3MBZA

Oxa-24 beta-lactamase complex soaked with 10mm sa4-17 inhibitor for 15min
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Betalactamase OXA24
total genus 76
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3mbzA00
1EWZA 2ZQAA 2Y2HA 3HLEA 4BLMA 4S2MA 4OPZA 4F94A 2J9PA 3C5AA 1KE4A 1MBLA 1BLHA 2OSUA 5DTSA 3C7VA 3IXHA 3WS5A 3ZVTA 3BYDA 4GZBA 4WZ4A 1CI9A 2ZM8A 5FA7A 2XH9A 2ZQCA 1FCOA 3ZVWA 3Q82A 3BFFA 2WUQA 3VOYA 4E3JA 4Y7PA 5GL9A 1TDGA 2UWXA 3CZDA 2PU2A 2HP5A 1JTDA 1FCNA 1SCWA 1TVFA 4LCMA 1L2SA 3HBRA 4WEKA 2XF3A 3PTEA 4ZJ3A 2Y55A 4WZ5A 5A93A 1XX2A 4QB8A 3SS4A 4EBLA 1XGJA 4ZJ1A 2ZD8A 5U47A 4S2LA 5FI2A 3O88A 1ZG4A 3FZCA 3G30A 1K6RA 5F1FA 4WM9A 1ES2A 3QNBA 2ZC3B 4OLGA 1NZOA 1JTGA 3LO7A 4C75A 1KE0A 4DXCA 1DJAA 2J8YA 4OPQA 4WMCD 3P09A 4E3IA 5KSCA 4S2OA 3TOIA 4LV3A 4OP5A 4S2IA 4E6WA 4GD6A 4KQOA 4OP8A 4JF6A 4DDYA 4ZJ2A 3FKVA 3VP1A 1PI5A 4EQIA 2WADA 1NRFA 3SS5A 3PBSA 5G18A 1K55C 2Y2LA 3N6IA 5HL1A 1YMSA 2WAEA 2Y91A 5KSHA 1AXBA 5GLBA 3HLDA 3WRTA 2PU4A 3O86A 1IEMA 1NYYA 3C4PA 4IVIA 3HLBA 2XQZA 2WK0A 3HUNA 1WYBA 3HL9A 4GDBA 3ZHHA 5HAIA 3IF6A 2Y2MA 4ID4A 3MZDA 1WE4A 4QY5A 4IBXA 5CEDA 4IVKA 5E2GA 5AQ7A 5TGFA 1RCJA 5EVIB 1S6RA 3SH9A 3SH8A 3Q81A 4N9KA 2ZC7A 3MBZA 1KGFA 5CHMA 4Z9QA 4B88A 3OPPA 4M3KA 4A5RA 2DNSA 3S1YA 3Q7VA 3A3IA 4B4XA 3AGDA 1PIOA 1GA0A 1FCMA 2BG1A 5CHUA 2WGWA 1MPLA 2Y2QA 3BFDA 3A3EA 3NBLA 4JXSA 1BLCA 1W8YA 1IELA 1NXYA 2H10A 1DY6A 4OOYA 3IXGA 1L0EA 3BFGA 4KZAA 5A92A 3G31A 3NCKA 3OPRA 4QY6A 2X71A 4UA6A 1DJCA 2HP9A 4X6TA 5FQJA 1ES5A 4WEJA 3PBTA 2C6WB 2XDMA 1IYOA 4RYEA 5EUAA 2XGNA 2VGKA 1K55A 2OLVA 1N9BA 3EQVA 2G2WA 3Q7VB 5FAQA 4N1HA 3WS4A 3JYIA 1I5QA 1PYYA 4U3TA 3IH8A 4E6XA 1K4FA 5I94A 1Z6FA 1LLBA 5CEBA 5CECA 2Y2JA 4P87A 4HBUA 5EPHA 4R0QA 4KZ3A 4RA7A 3LEZA 3ZCZA 2QPNA 4U0TA 3BECA 5CTNA 5HAPA 4GN2A 2Z2MB 1G68A 5AQAA 5E43A 1MWRA 5TFQA 3ITBA 3TSGA 4KZ8A 2J9OA 4DE2A 5JYOA 2XR0A 1K57A 3VFFA 3DW0A 3ZGAB 1RGYA 2XD1A 3N8SA 3UDIA 2X02A 4GNUA 3UE3A 4E3LA 3E2LA 4E3OA 4DRTA 5HX9A 4LV1A 4MBFA 4DE3A 4N1XA 4DF6A 4DE1A 1W7FA 5KZHA 3AGFA 4UA7A 1PWGA 2ZC6B 3D4FA 3CJMA 4JF5A 3WRZA 5JYPA 1FSWA 4OVDA 3NIAA 3O3VA 2HDSA 4XUZA 4YINA 5M19A 2GDNA 2E8IA 1TEMA 2DCFA 1O7EA 3N4IA 3OCNA 3GQZA 4OPRA 4H8RA 5AQBA 3UY6A 4C6YA 4BQMA 1RP5A 4X55A 3SH7A 3FKWA 2XFTA 4EUZA 4UAAA 3QNCA 1YLZA 4K0XA 4R3JA 3IXDA 3VP4A 2Y2KA 5GLCA 3FYZA 4NK3A 3FV7A 3W4QA 4CPKA 2Y2NA 4P85A 2Y4AA 2A49A 5FAPA 2EXAA 2ZQDA 4JXWA 3HREA 3PBRA 3DWKA 4LCLA 3QHYA 4LV2A 5IHVA 4KZ5A 5GHXA 1RGZA 3LCEA 2HDQA 2WAFA 4DE0A 2RL3A 3V3SA 3ZNYA 4L0LA 2JE5A 3PAGA 4N9LA 5EVIC 1ONHA 3EQUA 4DDSA 5EE8A 4K91A 3UO9A 3BRMA 3G2ZA 4WYYA 3ZNTA 2XEPA 3UDXA 1Q2PA 3VOZA 4HEFA 4R1GA 1L0DA 4UHUA 3MXRA 2ZC5B 4OOLA 2WKIA 3W8KA 2VGJA 3G35A 3M2KA 1PI4A 3BM6A 1SHVA 4XUXA 5A91A 1BLSA 5FQQA 1MY8A 4E3NA 2JC7A 3UNWA 1XXMA 2WKEA 3LY4A 3GV9A 3VSKA 1XPBA 1K54A 1LL9A 4KZ6A 1I2WA 3UN7A 1ES3A 3VMAA 5HARA 1GHIA 1JVJA 5DF8A 1C3BA 3Q07A 3GVBA 3PBQA 3VSLA 4QJGA 1XA7A 1CI8A 2A3UA 1GHPA 4UA9A 3HLWA 3Q7ZA 5EOOA 2JCHA 2I72A 4KQQA 4ZBEA 3UPOA 1Y54A 5EVLA 1CK3A 4S2PA 4X56A 1ZKJA 1E3UA 1H8ZA 5HAQA 5M1AA 2P9VA 4HBTA 1BSGA 3TG9A 1BLPA 1U60A 2Y2IA 3G32A 4PM9A 4PM7A 1IYPA 4DXBA 4GOGA 4OLDA 2R9WA 4EV4A 1BULA 3W4OA 3N8LA 2Z2LB 5FI7A 3W4PA 2ZJ9A 1PZOA 2XK1A 3NY4A 2J7VA 2WGWB 2WZXA 3ZFZA 5FAOA 5FQIA 3C7UA 5EECA 4E3KA 3WS1A 1ERMA 4OPYA 1MWTA 3MZEA 2OLUA 4PPRA 3ZG9B 5CRFA 3VFHA 1BT5A 2WGIA 4S2NC 4RX2A 5DF9A 5EVID 5CTMA 2R9XA 4BL2A 5DF7A 1NY0A 5TR7A 1SDEA 3HUMA 4WBGA 4R4SA 3GSGA 1KVMA 1FR1A 1WYCA 5HW3A 2WKHA 5DTKA 1FSYA 2P74A 4HESA 4WELA 4D2OA 3ZG7B 2ZQ7A 1K4EA 3HLFA 4JBFA 4ZAMA 4BJPA 1JWZA 1LI9A 3OZHA 4B4ZA 1VM1A 3RJUA 5M18A 3ZDJA 2ZQ8A 4OQGA 1Q2QA 4IBRA 1LI0A 3G34A 3OCLA 4CJNA 3UDFA 1K25A 1PWDA 3N7WA 1S0WA 3IHBA 5FATA 2Q9NA 3VP0A 4C3QA 3E2KA 1FQGA 3HUOA 4OOMA 3HLCA 4QHCA 4E3MA 5GHYA 1XGIA 2ZMAA 4FH2A 4Q8IA 4OQ0A 1ESIA 3WS0A 4LV0A 2PBYA 5F83A 3A3JA 1KE3A 1QMEA 5CXWA 3PBOA 5KMWA 1K57C 3NDEA 2Y2OA 1SDNA 4JF4A 4QU3A 3V5MA 4ZTKA 1KGGA 2OV5A 1N4OA 2HDRA 2IWCA 2ZLYA 4FD8A 2QZ6A 3M2JA 4JXVA 1L0FA 3NC8A 5FI6A 2IWBA 1XP4A 3IF6B 4EWFA 1K56D 2HDUA 1BZAA 1YLPA 4MEZA 4Y0OA 3CG5A 4MNRA 2B5RA 3ZG8B 4KG6A 1LHYA 3MXSA 4P6BA 4KENB 1PW8A 1NYMA 3BLSA 2X01A 2ZM2A 3OPHA 5E2HA 3M6BA 3ISGA 2HP6A 4S2JA 4QD4A 1MWSA 3RXXA 2C5WB 1MXOA 1MWUA 1NJ4A 3S22A 3NDGA 1OMEA 5CHJA 4KG5A 2WGVA 3IHAA 4KZ9A 1MKIA 1GA9A 3DTMA 3IT9A 3NI9A 3V50A 1W5DA 5FQ9A 3IH9A 4N92A 1YMXA 4GKUA 5FDHA 3GR2A 1PZPA 5FQKA 5F1GA 2XLNA 4GB7A 3FWLA 4PMAA 4WZ5C 4FH4A 1BTLA 1ZG6A 1IYQA 3WS2A 4P0MA 3CMZA 3VP3A 5BOHA 5CGSA 1JWPA 3IWOA 2V2FF 3BFCA 4S2KA 2BLSA 1PWCA 4X53A 3V3RA 4JXGA 1IKGA 1H5XA 4KQRA 1J9MA 1HVBA 1CEGA 2EX9A 2ZM0A 4GD8A 4OQIA 4OONA 4O7DA 1VQQA 1KDWA 2DRWA 3OC2A 2WYXA 1IYSA 3A3DA 3IWQA 2RCXA 2WZZA 4BD1A 2EX8A 4JPMA 1FOFA 1K6SA 5FSRA 4JKTA 3IXBA 3IQAA 3MFDA 5EVIA 5HFOA 1K38A 4BL3A 2Y2GA 1GHMA 3GRJA 1CEFA 1IKIA 3UE1A 5D3OA 3IF5A 3MKFA 3IF6C 1YLYA 2Q9MA 3B3XA 2V20A 3C4OA 2EFXA 5J8XA 3GMWA 4IEDA 2EFUA 2ZC4B 2IWDA 3S4XA 1K54C 1W8QA 4U0XA 3I7JA 3AGEA 3HVFA 3BLMA 4BENA 1L0GA 1HD8A 5L2FA 4KZ7A 5EOEA 3UE0A 2FFYA 4KZ4A 4OQHA 4R23A 3WWXA 1KVLA 1O07A 1ERQA 2EX6A 3OPLA 3ITAA 4R3BA 1M6KA 3ZG0A 2V1ZA 3VP2A 1YLJA 2Y59A 1M40A 3PAEA 1G6AA 4RVAA 3SOIA 1E25A 1YLTA 4X69A 1DJBA 4EBNA 3BEBA 1FR6A 2H0TA 4KZBA 1E4DA 5E2EA 1QMFA 5CGWA 4OH0A 4XXRA 1XKZA 2EX2A 1EROA 2H5SA 4MBKA 4OKPA 4S2NA 3DWZA 4EBPA 3SS3A 4FSFA 1KDSA 1TDLA 1BUEA 4PM8A 1GCEA 1JWVA 1YM1A 2P9VB 4K0WA 4Y0UA 3UPNA 1ALQA 3P98A 4GDNA 1SKFA 4RX3A 4BD0A 4DKIA 4FCFA 4YFMA 5FASA 2XFSA 1XA1A 5AQ9A 1K56A 5F82A 3RXWA 3N8RA 1PW1A 1HTZA 4NETA 3UPPA 5CGXA 2EXBA 1EI5A 3MKEA 1YQSA 4LENA 5GHZA 4X68A 5DTTA 4Y0TA 1H8YA 2ZQ9A 1HZOA 2CC1A 3PBNA 1ONGA 5GLDA 1LL5A 3V39A 3O87A 3A3FA 2H0YA 2JBFA 2QMIA 3HLGA 5A90A 4MBHA 4KG2A 3G4PA 5DVAA 2XD5A 2FFFB 3LY3A 2HPBA 1YT4A 3IWIA 5FQMA 1KGEA 4PM5A 3MZFA 5E2FA 2Y2PA 4R4RA 3Q1FA 3M6HA 1NZUA 3G2YA 3GTCA 1ESUA 2G2UA 4PM6A 1I2SA 1E3UD 4ZDXA 4WMCA 1ES4A 5CERA 3ZG5A 1W79A 1YLWA 3BFEA 4JLFA 5GLAA 1ZC2A 4MLLA
chains in the Genus database with same CATH superfamily
