA 3OPRA 2XH9A 3P98A 5KMWA 2VGKA 3UN7A 5E43A 4PPRA 4KZ7A 3E2KA 3NBLA 3HLFA 2ZQCA 3QNCA 3PBTA 5DF8A 5GLAA 5FI2A 3GQZA 2WADA 4OVDA 1Y54A 5G18A 5DF9A 1H8YA 4FH4A 1IKGA 5E2FA 4DXBA 3SH8A 1TDGA 4NETA 1KE3A 3JYIA 4HESA 4C6YA 2QZ6A 1N9BA 3HLWA 4IBXA 5EVIA 2HP5A 3RJUA 2OLUA 3ZG8B 2ZM2A 1W7FA 3BM6A 1E25A 1ESUA 2B5RA 1KGGA 1HD8A 4UA9A 1L0GA 1FSWA 4LV0A 4WBGA 3FV7A 1QMEA 1BLHA 3M2JA 3VSKA 2J9PA 4DE2A 5FA7A 4EWFA 4S2PA 2XFSA 4KQOA 2IWCA 3BECA 1RGYA 4JF5A 5GHZA 1PWCA 4D2OA 3N7WA 2WYXA 2FFYA 3PBSA 1KDSA 1YM1A 2PU4A 4Y0UA 3GV9A 4ZJ1A 3UE1A 3MBZA 3IHAA 3UNWA 4UA6A 5FQQA 2J9OA 1K25A 3LEZA 4KZ4A 5TGFA 4KZAA 5CHJA 5HARA 3LCEA 4R4SA 2Y2PA 3MKEA 4ZBEA 2WKHA 2WGWB 2Y2GA 3TOIA 4EV4A 4QU3A 1ALQA 1KE4A 2H0TA 5IHVA 1BZAA 1SCWA 3BLMA 4X68A 1NXYA 3Q7VA 3AGEA 3ZVWA 4LCLA 3FYZA 4DF6A 2ZC4B 4R1GA 1K55A 1ES2A 4LENA 3W4PA 1LLBA 4K0XA 3OPHA 4MLLA 4MNRA 1YLTA 4WELA 3FKWA 1L0EA 3BFEA 3IT9A 5FDHA 3G34A 4E3LA 4JXGA 1MWTA 4HBTA 5TR7A 3FWLA 3M6HA 4DE1A 3BRMA 1M40A 3EQUA 4WMCD 3HREA 2EXAA 4O7DA 5FQMA 1ONGA 1GHPA 2R9XA 1IYPA 2XR0A 3WWXA 1KVMA 2VGJA 3DWKA 4BD1A 3B3XA 4KZ8A 4S2NC 2EX2A 4OOMA 1FQGA 1BTLA 1JTDA 1IKIA 3NI9A 3G32A 4MBFA 1ES4A 1XA1A 4R4RA 1DJAA 5M18A 2HDQA 4JLFA 3ZHHA 2ZQ8A 5GLCA 5M19A 5CHUA 4OQ0A 3VFHA 3OCLA 1OMEA 5DTSA 5F82A 3GRJA 1GHMA 5EOEA 4P6BA 4R3BA 1I2SA 5FQ9A 4DDYA 1YT4A 4QY6A 3PBRA 1EI5A 4WYYA 3V3RA 3CZDA 1IYQA 2G2UA 1BULA 4U0XA 1SDNA 2Y59A 1NZUA 2ZQ9A 2XFTA 1DJBA 3VMAA 5A91A 1E3UA 2Y4AA 1ZG6A 4OQIA 3VP0A 4H8RA 3W8KA 3SS3A 3ZG7B 4KZ6A 3V5MA 1VQQA 1K6RA 3HLBA 2JC7A 4GOGA 4ZDXA 4K91A 2OV5A 3A3FA 4FD8A 3Q82A 2EFUA 3I7JA 4OPYA 3SH9A 3G35A 5BOHA 5A93A 2QPNA 1MWSA 2BLSA 1NRFA 1I2WA 1MBLA 4Z9QA 5CTNA 4DRTA 4OONA 1PW1A 3C7VA 1KVLA 4ZTKA 3LY3A 1GHIA 1KDWA 4JF6A 3PBNA 1FOFA 1ZC2A 2J8YA 1PZPA 5EE8A 3HLDA 1XX2A 3NDGA 4GD8A 3S1YA 3IWQA 4L0LA 1BSGA 2V1ZA 3VOZA 1E4DA 2HDUA 3SOIA 3ZG9B 3NC8A 2Y2LA 1XKZA 1Z6FA 4KG5A 1YLPA 4X69A 4KQRA 1K56D 4N92A 1LI9A 4MBKA 4OOYA 1TDLA 3A3DA 4KQQA 2GDNA 3BEBA 4P85A 4PM7A 3MZDA 2WKIA 4ZAMA 3NDEA 5GLBA 5F83A 2WGVA 4KZBA 3E2LA 2HP9A 1JWZA 3DTMA 4OPRA 2EX6A
chains in the Genus database with same CATH superfamily
2EA9A 4S2NA 4QB8A 3C38A 1W8QA 4OP5A 1LSXA 4CQHA 2WUQA 1PFLA 2XF3A 3IQAA 3AGDA 5E2HA 5KIZA 2ZC7A 3OPPA 4JKTA 3W4QA 5FI6A 2XK1A 4NK3A 3T4SA 4NXFA 5E2GA 4DN0A 4HH2A 4OKPA 3G2ZA 3OOVA 3HJIA 4OQHA 1GCEA 1UWNX 3OC2A 4XT2A 5FI7A 1BLCA 3ZCZA 1OTIA 4OP8A 1XFNA 5K5BA 5L10A 1OTEA 4WEJA 2PR6A 2RCXA 1SHVA 3IF6B 2QJ7A 1O07A 3FC7A 4EQ1A 1ES3A 1IELA 5HZHA 5DVAA 4K0WA 1MWRA 3MF0A 1AXBA 2WAFA 2UWXA 3VOLA 3ITAA 4M3KA 2HPBA 3HLEA 4OLGA 4L9GA 5CEDA 4E6XA 3KSIA 3EQVA 4ID4A 1PWGA 3TRCA 5E2EA 5DTTA 1YLZA 2PRFA 4BENA 3SZTA 2ZD8A 4RYEA 2ZC3B 3N8RA 2WKEA 2X71A 4EERA 2EX8A 2FH5A 3GMWA 3S7PA 3ITBA 3PXPA 3CUEC 1K55C 4ETXA 3O3VA 2I9VA 4N9LA 3H82B 1J9MA 3WS0A 4WZ5A 1YLJA 4BL3A 1TS0A 4QY5A 2ZMVA 1XPBA 4X6TA 5EVEA 2ZQ7A 1Y28A 2EWWA 5F5YA 4X53A 5GHYA 5TBMB 4PAUA 3C2WA 4FH2A 3LIEA 2EX9A 1M6KA 3UB7A 5AQ9A 2OOLA 5CXWA 1WA9A 1N4OA 5HW3A 2IWBA 3UB8A 4Y3IA 4DE0A 4I3JA 3T1XA 2PDRA 4QD4A 1MPLA 4Y15A 3UO9A 3UB9A 1S6RA 5EOOA 3BLSA 3KSFA 3N8LA 3BFCA 3UY6A 4QWOA 4R0QA 1Q2PA 2HF6A 1TVFA 3MFDA 2V20A 1K4EA 3ZGAB 4F94A 1G5UA 3AGFA 3IF5A 2VEAA 4Y13A 4WMCA 4U3TA 3HCYA 2KX6A 2Q9NA 1VEUA 3S7QA 4H6JB 1BYWA 2V0UA 1Z09A 1YSPA 3BWLA 1S66L 5HD5A 4LV3A 1I5QA 4LPZA 3F1NA 4DJ2A 1PI5A 2XA7S 5AVEA 1X0OA 3LO7A 3QP8A 3IHBA 4O01A 4CJNA 1XJ3A 3SW1A 5HAPA 2QKPA 4JBFA 2W3HA 5HAIA 4AFIA 5FEFA 4KZ5A 1TD5A 5DFXA 1AWIA 4EBLA 2VA0A 5J8XA 3G2YA 1YPRA 3G4PA 1PI4A 2X01A 1CI9A 1D06A 3PYPA 4HOIA 3DTEA 3Q7ZA 4PM6A 2WZXA 4IEDA 1DJCA 3HLGA 2Y91A 3BFFA 3VE3A 3OPLA 1CEFA 4X56A 4KUOA 3UB5P 3Q7VB 4E3MA 3PBOA 4HY8A 2WKPA 3O88A 3ZYTA 3CAXA 3R7WB 1RP5A 4NG2A 1K56A 2ZC5B 1H3QA 2EXBA 3C7UA 5AVFA 5AQ7A 4BQMA 4JGOA 2Q9MA 4BD0A 3MXRA 2W1TB 1SKOA 2VGKA 4PPRA 3E2KA 5GLAA 5L09A 4O0PA 4WL9A 5G18A 3MXQA 4NXBA 1N9NA 2H28A 4NETA 3JYIA 1A0KA 4HESA 4RQ9A 2QZ6A 4WUJA 3LEQA 5EVIA 2ZM2A 1W7FA 4CLCD 1GSWA 3VSKA 4WF0A 1UWPX 5EM1A 4JF5A 2WYXA 2PU4A 1YM1A 2NUPC 3IHAA 5HWWA 4KZAA 4EEUA 5CHJA 3LCEA 1NRJA 2WGWB 2Y2GA 4EV4A 1SCWA 2K7SA 1N9OA 3ZVWA 3B42A 1K55A 2HJ9C 3W4PA 4MLLA 4Q0HA 3BFEA 3G34A 2VZWA 3FWLA 4DE1A 3EQUA 1M40A 3HREA 2EXAA 2R9XA 2XR0A 1KVMA 2VGJA 3ZQ5A 4S2NC 3JVUA 3CITA 3CPTB 1IKIA 4BBVA 4M4XA 1ZTUA 1ES4A 2WKQA 3ZHHA 2A24B 5CHUA 2VJWA 4OQ0A 3LIBA 3IX4A 5F82A 5EOEA 2VGLS 4BBUA 1T1CA 3V3RA 2G2UA 1BULA 1DP6A 4U0XA 1SDNA 3EGXC 2Y59A 4LRZE 1E3UA 4OQIA 4H8RA 3W8KA 1VQQA 1K6RA 4GOGA 3S7NA 4ZDXA 3LR5A 3I7JA 2QPNA 5HD3A 1MBLA 4Z9QA 5HSQA 1PW1A 1GHIA 1KDWA 3PBNA 1FOFA 2XA7M 1XX2A 1H0MA 1SZVA 2VV8A 1EW0A 1YLPA 4KQRA 1LI9A 4MBKA 5C5KA 3BEBA 3MZDA 2WKIA 4ZAMA 3TW8A 1OJ5A 3DTMA 3L9KA 4PKYG 3W2ZA 2Z2MB 1J3WA 4WLAA 2Y2QA 1OTAA 1OT9A 1LSVA 1F2KA 2JKRM 1YMSA 5CGSA 4KZ9A 5DFYA 1IEMA 3L7HA 3GDIA 2PU2A 1D1JA 4FSFA 3F1OB 3PTEA 1PNEA 2KLIA 2Y2OA 4BWIA 2OLVA 1CK3A 1HVBA 2C6WB 3H7WA 3IBJA 1G28A 3BJNA 3HL9A 3C8CA 3G31A 2PAVP 4PM5A 4MBHA 5J4EA 4DJ3A 3GR2A 5HAQA 3CJMA 4WZ5C 2Y8HA 4R23A 1NJ4A 2WGIA 4OOLA 4HJ4A 2ACGA 2XLNA 3ZNYA 1C3BA 3MS6A 5EV0A 3IBRA 4I3AA 2ZMAA 4GZBA 4LGWA 5M1AA 4CLCB 1MXOA 2O99A 5HWVA 1V9YA 4BJPA 3UPOA 2BG1A 2CC1A 2DCFA 3WS4A 3MQ0A 2LB9A 4KUKA 1CI8A 2HP6A 4ZJ3A 2H5SA 3A3JA 2DNSA 1P0ZA 3UE0A 5HPIA 4X1MA 1LL5A 3F1PB 5JYOA 3V67A 1HZOA 3MR0A 1Q2QA 2HDSA 4N1HA 1FCOA 3EWKA 1VHMA 2OAQ1 1P9WA 1YMXA 5F6AA 5CECA 2VX8A 4P87A 4Q0IA 4G3VA 2ZJ9A 2VGLM 2PHYA 4Y7PA 3KO6A 5HFOA 1LL8A 2PBDP 3HLCA 3B47A 2WK0A 5IU1A 2HGVA 3CI6A 3A0RA 3UDFA 3T1RA 2GX5A 2ZMFA 2W3FA 1W63M 2O9CA 5J3WA 4UHUA 3SS5A 2P7JA 1BT5A 3TE8A 3A0VA 2E8JA 3KYZA 2UV0E 3DWZA 4LRXC 3NJAA 4KENB 2DRWA 2JCHA 4JXVA 2Y2NA 3IXBA 4HI4A 4D60A 4EBPA 1XP4A 3FPVA 3IXDA 3IH8A 5HDDA 2VV7A 2R78A 3ZG0A 1IYOA 3T4OA 3NOTC 4KG2A 4DDSA 1ES5A 4LCMA 3NULA 3HUOA 2V8CA 3IWIA 1SKFA 4II7A 2XRNA 1CQAA 1GA9A 4QHCA 1XGJA 4HIAA 4UQIM 4YWZA 3R7WA 5EVLA 5EPHA 3IXHA 3OZHA 4HP4A 2D02A 3E0YA 5JYPA 5IS1A 3RXXA 5FSRA 4EQIA 2PYPA 4S2KA 5DTKA 1F98A 3KX0X 3RH8B 5HDSA 1ESIA 5AQBA 5EVIC 4JGQA 2PR5A 1F9IA 3MJQA 2W0NA 4HNBA 1BLPA 3KYQA 4OLDA 4MDZA 4JF4A 1DP9A 4JPMA 5CRFA 1K54A 5CEBA 3LIDA 4HH3A 4GS9A 1XXMA 2H10A 1LSWA 4DKIA 3GTCA 3VP1A 3G6OA 3FG8A 4YFMA 3WS2A 2P9VB 1LHYA 1G6AA 2VV6A 3LI9A 4GNUA 5U47A 2XD1A 3A0SA 1L3LA 1W79A 3E4OA 4F3LA 1W8YA 2WGWA 1H5XA 5EM0A 1ZG4A 4ARZB 1XJ6A 4B88A 