1P97A 4DJ3A 1TS0A 2KLIA 3HLEA 3IX3A 4OPZA 2J9PA 2B95A 3K3DA 3CUEA 3WS5A 4HNBA 2ZL1B 1CI9A 5FA7A 5GL9A 1FCNA 1SCWA 1L2SA 4WEKA 2W3GA 4WZ5A 5A93A 4ZJ1A 3S7PA 1K6RA 1ES2A 3QNBA 1NZOA 1JTGA 3BW6A 3D72A 1ZTUA 1D7EA 4IUKA 3F1OA 2ZOHA 4OP5A 4E6WA 4DDYA 5HWWA 1CF0A 2NUTC 4JF6A 1UWNX 2NUPC 2HZ5A 1PI5A 1AXBA 2PU4A 1IEMA 3PHYA 2XQZA 4I39A 4GDBA 3ZHHA 4LPZA 2K2NA 1IOUA 1CJFA 1WE4A 1STZA 5TGFA 1S6RA 3SH9A 3SH8A 4N9KA 3MBZA 1KGFA 4M3KA 3S1YA 2W3FA 4B4XA 1VEUB 1K0KA 3AGDA 1GA0A 1BYWA 4DN0A 2WGWA 3BFDA 3NBLA 3IX4A 1NXYA 4WLAA 1DY6A 4OOYA 3BFGA 4UA6A 1OJ5A 2W1RA 4N1HA 1K4FA 4P87A 3LEZA 3ZCZA 4U0TA 2Z2MB 4YOFA 1PRQA 1G68A 4UQIM 4DE2A 3QP4A 3VFFA 2XD1A 2JKTI 2X02A 1W63Q 1G28A 4DE3A 4DF6A 1W7FA 4OVDA 4YINA 4BWIA 3R7WB 5M19A 2E8IA 4FOFA 1FIKA 1TEMA 3OCNA 2VGLM 4OPRA 3UB5P 4BQMA 4NXFA 3KYEA 3QNCA 4NEED 4P6ZS 3VP4A 1H3QA 5HSQA 5GLCA 1XJ6A 2Y2NA 4P85A 2Q0OA 1G6OA 3E4OA 3DWKA 3QHYA 4BBTA 1RGZA 3BY8A 3TE8A 3V3SA 3MFXA 3UB7A 1XJ2A 1ONHA 4DDSA 4K91A 3BRMA 3VOZA 1L0DA 4HH3A 4UHUA 4EETB 2LB9A 2B02A 1OTEA 3W8KA 3M2KA 3HCYA 3IS2B 3BJNA 1MY8A 2JC7A 1OTIA 1XXMA 3GV9A 1XPBA 3LR4A 5DF8A 4R6LA 4DJ2A 3VSLA 1CI8A 4HP4A 3T4OA 4ZBEA 1ZKJA 3B42A 3D9YA 1XFQA 1N9NA 1IYPA 1OT9A 4GOGA 1ZHHB 4WL9A 3N8LA 3W4OA 2W1TB 2J7VA 2WGWB 2WZXA 5FQIA 3WS1A 1MWTA 4PPRA 1BT5A 4MDZA 4RX2A 5EVID 2YKHA 3LR3A 2R9XA 4BL2A 1NY0A 2O99A 5TR7A 3GSGA 3NOUC 1FR1A 5DTKA 1LSXA 3ZG7B 3JPUA 3HLFA 3UB8A 2PRFA 2ZQ8A 3G34A 2HGVA 3IHBA 5DJUA 3HUOA 1XGIA 4Q8IA 4OQ0A 3WS0A 4LV0A 3A3JA 1KE3A 1QMEA 5J4EA 1UWPX 3IBJA 3KX0X 5HDDA 1SDNA 4CLCE 3R4KA 2QYBA 2O9BA 4P6ZM 5K5BA 3OBFA 4B93A 2QZ6A 4JXVA 2GNXA 3NOTC 3NC8A 4Y0OA 2J3TC 3CG5A 4KG6A 4P6BA 1PW8A 4I38A 1NYMA 2ZM2A 5KIZA 5E2HA 4Q0JA 1MXOA 1NJ4A 1OMEA 5DFYA 5IT5A 4KZ9A 1MKIA 1GA9A 3IT9A 1W5DA 4ZRRA 2Z6DA 1YMXA 4N92A 1P0ZA 4JGPA 4X1MA 3FWLA 4WZ5C 3LICA 1TS7A 3WS2A 3CMZA 4XT2B 1JWPA 3RFBA 3BFCA 2W3DA 4UQIS 5I5LA 2XRNA 1H5XA 1CEGA 2EX9A 2ZM0A 2M1CA 1VQQA 3VOLA 4BD1A 2WZZA 4JPMA 1K6SA 1SKOA 4JKTA 3BWLA 3IXBA 3IQAA 3CLOA 1T1CA 3C8CA 4BBUA 1K38A 3NOPC 2Y2GA 1GHMA 5CX7A 3LIFA 2Q9MA 3GMWA 4MMNA 4EEUA 3L7HA 1W8QA 3HVFA 3UE0A 4OQHA 4R23A 3OPLA 3ZG0A 5A8BA 1YLJA 2Y59A 1M40A 3PAEA 3SOIA 1YPRA 2O9CA 1FR6A 2H0TA 4KZBA 1E4DA 3GECA 5E2EA 3RTYA 1QMFA 4JGRA 5CGWA 4OH0A 5HDSA 4MBKA 1EROA 1YSPA 4S2NA 4EBPA 3F1PB 4FSFA 3HJIA 1YM1A 2P9VB 4K0WA 3UPNA 1P9WA 2P04A 3OLOA 5FASA 5AQ9A 1S66L 3UPPA 5CGXA 1EI5A 3CHWP 3SZTA 1VHMA 4LGWA 3HLGA 4KG2A 2XD5A 3DTIA 3IWIA 5E2FA 2Y2PA 5HL6A 3Q1FA 1NZUA 4O0PA 2VA0A 4II7A 3B33A 5CERA 3ZG5A 3A0RA 4JLFA 3MSHA 1GSWA 1ZC2A 4BD0A 2Y2HA 3MXQA 3SW1A 1KE4A 5IS1A 1BLHA 5DTSA 3BYDA 2YKFA 4I5SA 2PBDP 4WZ4A 5LBRA 1LT0A 2ZQCA 4AFIA 3Q82A 3VOYA 4E3JA 4Y7PA 1TDGA 2UWXA 3CZDA 1JTDA 1H0MA 2ZBBA 4LCMA 2UV0E 3PTEA 2Y55A 1XX2A 4QB8A 2ZD8A 5U47A 3O88A 1ZG4A 3T4TA 3FZCA 2Z6CA 1T1AA 2V8FA 3KSFA 3LO7A 1KE0A 4DXCA 1DJAA 4OPQA 4WMCD 1TD5A 3P09A 3TOIA 4KQOA 4OP8A 1OJGA 3FKVA 3VP1A 4Y15A 2WADA 3PBSA 3RH8B 5G18A 3CI6A 2Y2LA 3N6IA 5HL1A 1YMSA 2WAEA 5GLBA 4IVIA 5MC7A 2JN7A 3HUNA 4CLCD 3LFVA 2Y2MA 4UEYA 2GX5A 4IVKA 5E2GA 1RCJA 1N9LA 1PNEA 4D60A 3Q81A 5CHMA 5C5KA 3OPPA 2JKRM 3MR0A 1OTBA 1MPLA 3A3EA 2QKPA 3BQ8A 5HPFA 1H8MA 3IXGA 1L0EA 3G31A 5FQJA 1ES5A 3QP5A 4WEJA 3PBTA 2XGNA 3NJAA 1MC0A 1K55A 3EQVA 3Q7VB 3WS4A 1I5QA 3IH8A 4E6XA 3B47A 1SZVA 2QJ5A 3BECA 5CTNA 5HAPA 5TFQA 5E43A 3TSGA 3ITBA 4KZ8A 5JYOA 2FH5A 3UB6A 5FL3A 3UDIA 4E3LA 4E3OA 4DRTA 4LV1A 4NKPA 2INWA 1KOUA 1PWGA 2ZC6B 3CJMA 2OWJA 3G6OA 1FSWA 4WN5A 3O3VA 4X25A 1OTAA 1O7EA 2DCFA 3N4IA 3UY6A 3SH7A 2XFTA 4UAAA 3PR6A 3IXDA 3FYZA 4NK3A 3T1QB 2HJ9C 5FAPA 2EXAA 3HREA 3PBRA 2XA7S 1OTDA 4LCLA 4EESA 3OOVA 4KZ5A 3VV4A 2JE5A 3PAGA 4EXOA 1ODVA 5HWVA 3IX8A 5EE8A 3G2ZA 4WYYA 3ZNTA 2XEPA 4HEFA 4R1GA 3T1RA 3NULA 2WKIA 5TBMB 4L9EA 1PI4A 4E3NA 3UNWA 3LY4A 1K54A 2PDRA 3EGDC 3IS2A 1ES3A 5HARA 5HD3A 3Q07A 3GVBA 3H7WB 2P08A 4QJGA 1XA7A 4UA9A 5EOOA 3ICYA 3LIDA 5EVLA 1CK3A 4S2PA 4WUJA 5M1AA 3R7WA 1DP6A 4HBTA 4PM9A 4PM7A 4DXBA 4EV4A 1BULA 4PKYA 2Z2LB 3W4PA 2ZJ9A 3NY4A 5FAOA 4OPYA 3UMEA 3MZEA 2OLUA 2J3WA 3VFHA 5CTMA 5AJGA 2PD8A 2VKSA 1KVMA 5HW3A 2WKHA 2AVXA 2EWVA 1OT6A 2O0YA 2WKRA 3U4LP 4JBFA 4BJPA 1JWZA 1VM1A 3ZDJA 4OQGA 4IBRA 1VETB 4CJNA 3N7WA 3T1SA 1T18A 5FATA 2Q9NA 3VP0A 4JGQA 4HI4A 5GHYA 2ZMAA 2JKRI 3LR5A 4FUWA 1ACFA 5DJTA 5KMWA 2PAVP 4ZTKA 1KGGA 4GS9A 4HY8A 2HDRA 2IWCA 3M2JA 4FTXA 5FI6A 2IWBA 1XP4A 1YKDA 4Y2FA 3ZG8B 2X01A 2PHYA 3ISGA 2VX8A 4S2JA 3RXXA 2C5WB 3S22A 3A0VA 3ULFA 5F68A 3JVUA 3NDGA 2WGVA 3IHAA 3NHQA 1P9RA 5FQ9A 5F5YA 5FDHA 4R3AA 3GR2A 4PMAA 2HJEA 1ZG6A 5EFWA 2KDKA 5CGSA 2Y8HA 2BLSA 1PWCA 5L10A 5HZHA 3TRCA 4IHQA 4KQRA 1J9MA 4GD8A 4OQIA 4OONA 4O7DA 3MS6A 2DRWA 2A24A 1D06A 4JGOA 2PT7A 1FOFA 4E04A 5EM1A 2ACGA 4BL3A 1CEFA 5D3OA 2ZMVA 3IF5A 1YLYA 2V1AA 2V20A 5J8XA 2IWDA 1K54C 3I7JA 5F6AA 3AGEA 1V9YA 3T4KA 5EOEA 3WWXA 4QPRA 3EOIA 3PYPA 2MJ6A 1E25A 4X69A 1DJBA 3V67A 4EBNA 3BEBA 4H6JB 3BY9A 4DMZA 2W1TA 4XXRA 1FILA 3DWZA 1L3LA 1KDSA 1JWVA 1ALQA 1YAXA 4FCFA 4HIAA 4GS9B 1K56A 3RXWA 1PW1A 4NETA 3C30A 3T12B 3LIAA 3MKEA 4LENA 5GHZA 4X68A 1XJ4A 5DTTA 1H8YA 3E0YA 4EW7A 1HZOA 3PBNA 5GLDA 3O87A 2H0YA 2JBFA 3MQ0A 4MBHA 1LSWA 1D1JA 3LY3A 4NXEA 4HP9A 1YT4A 5FDSA 4MN7A 4NXGA 4R4RA 3G2YA 4PM6A 3T4SA 1ES4A 4F3LA 2JHEA 1TS8A 1W79A 4ARZA 2Y2QA 4MLLA 1EWZA 2ZQAA 3S7OA 4F94A 2A24B 1MBLA 2OSUA 4GZBA 1FCOA 3BFFA 3T4LA 2PU2A 2HP5A 1TVFA 1S1ZA 2V1BA 2XF3A 4ZJ3A 2L0WA 1X0OA 1XGJA 1DP9A 4S2LA 3GDIA 5FI2A 3H9WA 4C75A 4E3IA 5KSCA 3H7WA 4S2OA 4S2IA 4Y5FA 5L09A 4EQIA 1NRFA 4HJ3A 3HLDA 3O86A 2M7VA 1NYYA 3C4PA 3HLBA 3F1NA 1WYBA 3MZDA 2OWHA 4QY5A 1WA9A 4IBXA 5AQ7A 3UB9A 5EM0A 3T4QA 4ETZA 2ZC7A 4A5RA 2DNSA 4MN6A 1JNUA 3HJKA 1W63M 3CITA 4JXSA 1BLCA 1IELA 2H10A 4EQ1A 5A92A 3LYXA 3OPRA 2X71A 2BASA 4X6TA 5HPIA 2XDMA 5EUAA 2VGKA 5FAQA 1PYYA 2VZWA 3EEHA 1G5UA 1LLBA 5CECA 2HF6A 2Y2JA 1MKMA 4HBUA 4RA7A 2D01A 4HQAA 5AQAA 4PHTA 3F1NB 2XR0A 1K57A 3ZGAB 3N8SA 2VV8A 4GNUA 3E2LA 5HX9A 4MBFA 4N1XA 4DE1A 3W2ZA 3AGFA 4JF5A 3D4FA 5HWTA 3WRZA 5JYPA 3U2AA 3NIAA 2HDSA 4XUZA 2JKTM 4H8RA 5AQBA 2VGLS 4G3VA 1RP5A 4X55A 2VJWA 5DKKA 2VLGA 3W4QA 3FV7A 4CPKA 2ZQDA 4JXWA 4RQ9A 5EV0A 3LCEA 2EA9A 4DE0A 3ZNYA 2VV6A 2Y79A 2WKPA 3EEAA 4GW9A 4N9LA 5EVIC 3EQUA 3UO9A 4G3WA 4K08A 1F98A 1MZUA 2VGJA 3G35A 4EERA 4XUXA 5A91A 1BLSA 3CPTA 2WKEA 3KO6A 3MJQA 4MN5A 1LL9A 4KZ6A 1I2WA 4Y13A 2W27A 3L9KA 4HOIA 5HDCA 3QP8A 1GHPA 3EGXC 4QWOA 3UPOA 1Y54A 4EEPA 4LLOB 1E3UA 2FZ0A 1BSGA 3LGOA 3TG9A 3G32A 4OLDA 5FI7A 4Y17A 3C7UA 2JKGA 3KSGA 5DF7A 1F2KA 1SDEA 1EW0A 4WBGA 4R4SA 2J3TD 1WYCA 5IU1A 1K4EA 1OPXA 4ZAMA 1LI9A 3OZHA 4B4ZA 2W3EA 3RJUA 4WF0A 5F69A 2WKQA 1Q2QA 1LI0A 1K25A 1PWDA 2QHKA 1FQGA 4OOMA 4QHCA 3HLCA 4E3MA 4FH2A 3F1OB 5F83A 3PXPA 3VE3A 3NDEA 4QU3A 3V5MA 4CLCA 4GLQA 1N4OA 4GCZA 2V9AA 2ZLYA 2ZMFA 4BMWA 3IF6B 1K56D 2HDUA 1YLPA 4MEZA 4ME4A 4MNRA 2B5RA 5FEGA 4HHDA 4KENB 3BLSA 3CUEC 3OPHA 2VV7A 2HP6A 3KYZA 3DBAA 1MWUA 3ZQ5A 1SKOB 3IH9A 4LRXC 3DTEA 4F3LB 5FQKA 5F1GA 1F5MA 2XLNA 4GB7A 4FH4A 1BTLA 1IYQA 3KYQA 3LIEA 4P0MA 3TW8A 3IWOA 4KUOA 4X53A 3V3RA 1IKGA 1HVBA 3P01A 1KDWA 3A3DA 3IWQA 2RCXA 4X1LA 1CQAA 5FSRA 5TJJA 3MFDA 1YSQA 2LB5A 4XT2A 1IKIA 3C4OA 2EFXA 4IEDA 2EFUA 4EU0A 4U0XA 2FFYA 3EWKA 3IBRA 4NXBA 4LRZE 5HD5A 1KVLA 1ERQA 2EX6A 4R3BA 1M6KA 2E8JA 2V1ZA 3VP2A 2ZOIA 4RVAA 1G6AA 