4HQAA 3LIFA 1YAXA 3HBRA 1NYMA 4E3IA 4KG6A 4MEZA 3OPRA 3P98A 4GJ4A 5KMWA 2L0WA 3HLFA 1ACFA 2JKTM 5DF8A 1ODVA 1Y54A 2KDKA 1LT0A 4O8GA 1IKGA 5E2FA 4DXBA 3SH8A 3HLWA 5FL3A 5CX7A 2HP5A 3ZG8B 3RJUA 1ESUA 1FSWA 4LV0A 5IT5A 1QMEA 2J9PA 3EEHA 5FA7A 2AVXA 1PWCA 4C75A 2FFYA 3GV9A 3MBZA 4UA6A 2J9OA 4KZ4A 2D01A 4R4SA 4QU3A 1ALQA 1KE4A 2VKSA 3BLMA 4LCLA 2M1CA 4DF6A 3T4TA 1ES2A 3UMEA 1LLBA 4K0XA 4MNRA 1JNUA 3B33A 4WELA 3C30A 5FDHA 3LGOA 4HBTA 5TR7A 4WMCD 2J3TC 4O7DA 1GHPA 3DWKA 3QP4A 4OOMA 4NXEA 1BTLA 1JTDA 4IHQA 3G32A 4R4RA 5M18A 3U2AA 5M19A 3VFHA 5FQ9A 4DDYA 1OTBA 1YT4A 4QY6A 1IFQA 1DJBA 4K08A 5DKLA 5A91A 5F68A 3ZG7B 1G6OA 4KZ6A 3G35A 1MWSA 1NRFA 3U4LP 5CTNA 3LR4A 4DRTA 4OONA 4LRYC 1KVLA 4JF6A 4XT2B 2JN7A 2QJ5A 2V1ZA 3VOZA 1TF1A 3NC8A 3P7NA 1K56D 4OOYA 1TDLA 3A3DA 4P85A 2GDNA 4PM7A 2M7VA 3NDEA 4X1LA 2WGVA 3E2LA 4YOFA 1JWZA 1HTZA 3HUMA 4GHIB 4YINA 1G68A 3MFXA 3MZFA 4E3JA 2WZZA 4MN6A 2V1AA 3HUNA 3M6BA 4C3QA 5CHMA 5FAPA 3S22A 5EVID 2I72A 2PT7A 4OPQA 1PRQA 3Q07A 1BUEA 2MJ6A 3EGDC 3NECA 1PIOA 5L8MA 2YKFA 5CERA 2GNXA 1S4SA 3MQOA 4LV1A 3UPPA 3QP2A 4R3JA 4LV2A 2ZM0A 2ZOHA 3BQ8A 4GCZA 1L0FA 3FPWA 3IS2B 3NY4A 3N6IA 4B4XA 3BQAA 2PBYA 4X55A 3WRTA 2ZLYA 4NXGA 3T12B 1MC0A 3GVBA 1WE4A 5KSCA 5DJTA 4PMAA 4R3AA 4OPZA 1PZOA 4P0MA 2EFXA 2W27A 2W3GA 4FCFA 2OAP1 1EROA 3CMZA 2O9AA 1WYBA 1K6SA 1NLYA 5AJGA 4JXWA 2V1BA 1FR6A 3Q1FA 3TSGA 3NCKA 1OJGA 3BFGA 3LFVA 2A2LA 4S2JA 4BMWA 4JGRA 4HJ3A 3O87A 4PM8A 4HHDA 2Y2HA 1E3UD 1S1YA 4MN5A 1W5DA 1PYYA 2Z2LB 1ONHA 2GJ3A 2ZM8A 4R6LA 3IXGA 1XFQA 1LI0A 2V8FA 3CLOA 4GN2A 4R38A 2JE5A 1PWDA 3UDIA 1GSVA 1VEUB 4Q0JA 1S1ZA 3QP1A 2ZBBA 1JWPA 5CGXA 3D9YA 5CGWA 3F1NB 4LLOB 4HBUA 5FQIA 1SDEA 3IF6A 5FASA 1ERMA 1FCMA 3ZG5A 2IA2A 2J3TD 3P09A 4IUHA 1PW8A 3UE6A 4OH0A 1JWVA 3BY8A 3S4XA 4IVKA 3QHYA 4BLMA 3NIAA 4FTXA 3TJZC 5FEGA 4HP9A 1LL9A 3T4KA 1N9LA 2H0YA 1K54C 1O7EA 3VP3A 3HVFA 1K57A 3RFBA 3H9WA 5DKKA 1JVJA 3ZFZA 1KGFA 3VP4A 3FZCA 5L2FA 1YLYA 1U60A 2P9VA 2EWVA 2ZQAA 3MKFA 3O86A 4G3KA 2ZL1B 5HX9A 4P6ZS 3MQQA 4A5RA 4RA7A 4EUZA 1FCNA 4BBTA 3H82A 3PBQA 4N9KA 2CMNA 1RCJA 3A3IA 4ARZA 3SS4A 4IJGA 2B18A 1SKOB 2QWSA 4GDNA 2ZQDA 3D4FA 2A49A 1CEGA 2P04A 5TBMA 4XXRA 1RGZA 5HDCA 2JKGA 5F1FA 4HEFA 1STZA 3KSGA 2O9BA 3NOUC 2VK3A 4ZJ2A 4N1XA 2G2WA 5EVIB 4E3NA 2M7UA 2ZOIA 3V3SA 3SH7A 3FKVA 1DRMA 3Q81A 3A3EA 4JGPA 1GSXA 4Y2FA 3DTIA 1FSYA 2C5WB 1OPXA 3PAGA 2L1MA 5DJUA 2NUTC 4EEPA 2V2FF 5EFWA 2IWDA 3K3CA 3ZDJA 3N8SA 2RL3A 4EU0A 1L0DA 3VE4A 5AQAA 1DY6A 4H6JA 1VETB 4ETZA 4XUXA 4GD6A 2Y2MA 4GDBA 1JTGA 3UB6A 2XH9A 3UN7A 5E43A 4KZ7A 3NBLA 3QNCA 1S67L 1H8MA 2WADA 4UEYA 1TDGA 3T1QB 1T18A 3RTYA 4IBXA 3JPUA 3E98A 2OLUA 3BM6A 3PHYA 4UA9A 1KGGA 1HD8A 1L0GA 2HV1A 4EWFA 4S2PA 5HL6A 2IWCA 3BECA 1RGYA 1TS6A 4X25A 5GHZA 5G4YA 3N7WA 3UNWA 4Y0UA 3LEZA 5TGFA 2QHKA 2HJEA 2WKHA 3CHWP 2H0TA 1BZAA 4X68A 3Q7VA 3K3DA 2PD7A 3FYZA 3K2NA 2ZC4B 3OPHA 1YLTA 3IT9A 4E3LA 2QYBA 4I38A 1MWTA 3M6HA 3BRMA 4WN5A 2W1TA 3LR0A 3B3XA 4KZ8A 3VV4A 2EX2A 1FQGA 1P97A 3NI9A 4MBFA 1XA1A 3LI8A 1DJAA 2J80A 2HDQA 4JLFA 2ZQ8A 4MMNA 5GLCA 4DMZA 4GHIA 3OCLA 1OMEA 5DTSA 4CLCC 4P6BA 1EI5A 3MMHA 4WYYA 3CZDA 3PR6A 1IYQA 1DP8A 1NZUA 2ZQ9A 2XFTA 3VMAA 4IUKA 3LR3A 2OWJA 1ZG6A 3VP0A 3SS3A 4P6ZM 4Z1WA 3A3FA 3H7WB 3Q82A 2EFUA 4OPYA 3LICA 4G3WA 5BOHA 4YNRA 3QP6A 1I2WA 4ZTKA 3LY3A 1ZC2A 2VLGA 1PZPA 5EE8A 3HLDA 3NDGA 3S1YA 4E04A 3IWQA 2YKHA 2HDUA 3ZG9B 5J7EA 2Y2LA 5HWTA 1Z6FA 4KG5A 3NOPC 2XROA 3IS2A 4KQQA 4I39A 5GLBA 2HP9A 3C4OA 3CPTA 2Y2JA 3WS5A 2P74A 1XJ4A 2A24A 5TFQA 3N4IA 4KQDA 1MKMA 4FOFA 4RX3A 4B4ZA 3E4QA 3JVVA 3W4OA 5TJJA 3T4QA 3T4LA 2JKFA 4KZ3A 2L4RA 5GL9A 3V39A 2OWHA 4RVAA 4BL2A 4UA7A 3VP2A 2INWA 1WYCA 3HJKA 4WM9A 1T1BA 3VFFA 5FAOA 1S4RA 2FFFB 5LBRA 5D3OA 1VM1A 4PM9A 2WAEA 5EECA 2LB5A 3LUQA 4I3IA 1CF0A 1H8ZA 2QMIA 2XDMA 3OLOA 4S2LA 4EXOA 3ISGA 1OT6A 2W1RA 4WZ4A 3LIAA 3IF6C 2JBFA 2X02A 4IVIA 4L9FA 1ERQA 2HZ5A 2J7VA 3VOYA 2HDRA 3P01A 1QMFA 2ZC6B 1KOUA 1NYYA 4EESA 3MXSA 4DE3A 4DXCA 3C5AA 5GHXA 1K38A 1KGEA 1VB6A 3UDXA 4IBRA 2Y2IA 3M2KA 1K57C 4E6WA 4EW7A 3F1OA 3VSLA 3QNBA 4Y0OA 3IH9A 3C4PA 2JKRI 2W3EA 4FUWA 3BW6A 4ME4A 1XA7A 3R4KA 5I5LA 3T50A 1S0WA 4QPRA 4E3OA 1ZHHB 3RXWA 4U0TA 5FQKA 2ZL1A 1NZOA 5CTMA 4S2IA 5A92A 4Y0TA 3MZEA 1MZUA 3BYDA 3ZNTA 4NEED 2KOIA 2W3DA 1TS7A 2Y79A 4MCWA 2A3UA 4B9OA 3IWOA 1MWUA 4RX2A 4ZRRA 4CLCA 1T19A 4GKUA 4S2OA 1FR1A 4Y5FA 3LY4A 5A90A 3CG5A 2V0WA 2Q0OA 1YKDA 4PHTA 4GLQA 4JXSA 2XQZA 4UAAA 4GS9B 3DBAA 5A8BA 5F1GA 1K0KA 5DF7A 1K4FA 3T1SA 3TG9A 3OCNA 3F1PA 4MN7A 4F3LB 3UPNA 5KSHA 5FAQA 3IX8A 3WS1A 3EOIA 5EUAA 2XEPA 5I94A 5HL1A 3EEAA 4E3KA 3CUEA 3GSGA 1CJFA 2V9AA 3DTKA 2R9WA 5GLDA 1KE0A 2GZAA 2Y2KA 3GECA 3BFDA 1MY8A 3UE3A 2E8IA 1VETA 3PAEA 3ZVTA 1L2SA 3G30A 4Q8IA 4WEKA 1YQSA 3ICYA 1XGIA 1NWZA 4S2MA 1T1AA 1TEMA 5FDSA 4L9EA 1YLWA 2Z6DA 4QJGA 4EBNA 1BLSA 2Y55A 5FATA 1IYSA 1UGUA 2O0YA 1GA0A 4CPKA 3D72A 1EWZA 3V50A 2XD5A 4R70A 2DMWA 5F69A 5FQJA 4OQGA 3DAVA 4PKYA 4GB7A 1MKIA 4XUZA 1FIKA 1P9RA 2WKRA 2G7UA 2XGNA 4B93A 1ZKJA 1HLUP 3DW0A 2OSUA 5MC7A 1NY0A 2B95A 5KZHA 3WRZA 5HPFA 2Z6CA 2K31A 2ZQCA 3PBTA 3S7OA 5FI2A 4I5SA 3GQZA 4OVDA 4NKPA 5DF9A 1H8YA 4FH4A 4UQIS 1KE3A 4C6YA 1N9BA 3ULFA 3LYXA 1E25A 2B5RA 4WBGA 4DE2A 2PD8A 3FV7A 1BLHA 3M2JA 4EUVA 2XFSA 4KQOA 3KYEA 4D2OA 3E4PA 3PBSA 1V9ZA 1F5MA 1KDSA 3UE1A 4ZJ1A 5FQQA 1K25A 5HARA 2Y2PA 3MKEA 4ZBEA 1IOUA 4Y17A 1NLZA 1XJ2A 3TOIA 1W63Q 5IHVA 1NXYA 3AGEA 2K2NA 4R1GA 5L07A 4CLCE 4LENA 2XSSA 3O5YA 2PYRA 1YSQA 3FKWA 3KSHA 1L0EA 4JXGA 3CWFA 3T4JA 5FQMA 1ONGA 1IYPA 3WWXA 3D3OA 3NHQA 4BD1A 3MSHA 1D7EA 2B02A 2BTFP 1FILA 3GRJA 1GHMA 2P08A 2JKTI 4R3BA 1I2SA 4GW9A 3PBRA 4ESPA 4LFUA 2JHEA 3QP5A 2Y4AA 1Y4OA 3V5MA 3HLBA 2JC7A 4K91A 2OV5A 4FD8A 2BASA 3SH9A 3BY9A 3IX3A 5A93A 3UMDA 2BLSA 4HJ6A 2J3WA 3C7VA 2J8YA 4EETB 4GD8A 1TS8A 4L0LA 1BSGA 1E4DA 5G4ZA 2FZ0A 3SOIA 1XKZA 4X69A 4N92A 3OBFA 1OTDA 5F83A 4KZBA 4OPRA 2EX6A
chains in the Genus database with same CATH topology