4CLCB 2PR5A 2J80A 4M4XA 1XKZA 4Z1WA 2R78A 1TDLA 4Y0UA 1GCEA 4O8GA 3P98A 4GDNA 1XJ3A 2EWWA 3F1PA 3ZYTA 4YFMA 2XFSA 3N8RA 3KSHA 1HTZA 2ZL1A 5L8MA 2OAP1 2OAQ1 2EXBA 2ZQ9A 1LL5A 3A3FA 2QMIA 3NECA 5A90A 2FFFB 1S1YA 4PM5A 4NG2A 3MZFA 4YWZA 3M6HA 5DKLA 2B18A 1ESUA 2G2UA 4ZDXA 4WMCA 1F9IA 1NLZA 3BFEA 2K7SA 3QP1A 4LFUA 4BLMA 4S2MA 3C5AA 4CLCC 3C7VA 3IXHA 3ZVTA 2DMWA 2ZM8A 1Y4OA 2XH9A 3ZVWA 3TJZC 2WUQA 3LI9A 4B9OA 3HBRA 3FPVA 3MQQA 3SS4A 4EBLA 3CPTB 3H82A 3S7NA 3G30A 4H6JA 5F1FA 4WM9A 2BTFP 2ZC3B 4OLGA 3FG8A 2J8YA 1LL8A 4LV3A 3S7QA 2G7UA 1UGUA 4GD6A 4ZJ2A 3SS5A 1K55C 3QP6A 2Y91A 5KSHA 3WRTA 2JKFA 2WK0A 3D3OA 3HL9A 5HAIA 3IF6A 4ID4A 5CEDA 5EVIB 2P7JA 2A2LA 4Z9QA 4B88A 2QWSA 1NLYA 3Q7VA 3A3IA 1PIOA 1FCMA 2BG1A 5CHUA 1W8YA 4KZAA 3NCKA 4QY6A 1DJCA 2HP9A 4YNRA 4R38A 2C6WB 4RYEA 1IYOA 3P7NA 4R70A 3UMDA 2OLVA 1N9BA 2G2WA 3DAVA 3JYIA 4U3TA 2K31A 1IFQA 5I94A 5TBMA 1Z6FA 5CEBA 5EPHA 4R0QA 4KZ3A 2VEAA 2QPNA 4GN2A 2D02A 1MWRA 1NWZA 2J9OA 3DW0A 1RGYA 3UE3A 4PKYG 5KZHA 4UA7A 1AWIA 2L1MA 2GDNA 3GQZA 4GHIB 1VEUA 4C6YA 3FKWA 4EUZA 1YLZA 4K0XA 2W0NA 4R3JA 2Y2KA 2Y4AA 2A49A 4I3AA 2QJ7A 2PR6A 2PD7A 5L07A 4LV2A 5IHVA 3DTKA 3C2WA 5GHXA 2HDQA 4LRYC 2WAFA 2RL3A 4L0LA 4PAUA 4O01A 1TS6A 1J3WA 4HJ6A 5G4ZA 3E98A 1NRJA 3UDXA 1Q2PA 3LI8A 4I3JA 3MXRA 2ZC5B 4OOLA 3CWFA 3CAXA 2CMNA 3BM6A 1SHVA 1VB6A 3LEQA 5FQQA 2L4RA 3FPWA 3VSKA 1HLUP 3UN7A 2XSSA 3VMAA 5DFXA 1GHIA 1JVJA 2O9AA 1C3BA 3PBQA 2A3UA 3QP2A 4L9FA 3HLWA 3Q7ZA 2JCHA 2I72A 4KQQA 2IA2A 4L9GA 5EVEA 4X56A 4ETXA 1H8ZA 5HAQA 2P9VA 1BLPA 1U60A 2Y2IA 2R9WA 4MCWA 1PZOA 2XK1A 3T50A 3ZFZA 4E3KA 5EECA 1ERMA 3MMHA 3ZG9B 5CRFA 2WGIA 3LR0A 4S2NC 5DF9A 2XA7M 3HUMA 1S67L 4ARZB 3MQOA 1FSYA 2P74A 5AVEA 4HESA 4WELA 2M7UA 4D2OA 2ZQ7A 4HJ4A 5M18A 2OOLA 5AVFA 3OCLA 1Z09A 3UDFA 1S0WA 4C3QA 3E2KA 1ESIA 2PBYA 1Y28A 1N9OA 4BBVA 5CXWA 3BQAA 3PBOA 1K57C 2Y2OA 3T4JA 2KOIA 4JF4A 1V9ZA 2OV5A 3H82B 4IUHA 4GHIA 4GJ4A 4ESPA 4FD8A 3JVVA 1L0FA 4EWFA 1BZAA 1LHYA 3MXSA 4Q0HA 3O5YA 2GJ3A 3M6BA 2H28A 4QD4A 1MWSA 5CHJA 4KG5A 3DTMA 3NI9A 3V50A 2W3HA 4GKUA 1XFNA 1PZPA 4CQHA 5J3WA 2V8CA 2GZAA 5FEFA 1GSVA 3K3CA 3VP3A 5BOHA 1S4RA 2V2FF 4S2KA 4JXGA 5J7EA 3C38A 3OC2A 2WYXA 1IYSA 3KSIA 2PYPA 1T1BA 2EX8A 3A0SA 3E4PA 2I9VA 5G4YA 5EVIA 5HFOA 3MF0A 3GRJA 3UE1A 3MKFA 4I3IA 3IF6C 3B3XA 2V0WA 2ZC4B 4EUVA 2PYRA 3S4XA 4Q0IA 3LIBA 3BLMA 4BENA 1L0GA 1HD8A 5L2FA 4KZ7A 4KZ4A 2HV1A 1O07A 3FC7A 3ITAA 4HH2A 1YLTA 4KQDA 2VK3A 1DP8A 2H5SA 2EX2A 4OKPA 3SS3A 1BUEA 4PM8A 4Y3IA 1SKFA 4RX3A 4DKIA 1XA1A 4G3KA 3VE4A 5F82A 2XROA 1DRMA 4KUKA 3UE6A 1S4SA 1LSVA 1YQSA 4Y0TA 3LUQA 3K2NA 2CC1A 1ONGA 3V39A 3T1XA 1PFLA 3G4PA 5DVAA 2HPBA 5FQMA 2V0UA 1KGEA 1TF1A 1VETA 3E4QA 1GSXA 1A0KA 3GTCA 2KX6A 1I2SA 1E3UD 1YLWA 4IJGA 5GLAA 1T19A
chains in the Genus database with same CATH topology
1EWZA 2ZQAA 2Y2HA 3HLEA 4BLMA 4S2MA 4OPZA 4F94A 2J9PA 3C5AA 1KE4A 1MBLA 1BLHA 2OSUA 5DTSA 3C7VA 3IXHA 3WS5A 3ZVTA 3BYDA 4GZBA 4WZ4A 1CI9A 2ZM8A 5FA7A 2XH9A 2ZQCA 1FCOA 3ZVWA 3Q82A 3BFFA 2WUQA 3VOYA 4E3JA 4Y7PA 5GL9A 1TDGA 2UWXA 3CZDA 2PU2A 2HP5A 1JTDA 1FCNA 1SCWA 1TVFA 4LCMA 1L2SA 3HBRA 4WEKA 2XF3A 3PTEA 4ZJ3A 2Y55A 4WZ5A 5A93A 1XX2A 4QB8A 3SS4A 4EBLA 1XGJA 4ZJ1A 2ZD8A 5U47A 4S2LA 5FI2A 3O88A 1ZG4A 3FZCA 3G30A 1K6RA 5F1FA 4WM9A 1ES2A 3QNBA 2ZC3B 4OLGA 1NZOA 1JTGA 3LO7A 4C75A 1KE0A 4DXCA 1DJAA 2J8YA 4OPQA 4WMCD 3P09A 4E3IA 5KSCA 4S2OA 3TOIA 4LV3A 4OP5A 4S2IA 4E6WA 4GD6A 4KQOA 4OP8A 4JF6A 4DDYA 4ZJ2A 3FKVA 3VP1A 1PI5A 4EQIA 2WADA 1NRFA 3SS5A 3PBSA 5G18A 1K55C 2Y2LA 3N6IA 5HL1A 1YMSA 2WAEA 2Y91A 5KSHA 1AXBA 5GLBA 3HLDA 3WRTA 2PU4A 3O86A 1IEMA 1NYYA 3C4PA 4IVIA 3HLBA 2XQZA 2WK0A 3HUNA 1WYBA 3HL9A 4GDBA 3ZHHA 5HAIA 3IF6A 2Y2MA 4ID4A 3MZDA 1WE4A 4QY5A 4IBXA 5CEDA 4IVKA 5E2GA 5AQ7A 5TGFA 1RCJA 5EVIB 1S6RA 3SH9A 3SH8A 3Q81A 4N9KA 2ZC7A 3MBZA 1KGFA 5CHMA 4Z9QA 4B88A 3OPPA 4M3KA 4A5RA 2DNSA 3S1YA 3Q7VA 3A3IA 4B4XA 3AGDA 1PIOA 1GA0A 1FCMA 2BG1A 5CHUA 2WGWA 1MPLA 2Y2QA 3BFDA 3A3EA 3NBLA 4JXSA 1BLCA 1W8YA 1IELA 1NXYA 2H10A 1DY6A 4OOYA 3IXGA 1L0EA 3BFGA 4KZAA 5A92A 3G31A 3NCKA 3OPRA 4QY6A 2X71A 4UA6A 1DJCA 2HP9A 4X6TA 5FQJA 1ES5A 4WEJA 3PBTA 2C6WB 2XDMA 1IYOA 4RYEA 5EUAA 2XGNA 2VGKA 1K55A 2OLVA 1N9BA 3EQVA 2G2WA 3Q7VB 5FAQA 4N1HA 3WS4A 3JYIA 1I5QA 1PYYA 4U3TA 3IH8A 4E6XA 1K4FA 5I94A 1Z6FA 1LLBA 5CEBA 5CECA 2Y2JA 4P87A 4HBUA 5EPHA 4R0QA 4KZ3A 4RA7A 3LEZA 3ZCZA 2QPNA 4U0TA 3BECA 5CTNA 5HAPA 4GN2A 2Z2MB 1G68A 5AQAA 5E43A 1MWRA 5TFQA 3ITBA 3TSGA 4KZ8A 2J9OA 4DE2A 5JYOA 2XR0A 1K57A 3VFFA 3DW0A 3ZGAB 1RGYA 2XD1A 3N8SA 3UDIA 2X02A 4GNUA 3UE3A 4E3LA 3E2LA 4E3OA 4DRTA 5HX9A 4LV1A 4MBFA 4DE3A 4N1XA 4DF6A 4DE1A 1W7FA 5KZHA 3AGFA 4UA7A 1PWGA 2ZC6B 3D4FA 3CJMA 4JF5A 3WRZA 5JYPA 1FSWA 4OVDA 3NIAA 3O3VA 2HDSA 4XUZA 4YINA 5M19A 2GDNA 2E8IA 1TEMA 2DCFA 1O7EA 3N4IA 3OCNA 3GQZA 4OPRA 4H8RA 5AQBA 3UY6A 4C6YA 4BQMA 1RP5A 4X55A 3SH7A 3FKWA 2XFTA 4EUZA 4UAAA 3QNCA 1YLZA 4K0XA 4R3JA 3IXDA 3VP4A 2Y2KA 5GLCA 3FYZA 4NK3A 3FV7A 3W4QA 4CPKA 2Y2NA 4P85A 2Y4AA 2A49A 5FAPA 2EXAA 2ZQDA 4JXWA 3HREA 3PBRA 3DWKA 4LCLA 3QHYA 4LV2A 5IHVA 4KZ5A 5GHXA 1RGZA 3LCEA 2HDQA 2WAFA 4DE0A 2RL3A 3V3SA 3ZNYA 4L0LA 2JE5A 3PAGA 4N9LA 5EVIC 1ONHA 3EQUA 4DDSA 5EE8A 4K91A 3UO9A 3BRMA 3G2ZA 4WYYA 3ZNTA 2XEPA 3UDXA 1Q2PA 3VOZA 4HEFA 4R1GA 1L0DA 4UHUA 3MXRA 2ZC5B 4OOLA 2WKIA 3W8KA 2VGJA 3G35A 3M2KA 1PI4A 3BM6A 1SHVA 4XUXA 5A91A 1BLSA 5FQQA 1MY8A 4E3NA 2JC7A 3UNWA 1XXMA 2WKEA 3LY4A 3GV9A 3VSKA 1XPBA 1K54A 1LL9A 4KZ6A 1I2WA 3UN7A 1ES3A 3VMAA 5HARA 1GHIA 1JVJA 5DF8A 1C3BA 3Q07A 3GVBA 3PBQA 3VSLA 4QJGA 1XA7A 1CI8A 2A3UA 1GHPA 4UA9A 3HLWA 3Q7ZA 5EOOA 2JCHA 2I72A 4KQQA 4ZBEA 3UPOA 1Y54A 5EVLA 1CK3A 4S2PA 4X56A 1ZKJA 1E3UA 1H8ZA 5HAQA 5M1AA 2P9VA 4HBTA 1BSGA 3TG9A 1BLPA 1U60A 2Y2IA 3G32A 4PM9A 4PM7A 1IYPA 4DXBA 4GOGA 4OLDA 2R9WA 4EV4A 1BULA 3W4OA 3N8LA 2Z2LB 5FI7A 3W4PA 2ZJ9A 1PZOA 2XK1A 3NY4A 2J7VA 2WGWB 2WZXA 3ZFZA 5FAOA 5FQIA 3C7UA 5EECA 4E3KA 3WS1A 1ERMA 4OPYA 1MWTA 3MZEA 2OLUA 4PPRA 3ZG9B 5CRFA 3VFHA 1BT5A 2WGIA 4S2NC 4RX2A 5DF9A 5EVID 5CTMA 2R9XA 4BL2A 5DF7A 1NY0A 5TR7A 1SDEA 3HUMA 4WBGA 4R4SA 3GSGA 1KVMA 1FR1A 1WYCA 5HW3A 2WKHA 5DTKA 1FSYA 2P74A 4HESA 4WELA 4D2OA 3ZG7B 2ZQ7A 1K4EA 3HLFA 4JBFA 4ZAMA 4BJPA 1JWZA 1LI9A 3OZHA 4B4ZA 1VM1A 3RJUA 5M18A 3ZDJA 2ZQ8A 4OQGA 1Q2QA 4IBRA 1LI0A 3G34A 3OCLA 4CJNA 3UDFA 1K25A 1PWDA 3N7WA 1S0WA 3IHBA 5FATA 2Q9NA 3VP0A 4C3QA 3E2KA 1FQGA 3HUOA 4OOMA 3HLCA 4QHCA 4E3MA 5GHYA 1XGIA 2ZMAA 4FH2A 4Q8IA 4OQ0A 1ESIA 3WS0A 4LV0A 2PBYA 5F83A 3A3JA 1KE3A 1QMEA 5CXWA 3PBOA 5KMWA 1K57C 3NDEA 2Y2OA 1SDNA 4JF4A 4QU3A 3V5MA 4ZTKA 1KGGA 2OV5A 1N4OA 2HDRA 2IWCA 2ZLYA 4FD8A 2QZ6A 3M2JA 4JXVA 1L0FA 3NC8A 5FI6A 2IWBA 1XP4A 3IF6B 4EWFA 1K56D 2HDUA 1BZAA 1YLPA 4MEZA 4Y0OA 3CG5A 4MNRA 2B5RA 3ZG8B 4KG6A 1LHYA 3MXSA 4P6BA 4KENB 1PW8A 1NYMA 3BLSA 2X01A 2ZM2A 3OPHA 5E2HA 3M6BA 3ISGA 2HP6A 4S2JA 4QD4A 1MWSA 3RXXA 2C5WB 1MXOA 1MWUA 1NJ4A 3S22A 3NDGA 1OMEA 5CHJA 4KG5A 2WGVA 3IHAA 4KZ9A 1MKIA 1GA9A 3DTMA 3IT9A 3NI9A 3V50A 1W5DA 5FQ9A 3IH9A 4N92A 1YMXA 4GKUA 5FDHA 3GR2A 1PZPA 5FQKA 5F1GA 2XLNA 4GB7A 3FWLA 4PMAA 4WZ5C 4FH4A 1BTLA 1ZG6A 1IYQA 3WS2A 4P0MA 3CMZA 3VP3A 5BOHA 5CGSA 1JWPA 3IWOA 2V2FF 3BFCA 4S2KA 2BLSA 1PWCA 4X53A 3V3RA 4JXGA 1IKGA 1H5XA 4KQRA 1J9MA 1HVBA 1CEGA 2EX9A 2ZM0A 4GD8A 4OQIA 4OONA 4O7DA 1VQQA 1KDWA 2DRWA 3OC2A 2WYXA 1IYSA 3A3DA 3IWQA 2RCXA 2WZZA 4BD1A 2EX8A 4JPMA 1FOFA 1K6SA 5FSRA 4JKTA 3IXBA 3IQAA 3MFDA 5EVIA 5HFOA 1K38A 4BL3A 2Y2GA 1GHMA 3GRJA 1CEFA 1IKIA 3UE1A 5D3OA 3IF5A 3MKFA 3IF6C 1YLYA 2Q9MA 3B3XA 2V20A 3C4OA 2EFXA 5J8XA 3GMWA 4IEDA 2EFUA 2ZC4B 2IWDA 3S4XA 1K54C 1W8QA 4U0XA 3I7JA 3AGEA 3HVFA 3BLMA 4BENA 1L0GA 1HD8A 5L2FA 4KZ7A 5EOEA 3UE0A 2FFYA 4KZ4A 4OQHA 4R23A 3WWXA 1KVLA 1O07A 1ERQA 2EX6A 3OPLA 3ITAA 4R3BA 1M6KA 3ZG0A 2V1ZA 3VP2A 1YLJA 2Y59A 1M40A 3PAEA 1G6AA 4RVAA 3SOIA 1E25A 1YLTA 4X69A 1DJBA 4EBNA 3BEBA 1FR6A 2H0TA 4KZBA 1E4DA 5E2EA 1QMFA 5CGWA 4OH0A 4XXRA 1XKZA 2EX2A 1EROA 2H5SA 4MBKA 4OKPA 4S2NA 3DWZA 4EBPA 3SS3A 4FSFA 1KDSA 1TDLA 1BUEA 4PM8A 1GCEA 1JWVA 1YM1A 2P9VB 4K0WA 4Y0UA 3UPNA 1ALQA 3P98A 4GDNA 1SKFA 4RX3A 4BD0A 4DKIA 4FCFA 4YFMA 5FASA 2XFSA 1XA1A 5AQ9A 1K56A 5F82A 3RXWA 3N8RA 1PW1A 1HTZA 4NETA 3UPPA 5CGXA 2EXBA 1EI5A 3MKEA 1YQSA 4LENA 5GHZA 4X68A 5DTTA 4Y0TA 1H8YA 2ZQ9A 1HZOA 2CC1A 3PBNA 1ONGA 5GLDA 1LL5A 3V39A 3O87A 3A3FA 2H0YA 2JBFA 2QMIA 3HLGA 5A90A 4MBHA 4KG2A 3G4PA 5DVAA 2XD5A 2FFFB 3LY3A 2HPBA 1YT4A 3IWIA 5FQMA 1KGEA 4PM5A 3MZFA 5E2FA 2Y2PA 4R4RA 3Q1FA 3M6HA 1NZUA 3G2YA 3GTCA 1ESUA 2G2UA 4PM6A 1I2SA 1E3UD 4ZDXA 4WMCA 1ES4A 5CERA 3ZG5A 1W79A 1YLWA 3BFEA 4JLFA 5GLAA 1ZC2A 4MLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWZ A;  2ZQA A;  2Y2H A;  3HLE A;  4BLM A;  4S2M A;  4OPZ A;  4F94 A;  2J9P A;  3C5A A;  1KE4 A;  1MBL A;  1BLH A;  2OSU A;  5DTS A;  3C7V A;  3IXH A;  3WS5 A;  3ZVT A;  3BYD A;  4GZB A;  4WZ4 A;  1CI9 A;  2ZM8 A;  5FA7 A;  2XH9 A;  2ZQC A;  1FCO A;  3ZVW A;  3Q82 A;  3BFF A;  2WUQ A;  3VOY A;  4E3J A;  4Y7P A;  5GL9 A;  1TDG A;  2UWX A;  3CZD A;  2PU2 A;  2HP5 A;  1JTD A;  1FCN A;  1SCW A;  1TVF A;  4LCM A;  1L2S A;  3HBR A;  4WEK A;  2XF3 A;  3PTE A;  4ZJ3 A;  2Y55 A;  4WZ5 A;  5A93 A;  1XX2 A;  4QB8 A;  3SS4 A;  4EBL A;  1XGJ A;  4ZJ1 A;  2ZD8 A;  5U47 A;  4S2L A;  5FI2 A;  3O88 A;  1ZG4 A;  3FZC A;  3G30 A;  1K6R A;  5F1F A;  4WM9 A;  1ES2 A;  3QNB A;  2ZC3 B;  4OLG A;  1NZO A;  1JTG A;  3LO7 A;  4C75 A;  1KE0 A;  4DXC A;  1DJA A;  2J8Y A;  4OPQ A;  4WMC D;  3P09 A;  4E3I A;  5KSC A;  4S2O A;  3TOI A;  4LV3 A;  4OP5 A;  4S2I A;  4E6W A;  4GD6 A;  4KQO A;  4OP8 A;  4JF6 A;  4DDY A;  4ZJ2 A;  3FKV A;  3VP1 A;  1PI5 A;  4EQI A;  2WAD A;  1NRF A;  3SS5 A;  3PBS A;  5G18 A;  1K55 C;  2Y2L A;  3N6I A;  5HL1 A;  1YMS A;  2WAE A;  2Y91 A;  5KSH A;  1AXB A;  5GLB A;  3HLD A;  3WRT A;  2PU4 A;  3O86 A;  1IEM A;  1NYY A;  3C4P A;  4IVI A;  3HLB A;  2XQZ A;  2WK0 A;  3HUN A;  1WYB A;  3HL9 A;  4GDB A;  3ZHH A;  5HAI A;  3IF6 A;  2Y2M A;  4ID4 A;  3MZD A;  1WE4 A;  4QY5 A;  4IBX A;  5CED A;  4IVK A;  5E2G A;  5AQ7 A;  5TGF A;  1RCJ A;  5EVI B;  1S6R A;  3SH9 A;  3SH8 A;  3Q81 A;  4N9K A;  2ZC7 A;  3MBZ A;  1KGF A;  5CHM A;  4Z9Q A;  4B88 A;  3OPP A;  4M3K A;  4A5R A;  2DNS A;  3S1Y A;  3Q7V A;  3A3I A;  4B4X A;  3AGD A;  1PIO A;  1GA0 A;  1FCM A;  2BG1 A;  5CHU A;  2WGW A;  1MPL A;  2Y2Q A;  3BFD A;  3A3E A;  3NBL A;  4JXS A;  1BLC A;  1W8Y A;  1IEL A;  1NXY A;  2H10 A;  1DY6 A;  4OOY A;  3IXG A;  1L0E A;  3BFG A;  4KZA A;  5A92 A;  3G31 A;  3NCK A;  3OPR A;  4QY6 A;  2X71 A;  4UA6 A;  1DJC A;  2HP9 A;  4X6T A;  5FQJ A;  1ES5 A;  4WEJ A;  3PBT A;  2C6W B;  2XDM A;  1IYO A;  4RYE A;  5EUA A;  2XGN A;  2VGK A;  1K55 A;  2OLV A;  1N9B A;  3EQV A;  2G2W A;  3Q7V B;  5FAQ A;  4N1H A;  3WS4 A;  3JYI A;  1I5Q A;  1PYY A;  4U3T A;  3IH8 A;  4E6X A;  1K4F A;  5I94 A;  1Z6F A;  1LLB A;  5CEB A;  5CEC A;  2Y2J A;  4P87 A;  4HBU A;  5EPH A;  4R0Q A;  4KZ3 A;  4RA7 A;  3LEZ A;  3ZCZ A;  2QPN A;  4U0T A;  3BEC A;  5CTN A;  5HAP A;  4GN2 A;  2Z2M B;  1G68 A;  5AQA A;  5E43 A;  1MWR A;  5TFQ A;  3ITB A;  3TSG A;  4KZ8 A;  2J9O A;  4DE2 A;  5JYO A;  2XR0 A;  1K57 A;  3VFF A;  3DW0 A;  3ZGA B;  1RGY A;  2XD1 A;  3N8S A;  3UDI A;  2X02 A;  4GNU A;  3UE3 A;  4E3L A;  3E2L A;  4E3O A;  4DRT A;  5HX9 A;  4LV1 A;  4MBF A;  4DE3 A;  4N1X A;  4DF6 A;  4DE1 A;  1W7F A;  5KZH A;  3AGF A;  4UA7 A;  1PWG A;  2ZC6 B;  3D4F A;  3CJM A;  4JF5 A;  3WRZ A;  5JYP A;  1FSW A;  4OVD A;  3NIA A;  3O3V A;  2HDS A;  4XUZ A;  4YIN A;  5M19 A;  2GDN A;  2E8I A;  1TEM A;  2DCF A;  1O7E A;  3N4I A;  3OCN A;  3GQZ A;  4OPR A;  4H8R A;  5AQB A;  3UY6 A;  4C6Y A;  4BQM A;  1RP5 A;  4X55 A;  3SH7 A;  3FKW A;  2XFT A;  4EUZ A;  4UAA A;  3QNC A;  1YLZ A;  4K0X A;  4R3J A;  3IXD A;  3VP4 A;  2Y2K A;  5GLC A;  3FYZ A;  4NK3 A;  3FV7 A;  3W4Q A;  4CPK A;  2Y2N A;  4P85 A;  2Y4A A;  2A49 A;  5FAP A;  2EXA A;  2ZQD A;  4JXW A;  3HRE A;  3PBR A;  3DWK A;  4LCL A;  3QHY A;  4LV2 A;  5IHV A;  4KZ5 A;  5GHX A;  1RGZ A;  3LCE A;  2HDQ A;  2WAF A;  4DE0 A;  2RL3 A;  3V3S A;  3ZNY A;  4L0L A;  2JE5 A;  3PAG A;  4N9L A;  5EVI C;  1ONH A;  3EQU A;  4DDS A;  5EE8 A;  4K91 A;  3UO9 A;  3BRM A;  3G2Z A;  4WYY A;  3ZNT A;  2XEP A;  3UDX A;  1Q2P A;  3VOZ A;  4HEF A;  4R1G A;  1L0D A;  4UHU A;  3MXR A;  2ZC5 B;  4OOL A;  2WKI A;  3W8K A;  2VGJ A;  3G35 A;  3M2K A;  1PI4 A;  3BM6 A;  1SHV A;  4XUX A;  5A91 A;  1BLS A;  5FQQ A;  1MY8 A;  4E3N A;  2JC7 A;  3UNW A;  1XXM A;  2WKE A;  3LY4 A;  3GV9 A;  3VSK A;  1XPB A;  1K54 A;  1LL9 A;  4KZ6 A;  1I2W A;  3UN7 A;  1ES3 A;  3VMA A;  5HAR A;  1GHI A;  1JVJ A;  5DF8 A;  1C3B A;  3Q07 A;  3GVB A;  3PBQ A;  3VSL A;  4QJG A;  1XA7 A;  1CI8 A;  2A3U A;  1GHP A;  4UA9 A;  3HLW A;  3Q7Z A;  5EOO A;  2JCH A;  2I72 A;  4KQQ A;  4ZBE A;  3UPO A;  1Y54 A;  5EVL A;  1CK3 A;  4S2P A;  4X56 A;  1ZKJ A;  1E3U A;  1H8Z A;  5HAQ A;  5M1A A;  2P9V A;  4HBT A;  1BSG A;  3TG9 A;  1BLP A;  1U60 A;  2Y2I A;  3G32 A;  4PM9 A;  4PM7 A;  1IYP A;  4DXB A;  4GOG A;  4OLD A;  2R9W A;  4EV4 A;  1BUL A;  3W4O A;  3N8L A;  2Z2L B;  5FI7 A;  3W4P A;  2ZJ9 A;  1PZO A;  2XK1 A;  3NY4 A;  2J7V A;  2WGW B;  2WZX A;  3ZFZ A;  5FAO A;  5FQI A;  3C7U A;  5EEC A;  4E3K A;  3WS1 A;  1ERM A;  4OPY A;  1MWT A;  3MZE A;  2OLU A;  4PPR A;  3ZG9 B;  5CRF A;  3VFH A;  