3C4OA 1HTZA 3HUMA 4S2NA 2Z2MB 4YINA 4QB8A 2Y2JA 3WS5A 1G68A 1W8QA 2P74A 4OP5A 2WUQA 5TFQA 3N4IA 3MZFA 4E3JA 2XF3A 3IQAA 2Y2QA 2WZZA 4RX3A 3AGDA 4B4ZA 5E2HA 3HUNA 1YMSA 2ZC7A 5CGSA 3OPPA 4KZ9A 4JKTA 3M6BA 3W4OA 3W4QA 4C3QA 5CHMA 5FAPA 1IEMA 3S22A 2PU2A 2XK1A 4KZ3A 2I72A 4FSFA 5EVID 5FI6A 4OPQA 5GL9A 4NK3A 3PTEA 3V39A 3Q07A 1BUEA 4RVAA 4BL2A 4UA7A 5E2GA 3VP2A 1PIOA 1WYCA 2Y2OA 2OLVA 1CK3A 1HVBA 2C6WB 4WM9A 4OKPA 5CERA 4C75A 3G2ZA 4OQHA 1GCEA 3VFFA 3HL9A 3G31A 4PM5A 4LV1A 3UPPA 4R3JA 3OC2A 4LV2A 5FAOA 2FFFB 4MBHA 5FI7A 2ZM0A 5D3OA 3GR2A 1VM1A 4PM9A 2WAEA 5EECA 1BLCA 3ZCZA 1L0FA 5HAQA 1H8ZA 2QMIA 3NY4A 3N6IA 4B4XA 3CJMA 2XDMA 2PBYA 4S2LA 4WZ5C 3ISGA 4OP8A 4R23A 1NJ4A 2WGIA 4OOLA 4WZ4A 4X55A 4WEJA 3IF6C 2RCXA 3WRTA 2XLNA 1SHVA 3ZNYA 2JBFA 1C3BA 2X02A 2ZLYA 4IVIA 3IF6B 1ERQA 3GVBA 2J7VA 1O07A 3VOYA 1ES3A 1WE4A 2HDRA 5KSCA 1QMFA 2ZMAA 4PMAA 2ZC6B 4OPZA 1NYYA 1PZOA 4GZBA 1IELA 4P0MA 2EFXA 5DVAA 5M1AA 4FCFA 3MXSA 1EROA 4K0WA 1MWRA 3C5AA 4DE3A 1AXBA 1MXOA 2WAFA 3CMZA 4DXCA 5GHXA 2UWXA 1K38A 3ITAA 4M3KA 2HPBA 1WYBA 1K6SA 1KGEA 3UDXA 3HLEA 4IBRA 4OLGA 2Y2IA 4BJPA 3UPOA 3M2KA 4JXWA 2BG1A 2CC1A 1K57C 4E6WA 5CEDA 1FR6A 2DCFA 3Q1FA 4E6XA 3EQVA 3WS4A 4ID4A 3VSLA 3TSGA 1CI8A 1PWGA 3NCKA 3QNBA 4Y0OA 2HP6A 3IH9A 2H5SA 3A3JA 1YLZA 3BFGA 3C4PA 5DTTA 5E2EA 4ZJ3A 4BENA 2DNSA 4S2JA 3UE0A 2ZD8A 4RYEA 3O87A 4PM8A 2Y2HA 2ZC3B 1E3UD 1XA7A 3N8RA 2WKEA 1LL5A 1W5DA 2X71A 1PYYA 2Z2LB 1S0WA 1ONHA 4E3OA 5JYOA 1HZOA 2EX8A 2ZM8A 3IXGA 1Q2QA 1LI0A 3RXWA 3GMWA 4U0TA 2HDSA 4GN2A 3ITBA 4N1HA 1K55C 1FCOA 2JE5A 1PWDA 3O3VA 5FQKA 3UDIA 1NZOA 1YMXA 4N9LA 5CECA 5CTMA 4P87A 1J9MA 4S2IA 3WS0A 4Y0TA 5A92A 4WZ5A 1YLJA 4BL3A 1JWPA 5CGXA 3MZEA 4QY5A 5CGWA 4HBUA 5FQIA 1SDEA 1XPBA 3BYDA 3IF6A 4X6TA 2ZQ7A 3ZNTA 2ZJ9A 1ERMA 4Y7PA 5FASA 5HFOA 1FCMA 3HLCA 4X53A 2WK0A 5GHYA 3ZG5A 4FH2A 3UDFA 2EX9A 3P09A 1M6KA 2A3UA 1PW8A 3IWOA 1MWUA 4RX2A 5AQ9A 5CXWA 4OH0A 1JWVA 1N4OA 5HW3A 4GKUA 3S4XA 4IVKA 3QHYA 4BLMA 2IWBA 4UHUA 3SS5A 3NIAA 1BT5A 4S2OA 1FR1A 1LL9A 4DE0A 3LY4A 2H0YA 5A90A 3CG5A 1K54C 1O7EA 3DWZA 1MPLA 3HVFA 4QD4A 3VP3A 1K57A 4KENB 2DRWA 3UO9A 4JXSA 1JVJA 2XQZA 3ZFZA 4UAAA 2JCHA 4JXVA 1KGFA 1S6RA 2Y2NA 5EOOA 3VP4A 3BLSA 3IXBA 5F1GA 4EBPA 1XP4A 3N8LA 3FZCA 3BFCA 3IXDA 3IH8A 5DF7A 1K4FA 3UY6A 4R0QA 3TG9A 5L2FA 1YLYA 1Q2PA 3OCNA 3ZG0A 1TVFA 1IYOA 4KG2A 1U60A 3MFDA 2V20A 3UPNA 4DDSA 5KSHA 1ES5A 2P9VA 2ZQAA 5FAQA 3WS1A 3MKFA 4LCMA 3O86A 5EUAA 5HX9A 1K4EA 3ZGAB 4F94A 2XEPA 3HUOA 5I94A 3AGFA 5HL1A 3IF5A 3IWIA 1SKFA 4WMCA 4U3TA 4E3KA 4A5RA 3GSGA 1GA9A 2Q9NA 4QHCA 4RA7A 5GLDA 1XGJA 2R9WA 4EUZA 1KE0A 1FCNA 2Y2KA 5EVLA 3PBQA 5EPHA 3IXHA 3OZHA 3A3IA 1RCJA 4N9KA 5JYPA 3SS4A 3BFDA 4LV3A 1MY8A 3UE3A 1I5QA 2E8IA 1PI5A 3PAEA 3ZVTA 3RXXA 1L2SA 3G30A 4Q8IA 5FSRA 4EQIA 4GDNA 2ZQDA 3D4FA 4WEKA 2A49A 1CEGA 4S2KA 3LO7A 1YQSA 5DTKA 3IHBA 4CJNA 1XGIA 4XXRA 1RGZA 5HAPA 5F1FA 4HEFA 4S2MA 1ESIA 4JBFA 1TEMA 5HAIA 5AQBA 5EVIC 1YLWA 4ZJ2A 4N1XA 4QJGA 2G2WA 5EVIB 4EBNA 4KZ5A 4E3NA 1BLSA 2Y55A 5FATA 4EBLA 3V3SA 1BLPA 4OLDA 3SH7A 1IYSA 3FKVA 5J8XA 3G2YA 1GA0A 3G4PA 4CPKA 4JF4A 1PI4A 3Q81A 4JPMA 3A3EA 2X01A 5CRFA 1K54A 5CEBA 1CI9A 1EWZA 3Q7ZA 4PM6A 1XXMA 2H10A 2WZXA 4IEDA 3V50A 4DKIA 1DJCA 3GTCA 2XD5A 3VP1A 3HLGA 1FSYA 2Y91A 3BFFA 2C5WB 5FQJA 3OPLA 1CEFA 4OQGA 3PAGA 4YFMA 3WS2A 2P9VB 1LHYA 1G6AA 4GNUA 4X56A 4GB7A 1MKIA 5U47A 2V2FF 2XD1A 4XUZA 3Q7VB 1W79A 4E3MA 1W8YA 2WGWA 2XGNA 1H5XA 3PBOA 2IWDA 1ZKJA 3O88A 3ZDJA 3DW0A 3N8SA 2RL3A 1L0DA 1RP5A 1K56A 2ZC5B 1ZG4A 2EXBA 2OSUA 3C7UA 5AQAA 4B88A 5AQ7A 1DY6A 4BQMA 3HBRA 1NYMA 2Q9MA 1NY0A 4XUXA 4GD6A 4E3IA 3WRZA 2Y2MA 4GDBA 1JTGA 4KG6A 4BD0A 3MXRA 5KZHA 4MEZA 3OPRA 2XH9A 3P98A 5KMWA 2VGKA 3UN7A 5E43A 4PPRA 4KZ7A 3E2KA 3NBLA 3HLFA 2ZQCA 3QNCA 3PBTA 5DF8A 5GLAA 5FI2A 3GQZA 2WADA 4OVDA 1Y54A 5G18A 5DF9A 1H8YA 4FH4A 1IKGA 5E2FA 4DXBA 3SH8A 1TDGA 4NETA 1KE3A 3JYIA 4HESA 4C6YA 2QZ6A 1N9BA 3HLWA 4IBXA 5EVIA 2HP5A 3RJUA 2OLUA 3ZG8B 2ZM2A 1W7FA 3BM6A 1E25A 1ESUA 2B5RA 1KGGA 1HD8A 4UA9A 1L0GA 1FSWA 4LV0A 4WBGA 3FV7A 1QMEA 1BLHA 3M2JA 3VSKA 2J9PA 4DE2A 5FA7A 4EWFA 4S2PA 2XFSA 4KQOA 2IWCA 3BECA 1RGYA 4JF5A 5GHZA 1PWCA 4D2OA 3N7WA 2WYXA 2FFYA 3PBSA 1KDSA 1YM1A 2PU4A 4Y0UA 3GV9A 4ZJ1A 3UE1A 3MBZA 3IHAA 3UNWA 4UA6A 5FQQA 2J9OA 1K25A 3LEZA 4KZ4A 5TGFA 4KZAA 5CHJA 5HARA 3LCEA 4R4SA 2Y2PA 3MKEA 4ZBEA 2WKHA 2WGWB 2Y2GA 3TOIA 4EV4A 4QU3A 1ALQA 1KE4A 2H0TA 5IHVA 1BZAA 1SCWA 3BLMA 4X68A 1NXYA 3Q7VA 3AGEA 3ZVWA 4LCLA 3FYZA 4DF6A 2ZC4B 4R1GA 1K55A 1ES2A 4LENA 3W4PA 1LLBA 4K0XA 3OPHA 4MLLA 4MNRA 1YLTA 4WELA 3FKWA 1L0EA 3BFEA 3IT9A 5FDHA 3G34A 4E3LA 4JXGA 1MWTA 4HBTA 5TR7A 3FWLA 3M6HA 4DE1A 3BRMA 1M40A 3EQUA 4WMCD 3HREA 2EXAA 4O7DA 5FQMA 1ONGA 1GHPA 2R9XA 1IYPA 2XR0A 3WWXA 1KVMA 2VGJA 3DWKA 4BD1A 3B3XA 4KZ8A 4S2NC 2EX2A 4OOMA 1FQGA 1BTLA 1JTDA 1IKIA 3NI9A 3G32A 4MBFA 1ES4A 1XA1A 4R4RA 1DJAA 5M18A 2HDQA 4JLFA 3ZHHA 2ZQ8A 5GLCA 5M19A 5CHUA 4OQ0A 3VFHA 3OCLA 1OMEA 5DTSA 5F82A 3GRJA 1GHMA 5EOEA 4P6BA 4R3BA 1I2SA 5FQ9A 4DDYA 1YT4A 4QY6A 3PBRA 1EI5A 4WYYA 3V3RA 3CZDA 1IYQA 2G2UA 1BULA 4U0XA 1SDNA 2Y59A 1NZUA 2ZQ9A 2XFTA 1DJBA 3VMAA 5A91A 1E3UA 2Y4AA 1ZG6A 4OQIA 3VP0A 4H8RA 3W8KA 3SS3A 3ZG7B 4KZ6A 3V5MA 1VQQA 1K6RA 3HLBA 2JC7A 4GOGA 4ZDXA 4K91A 2OV5A 3A3FA 4FD8A 3Q82A 2EFUA 3I7JA 4OPYA 3SH9A 3G35A 5BOHA 5A93A 2QPNA 1MWSA 2BLSA 1NRFA 1I2WA 1MBLA 4Z9QA 5CTNA 4DRTA 4OONA 1PW1A 3C7VA 1KVLA 4ZTKA 3LY3A 1GHIA 1KDWA 4JF6A 3PBNA 1FOFA 1ZC2A 2J8YA 1PZPA 5EE8A 3HLDA 1XX2A 3NDGA 4GD8A 3S1YA 3IWQA 4L0LA 1BSGA 2V1ZA 3VOZA 1E4DA 2HDUA 3SOIA 3ZG9B 3NC8A 2Y2LA 1XKZA 1Z6FA 4KG5A 1YLPA 4X69A 4KQRA 1K56D 4N92A 1LI9A 4MBKA 4OOYA 1TDLA 3A3DA 4KQQA 2GDNA 3BEBA 4P85A 4PM7A 3MZDA 2WKIA 4ZAMA 3NDEA 5GLBA 5F83A 2WGVA 4KZBA 3E2LA 2HP9A 1JWZA 3DTMA 4OPRA 2EX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4O A;  1HTZ A;  3HUM A;  4S2N A;  2Z2M B;  4YIN A;  4QB8 A;  2Y2J A;  3WS5 A;  1G68 A;  1W8Q A;  2P74 A;  4OP5 A;  2WUQ A;  5TFQ A;  3N4I A;  3MZF A;  4E3J A;  2XF3 A;  3IQA A;  2Y2Q A;  2WZZ A;  4RX3 A;  3AGD A;  4B4Z A;  5E2H A;  3HUN A;  1YMS A;  2ZC7 A;  5CGS A;  3OPP A;  4KZ9 A;  4JKT A;  3M6B A;  3W4O A;  3W4Q A;  4C3Q A;  5CHM A;  5FAP A;  1IEM A;  3S22 A;  2PU2 A;  2XK1 A;  4KZ3 A;  2I72 A;  4FSF A;  5EVI D;  5FI6 A;  4OPQ A;  5GL9 A;  4NK3 A;  3PTE A;  3V39 A;  3Q07 A;  1BUE A;  4RVA A;  4BL2 A;  4UA7 A;  5E2G A;  3VP2 A;  1PIO A;  1WYC A;  2Y2O A;  2OLV A;  1CK3 A;  1HVB A;  2C6W B;  4WM9 A;  4OKP A;  5CER A;  4C75 A;  3G2Z A;  4OQH A;  1GCE A;  3VFF A;  3HL9 A;  3G31 A;  4PM5 A;  4LV1 A;  3UPP A;  4R3J A;  3OC2 A;  4LV2 A;  5FAO A;  2FFF B;  4MBH A;  5FI7 A;  2ZM0 A;  5D3O A;  3GR2 A;  1VM1 A;  4PM9 A;  2WAE A;  5EEC A;  1BLC A;  3ZCZ A;  1L0F A;  5HAQ A;  1H8Z A;  2QMI A;  3NY4 A;  3N6I A;  4B4X A;  3CJM A;  2XDM A;  2PBY A;  4S2L A;  4WZ5 C;  3ISG A;  4OP8 A;  4R23 A;  1NJ4 A;  2WGI A;  4OOL A;  4WZ4 A;  4X55 A;  4WEJ A;  3IF6 C;  2RCX A;  3WRT A;  2XLN A;  1SHV A;  3ZNY A;  2JBF A;  1C3B A;  2X02 A;  2ZLY A;  4IVI A;  3IF6 B;  1ERQ A;  3GVB A;  2J7V A;  1O07 A;  3VOY A;  1ES3 A;  1WE4 A;  2HDR A;  5KSC A;  1QMF A;  2ZMA A;  4PMA A;  2ZC6 B;  4OPZ A;  1NYY A;  1PZO A;  4GZB A;  1IEL A;  4P0M A;  2EFX A;  5DVA A;  5M1A A;  4FCF A;  3MXS A;  1ERO A;  4K0W A;  1MWR A;  3C5A A;  4DE3 A;  1AXB A;  1MXO A;  2WAF A;  3CMZ A;  4DXC A;  5GHX A;  2UWX A;  1K38 A;  3ITA A;  4M3K A;  2HPB A;  1WYB A;  1K6S A;  1KGE A;  3UDX A;  3HLE A;  4IBR A;  4OLG A;  2Y2I A;  4BJP A;  3UPO A;  3M2K A;  4JXW A;  2BG1 A;  2CC1 A;  1K57 C;  4E6W A;  5CED A;  1FR6 A;  2DCF A;  3Q1F A;  4E6X A;  3EQV A;  3WS4 A;  4ID4 A;  3VSL A;  3TSG A;  1CI8 A;  1PWG A;  3NCK A;  3QNB A;  4Y0O A;  2HP6 A;  3IH9 A;  2H5S A;  3A3J A;  1YLZ A;  3BFG A;  3C4P A;  5DTT A;  5E2E A;  4ZJ3 A;  4BEN A;  2DNS A;  4S2J A;  3UE0 A;  2ZD8 A;  4RYE A;  3O87 A;  4PM8 A;  2Y2H A;  2ZC3 B;  1E3U D;  1XA7 A;  3N8R A;  2WKE A;  1LL5 A;  1W5D A;  2X71 A;  1PYY A;  2Z2L B;  1S0W A;  1ONH A;  4E3O A;  5JYO A;  1HZO A;  2EX8 A;  2ZM8 A;  3IXG A;  1Q2Q A;  1LI0 A;  3RXW A;  3GMW A;  4U0T A;  2HDS A;  4GN2 A;  3ITB A;  4N1H A;  1K55 C;  1FCO A;  2JE5 A;  1PWD A;  3O3V A;  5FQK A;  3UDI A;  1NZO A;  1YMX A;  4N9L A;  5CEC A;  5CTM A;  4P87 A;  1J9M A;  4S2I A;  3WS0 A;  4Y0T A;  5A92 A;  4WZ5 A;  1YLJ A;  4BL3 A;  1JWP A;  5CGX A;  3MZE A;  4QY5 A;  5CGW A;  4HBU A;  5FQI A;  1SDE A;  1XPB A;  3BYD A;  3IF6 A;  4X6T A;  2ZQ7 A;  3ZNT A;  2ZJ9 A;  1ERM A;  4Y7P A;  5FAS A;  5HFO A;  1FCM A;  3HLC A;  4X53 A;  2WK0 A;  5GHY A;  3ZG5 A;  4FH2 A;  3UDF A;  2EX9 A;  3P09 A;  1M6K A;  2A3U A;  1PW8 A;  3IWO A;  1MWU A;  4RX2 A;  5AQ9 A;  5CXW A;  4OH0 A;  1JWV A;  1N4O A;  5HW3 A;  4GKU A;  3S4X A;  4IVK A;  3QHY A;  4BLM A;  2IWB A;  4UHU A;  3SS5 A;  3NIA A;  1BT5 A;  4S2O A;  1FR1 A;  1LL9 A;  4DE0 A;  3LY4 A;  2H0Y A;  5A90 A;  3CG5 A;  1K54 C;  1O7E A;  3DWZ A;  1MPL A;  3HVF A;  4QD4 A;  3VP3 A;  1K57 A;  4KEN B;  2DRW A;  3UO9 A;  4JXS A;  1JVJ A;  2XQZ A;  3ZFZ A;  4UAA A;  2JCH A;  4JXV A;  1KGF A;  1S6R A;  2Y2N A;  5EOO A;  3VP4 A;  3BLS A;  3IXB A;  5F1G A;  4EBP A;  1XP4 A;  3N8L A;  3FZC A;  3BFC A;  3IXD A;  3IH8 A;  5DF7 A;  1K4F A;  3UY6 A;  4R0Q A;  3TG9 A;  5L2F A;  1YLY A;  1Q2P A;  3OCN A;  3ZG0 A;  1TVF A;  1IYO A;  4KG2 A;  1U60 A;  3MFD A;  2V20 A;  3UPN A;  4DDS A;  5KSH A;  1ES5 A;  2P9V A;  2ZQA A;  5FAQ A;  3WS1 A;  3MKF A;  4LCM A;  3O86 A;  5EUA A;  5HX9 A;  1K4E A;  3ZGA B;  4F94 A;  2XEP A;  3HUO A;  5I94 A;  3AGF A;  5HL1 A;  3IF5 A;  3IWI A;  1SKF A;  4WMC A;  4U3T A;  4E3K A;  4A5R A;  3GSG A;  1GA9 A;  2Q9N A;  4QHC A;  4RA7 A;  5GLD A;  1XGJ A;  2R9W A;  4EUZ A;  1KE0 A;  1FCN A;  2Y2K A;  5EVL A;  3PBQ A;  5EPH A;  3IXH A;  3OZH A;  3A3I A;  1RCJ A;  4N9K A;  5JYP A;  3SS4 A;  3BFD A;  4LV3 A;  1MY8 A;  3UE3 A;  1I5Q A;  2E8I A;  1PI5 A;  3PAE A;  3ZVT A;  3RXX A;  1L2S A;  3G30 A;  4Q8I A;  5FSR A;  4EQI A;  4GDN A;  2ZQD A;  3D4F A;  4WEK A;  2A49 A;  1CEG A;  4S2K A;  3LO7 A;  1YQS A;  5DTK A;  3IHB A;  4CJN A;  1XGI A;  4XXR A;  1RGZ A;  5HAP A;  5F1F A;  4HEF A;  4S2M A;  1ESI A;  4JBF A;  1TEM A;  5HAI A;  5AQB A;  5EVI C;  1YLW A;  4ZJ2 A;  4N1X A;  4QJG A;  2G2W A;  5EVI B;  4EBN A;  4KZ5 A;  4E3N A;  1BLS A;  2Y55 A;  5FAT A;  4EBL A;  3V3S A;  1BLP A;  4OLD A;  3SH7 A;  1IYS A;  3FKV A;  5J8X A;  3G2Y A;  1GA0 A;  3G4P A;  4CPK A;  4JF4 A;  1PI4 A;  3Q81 A;  4JPM A;  3A3E A;  2X01 A;  5CRF A;  1K54 A;  5CEB A;  1CI9 A;  1EWZ A;  3Q7Z A;  4PM6 A;  1XXM A;  2H10 A;  2WZX A;  4IED A;  3V50 A;  4DKI A;  1DJC A;  3GTC A;  2XD5 A;  3VP1 A;  3HLG A;  1FSY A;  2Y91 A;  3BFF A;  2C5W B;  5FQJ A;  3OPL A;  1CEF A;  4OQG A;  3PAG A;  4YFM A;  3WS2 A;  2P9V B;  1LHY A;  1G6A A;  4GNU A;  4X56 A;  4GB7 A;  1MKI A;  5U47 A;  2V2F F;  2XD1 A;  4XUZ A;  3Q7V B;  1W79 A;  4E3M A;  1W8Y A;  2WGW A;  2XGN A;  1H5X A;  3PBO A;  2IWD A;  1ZKJ A;  3O88 A;  3ZDJ A;  3DW0 A;  3N8S A;  2RL3 A;  1L0D A;  1RP5 A;  1K56 A;  2ZC5 B;  1ZG4 A;  2EXB A;  2OSU A;  3C7U A;  5AQA A;  4B88 A;  5AQ7 A;  1DY6 A;  4BQM A;  3HBR A;  1NYM A;  2Q9M A;  1NY0 A;  4XUX A;  4GD6 A;  4E3I A;  3WRZ A;  2Y2M A;  4GDB A;  1JTG A;  4KG6 A;  4BD0 A;  3MXR A;  5KZH A;  4MEZ A;  3OPR A;  2XH9 A;  3P98 A;  5KMW A;  2VGK A;  3UN7 A;  5E43 A;  4PPR A;  4KZ7 A;  3E2K A;  3NBL A;  3HLF A;  2ZQC A;  3QNC A;  3PBT A;  5DF8 A;  5GLA A;  5FI2 A;  3GQZ A;  2WAD A;  4OVD A;  1Y54 A;  5G18 A;  5DF9 A;  1H8Y A;  4FH4 A;  1IKG A;  5E2F A;  4DXB A;  3SH8 A;  1TDG A;  4NET A;  1KE3 A;  3JYI A;  4HES A;  4C6Y A;  2QZ6 A;  1N9B A;  3HLW A;  4IBX A;  5EVI A;  2HP5 A;  3RJU A;  2OLU A;  3ZG8 B;  2ZM2 A;  1W7F A;  3BM6 A;  1E25 A;  1ESU A;  2B5R A;  1KGG A;  1HD8 A;  4UA9 A;  1L0G A;  1FSW A;  4LV0 A;  4WBG A;  3FV7 A;  1QME A;  1BLH A;  3M2J A;  3VSK A;  2J9P A;  4DE2 A;  5FA7 A;  4EWF A;  4S2P A;  2XFS A;  4KQO A;  2IWC A;  3BEC A;  1RGY A;  4JF5 A;  5GHZ A;  1PWC A;  4D2O A;  3N7W A;  2WYX A;  2FFY A;  3PBS A;  1KDS A;  1YM1 A;  2PU4 A;  4Y0U A;  3GV9 A;  4ZJ1 A;  3UE1 A;  3MBZ A;  3IHA A;  3UNW A;  4UA6 A;  5FQQ A;  2J9O A;  1K25 A;  3LEZ A;  4KZ4 A;  5TGF A;  4KZA A;  5CHJ A;  5HAR A;  3LCE A;  4R4S A;  2Y2P A;  3MKE A;  4ZBE A;  2WKH A;  2WGW B;  2Y2G A;  3TOI A;  4EV4 A;  4QU3 A;  1ALQ A;  1KE4 A;  2H0T A;  5IHV A;  1BZA A;  1SCW A;  3BLM A;  4X68 A;  1NXY A;  3Q7V A;  3AGE A;  3ZVW A;  4LCL A;  3FYZ A;  4DF6 A;  2ZC4 B;  4R1G A;  1K55 A;  1ES2 A;  4LEN A;  3W4P A;  1LLB A;  4K0X A;  3OPH A;  4MLL A;  4MNR A;  1YLT A;  4WEL A;  3FKW A;  1L0E A;  3BFE A;  3IT9 A;  5FDH A;  3G34 A;  4E3L A;  4JXG A;  1MWT A;  4HBT A;  5TR7 A;  3FWL A;  3M6H A;  4DE1 A;  3BRM A;  1M40 A;  3EQU A;  4WMC D;  3HRE A;  2EXA A;  4O7D A;  5FQM A;  1ONG A;  1GHP A;  2R9X A;  1IYP A;  2XR0 A;  3WWX A;  1KVM A;  2VGJ A;  3DWK A;  4BD1 A;  3B3X A;  4KZ8 A;  4S2N C;  2EX2 A;  4OOM A;  1FQG A;  1BTL A;  1JTD A;  1IKI A;  