1BT5 A;  2WGI A;  4S2N C;  4RX2 A;  5DF9 A;  5EVI D;  5CTM A;  2R9X A;  4BL2 A;  5DF7 A;  1NY0 A;  5TR7 A;  1SDE A;  3HUM A;  4WBG A;  4R4S A;  3GSG A;  1KVM A;  1FR1 A;  1WYC A;  5HW3 A;  2WKH A;  5DTK A;  1FSY A;  2P74 A;  4HES A;  4WEL A;  4D2O A;  3ZG7 B;  2ZQ7 A;  1K4E A;  3HLF A;  4JBF A;  4ZAM A;  4BJP A;  1JWZ A;  1LI9 A;  3OZH A;  4B4Z A;  1VM1 A;  3RJU A;  5M18 A;  3ZDJ A;  2ZQ8 A;  4OQG A;  1Q2Q A;  4IBR A;  1LI0 A;  3G34 A;  3OCL A;  4CJN A;  3UDF A;  1K25 A;  1PWD A;  3N7W A;  1S0W A;  3IHB A;  5FAT A;  2Q9N A;  3VP0 A;  4C3Q A;  3E2K A;  1FQG A;  3HUO A;  4OOM A;  3HLC A;  4QHC A;  4E3M A;  5GHY A;  1XGI A;  2ZMA A;  4FH2 A;  4Q8I A;  4OQ0 A;  1ESI A;  3WS0 A;  4LV0 A;  2PBY A;  5F83 A;  3A3J A;  1KE3 A;  1QME A;  5CXW A;  3PBO A;  5KMW A;  1K57 C;  3NDE A;  2Y2O A;  1SDN A;  4JF4 A;  4QU3 A;  3V5M A;  4ZTK A;  1KGG A;  2OV5 A;  1N4O A;  2HDR A;  2IWC A;  2ZLY A;  4FD8 A;  2QZ6 A;  3M2J A;  4JXV A;  1L0F A;  3NC8 A;  5FI6 A;  2IWB A;  1XP4 A;  3IF6 B;  4EWF A;  1K56 D;  2HDU A;  1BZA A;  1YLP A;  4MEZ A;  4Y0O A;  3CG5 A;  4MNR A;  2B5R A;  3ZG8 B;  4KG6 A;  1LHY A;  3MXS A;  4P6B A;  4KEN B;  1PW8 A;  1NYM A;  3BLS A;  2X01 A;  2ZM2 A;  3OPH A;  5E2H A;  3M6B A;  3ISG A;  2HP6 A;  4S2J A;  4QD4 A;  1MWS A;  3RXX A;  2C5W B;  1MXO A;  1MWU A;  1NJ4 A;  3S22 A;  3NDG A;  1OME A;  5CHJ A;  4KG5 A;  2WGV A;  3IHA A;  4KZ9 A;  1MKI A;  1GA9 A;  3DTM A;  3IT9 A;  3NI9 A;  3V50 A;  1W5D A;  5FQ9 A;  3IH9 A;  4N92 A;  1YMX A;  4GKU A;  5FDH A;  3GR2 A;  1PZP A;  5FQK A;  5F1G A;  2XLN A;  4GB7 A;  3FWL A;  4PMA A;  4WZ5 C;  4FH4 A;  1BTL A;  1ZG6 A;  1IYQ A;  3WS2 A;  4P0M A;  3CMZ A;  3VP3 A;  5BOH A;  5CGS A;  1JWP A;  3IWO A;  2V2F F;  3BFC A;  4S2K A;  2BLS A;  1PWC A;  4X53 A;  3V3R A;  4JXG A;  1IKG A;  1H5X A;  4KQR A;  1J9M A;  1HVB A;  1CEG A;  2EX9 A;  2ZM0 A;  4GD8 A;  4OQI A;  4OON A;  4O7D A;  1VQQ A;  1KDW A;  2DRW A;  3OC2 A;  2WYX A;  1IYS A;  3A3D A;  3IWQ A;  2RCX A;  2WZZ A;  4BD1 A;  2EX8 A;  4JPM A;  1FOF A;  1K6S A;  5FSR A;  4JKT A;  3IXB A;  3IQA A;  3MFD A;  5EVI A;  5HFO A;  1K38 A;  4BL3 A;  2Y2G A;  1GHM A;  3GRJ A;  1CEF A;  1IKI A;  3UE1 A;  5D3O A;  3IF5 A;  3MKF A;  3IF6 C;  1YLY A;  2Q9M A;  3B3X A;  2V20 A;  3C4O A;  2EFX A;  5J8X A;  3GMW A;  4IED A;  2EFU A;  2ZC4 B;  2IWD A;  3S4X A;  1K54 C;  1W8Q A;  4U0X A;  3I7J A;  3AGE A;  3HVF A;  3BLM A;  4BEN A;  1L0G A;  1HD8 A;  5L2F A;  4KZ7 A;  5EOE A;  3UE0 A;  2FFY A;  4KZ4 A;  4OQH A;  4R23 A;  3WWX A;  1KVL A;  1O07 A;  1ERQ A;  2EX6 A;  3OPL A;  3ITA A;  4R3B A;  1M6K A;  3ZG0 A;  2V1Z A;  3VP2 A;  1YLJ A;  2Y59 A;  1M40 A;  3PAE A;  1G6A A;  4RVA A;  3SOI A;  1E25 A;  1YLT A;  4X69 A;  1DJB A;  4EBN A;  3BEB A;  1FR6 A;  2H0T A;  4KZB A;  1E4D A;  5E2E A;  1QMF A;  5CGW A;  4OH0 A;  4XXR A;  1XKZ A;  2EX2 A;  1ERO A;  2H5S A;  4MBK A;  4OKP A;  4S2N A;  3DWZ A;  4EBP A;  3SS3 A;  4FSF A;  1KDS A;  1TDL A;  1BUE A;  4PM8 A;  1GCE A;  1JWV A;  1YM1 A;  2P9V B;  4K0W A;  4Y0U A;  3UPN A;  1ALQ A;  3P98 A;  4GDN A;  1SKF A;  4RX3 A;  4BD0 A;  4DKI A;  4FCF A;  4YFM A;  5FAS A;  2XFS A;  1XA1 A;  5AQ9 A;  1K56 A;  5F82 A;  3RXW A;  3N8R A;  1PW1 A;  1HTZ A;  4NET A;  3UPP A;  5CGX A;  2EXB A;  1EI5 A;  3MKE A;  1YQS A;  4LEN A;  5GHZ A;  4X68 A;  5DTT A;  4Y0T A;  1H8Y A;  2ZQ9 A;  1HZO A;  2CC1 A;  3PBN A;  1ONG A;  5GLD A;  1LL5 A;  3V39 A;  3O87 A;  3A3F A;  2H0Y A;  2JBF A;  2QMI A;  3HLG A;  5A90 A;  4MBH A;  4KG2 A;  3G4P A;  5DVA A;  2XD5 A;  2FFF B;  3LY3 A;  2HPB A;  1YT4 A;  3IWI A;  5FQM A;  1KGE A;  4PM5 A;  3MZF A;  5E2F A;  2Y2P A;  4R4R A;  3Q1F A;  3M6H A;  1NZU A;  3G2Y A;  3GTC A;  1ESU A;  2G2U A;  4PM6 A;  1I2S A;  1E3U D;  4ZDX A;  4WMC A;  1ES4 A;  5CER A;  3ZG5 A;  1W79 A;  1YLW A;  3BFE A;  4JLF A;  5GLA A;  1ZC2 A;  4MLL A; 
#chains in the Genus database with same CATH topology
 1P97 A;  4DJ3 A;  1TS0 A;  2KLI A;  3HLE A;  3IX3 A;  4OPZ A;  2J9P A;  2B95 A;  3K3D A;  3CUE A;  3WS5 A;  4HNB A;  2ZL1 B;  1CI9 A;  5FA7 A;  5GL9 A;  1FCN A;  1SCW A;  1L2S A;  4WEK A;  2W3G A;  4WZ5 A;  5A93 A;  4ZJ1 A;  3S7P A;  1K6R A;  1ES2 A;  3QNB A;  1NZO A;  1JTG A;  3BW6 A;  3D72 A;  1ZTU A;  1D7E A;  4IUK A;  3F1O A;  2ZOH A;  4OP5 A;  4E6W A;  4DDY A;  5HWW A;  1CF0 A;  2NUT C;  4JF6 A;  1UWN X;  2NUP C;  2HZ5 A;  1PI5 A;  1AXB A;  2PU4 A;  1IEM A;  3PHY A;  2XQZ A;  4I39 A;  4GDB A;  3ZHH A;  4LPZ A;  2K2N A;  1IOU A;  1CJF A;  1WE4 A;  1STZ A;  5TGF A;  1S6R A;  3SH9 A;  3SH8 A;  4N9K A;  3MBZ A;  1KGF A;  4M3K A;  3S1Y A;  2W3F A;  4B4X A;  1VEU B;  1K0K A;  3AGD A;  1GA0 A;  1BYW A;  4DN0 A;  2WGW A;  3BFD A;  3NBL A;  3IX4 A;  1NXY A;  4WLA A;  1DY6 A;  4OOY A;  3BFG A;  4UA6 A;  1OJ5 A;  2W1R A;  4N1H A;  1K4F A;  4P87 A;  3LEZ A;  3ZCZ A;  4U0T A;  2Z2M B;  4YOF A;  1PRQ A;  1G68 A;  4UQI M;  4DE2 A;  3QP4 A;  3VFF A;  2XD1 A;  2JKT I;  2X02 A;  1W63 Q;  1G28 A;  4DE3 A;  4DF6 A;  1W7F A;  4OVD A;  4YIN A;  4BWI A;  3R7W B;  5M19 A;  2E8I A;  4FOF A;  1FIK A;  1TEM A;  3OCN A;  2VGL M;  4OPR A;  3UB5 P;  4BQM A;  4NXF A;  3KYE A;  3QNC A;  4NEE D;  4P6Z S;  3VP4 A;  1H3Q A;  5HSQ A;  5GLC A;  1XJ6 A;  2Y2N A;  4P85 A;  2Q0O A;  1G6O A;  3E4O A;  3DWK A;  3QHY A;  4BBT A;  1RGZ A;  3BY8 A;  3TE8 A;  3V3S A;  3MFX A;  3UB7 A;  1XJ2 A;  1ONH A;  4DDS A;  4K91 A;  3BRM A;  3VOZ A;  1L0D A;  4HH3 A;  4UHU A;  4EET B;  2LB9 A;  2B02 A;  1OTE A;  3W8K A;  3M2K A;  3HCY A;  3IS2 B;  3BJN A;  1MY8 A;  2JC7 A;  1OTI A;  1XXM A;  3GV9 A;  1XPB A;  3LR4 A;  5DF8 A;  4R6L A;  4DJ2 A;  3VSL A;  1CI8 A;  4HP4 A;  3T4O A;  4ZBE A;  1ZKJ A;  3B42 A;  3D9Y A;  1XFQ A;  1N9N A;  1IYP A;  1OT9 A;  4GOG A;  1ZHH B;  4WL9 A;  3N8L A;  3W4O A;  2W1T B;  2J7V A;  2WGW B;  2WZX A;  5FQI A;  3WS1 A;  1MWT A;  4PPR A;  1BT5 A;  4MDZ A;  4RX2 A;  5EVI D;  2YKH A;  3LR3 A;  2R9X A;  4BL2 A;  1NY0 A;  2O99 A;  5TR7 A;  3GSG A;  3NOU C;  1FR1 A;  5DTK A;  1LSX A;  3ZG7 B;  3JPU A;  3HLF A;  3UB8 A;  2PRF A;  2ZQ8 A;  3G34 A;  2HGV A;  3IHB A;  5DJU A;  3HUO A;  1XGI A;  4Q8I A;  4OQ0 A;  3WS0 A;  4LV0 A;  3A3J A;  1KE3 A;  1QME A;  5J4E A;  1UWP X;  3IBJ A;  3KX0 X;  5HDD A;  1SDN A;  4CLC E;  3R4K A;  2QYB A;  2O9B A;  4P6Z M;  5K5B A;  3OBF A;  4B93 A;  2QZ6 A;  4JXV A;  2GNX A;  3NOT C;  3NC8 A;  4Y0O A;  2J3T C;  3CG5 A;  4KG6 A;  4P6B A;  1PW8 A;  4I38 A;  1NYM A;  2ZM2 A;  5KIZ A;  5E2H A;  4Q0J A;  1MXO A;  1NJ4 A;  1OME A;  5DFY A;  5IT5 A;  4KZ9 A;  1MKI A;  1GA9 A;  3IT9 A;  1W5D A;  4ZRR A;  2Z6D A;  1YMX A;  