3NI9 A;  3G32 A;  4MBF A;  1ES4 A;  1XA1 A;  4R4R A;  1DJA A;  5M18 A;  2HDQ A;  4JLF A;  3ZHH A;  2ZQ8 A;  5GLC A;  5M19 A;  5CHU A;  4OQ0 A;  3VFH A;  3OCL A;  1OME A;  5DTS A;  5F82 A;  3GRJ A;  1GHM A;  5EOE A;  4P6B A;  4R3B A;  1I2S A;  5FQ9 A;  4DDY A;  1YT4 A;  4QY6 A;  3PBR A;  1EI5 A;  4WYY A;  3V3R A;  3CZD A;  1IYQ A;  2G2U A;  1BUL A;  4U0X A;  1SDN A;  2Y59 A;  1NZU A;  2ZQ9 A;  2XFT A;  1DJB A;  3VMA A;  5A91 A;  1E3U A;  2Y4A A;  1ZG6 A;  4OQI A;  3VP0 A;  4H8R A;  3W8K A;  3SS3 A;  3ZG7 B;  4KZ6 A;  3V5M A;  1VQQ A;  1K6R A;  3HLB A;  2JC7 A;  4GOG A;  4ZDX A;  4K91 A;  2OV5 A;  3A3F A;  4FD8 A;  3Q82 A;  2EFU A;  3I7J A;  4OPY A;  3SH9 A;  3G35 A;  5BOH A;  5A93 A;  2QPN A;  1MWS A;  2BLS A;  1NRF A;  1I2W A;  1MBL A;  4Z9Q A;  5CTN A;  4DRT A;  4OON A;  1PW1 A;  3C7V A;  1KVL A;  4ZTK A;  3LY3 A;  1GHI A;  1KDW A;  4JF6 A;  3PBN A;  1FOF A;  1ZC2 A;  2J8Y A;  1PZP A;  5EE8 A;  3HLD A;  1XX2 A;  3NDG A;  4GD8 A;  3S1Y A;  3IWQ A;  4L0L A;  1BSG A;  2V1Z A;  3VOZ A;  1E4D A;  2HDU A;  3SOI A;  3ZG9 B;  3NC8 A;  2Y2L A;  1XKZ A;  1Z6F A;  4KG5 A;  1YLP A;  4X69 A;  4KQR A;  1K56 D;  4N92 A;  1LI9 A;  4MBK A;  4OOY A;  1TDL A;  3A3D A;  4KQQ A;  2GDN A;  3BEB A;  4P85 A;  4PM7 A;  3MZD A;  2WKI A;  4ZAM A;  3NDE A;  5GLB A;  5F83 A;  2WGV A;  4KZB A;  3E2L A;  2HP9 A;  1JWZ A;  3DTM A;  4OPR A;  2EX6 A; 
#chains in the Genus database with same CATH topology
 2EA9 A;  4S2N A;  4QB8 A;  3C38 A;  1W8Q A;  4OP5 A;  1LSX A;  4CQH A;  2WUQ A;  1PFL A;  2XF3 A;  3IQA A;  3AGD A;  5E2H A;  5KIZ A;  2ZC7 A;  3OPP A;  4JKT A;  3W4Q A;  5FI6 A;  2XK1 A;  4NK3 A;  3T4S A;  4NXF A;  5E2G A;  4DN0 A;  4HH2 A;  4OKP A;  3G2Z A;  3OOV A;  3HJI A;  4OQH A;  1GCE A;  1UWN X;  3OC2 A;  4XT2 A;  5FI7 A;  1BLC A;  3ZCZ A;  1OTI A;  4OP8 A;  1XFN A;  5K5B A;  5L10 A;  1OTE A;  4WEJ A;  2PR6 A;  2RCX A;  1SHV A;  3IF6 B;  2QJ7 A;  1O07 A;  3FC7 A;  4EQ1 A;  1ES3 A;  1IEL A;  5HZH A;  5DVA A;  4K0W A;  1MWR A;  3MF0 A;  1AXB A;  2WAF A;  2UWX A;  3VOL A;  3ITA A;  4M3K A;  2HPB A;  3HLE A;  4OLG A;  4L9G A;  5CED A;  4E6X A;  3KSI A;  3EQV A;  4ID4 A;  1PWG A;  3TRC A;  5E2E A;  5DTT A;  1YLZ A;  2PRF A;  4BEN A;  3SZT A;  2ZD8 A;  4RYE A;  2ZC3 B;  3N8R A;  2WKE A;  2X71 A;  4EER A;  2EX8 A;  2FH5 A;  3GMW A;  3S7P A;  3ITB A;  3PXP A;  3CUE C;  1K55 C;  4ETX A;  3O3V A;  2I9V A;  4N9L A;  3H82 B;  1J9M A;  3WS0 A;  4WZ5 A;  1YLJ A;  4BL3 A;  1TS0 A;  4QY5 A;  2ZMV A;  1XPB A;  4X6T A;  5EVE A;  2ZQ7 A;  1Y28 A;  2EWW A;  5F5Y A;  4X53 A;  5GHY A;  5TBM B;  4PAU A;  3C2W A;  4FH2 A;  3LIE A;  2EX9 A;  1M6K A;  3UB7 A;  5AQ9 A;  2OOL A;  5CXW A;  1WA9 A;  1N4O A;  5HW3 A;  2IWB A;  3UB8 A;  4Y3I A;  4DE0 A;  4I3J A;  3T1X A;  2PDR A;  4QD4 A;  1MPL A;  4Y15 A;  3UO9 A;  3UB9 A;  1S6R A;  5EOO A;  3BLS A;  3KSF A;  3N8L A;  3BFC A;  3UY6 A;  4QWO A;  4R0Q A;  1Q2P A;  2HF6 A;  1TVF A;  3MFD A;  2V20 A;  1K4E A;  3ZGA B;  4F94 A;  1G5U A;  3AGF A;  3IF5 A;  2VEA A;  4Y13 A;  4WMC A;  4U3T A;  3HCY A;  2KX6 A;  2Q9N A;  1VEU A;  3S7Q A;  4H6J B;  1BYW A;  2V0U A;  1Z09 A;  1YSP A;  3BWL A;  1S66 L;  5HD5 A;  4LV3 A;  1I5Q A;  4LPZ A;  3F1N A;  4DJ2 A;  1PI5 A;  2XA7 S;  5AVE A;  1X0O A;  3LO7 A;  3QP8 A;  3IHB A;  4O01 A;  4CJN A;  1XJ3 A;  3SW1 A;  5HAP A;  2QKP A;  4JBF A;  2W3H A;  5HAI A;  4AFI A;  5FEF A;  4KZ5 A;  1TD5 A;  5DFX A;  1AWI A;  4EBL A;  2VA0 A;  5J8X A;  3G2Y A;  1YPR A;  3G4P A;  1PI4 A;  2X01 A;  1CI9 A;  1D06 A;  3PYP A;  4HOI A;  3DTE A;  3Q7Z A;  4PM6 A;  2WZX A;  4IED A;  1DJC A;  3HLG A;  2Y91 A;  3BFF A;  3VE3 A;  3OPL A;  1CEF A;  4X56 A;  4KUO A;  3UB5 P;  3Q7V B;  4E3M A;  3PBO A;  4HY8 A;  2WKP A;  3O88 A;  3ZYT A;  3CAX A;  3R7W B;  1RP5 A;  4NG2 A;  1K56 A;  2ZC5 B;  1H3Q A;  2EXB A;  3C7U A;  5AVF A;  5AQ7 A;  4BQM A;  4JGO A;  2Q9M A;  4BD0 A;  3MXR A;  2W1T B;  1SKO A;  2VGK A;  4PPR A;  3E2K A;  5GLA A;  5L09 A;  4O0P A;  4WL9 A;  5G18 A;  3MXQ A;  4NXB A;  1N9N A;  2H28 A;  4NET A;  3JYI A;  1A0K A;  4HES A;  4RQ9 A;  2QZ6 A;  4WUJ A;  3LEQ A;  5EVI A;  2ZM2 A;  1W7F A;  4CLC D;  1GSW A;  3VSK A;  4WF0 A;  1UWP X;  5EM1 A;  4JF5 A;  2WYX A;  2PU4 A;  1YM1 A;  2NUP C;  3IHA A;  5HWW A;  4KZA A;  4EEU A;  5CHJ A;  3LCE A;  1NRJ A;  2WGW B;  2Y2G A;  4EV4 A;  1SCW A;  2K7S A;  1N9O A;  3ZVW A;  3B42 A;  1K55 A;  2HJ9 C;  3W4P A;  4MLL A;  4Q0H A;  3BFE A;  3G34 A;  2VZW A;  3FWL A;  4DE1 A;  3EQU A;  1M40 A;  3HRE A;  2EXA A;  2R9X A;  2XR0 A;  1KVM A;  2VGJ A;  3ZQ5 A;  4S2N C;  3JVU A;  3CIT A;  3CPT B;  1IKI A;  4BBV A;  4M4X A;  1ZTU A;  1ES4 A;  2WKQ A;  3ZHH A;  2A24 B;  5CHU A;  2VJW A;  4OQ0 A;  3LIB A;  3IX4 A;  5F82 A;  5EOE A;  2VGL S;  4BBU A;  1T1C A;  3V3R A;  2G2U A;  1BUL A;  1DP6 A;  4U0X A;  1SDN A;  3EGX C;  2Y59 A;  4LRZ E;  1E3U A;  4OQI A;  4H8R A;  3W8K A;  1VQQ A;  1K6R A;  4GOG A;  3S7N A;  4ZDX A;  3LR5 A;  3I7J A;  2QPN A;  5HD3 A;  1MBL A;  4Z9Q A;  5HSQ A;  1PW1 A;  1GHI A;  1KDW A;  3PBN A;  1FOF A;  2XA7 M;  1XX2 A;  1H0M A;  1SZV A;  2VV8 A;  1EW0 A;  1YLP A;  4KQR A;  1LI9 A;  4MBK A;  5C5K A;  3BEB A;  3MZD A;  2WKI A;  4ZAM A;  3TW8 A;  1OJ5 A;  3DTM A;  3L9K A;  4PKY G;  3W2Z A;  2Z2M B;  1J3W A;  4WLA A;  2Y2Q A;  1OTA A;  1OT9 A;  1LSV A;  1F2K A;  2JKR M;  1YMS A;  5CGS A;  4KZ9 A;  5DFY A;  1IEM A;  3L7H A;  3GDI A;  2PU2 A;  1D1J A;  4FSF A;  3F1O B;  3PTE A;  1PNE A;  2KLI A;  2Y2O A;  4BWI A;  2OLV A;  1CK3 A;  1HVB A;  2C6W B;  3H7W A;  3IBJ A;  1G28 A;  3BJN A;  3HL9 A;  3C8C A;  3G31 A;  2PAV P;  4PM5 A;  4MBH A;  5J4E A;  4DJ3 A;  3GR2 A;  5HAQ A;  3CJM A;  4WZ5 C;  2Y8H A;  4R23 A;  1NJ4 A;  2WGI A;  4OOL A;  4HJ4 A;  2ACG A;  2XLN A;  3ZNY A;  1C3B A;  3MS6 A;  5EV0 A;  3IBR A;  4I3A A;  2ZMA A;  4GZB A;  4LGW A;  5M1A A;  4CLC B;  1MXO A;  2O99 A;  5HWV A;  1V9Y A;  4BJP A;  3UPO A;  2BG1 A;  2CC1 A;  2DCF A;  3WS4 A;  3MQ0 A;  2LB9 A;  4KUK A;  1CI8 A;  2HP6 A;  4ZJ3 A;  2H5S A;  3A3J A;  2DNS A;  1P0Z A;  3UE0 A;  5HPI A;  4X1M A;  1LL5 A;  3F1P B;  5JYO A;  3V67 A;  1HZO A;  3MR0 A;  1Q2Q A;  2HDS A;  4N1H A;  1FCO A;  3EWK A;  1VHM A;  2OAQ 1;  1P9W A;  1YMX A;  5F6A A;  5CEC A;  2VX8 A;  4P87 A;  4Q0I A;  4G3V A;  2ZJ9 A;  2VGL M;  2PHY A;  4Y7P A;  3KO6 A;  5HFO A;  1LL8 A;  2PBD P;  3HLC A;  3B47 A;  2WK0 A;  5IU1 A;  2HGV A;  3CI6 A;  3A0R A;  3UDF A;  3T1R A;  2GX5 A;  2ZMF A;  2W3F A;  1W63 M;  2O9C A;  5J3W A;  4UHU A;  3SS5 A;  2P7J A;  1BT5 A;  3TE8 A;  3A0V A;  2E8J A;  3KYZ A;  2UV0 E;  3DWZ A;  4LRX C;  3NJA A;  4KEN B;  2DRW A;  2JCH A;  4JXV A;  2Y2N A;  3IXB A;  4HI4 A;  4D60 A;  4EBP A;  1XP4 A;  3FPV A;  3IXD A;  3IH8 A;  5HDD A;  2VV7 A;  2R78 A;  3ZG0 A;  1IYO A;  3T4O A;  3NOT C;  4KG2 A;  4DDS A;  1ES5 A;  4LCM A;  3NUL A;  3HUO A;  2V8C A;  3IWI A;  1SKF A;  4II7 A;  2XRN A;  1CQA A;  1GA9 A;  4QHC A;  1XGJ A;  4HIA A;  4UQI M;  4YWZ A;  3R7W A;  5EVL A;  5EPH A;  3IXH A;  3OZH A;  4HP4 A;  2D02 A;  3E0Y A;  5JYP A;  5IS1 A;  3RXX A;  5FSR A;  4EQI A;  2PYP A;  4S2K A;  5DTK A;  1F98 A;  3KX0 X;  3RH8 B;  5HDS A;  1ESI A;  5AQB A;  5EVI C;  4JGQ A;  2PR5 A;  1F9I A;  3MJQ A;  2W0N A;  4HNB A;  1BLP A;  3KYQ A;  4OLD A;  4MDZ A;  4JF4 A;  1DP9 A;  4JPM A;  5CRF A;  1K54 A;  5CEB A;  3LID A;  4HH3 A;  4GS9 A;  1XXM A;  2H10 A;  1LSW A;  4DKI A;  3GTC A;  3VP1 A;  3G6O A;  3FG8 A;  4YFM A;  3WS2 A;  2P9V B;  1LHY A;  1G6A A;  2VV6 A;  3LI9 A;  4GNU A;  5U47 A;  2XD1 A;  3A0S A;  1L3L A;  1W79 A;  3E4O A;  4F3L A;  1W8Y A;  2WGW A;  1H5X A;  5EM0 A;  1ZG4 A;  4ARZ B;  1XJ6 A;  4B88 A;  4HQA A;  3LIF A;  1YAX A;  3HBR A;  1NYM A;  4E3I A;  4KG6 A;  4MEZ A;  3OPR A;  3P98 A;  4GJ4 A;  5KMW A;  2L0W A;  3HLF A;  1ACF A;  2JKT M;  5DF8 A;  1ODV A;  1Y54 A;  2KDK A;  1LT0 A;  4O8G A;  1IKG A;  5E2F A;  4DXB A;  3SH8 A;  3HLW A;  5FL3 A;  5CX7 A;  2HP5 A;  3ZG8 B;  3RJU A;  1ESU A;  1FSW A;  4LV0 A;  5IT5 A;  1QME A;  2J9P A;  3EEH A;  5FA7 A;  2AVX A;  1PWC A;  4C75 A;  2FFY A;  3GV9 A;  3MBZ A;  4UA6 A;  2J9O A;  4KZ4 A;  2D01 A;  4R4S A;  4QU3 A;  1ALQ A;  1KE4 A;  2VKS A;  3BLM A;  4LCL A;  2M1C A;  4DF6 A;  3T4T A;  1ES2 A;  3UME A;  1LLB A;  4K0X A;  4MNR A;  1JNU A;  3B33 A;  4WEL A;  3C30 A;  5FDH A;  3LGO A;  4HBT A;  5TR7 A;  4WMC D;  2J3T C;  4O7D A;  1GHP A;  3DWK A;  3QP4 A;  4OOM A;  4NXE A;  1BTL A;  1JTD A;  4IHQ A;  3G32 A;  4R4R A;  5M18 A;  3U2A A;  5M19 A;  3VFH A;  5FQ9 A;  4DDY A;  1OTB A;  1YT4 A;  4QY6 A;  1IFQ A;  1DJB A;  4K08 A;  5DKL A;  5A91 A;  5F68 A;  3ZG7 B;  1G6O A;  4KZ6 A;  3G35 A;  1MWS A;  1NRF A;  3U4L P;  5CTN A;  3LR4 A;  4DRT A;  4OON A;  4LRY C;  1KVL A;  4JF6 A;  4XT2 B;  2JN7 A;  2QJ5 A;  2V1Z A;  3VOZ A;  1TF1 A;  3NC8 A;  3P7N A;  1K56 D;  4OOY A;  1TDL A;  3A3D A;  4P85 A;  2GDN A;  4PM7 A;  2M7V A;  3NDE A;  4X1L A;  2WGV A;  3E2L A;  4YOF A;  1JWZ A;  1HTZ A;  3HUM A;  4GHI B;  4YIN A;  1G68 A;  3MFX A;  3MZF A;  4E3J A;  2WZZ A;  4MN6 A;  2V1A A;  3HUN A;  3M6B A;  4C3Q A;  5CHM A;  5FAP A;  3S22 A;  5EVI D;  2I72 A;  2PT7 A;  4OPQ A;  1PRQ A;  3Q07 A;  1BUE A;  2MJ6 A;  3EGD C;  3NEC A;  1PIO A;  5L8M A;  2YKF A;  5CER A;  2GNX A;  1S4S A;  3MQO A;  4LV1 A;  3UPP A;  3QP2 A;  4R3J A;  4LV2 A;  2ZM0 A;  2ZOH A;  3BQ8 A;  4GCZ A;  1L0F A;  3FPW A;  3IS2 B;  3NY4 A;  3N6I A;  4B4X A;  3BQA A;  2PBY A;  4X55 A;  3WRT A;  2ZLY A;  4NXG A;  3T12 B;  1MC0 A;  3GVB A;  1WE4 A;  5KSC A;  5DJT A;  4PMA A;  4R3A A;  4OPZ A;  1PZO A;  4P0M A;  2EFX A;  2W27 A;  2W3G A;  4FCF A;  2OAP 1;  1ERO A;  3CMZ A;  2O9A A;  1WYB A;  1K6S A;  1NLY A;  5AJG A;  4JXW A;  2V1B A;  1FR6 A;  3Q1F A;  3TSG A;  3NCK A;  1OJG A;  3BFG A;  3LFV A;  2A2L A;  4S2J A;  4BMW A;  4JGR A;  4HJ3 A;  3O87 A;  4PM8 A;  4HHD A;  2Y2H A;  1E3U D;  1S1Y A;  4MN5 A;  1W5D A;  1PYY A;  2Z2L B;  1ONH A;  2GJ3 A;  2ZM8 A;  4R6L A;  3IXG A;  1XFQ A;  1LI0 A;  2V8F A;  3CLO A;  4GN2 A;  4R38 A;  2JE5 A;  1PWD A;  3UDI A;  1GSV A;  1VEU B;  4Q0J A;  1S1Z A;  3QP1 A;  2ZBB A;  1JWP A;  5CGX A;  3D9Y A;  5CGW A;  3F1N B;  4LLO B;  4HBU A;  5FQI A;  1SDE A;  3IF6 A;  5FAS A;  1ERM A;  1FCM A;  3ZG5 A;  2IA2 A;  2J3T D;  3P09 A;  4IUH A;  1PW8 A;  3UE6 A;  4OH0 A;  1JWV A;  3BY8 A;  3S4X A;  4IVK A;  3QHY A;  4BLM A;  3NIA A;  4FTX A;  3TJZ C;  5FEG A;  4HP9 A;  1LL9 A;  3T4K A;  1N9L A;  2H0Y A;  1K54 C;  1O7E A;  3VP3 A;  3HVF A;  1K57 A;  3RFB A;  3H9W A;  5DKK A;  1JVJ A;  3ZFZ A;  1KGF A;  3VP4 A;  3FZC A;  5L2F A;  1YLY A;  1U60 A;  2P9V A;  2EWV A;  2ZQA A;  3MKF A;  3O86 A;  4G3K A;  2ZL1 B;  5HX9 A;  4P6Z S;  3MQQ A;  4A5R A;  4RA7 A;  4EUZ A;  1FCN A;  4BBT A;  3H82 A;  3PBQ A;  4N9K A;  2CMN A;  1RCJ A;  3A3I A;  4ARZ A;  3SS4 A;  4IJG A;  2B18 A;  1SKO B;  2QWS A;  4GDN A;  2ZQD A;  3D4F A;  2A49 A;  1CEG A;  2P04 A;  5TBM A;  4XXR A;  1RGZ A;  5HDC A;  2JKG A;  5F1F A;  4HEF A;  1STZ A;  3KSG A;  2O9B A;  3NOU C;  2VK3 A;  4ZJ2 A;  4N1X A;  2G2W A;  5EVI B;  4E3N A;  2M7U A;  2ZOI A;  3V3S A;  3SH7 A;  3FKV A;  1DRM A;  3Q81 A;  3A3E A;  4JGP A;  1GSX A;  4Y2F A;  3DTI A;  1FSY A;  2C5W B;  1OPX A;  3PAG A;  2L1M A;  5DJU A;  2NUT C;  4EEP A;  2V2F F;  5EFW A;  2IWD A;  3K3C A;  3ZDJ A;  3N8S A;  2RL3 A;  4EU0 A;  1L0D A;  3VE4 A;  5AQA A;  1DY6 A;  4H6J A;  1VET B;  4ETZ A;  4XUX A;  4GD6 A;  2Y2M A;  4GDB A;  1JTG A;  3UB6 A;  2XH9 A;  3UN7 A;  5E43 A;  4KZ7 A;  3NBL A;  3QNC A;  1S67 L;  1H8M A;  2WAD A;  4UEY A;  1TDG A;  3T1Q B;  1T18 A;  3RTY A;  4IBX A;  3JPU A;  3E98 A;  2OLU A;  3BM6 A;  3PHY A;  4UA9 A;  1KGG A;  1HD8 A;  1L0G A;  2HV1 A;  4EWF A;  4S2P A;  5HL6 A;  2IWC A;  3BEC A;  1RGY A;  1TS6 A;  4X25 A;  5GHZ A;  5G4Y A;  3N7W A;  3UNW A;  4Y0U A;  3LEZ A;  5TGF A;  2QHK A;  2HJE A;  2WKH A;  3CHW P;  2H0T A;  1BZA A;  4X68 A;  3Q7V A;  3K3D A;  2PD7 A;  3FYZ A;  3K2N A;  2ZC4 B;  3OPH A;  1YLT A;  3IT9 A;  4E3L A;  2QYB A;  4I38 A;  1MWT A;  3M6H A;  3BRM A;  4WN5 A;  2W1T A;  3LR0 A;  3B3X A;  4KZ8 A;  3VV4 A;  2EX2 A;  1FQG A;  1P97 A;  3NI9 A;  4MBF A;  1XA1 A;  3LI8 A;  1DJA A;  2J80 A;  2HDQ A;  4JLF A;  2ZQ8 A;  4MMN A;  5GLC A;  4DMZ A;  4GHI A;  3OCL A;  1OME A;  5DTS A;  4CLC C;  4P6B A;  1EI5 A;  3MMH A;  4WYY A;  3CZD A;  3PR6 A;  1IYQ A;  1DP8 A;  1NZU A;  2ZQ9 A;  2XFT A;  3VMA A;  4IUK A;  3LR3 A;  2OWJ A;  1ZG6 A;  3VP0 A;  3SS3 A;  4P6Z M;  4Z1W A;  3A3F A;  3H7W B;  3Q82 A;  2EFU A;  4OPY A;  3LIC A;  4G3W A;  5BOH