4N92 A;  1P0Z A;  4JGP A;  4X1M A;  3FWL A;  4WZ5 C;  3LIC A;  1TS7 A;  3WS2 A;  3CMZ A;  4XT2 B;  1JWP A;  3RFB A;  3BFC A;  2W3D A;  4UQI S;  5I5L A;  2XRN A;  1H5X A;  1CEG A;  2EX9 A;  2ZM0 A;  2M1C A;  1VQQ A;  3VOL A;  4BD1 A;  2WZZ A;  4JPM A;  1K6S A;  1SKO A;  4JKT A;  3BWL A;  3IXB A;  3IQA A;  3CLO A;  1T1C A;  3C8C A;  4BBU A;  1K38 A;  3NOP C;  2Y2G A;  1GHM A;  5CX7 A;  3LIF A;  2Q9M A;  3GMW A;  4MMN A;  4EEU A;  3L7H A;  1W8Q A;  3HVF A;  3UE0 A;  4OQH A;  4R23 A;  3OPL A;  3ZG0 A;  5A8B A;  1YLJ A;  2Y59 A;  1M40 A;  3PAE A;  3SOI A;  1YPR A;  2O9C A;  1FR6 A;  2H0T A;  4KZB A;  1E4D A;  3GEC A;  5E2E A;  3RTY A;  1QMF A;  4JGR A;  5CGW A;  4OH0 A;  5HDS A;  4MBK A;  1ERO A;  1YSP A;  4S2N A;  4EBP A;  3F1P B;  4FSF A;  3HJI A;  1YM1 A;  2P9V B;  4K0W A;  3UPN A;  1P9W A;  2P04 A;  3OLO A;  5FAS A;  5AQ9 A;  1S66 L;  3UPP A;  5CGX A;  1EI5 A;  3CHW P;  3SZT A;  1VHM A;  4LGW A;  3HLG A;  4KG2 A;  2XD5 A;  3DTI A;  3IWI A;  5E2F A;  2Y2P A;  5HL6 A;  3Q1F A;  1NZU A;  4O0P A;  2VA0 A;  4II7 A;  3B33 A;  5CER A;  3ZG5 A;  3A0R A;  4JLF A;  3MSH A;  1GSW A;  1ZC2 A;  4BD0 A;  2Y2H A;  3MXQ A;  3SW1 A;  1KE4 A;  5IS1 A;  1BLH A;  5DTS A;  3BYD A;  2YKF A;  4I5S A;  2PBD P;  4WZ4 A;  5LBR A;  1LT0 A;  2ZQC A;  4AFI A;  3Q82 A;  3VOY A;  4E3J A;  4Y7P A;  1TDG A;  2UWX A;  3CZD A;  1JTD A;  1H0M A;  2ZBB A;  4LCM A;  2UV0 E;  3PTE A;  2Y55 A;  1XX2 A;  4QB8 A;  2ZD8 A;  5U47 A;  3O88 A;  1ZG4 A;  3T4T A;  3FZC A;  2Z6C A;  1T1A A;  2V8F A;  3KSF A;  3LO7 A;  1KE0 A;  4DXC A;  1DJA A;  4OPQ A;  4WMC D;  1TD5 A;  3P09 A;  3TOI A;  4KQO A;  4OP8 A;  1OJG A;  3FKV A;  3VP1 A;  4Y15 A;  2WAD A;  3PBS A;  3RH8 B;  5G18 A;  3CI6 A;  2Y2L A;  3N6I A;  5HL1 A;  1YMS A;  2WAE A;  5GLB A;  4IVI A;  5MC7 A;  2JN7 A;  3HUN A;  4CLC D;  3LFV A;  2Y2M A;  4UEY A;  2GX5 A;  4IVK A;  5E2G A;  1RCJ A;  1N9L A;  1PNE A;  4D60 A;  3Q81 A;  5CHM A;  5C5K A;  3OPP A;  2JKR M;  3MR0 A;  1OTB A;  1MPL A;  3A3E A;  2QKP A;  3BQ8 A;  5HPF A;  1H8M A;  3IXG A;  1L0E A;  3G31 A;  5FQJ A;  1ES5 A;  3QP5 A;  4WEJ A;  3PBT A;  2XGN A;  3NJA A;  1MC0 A;  1K55 A;  3EQV A;  3Q7V B;  3WS4 A;  1I5Q A;  3IH8 A;  4E6X A;  3B47 A;  1SZV A;  2QJ5 A;  3BEC A;  5CTN A;  5HAP A;  5TFQ A;  5E43 A;  3TSG A;  3ITB A;  4KZ8 A;  5JYO A;  2FH5 A;  3UB6 A;  5FL3 A;  3UDI A;  4E3L A;  4E3O A;  4DRT A;  4LV1 A;  4NKP A;  2INW A;  1KOU A;  1PWG A;  2ZC6 B;  3CJM A;  2OWJ A;  3G6O A;  1FSW A;  4WN5 A;  3O3V A;  4X25 A;  1OTA A;  1O7E A;  2DCF A;  3N4I A;  3UY6 A;  3SH7 A;  2XFT A;  4UAA A;  3PR6 A;  3IXD A;  3FYZ A;  4NK3 A;  3T1Q B;  2HJ9 C;  5FAP A;  2EXA A;  3HRE A;  3PBR A;  2XA7 S;  1OTD A;  4LCL A;  4EES A;  3OOV A;  4KZ5 A;  3VV4 A;  2JE5 A;  3PAG A;  4EXO A;  1ODV A;  5HWV A;  3IX8 A;  5EE8 A;  3G2Z A;  4WYY A;  3ZNT A;  2XEP A;  4HEF A;  4R1G A;  3T1R A;  3NUL A;  2WKI A;  5TBM B;  4L9E A;  1PI4 A;  4E3N A;  3UNW A;  3LY4 A;  1K54 A;  2PDR A;  3EGD C;  3IS2 A;  1ES3 A;  5HAR A;  5HD3 A;  3Q07 A;  3GVB A;  3H7W B;  2P08 A;  4QJG A;  1XA7 A;  4UA9 A;  5EOO A;  3ICY A;  3LID A;  5EVL A;  1CK3 A;  4S2P A;  4WUJ A;  5M1A A;  3R7W A;  1DP6 A;  4HBT A;  4PM9 A;  4PM7 A;  4DXB A;  4EV4 A;  1BUL A;  4PKY A;  2Z2L B;  3W4P A;  2ZJ9 A;  3NY4 A;  5FAO A;  4OPY A;  3UME A;  3MZE A;  2OLU A;  2J3W A;  3VFH A;  5CTM A;  5AJG A;  2PD8 A;  2VKS A;  1KVM A;  5HW3 A;  2WKH A;  2AVX A;  2EWV A;  1OT6 A;  2O0Y A;  2WKR A;  3U4L P;  4JBF A;  4BJP A;  1JWZ A;  1VM1 A;  3ZDJ A;  4OQG A;  4IBR A;  1VET B;  4CJN A;  3N7W A;  3T1S A;  1T18 A;  5FAT A;  2Q9N A;  3VP0 A;  4JGQ A;  4HI4 A;  5GHY A;  2ZMA A;  2JKR I;  3LR5 A;  4FUW A;  1ACF A;  5DJT A;  5KMW A;  2PAV P;  4ZTK A;  1KGG A;  4GS9 A;  4HY8 A;  2HDR A;  2IWC A;  3M2J A;  4FTX A;  5FI6 A;  2IWB A;  1XP4 A;  1YKD A;  4Y2F A;  3ZG8 B;  2X01 A;  2PHY A;  3ISG A;  2VX8 A;  4S2J A;  3RXX A;  2C5W B;  3S22 A;  3A0V A;  3ULF A;  5F68 A;  3JVU A;  3NDG A;  2WGV A;  3IHA A;  3NHQ A;  1P9R A;  5FQ9 A;  5F5Y A;  5FDH A;  4R3A A;  3GR2 A;  4PMA A;  2HJE A;  1ZG6 A;  5EFW A;  2KDK A;  5CGS A;  2Y8H A;  2BLS A;  1PWC A;  5L10 A;  5HZH A;  3TRC A;  4IHQ A;  4KQR A;  1J9M A;  4GD8 A;  4OQI A;  4OON A;  4O7D A;  3MS6 A;  2DRW A;  2A24 A;  1D06 A;  4JGO A;  2PT7 A;  1FOF A;  4E04 A;  5EM1 A;  2ACG A;  4BL3 A;  1CEF A;  5D3O A;  2ZMV A;  3IF5 A;  1YLY A;  2V1A A;  2V20 A;  5J8X A;  2IWD A;  1K54 C;  3I7J A;  5F6A A;  3AGE A;  1V9Y A;  3T4K A;  5EOE A;  3WWX A;  4QPR A;  3EOI A;  3PYP A;  2MJ6 A;  1E25 A;  4X69 A;  1DJB A;  3V67 A;  4EBN A;  3BEB A;  4H6J B;  3BY9 A;  4DMZ A;  2W1T A;  4XXR A;  1FIL A;  3DWZ A;  1L3L A;  1KDS A;  1JWV A;  1ALQ A;  1YAX A;  4FCF A;  4HIA A;  4GS9 B;  1K56 A;  3RXW A;  1PW1 A;  4NET A;  3C30 A;  3T12 B;  3LIA A;  3MKE A;  4LEN A;  5GHZ A;  4X68 A;  1XJ4 A;  5DTT A;  1H8Y A;  3E0Y A;  4EW7 A;  1HZO A;  3PBN A;  5GLD A;  3O87 A;  2H0Y A;  2JBF A;  3MQ0 A;  4MBH A;  1LSW A;  1D1J A;  3LY3 A;  4NXE A;  4HP9 A;  1YT4 A;  5FDS A;  4MN7 A;  4NXG A;  4R4R A;  3G2Y A;  4PM6 A;  3T4S A;  1ES4 A;  4F3L A;  2JHE A;  1TS8 A;  1W79 A;  4ARZ A;  2Y2Q A;  4MLL A;  1EWZ A;  2ZQA A;  3S7O A;  4F94 A;  2A24 B;  1MBL A;  2OSU A;  4GZB A;  1FCO A;  3BFF A;  3T4L A;  2PU2 A;  2HP5 A;  1TVF A;  1S1Z A;  2V1B A;  2XF3 A;  4ZJ3 A;  2L0W A;  1X0O A;  1XGJ A;  1DP9 A;  4S2L A;  3GDI A;  5FI2 A;  3H9W A;  4C75 A;  4E3I A;  5KSC A;  3H7W A;  4S2O A;  4S2I A;  4Y5F A;  5L09 A;  4EQI A;  1NRF A;  4HJ3 A;  3HLD A;  3O86 A;  2M7V A;  1NYY A;  3C4P A;  3HLB A;  3F1N A;  1WYB A;  3MZD A;  2OWH A;  4QY5 A;  1WA9 A;  4IBX A;  5AQ7 A;  3UB9 A;  5EM0 A;  3T4Q A;  4ETZ A;  2ZC7 A;  4A5R A;  2DNS A;  4MN6 A;  1JNU A;  3HJK A;  1W63 M;  3CIT A;  4JXS A;  1BLC A;  1IEL A;  2H10 A;  4EQ1 A;  5A92 A;  3LYX A;  3OPR A;  2X71 A;  2BAS A;  4X6T A;  5HPI A;  2XDM A;  5EUA A;  2VGK A;  5FAQ A;  1PYY A;  2VZW A;  3EEH A;  1G5U A;  1LLB A;  5CEC A;  2HF6 A;  2Y2J A;  1MKM A;  4HBU A;  4RA7 A;  2D01 A;  4HQA A;  5AQA A;  4PHT A;  3F1N B;  2XR0 A;  1K57 A;  3ZGA B;  3N8S A;  2VV8 A;  4GNU A;  3E2L A;  5HX9 A;  4MBF A;  4N1X A;  4DE1 A;  3W2Z A;  3AGF A;  4JF5 A;  3D4F A;  5HWT A;  3WRZ A;  5JYP A;  3U2A A;  3NIA A;  2HDS A;  4XUZ A;  2JKT M;  4H8R A;  5AQB A;  2VGL S;  4G3V A;  1RP5 A;  4X55 A;  2VJW A;  5DKK A;  2VLG A;  3W4Q A;  3FV7 A;  4CPK A;  2ZQD A;  4JXW A;  4RQ9 A;  5EV0 A;  3LCE A;  2EA9 A;  4DE0 A;  3ZNY A;  2VV6 A;  2Y79 A;  2WKP A;  3EEA A;  4GW9 A;  4N9L A;  5EVI C;  3EQU A;  3UO9 A;  4G3W A;  4K08 A;  1F98 A;  1MZU A;  2VGJ A;  3G35 