A;  4YNR A;  3QP6 A;  1I2W A;  4ZTK A;  3LY3 A;  1ZC2 A;  2VLG A;  1PZP A;  5EE8 A;  3HLD A;  3NDG A;  3S1Y A;  4E04 A;  3IWQ A;  2YKH A;  2HDU A;  3ZG9 B;  5J7E A;  2Y2L A;  5HWT A;  1Z6F A;  4KG5 A;  3NOP C;  2XRO A;  3IS2 A;  4KQQ A;  4I39 A;  5GLB A;  2HP9 A;  3C4O A;  3CPT A;  2Y2J A;  3WS5 A;  2P74 A;  1XJ4 A;  2A24 A;  5TFQ A;  3N4I A;  4KQD A;  1MKM A;  4FOF A;  4RX3 A;  4B4Z A;  3E4Q A;  3JVV A;  3W4O A;  5TJJ A;  3T4Q A;  3T4L A;  2JKF A;  4KZ3 A;  2L4R A;  5GL9 A;  3V39 A;  2OWH A;  4RVA A;  4BL2 A;  4UA7 A;  3VP2 A;  2INW A;  1WYC A;  3HJK A;  4WM9 A;  1T1B A;  3VFF A;  5FAO A;  1S4R A;  2FFF B;  5LBR A;  5D3O A;  1VM1 A;  4PM9 A;  2WAE A;  5EEC A;  2LB5 A;  3LUQ A;  4I3I A;  1CF0 A;  1H8Z A;  2QMI A;  2XDM A;  3OLO A;  4S2L A;  4EXO A;  3ISG A;  1OT6 A;  2W1R A;  4WZ4 A;  3LIA A;  3IF6 C;  2JBF A;  2X02 A;  4IVI A;  4L9F A;  1ERQ A;  2HZ5 A;  2J7V A;  3VOY A;  2HDR A;  3P01 A;  1QMF A;  2ZC6 B;  1KOU A;  1NYY A;  4EES A;  3MXS A;  4DE3 A;  4DXC A;  3C5A A;  5GHX A;  1K38 A;  1KGE A;  1VB6 A;  3UDX A;  4IBR A;  2Y2I A;  3M2K A;  1K57 C;  4E6W A;  4EW7 A;  3F1O A;  3VSL A;  3QNB A;  4Y0O A;  3IH9 A;  3C4P A;  2JKR I;  2W3E A;  4FUW A;  3BW6 A;  4ME4 A;  1XA7 A;  3R4K A;  5I5L A;  3T50 A;  1S0W A;  4QPR A;  4E3O A;  1ZHH B;  3RXW A;  4U0T A;  5FQK A;  2ZL1 A;  1NZO A;  5CTM A;  4S2I A;  5A92 A;  4Y0T A;  3MZE A;  1MZU A;  3BYD A;  3ZNT A;  4NEE D;  2KOI A;  2W3D A;  1TS7 A;  2Y79 A;  4MCW A;  2A3U A;  4B9O A;  3IWO A;  1MWU A;  4RX2 A;  4ZRR A;  4CLC A;  1T19 A;  4GKU A;  4S2O A;  1FR1 A;  4Y5F A;  3LY4 A;  5A90 A;  3CG5 A;  2V0W A;  2Q0O A;  1YKD A;  4PHT A;  4GLQ A;  4JXS A;  2XQZ A;  4UAA A;  4GS9 B;  3DBA A;  5A8B A;  5F1G A;  1K0K A;  5DF7 A;  1K4F A;  3T1S A;  3TG9 A;  3OCN A;  3F1P A;  4MN7 A;  4F3L B;  3UPN A;  5KSH A;  5FAQ A;  3IX8 A;  3WS1 A;  3EOI A;  5EUA A;  2XEP A;  5I94 A;  5HL1 A;  3EEA A;  4E3K A;  3CUE A;  3GSG A;  1CJF A;  2V9A A;  3DTK A;  2R9W A;  5GLD A;  1KE0 A;  2GZA A;  2Y2K A;  3GEC A;  3BFD A;  1MY8 A;  3UE3 A;  2E8I A;  1VET A;  3PAE A;  3ZVT A;  1L2S A;  3G30 A;  4Q8I A;  4WEK A;  1YQS A;  3ICY A;  1XGI A;  1NWZ A;  4S2M A;  1T1A A;  1TEM A;  5FDS A;  4L9E A;  1YLW A;  2Z6D A;  4QJG A;  4EBN A;  1BLS A;  2Y55 A;  5FAT A;  1IYS A;  1UGU A;  2O0Y A;  1GA0 A;  4CPK A;  3D72 A;  1EWZ A;  3V50 A;  2XD5 A;  4R70 A;  2DMW A;  5F69 A;  5FQJ A;  4OQG A;  3DAV A;  4PKY A;  4GB7 A;  1MKI A;  4XUZ A;  1FIK A;  1P9R A;  2WKR A;  2G7U A;  2XGN A;  4B93 A;  1ZKJ A;  1HLU P;  3DW0 A;  2OSU A;  5MC7 A;  1NY0 A;  2B95 A;  5KZH A;  3WRZ A;  5HPF A;  2Z6C A;  2K31 A;  2ZQC A;  3PBT A;  3S7O A;  5FI2 A;  4I5S A;  3GQZ A;  4OVD A;  4NKP A;  5DF9 A;  1H8Y A;  4FH4 A;  4UQI S;  1KE3 A;  4C6Y A;  1N9B A;  3ULF A;  3LYX A;  1E25 A;  2B5R A;  4WBG A;  4DE2 A;  2PD8 A;  3FV7 A;  1BLH A;  3M2J A;  4EUV A;  2XFS A;  4KQO A;  3KYE A;  4D2O A;  3E4P A;  3PBS A;  1V9Z A;  1F5M A;  1KDS A;  3UE1 A;  4ZJ1 A;  5FQQ A;  1K25 A;  5HAR A;  2Y2P A;  3MKE A;  4ZBE A;  1IOU A;  4Y17 A;  1NLZ A;  1XJ2 A;  3TOI A;  1W63 Q;  5IHV A;  1NXY A;  3AGE A;  2K2N A;  4R1G A;  5L07 A;  4CLC E;  4LEN A;  2XSS A;  3O5Y A;  2PYR A;  1YSQ A;  3FKW A;  3KSH A;  1L0E A;  4JXG A;  3CWF A;  3T4J A;  5FQM A;  1ONG A;  1IYP A;  3WWX A;  3D3O A;  3NHQ A;  4BD1 A;  3MSH A;  1D7E A;  2B02 A;  2BTF P;  1FIL A;  3GRJ A;  1GHM A;  2P08 A;  2JKT I;  4R3B A;  1I2S A;  4GW9 A;  3PBR A;  4ESP A;  4LFU A;  2JHE A;  3QP5 A;  2Y4A A;  1Y4O A;  3V5M A;  3HLB A;  2JC7 A;  4K91 A;  2OV5 A;  4FD8 A;  2BAS A;  3SH9 A;  3BY9 A;  3IX3 A;  5A93 A;  3UMD A;  2BLS A;  4HJ6 A;  2J3W A;  3C7V A;  2J8Y A;  4EET B;  4GD8 A;  1TS8 A;  4L0L A;  1BSG A;  1E4D A;  5G4Z A;  2FZ0 A;  3SOI A;  1XKZ A;  4X69 A;  4N92 A;  3OBF A;  1OTD A;  5F83 A;  4KZB A;  4OPR A;  2EX6 A; 
#chains in the Genus database with same CATH homology
 3C4O A;  1HTZ A;  3HUM A;  4S2N A;  2Z2M B;  4YIN A;  4QB8 A;  2Y2J A;  3WS5 A;  1G68 A;  1W8Q A;  2P74 A;  4OP5 A;  2WUQ A;  5TFQ A;  3N4I A;  3MZF A;  4E3J A;  2XF3 A;  3IQA A;  2Y2Q A;  2WZZ A;  4RX3 A;  3AGD A;  4B4Z A;  5E2H A;  3HUN A;  1YMS A;  2ZC7 A;  5CGS A;  3OPP A;  4KZ9 A;  4JKT A;  3M6B A;  3W4O A;  3W4Q A;  4C3Q A;  5CHM A;  5FAP A;  1IEM A;  3S22 A;  2PU2 A;  2XK1 A;  4KZ3 A;  2I72 A;  4FSF A;  5EVI D;  5FI6 A;  4OPQ A;  5GL9 A;  4NK3 A;  3PTE A;  3V39 A;  3Q07 A;  1BUE A;  4RVA A;  4BL2 A;  4UA7 A;  5E2G A;  3VP2 A;  1PIO A;  1WYC A;  2Y2O A;  2OLV A;  1CK3 A;  1HVB A;  2C6W B;  4WM9 A;  4OKP A;  5CER A;  4C75 A;  3G2Z A;  4OQH A;  1GCE A;  3VFF A;  3HL9 A;  3G31 A;  4PM5 A;  4LV1 A;  3UPP A;  4R3J A;  3OC2 A;  4LV2 A;  5FAO A;  2FFF B;  4MBH A;  5FI7 A;  2ZM0 A;  5D3O A;  3GR2 A;  1VM1 A;  4PM9 A;  2WAE A;  5EEC A;  1BLC A;  3ZCZ A;  1L0F A;  5HAQ A;  1H8Z A;  2QMI A;  3NY4 A;  3N6I A;  4B4X A;  3CJM A;  2XDM A;  2PBY A;  4S2L A;  4WZ5 C;  3ISG A;  4OP8 A;  4R23 A;  1NJ4 A;  2WGI A;  4OOL A;  4WZ4 A;  4X55 A;  4WEJ A;  3IF6 C;  2RCX A;  3WRT A;  2XLN A;  1SHV A;  3ZNY A;  2JBF A;  1C3B A;  2X02 A;  2ZLY A;  4IVI A;  3IF6 B;  1ERQ A;  3GVB A;  2J7V A;  1O07 A;  3VOY A;  1ES3 A;  1WE4 A;  2HDR A;  5KSC A;  1QMF A;  2ZMA A;  4PMA A;  2ZC6 B;  4OPZ A;  1NYY A;  1PZO A;  4GZB A;  1IEL A;  4P0M A;  2EFX A;  5DVA A;  5M1A A;  4FCF A;  3MXS A;  1ERO A;  4K0W A;  1MWR A;  3C5A A;  4DE3 A;  1AXB A;  1MXO A;  2WAF A;  3CMZ A;  4DXC A;  5GHX A;  2UWX A;  1K38 A;  3ITA A;  4M3K A;  2HPB A;  1WYB A;  1K6S A;  1KGE A;  3UDX A;  3HLE A;  4IBR A;  4OLG A;  2Y2I A;  4BJP A;  3UPO A;  3M2K A;  4JXW A;  2BG1 A;  2CC1 A;  1K57 C;  4E6W A;  5CED A;  1FR6 A;  2DCF A;  3Q1F A;  4E6X A;  3EQV A;  3WS4 A;  4ID4 A;  3VSL A;  3TSG A;  1CI8 A;  1PWG A;  3NCK A;  3QNB A;  4Y0O A;  2HP6 A;  3IH9 A;  2H5S A;  3A3J A;  1YLZ A;  3BFG A;  3C4P A;  5DTT A;  5E2E A;  4ZJ3 A;  4BEN A;  2DNS A;  4S2J A;  3UE0 A;  2ZD8 A;  4RYE A;  3O87 A;  4PM8 A;  2Y2H A;  2ZC3 B;  1E3U D;  1XA7 A;  3N8R A;  2WKE A;  1LL5 A;  1W5D A;  2X71 A;  1PYY A;  2Z2L B;  1S0W A;  1ONH A;  4E3O A;  5JYO A;  1HZO A;  2EX8 A;  2ZM8 A;  3IXG A;  1Q2Q A;  1LI0 A;  3RXW A;  3GMW A;  4U0T A;  2HDS A;  4GN2 A;  3ITB A;  4N1H A;  1K55 C;  1FCO A;  2JE5 A;  1PWD A;  3O3V A;  5FQK A;  3UDI A;  1NZO A;  1YMX A;  4N9L A;  5CEC A;  5CTM A;  4P87 A;  1J9M A;  4S2I A;  3WS0 A;  4Y0T A;  5A92 A;  4WZ5 A;  1YLJ A;  4BL3 A;  1JWP A;  5CGX A;  3MZE A;  4QY5 A;  5CGW A;  4HBU A;  5FQI A;  1SDE A;  1XPB A;  3BYD A;  3IF6 A;  4X6T A;  2ZQ7 A;  3ZNT A;  2ZJ9 A;  1ERM A;  4Y7P A;  5FAS A;  5HFO A;  1FCM A;  3HLC A;  4X53 A;  2WK0 A;  5GHY A;  3ZG5 A;  4FH2 A;  3UDF A;  2EX9 A;  3P09 A;  1M6K A;  2A3U A;  1PW8 A;  3IWO A;  1MWU A;  4RX2 A;  5AQ9 A;  5CXW A;  4OH0 A;  1JWV A;  1N4O A;  5HW3 A;  4GKU A;  3S4X A;  4IVK A;  3QHY A;  4BLM A;  2IWB A;  4UHU A;  3SS5 A;  3NIA A;  1BT5 A;  4S2O A;  1FR1 A;  1LL9 A;  4DE0 A;  3LY4 A;  2H0Y A;  5A90 A;  3CG5 A;  1K54 C;  1O7E A;  3DWZ A;  1MPL A;  3HVF A;  4QD4 A;  3VP3 A;  1K57 A;  4KEN B;  2DRW A;  3UO9 A;  4JXS A;  1JVJ A;  2XQZ A;  3ZFZ A;  4UAA A;  2JCH A;  4JXV A;  1KGF A;  1S6R A;  2Y2N A;  5EOO A;  3VP4 A;  3BLS A;  3IXB A;  5F1G A;  4EBP A;  1XP4 A;  3N8L A;  3FZC A;  3BFC A;  3IXD A;  3IH8 A;  5DF7 A;  1K4F A;  3UY6 A;  4R0Q A;  3TG9 A;  5L2F A;  1YLY A;  1Q2P A;  3OCN A;  3ZG0 A;  1TVF A;  1IYO A;  4KG2 A;  1U60 A;  3MFD A;  2V20 A;  3UPN A;  4DDS A;  5KSH A;  1ES5 A;  2P9V A;  2ZQA A;  5FAQ A;  3WS1 A;  3MKF A;  4LCM A;  3O86 A;  5EUA A;  5HX9 A;  1K4E A;  3ZGA B;  4F94 A;  2XEP A;  3HUO A;  5I94 A;  3AGF A;  5HL1 A;  3IF5 A;  3IWI A;  1SKF A;  4WMC A;  4U3T A;  4E3K A;  4A5R A;  3GSG A;  1GA9 A;  2Q9N A;  4QHC A;  4RA7 A;  5GLD A;  1XGJ A;  2R9W A;  4EUZ A;  1KE0 A;  1FCN A;  2Y2K A;  5EVL A;  3PBQ A;  5EPH A;  3IXH A;  3OZH A;  3A3I A;  1RCJ A;  4N9K A;  5JYP A;  3SS4 A;  3BFD A;  4LV3 A;  1MY8 A;  3UE3 A;  1I5Q A;  2E8I A;  1PI5 A;  3PAE A;  3ZVT A;  3RXX A;  1L2S A;  3G30 A;  4Q8I A;  5FSR A;  4EQI A;  4GDN A;  2ZQD A;  3D4F A;  4WEK A;  2A49 A;  1CEG A;  4S2K A;  3LO7 A;  1YQS A;  5DTK A;  3IHB A;  4CJN A;  1XGI A;  4XXR A;  1RGZ A;  5HAP A;  5F1F A;  4HEF A;  4S2M A;  1ESI A;  4JBF A;  1TEM A;  5HAI A;  5AQB A;  5EVI C;  1YLW A;  4ZJ2 A;  4N1X A;  4QJG A;  2G2W A;  5EVI B;  4EBN A;  4KZ5 A;  4E3N A;  1BLS A;  2Y55 A;  5FAT A;  4EBL A;  3V3S A;  1BLP A;  4OLD A;  3SH7 A;  1IYS A;  3FKV A;  5J8X A;  3G2Y A;  1GA0 A;  3G4P A;  4CPK A;  4JF4 A;  1PI4 A;  3Q81 A;  4JPM A;  3A3E A;  2X01 A;  5CRF A;  1K54 A;  5CEB A;  1CI9 A;  1EWZ A;  3Q7Z A;  4PM6 A;  1XXM A;  2H10 A;  2WZX A;  4IED A;  3V50 A;  4DKI A;  1DJC A;  3GTC A;  2XD5 A;  3VP1 A;  3HLG A;  1FSY A;  2Y91 A;  3BFF A;  2C5W B;  5FQJ A;  3OPL A;  1CEF A;  4OQG A;  3PAG A;  4YFM A;  3WS2 A;  2P9V B;  1LHY A;  1G6A A;  4GNU A;  4X56 A;  4GB7 A;  1MKI A;  5U47 A;  2V2F F;  2XD1 A;  4XUZ A;  3Q7V B;  1W79 A;  4E3M A;  1W8Y A;  2WGW A;  2XGN A;  1H5X A;  3PBO A;  2IWD A;  1ZKJ A;  3O88 A;  3ZDJ A;  3DW0 A;  3N8S A;  2RL3 A;  1L0D A;  1RP5 A;  1K56 A;  2ZC5 B;  1ZG4 A;  2EXB A;  2OSU A;  3C7U A;  5AQA A;  4B88 A;  5AQ7 A;  1DY6 A;  4BQM A;  3HBR A;  1NYM A;  2Q9M A;  1NY0 A;  4XUX A;  4GD6 A;  4E3I A;  3WRZ A;  2Y2M A;  4GDB A;  1JTG A;  4KG6 A;  4BD0 A;  3MXR A;  5KZH A;  4MEZ A;  3OPR A;  2XH9 A;  3P98 A;  5KMW A;  2VGK A;  3UN7 A;  5E43 A;  4PPR A;  4KZ7 A;  3E2K A;  3NBL A;  3HLF A;  2ZQC A;  3QNC A;  3PBT A;  5DF8 A;  5GLA A;  5FI2 A;  3GQZ A;  2WAD A;  4OVD A;  1Y54 A;  5G18 A;  5DF9 A;  1H8Y A;  4FH4 A;  1IKG A;  5E2F A;  4DXB A;  3SH8 A;  1TDG A;  4NET A;  1KE3 A;  3JYI A;  4HES A;  4C6Y A;  2QZ6 A;  1N9B A;  3HLW A;  4IBX A;  5EVI A;  2HP5 A;  3RJU A;  2OLU A;  3ZG8 B;  2ZM2 A;  1W7F A;  3BM6 A;  1E25 A;  1ESU A;  2B5R A;  1KGG A;  1HD8 A;  4UA9 A;  1L0G A;  1FSW A;  4LV0 A;  4WBG A;  3FV7 A;  1QME A;  1BLH A;  3M2J A;  3VSK A;  2J9P A;  4DE2 A;  5FA7 A;  4EWF A;  4S2P A;  2XFS A;  4KQO A;  2IWC A;  3BEC A;  1RGY A;  4JF5 A;  5GHZ A;  1PWC A;  4D2O A;  3N7W A;  2WYX A;  2FFY A;  3PBS A;  1KDS A;  1YM1 A;  2PU4 A;  4Y0U A;  3GV9 A;  4ZJ1 A;  3UE1 A;  3MBZ A;  3IHA A;  3UNW A;  4UA6 A;  5FQQ A;  2J9O A;  1K25 A;  3LEZ A;  4KZ4 A;  5TGF A;  4KZA A;  5CHJ A;  5HAR A;  3LCE A;  4R4S A;  2Y2P A;  3MKE A;  4ZBE A;  2WKH A;  2WGW B;  2Y2G A;  3TOI A;  4EV4 A;  4QU3 A;  1ALQ A;  1KE4 A;  2H0T A;  5IHV A;  1BZA A;  1SCW A;  3BLM A;  4X68 A;  1NXY A;  3Q7V A;  3AGE A;  3ZVW A;  4LCL A;  3FYZ A;  4DF6 A;  2ZC4 B;  4R1G A;  1K55 A;  1ES2 A;  4LEN A;  3W4P A;  1LLB A;  4K0X A;  3OPH A;  4MLL A;  4MNR A;  1YLT A;  4WEL A;  3FKW A;  1L0E A;  3BFE A;  3IT9 A;  5FDH A;  3G34 A;  4E3L A;  4JXG A;  1MWT A;  4HBT A;  5TR7 A;  3FWL A;  3M6H A;  4DE1 A;  3BRM A;  1M40 A;  3EQU A;  4WMC D;  3HRE A;  2EXA A;  4O7D A;  5FQM A;  1ONG A;  1GHP A;  2R9X A;  1IYP A;  2XR0 A;  3WWX A;  1KVM A;  2VGJ A;  3DWK A;  4BD1 A;  3B3X A;  4KZ8 A;  4S2N C;  2EX2 A;  4OOM A;  1FQG A;  1BTL A;  1JTD A;  1IKI A;  3NI9 A;  3G32 A;  4MBF A;  1ES4 A;  1XA1 A;  4R4R A;  1DJA A;  5M18 A;  2HDQ A;  4JLF A;  3ZHH A;  2ZQ8 A;  5GLC A;  5M19 A;  5CHU A;  4OQ0 A;  3VFH A;  3OCL A;  1OME A;  5DTS A;  5F82 A;  3GRJ A;  1GHM A;  5EOE A;  4P6B A;  4R3B A;  1I2S A;  5FQ9 A;  4DDY A;  1YT4 A;  4QY6 A;  3PBR A;  1EI5 A;  4WYY A;  3V3R A;  3CZD A;  1IYQ A;  2G2U A;  1BUL A;  4U0X A;  1SDN A;  2Y59 A;  1NZU A;  2ZQ9 A;  2XFT A;  1DJB A;  3VMA A;  5A91 A;  1E3U A;  2Y4A A;  1ZG6 A;  4OQI A;  3VP0 A;  4H8R A;  3W8K A;  3SS3 A;  3ZG7 B;  4KZ6 A;  3V5M A;  1VQQ A;  1K6R A;  3HLB A;  2JC7 A;  4GOG A;  4ZDX A;  4K91 A;  2OV5 A;  3A3F A;  4FD8 A;  3Q82 A;  2EFU A;  3I7J A;  4OPY A;  3SH9 A;  3G35 A;  5BOH A;  5A93 A;  2QPN A;  1MWS A;  2BLS A;  1NRF A;  1I2W A;  1MBL A;  4Z9Q A;  5CTN A;  4DRT A;  4OON A;  1PW1 A;  3C7V A;  1KVL A;  4ZTK A;  3LY3 A;  1GHI A;  1KDW A;  4JF6 A;  3PBN A;  1FOF A;  1ZC2 A;  2J8Y A;  1PZP A;  5EE8 A;  3HLD A;  1XX2 A;  3NDG A;  4GD8 A;  3S1Y A;  3IWQ A;  4L0L A;  1BSG A;  2V1Z A;  3VOZ A;  1E4D A;  2HDU A;  3SOI A;  3ZG9 B;  3NC8 A;  2Y2L A;  1XKZ A;  1Z6F A;  4KG5 A;  1YLP A;  4X69 A;  4KQR A;  1K56 D;  4N92 A;  1LI9 A;  4MBK A;  4OOY A;  1TDL A;  3A3D A;  4KQQ A;  2GDN A;  3BEB A;  4P85 A;  4PM7 A;  3MZD A;  2WKI A;  4ZAM A;  3NDE A;  5GLB A;  5F83 A;  2WGV A;  4KZB A;  3E2L A;  2HP9 A;  1JWZ A;  3DTM A;  4OPR A;  2EX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...