A;  4EER A;  4XUX A;  5A91 A;  1BLS A;  3CPT A;  2WKE A;  3KO6 A;  3MJQ A;  4MN5 A;  1LL9 A;  4KZ6 A;  1I2W A;  4Y13 A;  2W27 A;  3L9K A;  4HOI A;  5HDC A;  3QP8 A;  1GHP A;  3EGX C;  4QWO A;  3UPO A;  1Y54 A;  4EEP A;  4LLO B;  1E3U A;  2FZ0 A;  1BSG A;  3LGO A;  3TG9 A;  3G32 A;  4OLD A;  5FI7 A;  4Y17 A;  3C7U A;  2JKG A;  3KSG A;  5DF7 A;  1F2K A;  1SDE A;  1EW0 A;  4WBG A;  4R4S A;  2J3T D;  1WYC A;  5IU1 A;  1K4E A;  1OPX A;  4ZAM A;  1LI9 A;  3OZH A;  4B4Z A;  2W3E A;  3RJU A;  4WF0 A;  5F69 A;  2WKQ A;  1Q2Q A;  1LI0 A;  1K25 A;  1PWD A;  2QHK A;  1FQG A;  4OOM A;  4QHC A;  3HLC A;  4E3M A;  4FH2 A;  3F1O B;  5F83 A;  3PXP A;  3VE3 A;  3NDE A;  4QU3 A;  3V5M A;  4CLC A;  4GLQ A;  1N4O A;  4GCZ A;  2V9A A;  2ZLY A;  2ZMF A;  4BMW A;  3IF6 B;  1K56 D;  2HDU A;  1YLP A;  4MEZ A;  4ME4 A;  4MNR A;  2B5R A;  5FEG A;  4HHD A;  4KEN B;  3BLS A;  3CUE C;  3OPH A;  2VV7 A;  2HP6 A;  3KYZ A;  3DBA A;  1MWU A;  3ZQ5 A;  1SKO B;  3IH9 A;  4LRX C;  3DTE A;  4F3L B;  5FQK A;  5F1G A;  1F5M A;  2XLN A;  4GB7 A;  4FH4 A;  1BTL A;  1IYQ A;  3KYQ A;  3LIE A;  4P0M A;  3TW8 A;  3IWO A;  4KUO A;  4X53 A;  3V3R A;  1IKG A;  1HVB A;  3P01 A;  1KDW A;  3A3D A;  3IWQ A;  2RCX A;  4X1L A;  1CQA A;  5FSR A;  5TJJ A;  3MFD A;  1YSQ A;  2LB5 A;  4XT2 A;  1IKI A;  3C4O A;  2EFX A;  4IED A;  2EFU A;  4EU0 A;  4U0X A;  2FFY A;  3EWK A;  3IBR A;  4NXB A;  4LRZ E;  5HD5 A;  1KVL A;  1ERQ A;  2EX6 A;  4R3B A;  1M6K A;  2E8J A;  2V1Z A;  3VP2 A;  2ZOI A;  4RVA A;  1G6A A;  4CLC B;  2PR5 A;  2J80 A;  4M4X A;  1XKZ A;  4Z1W A;  2R78 A;  1TDL A;  4Y0U A;  1GCE A;  4O8G A;  3P98 A;  4GDN A;  1XJ3 A;  2EWW A;  3F1P A;  3ZYT A;  4YFM A;  2XFS A;  3N8R A;  3KSH A;  1HTZ A;  2ZL1 A;  5L8M A;  2OAP 1;  2OAQ 1;  2EXB A;  2ZQ9 A;  1LL5 A;  3A3F A;  2QMI A;  3NEC A;  5A90 A;  2FFF B;  1S1Y A;  4PM5 A;  4NG2 A;  3MZF A;  4YWZ A;  3M6H A;  5DKL A;  2B18 A;  1ESU A;  2G2U A;  4ZDX A;  4WMC A;  1F9I A;  1NLZ A;  3BFE A;  2K7S A;  3QP1 A;  4LFU A;  4BLM A;  4S2M A;  3C5A A;  4CLC C;  3C7V A;  3IXH A;  3ZVT A;  2DMW A;  2ZM8 A;  1Y4O A;  2XH9 A;  3ZVW A;  3TJZ C;  2WUQ A;  3LI9 A;  4B9O A;  3HBR A;  3FPV A;  3MQQ A;  3SS4 A;  4EBL A;  3CPT B;  3H82 A;  3S7N A;  3G30 A;  4H6J A;  5F1F A;  4WM9 A;  2BTF P;  2ZC3 B;  4OLG A;  3FG8 A;  2J8Y A;  1LL8 A;  4LV3 A;  3S7Q A;  2G7U A;  1UGU A;  4GD6 A;  4ZJ2 A;  3SS5 A;  1K55 C;  3QP6 A;  2Y91 A;  5KSH A;  3WRT A;  2JKF A;  2WK0 A;  3D3O A;  3HL9 A;  5HAI A;  3IF6 A;  4ID4 A;  5CED A;  5EVI B;  2P7J A;  2A2L A;  4Z9Q A;  4B88 A;  2QWS A;  1NLY A;  3Q7V A;  3A3I A;  1PIO A;  1FCM A;  2BG1 A;  5CHU A;  1W8Y A;  4KZA A;  3NCK A;  4QY6 A;  1DJC A;  2HP9 A;  4YNR A;  4R38 A;  2C6W B;  4RYE A;  1IYO A;  3P7N A;  4R70 A;  3UMD A;  2OLV A;  1N9B A;  2G2W A;  3DAV A;  3JYI A;  4U3T A;  2K31 A;  1IFQ A;  5I94 A;  5TBM A;  1Z6F A;  5CEB A;  5EPH A;  4R0Q A;  4KZ3 A;  2VEA A;  2QPN A;  4GN2 A;  2D02 A;  1MWR A;  1NWZ A;  2J9O A;  3DW0 A;  1RGY A;  3UE3 A;  4PKY G;  5KZH A;  4UA7 A;  1AWI A;  2L1M A;  2GDN A;  3GQZ A;  4GHI B;  1VEU A;  4C6Y A;  3FKW A;  4EUZ A;  1YLZ A;  4K0X A;  2W0N A;  4R3J A;  2Y2K A;  2Y4A A;  2A49 A;  4I3A A;  2QJ7 A;  2PR6 A;  2PD7 A;  5L07 A;  4LV2 A;  5IHV A;  3DTK A;  3C2W A;  5GHX A;  2HDQ A;  4LRY C;  2WAF A;  2RL3 A;  4L0L A;  4PAU A;  4O01 A;  1TS6 A;  1J3W A;  4HJ6 A;  5G4Z A;  3E98 A;  1NRJ A;  3UDX A;  1Q2P A;  3LI8 A;  4I3J A;  3MXR A;  2ZC5 B;  4OOL A;  3CWF A;  3CAX A;  2CMN A;  3BM6 A;  1SHV A;  1VB6 A;  3LEQ A;  5FQQ A;  2L4R A;  3FPW A;  3VSK A;  1HLU P;  3UN7 A;  2XSS A;  3VMA A;  5DFX A;  1GHI A;  1JVJ A;  2O9A A;  1C3B A;  3PBQ A;  2A3U A;  3QP2 A;  4L9F A;  3HLW A;  3Q7Z A;  2JCH A;  2I72 A;  4KQQ A;  2IA2 A;  4L9G A;  5EVE A;  4X56 A;  4ETX A;  1H8Z A;  5HAQ A;  2P9V A;  1BLP A;  1U60 A;  2Y2I A;  2R9W A;  4MCW A;  1PZO A;  2XK1 A;  3T50 A;  3ZFZ A;  4E3K A;  5EEC A;  1ERM A;  3MMH A;  3ZG9 B;  5CRF A;  2WGI A;  3LR0 A;  4S2N C;  5DF9 A;  2XA7 M;  3HUM A;  1S67 L;  4ARZ B;  3MQO A;  1FSY A;  2P74 A;  5AVE A;  4HES A;  4WEL A;  2M7U A;  4D2O A;  2ZQ7 A;  4HJ4 A;  5M18 A;  2OOL A;  5AVF A;  3OCL A;  1Z09 A;  3UDF A;  1S0W A;  4C3Q A;  3E2K A;  1ESI A;  2PBY A;  1Y28 A;  1N9O A;  4BBV A;  5CXW A;  3BQA A;  3PBO A;  1K57 C;  2Y2O A;  3T4J A;  2KOI A;  4JF4 A;  1V9Z A;  2OV5 A;  3H82 B;  4IUH A;  4GHI A;  4GJ4 A;  4ESP A;  4FD8 A;  3JVV A;  1L0F A;  4EWF A;  1BZA A;  1LHY A;  3MXS A;  4Q0H A;  3O5Y A;  2GJ3 A;  3M6B A;  2H28 A;  4QD4 A;  1MWS A;  5CHJ A;  4KG5 A;  3DTM A;  3NI9 A;  3V50 A;  2W3H A;  4GKU A;  1XFN A;  1PZP A;  4CQH A;  5J3W A;  2V8C A;  2GZA A;  5FEF A;  1GSV A;  3K3C A;  3VP3 A;  5BOH A;  1S4R A;  2V2F F;  4S2K A;  4JXG A;  5J7E A;  3C38 A;  3OC2 A;  2WYX A;  1IYS A;  3KSI A;  2PYP A;  1T1B A;  2EX8 A;  3A0S A;  3E4P A;  2I9V A;  5G4Y A;  5EVI A;  5HFO A;  3MF0 A;  3GRJ A;  3UE1 A;  3MKF A;  4I3I A;  3IF6 C;  3B3X A;  2V0W A;  2ZC4 B;  4EUV A;  2PYR A;  3S4X A;  4Q0I A;  3LIB A;  3BLM A;  4BEN A;  1L0G A;  1HD8 A;  5L2F A;  4KZ7 A;  4KZ4 A;  2HV1 A;  1O07 A;  3FC7 A;  3ITA A;  4HH2 A;  1YLT A;  4KQD A;  2VK3 A;  1DP8 A;  2H5S A;  2EX2 A;  4OKP A;  3SS3 A;  1BUE A;  4PM8 A;  4Y3I A;  1SKF A;  4RX3 A;  4DKI A;  1XA1 A;  4G3K A;  3VE4 A;  5F82 A;  2XRO A;  1DRM A;  4KUK A;  3UE6 A;  1S4S A;  1LSV A;  1YQS A;  4Y0T A;  3LUQ A;  3K2N A;  2CC1 A;  1ONG A;  3V39 A;  3T1X A;  1PFL A;  3G4P A;  5DVA A;  2HPB A;  5FQM A;  2V0U A;  1KGE A;  1TF1 A;  1VET A;  3E4Q A;  1GSX A;  1A0K A;  3GTC A;  2KX6 A;  1I2S A;  1E3U D;  1YLW A;  4IJG A;  5GLA A;  1T19 A; 
#chains in the Genus database with same CATH homology
 1EWZ A;  2ZQA A;  2Y2H A;  3HLE A;  4BLM A;  4S2M A;  4OPZ A;  4F94 A;  2J9P A;  3C5A A;  1KE4 A;  1MBL A;  1BLH A;  2OSU A;  5DTS A;  3C7V A;  3IXH A;  3WS5 A;  3ZVT A;  3BYD A;  4GZB A;  4WZ4 A;  1CI9 A;  2ZM8 A;  5FA7 A;  2XH9 A;  2ZQC A;  1FCO A;  3ZVW A;  3Q82 A;  3BFF A;  2WUQ A;  3VOY A;  4E3J A;  4Y7P A;  5GL9 A;  1TDG A;  2UWX A;  3CZD A;  2PU2 A;  2HP5 A;  1JTD A;  1FCN A;  1SCW A;  1TVF A;  4LCM A;  1L2S A;  3HBR A;  4WEK A;  2XF3 A;  3PTE A;  4ZJ3 A;  2Y55 A;  4WZ5 A;  5A93 A;  1XX2 A;  4QB8 A;  3SS4 A;  4EBL A;  1XGJ A;  4ZJ1 A;  2ZD8 A;  5U47 A;  4S2L A;  5FI2 A;  3O88 A;  1ZG4 A;  3FZC A;  3G30 A;  1K6R A;  5F1F A;  4WM9 A;  1ES2 A;  3QNB A;  2ZC3 B;  4OLG A;  1NZO A;  1JTG A;  3LO7 A;  4C75 A;  1KE0 A;  4DXC A;  1DJA A;  2J8Y A;  4OPQ A;  4WMC D;  3P09 A;  4E3I A;  5KSC A;  4S2O A;  3TOI A;  4LV3 A;  4OP5 A;  4S2I A;  4E6W A;  4GD6 A;  4KQO A;  4OP8 A;  4JF6 A;  4DDY A;  4ZJ2 A;  3FKV A;  3VP1 A;  1PI5 A;  4EQI A;  2WAD A;  1NRF A;  3SS5 A;  3PBS A;  5G18 A;  1K55 C;  2Y2L A;  3N6I A;  5HL1 A;  1YMS A;  2WAE A;  2Y91 A;  5KSH A;  1AXB A;  5GLB A;  3HLD A;  3WRT A;  2PU4 A;  3O86 A;  1IEM A;  1NYY A;  3C4P A;  4IVI A;  3HLB A;  2XQZ A;  2WK0 A;  3HUN A;  1WYB A;  3HL9 A;  4GDB A;  3ZHH A;  5HAI A;  3IF6 A;  2Y2M A;  4ID4 A;  3MZD A;  1WE4 A;  4QY5 A;  4IBX A;  5CED A;  4IVK A;  5E2G A;  5AQ7 A;  5TGF A;  1RCJ A;  5EVI B;  1S6R A;  3SH9 A;  3SH8 A;  3Q81 A;  4N9K A;  2ZC7 A;  3MBZ A;  1KGF A;  5CHM A;  4Z9Q A;  4B88 A;  3OPP A;  4M3K A;  4A5R A;  2DNS A;  3S1Y A;  3Q7V A;  3A3I A;  4B4X A;  3AGD A;  1PIO A;  1GA0 A;  1FCM A;  2BG1 A;  5CHU A;  2WGW A;  1MPL A;  2Y2Q A;  3BFD A;  3A3E A;  3NBL A;  4JXS A;  1BLC A;  1W8Y A;  1IEL A;  1NXY A;  2H10 A;  1DY6 A;  4OOY A;  3IXG A;  1L0E A;  3BFG A;  4KZA A;  5A92 A;  3G31 A;  3NCK A;  3OPR A;  4QY6 A;  2X71 A;  4UA6 A;  1DJC A;  2HP9 A;  4X6T A;  5FQJ A;  1ES5 A;  4WEJ A;  3PBT A;  2C6W B;  2XDM A;  1IYO A;  4RYE A;  5EUA A;  2XGN A;  2VGK A;  1K55 A;  2OLV A;  1N9B A;  3EQV A;  2G2W A;  3Q7V B;  5FAQ A;  4N1H A;  3WS4 A;  3JYI A;  1I5Q A;  1PYY A;  4U3T A;  3IH8 A;  4E6X A;  1K4F A;  5I94 A;  1Z6F A;  1LLB A;  5CEB A;  5CEC A;  2Y2J A;  4P87 A;  4HBU A;  5EPH A;  4R0Q A;  4KZ3 A;  4RA7 A;  3LEZ A;  3ZCZ A;  2QPN A;  4U0T A;  3BEC A;  5CTN A;  5HAP A;  4GN2 A;  2Z2M B;  1G68 A;  5AQA A;  5E43 A;  1MWR A;  5TFQ A;  3ITB A;  3TSG A;  4KZ8 A;  2J9O A;  4DE2 A;  5JYO A;  2XR0 A;  1K57 A;  3VFF A;  3DW0 A;  3ZGA B;  1RGY A;  2XD1 A;  3N8S A;  3UDI A;  2X02 A;  4GNU A;  3UE3 A;  4E3L A;  3E2L A;  4E3O A;  4DRT A;  5HX9 A;  4LV1 A;  4MBF A;  4DE3 A;  4N1X A;  4DF6 A;  4DE1 A;  1W7F A;  5KZH A;  3AGF A;  4UA7 A;  1PWG A;  2ZC6 B;  3D4F A;  3CJM A;  4JF5 A;  3WRZ A;  5JYP A;  1FSW A;  4OVD A;  3NIA A;  3O3V A;  2HDS A;  4XUZ A;  4YIN A;  5M19 A;  2GDN A;  2E8I A;  1TEM A;  2DCF A;  1O7E A;  3N4I A;  3OCN A;  3GQZ A;  4OPR A;  4H8R A;  5AQB A;  3UY6 A;  4C6Y A;  4BQM A;  1RP5 A;  4X55 A;  3SH7 A;  3FKW A;  2XFT A;  4EUZ A;  4UAA A;  3QNC A;  1YLZ A;  4K0X A;  4R3J A;  3IXD A;  3VP4 A;  2Y2K A;  5GLC A;  3FYZ A;  4NK3 A;  3FV7 A;  3W4Q A;  4CPK A;  2Y2N A;  4P85 A;  2Y4A A;  2A49 A;  5FAP A;  2EXA A;  2ZQD A;  4JXW A;  3HRE A;  3PBR A;  3DWK A;  4LCL A;  3QHY A;  4LV2 A;  5IHV A;  4KZ5 A;  5GHX A;  1RGZ A;  3LCE A;  2HDQ A;  2WAF A;  4DE0 A;  2RL3 A;  3V3S A;  3ZNY A;  4L0L A;  2JE5 A;  3PAG A;  4N9L A;  5EVI C;  1ONH A;  3EQU A;  4DDS A;  5EE8 A;  4K91 A;  3UO9 A;  3BRM A;  3G2Z A;  4WYY A;  3ZNT A;  2XEP A;  3UDX A;  1Q2P A;  3VOZ A;  4HEF A;  4R1G A;  1L0D A;  4UHU A;  3MXR A;  2ZC5 B;  4OOL A;  2WKI A;  3W8K A;  2VGJ A;  3G35 A;  3M2K A;  1PI4 A;  3BM6 A;  1SHV A;  4XUX A;  5A91 A;  1BLS A;  5FQQ A;  1MY8 A;  4E3N A;  2JC7 A;  3UNW A;  1XXM A;  2WKE A;  3LY4 A;  3GV9 A;  3VSK A;  1XPB A;  1K54 A;  1LL9 A;  4KZ6 A;  1I2W A;  3UN7 A;  1ES3 A;  3VMA A;  5HAR A;  1GHI A;  1JVJ A;  5DF8 A;  1C3B A;  3Q07 A;  3GVB A;  3PBQ A;  3VSL A;  4QJG A;  1XA7 A;  1CI8 A;  2A3U A;  1GHP A;  4UA9 A;  3HLW A;  3Q7Z A;  5EOO A;  2JCH A;  2I72 A;  4KQQ A;  4ZBE A;  3UPO A;  1Y54 A;  5EVL A;  1CK3 A;  4S2P A;  4X56 A;  1ZKJ A;  1E3U A;  1H8Z A;  5HAQ A;  5M1A A;  2P9V A;  4HBT A;  1BSG A;  3TG9 A;  1BLP A;  1U60 A;  2Y2I A;  3G32 A;  4PM9 A;  4PM7 A;  1IYP A;  4DXB A;  4GOG A;  4OLD A;  2R9W A;  4EV4 A;  1BUL A;  3W4O A;  3N8L A;  2Z2L B;  5FI7 A;  3W4P A;  2ZJ9 A;  1PZO A;  2XK1 A;  3NY4 A;  2J7V A;  2WGW B;  2WZX A;  3ZFZ A;  5FAO A;  5FQI A;  3C7U A;  5EEC A;  4E3K A;  3WS1 A;  1ERM A;  4OPY A;  1MWT A;  3MZE A;  2OLU A;  4PPR A;  3ZG9 B;  5CRF A;  3VFH A;  1BT5 A;  2WGI A;  4S2N C;  4RX2 A;  5DF9 A;  5EVI D;  5CTM A;  2R9X A;  4BL2 A;  5DF7 A;  1NY0 A;  5TR7 A;  1SDE A;  3HUM A;  4WBG A;  4R4S A;  3GSG A;  1KVM A;  1FR1 A;  1WYC A;  5HW3 A;  2WKH A;  5DTK A;  1FSY A;  2P74 A;  4HES A;  4WEL A;  4D2O A;  3ZG7 B;  2ZQ7 A;  1K4E A;  3HLF A;  4JBF A;  4ZAM A;  4BJP A;  1JWZ A;  1LI9 A;  3OZH A;  4B4Z A;  1VM1 A;  3RJU A;  5M18 A;  3ZDJ A;  2ZQ8 A;  4OQG A;  1Q2Q A;  4IBR A;  1LI0 A;  3G34 A;  3OCL A;  4CJN A;  3UDF A;  1K25 A;  1PWD A;  3N7W A;  1S0W A;  3IHB A;  5FAT A;  2Q9N A;  3VP0 A;  4C3Q A;  3E2K A;  1FQG A;  3HUO A;  4OOM A;  3HLC A;  4QHC A;  4E3M A;  5GHY A;  1XGI A;  2ZMA A;  4FH2 A;  4Q8I A;  4OQ0 A;  1ESI A;  3WS0 A;  4LV0 A;  2PBY A;  5F83 A;  3A3J A;  1KE3 A;  1QME A;  5CXW A;  3PBO A;  5KMW A;  1K57 C;  3NDE A;  2Y2O A;  1SDN A;  4JF4 A;  4QU3 A;  3V5M A;  4ZTK A;  1KGG A;  2OV5 A;  1N4O A;  2HDR A;  2IWC A;  2ZLY A;  4FD8 A;  2QZ6 A;  3M2J A;  4JXV A;  1L0F A;  3NC8 A;  5FI6 A;  2IWB A;  1XP4 A;  3IF6 B;  4EWF A;  1K56 D;  2HDU A;  1BZA A;  1YLP A;  4MEZ A;  4Y0O A;  3CG5 A;  4MNR A;  2B5R A;  3ZG8 B;  4KG6 A;  1LHY A;  3MXS A;  4P6B A;  4KEN B;  1PW8 A;  1NYM A;  3BLS A;  2X01 A;  2ZM2 A;  3OPH A;  5E2H A;  3M6B A;  3ISG A;  2HP6 A;  4S2J A;  4QD4 A;  1MWS A;  3RXX A;  2C5W B;  1MXO A;  1MWU A;  1NJ4 A;  3S22 A;  3NDG A;  1OME A;  5CHJ A;  4KG5 A;  2WGV A;  3IHA A;  4KZ9 A;  1MKI A;  1GA9 A;  3DTM A;  3IT9 A;  3NI9 A;  3V50 A;  1W5D A;  5FQ9 A;  3IH9 A;  4N92 A;  1YMX A;  4GKU A;  5FDH A;  3GR2 A;  1PZP A;  5FQK A;  5F1G A;  2XLN A;  4GB7 A;  3FWL A;  4PMA A;  4WZ5 C;  4FH4 A;  1BTL A;  1ZG6 A;  1IYQ A;  3WS2 A;  4P0M A;  3CMZ A;  3VP3 A;  5BOH A;  5CGS A;  1JWP A;  3IWO A;  2V2F F;  3BFC A;  4S2K A;  2BLS A;  1PWC A;  4X53 A;  3V3R A;  4JXG A;  1IKG A;  1H5X A;  4KQR A;  1J9M A;  1HVB A;  1CEG A;  2EX9 A;  2ZM0 A;  4GD8 A;  4OQI A;  4OON A;  4O7D A;  1VQQ A;  1KDW A;  2DRW A;  3OC2 A;  2WYX A;  1IYS A;  3A3D A;  3IWQ A;  2RCX A;  2WZZ A;  4BD1 A;  2EX8 A;  4JPM A;  1FOF A;  1K6S A;  5FSR A;  4JKT A;  3IXB A;  3IQA A;  3MFD A;  5EVI A;  5HFO A;  1K38 A;  4BL3 A;  2Y2G A;  1GHM A;  3GRJ A;  1CEF A;  1IKI A;  3UE1 A;  5D3O A;  3IF5 A;  3MKF A;  3IF6 C;  1YLY A;  2Q9M A;  3B3X A;  2V20 A;  3C4O A;  2EFX A;  5J8X A;  3GMW A;  4IED A;  2EFU A;  2ZC4 B;  2IWD A;  3S4X A;  1K54 C;  1W8Q A;  4U0X A;  3I7J A;  3AGE A;  3HVF A;  3BLM A;  4BEN A;  1L0G A;  1HD8 A;  5L2F A;  4KZ7 A;  5EOE A;  3UE0 A;  2FFY A;  4KZ4 A;  4OQH A;  4R23 A;  3WWX A;  1KVL A;  1O07 A;  1ERQ A;  2EX6 A;  3OPL A;  3ITA A;  4R3B A;  1M6K A;  3ZG0 A;  2V1Z A;  3VP2 A;  1YLJ A;  2Y59 A;  1M40 A;  3PAE A;  1G6A A;  4RVA A;  3SOI A;  1E25 A;  1YLT A;  4X69 A;  1DJB A;  4EBN A;  3BEB A;  1FR6 A;  2H0T A;  4KZB A;  1E4D A;  5E2E A;  1QMF A;  5CGW A;  4OH0 A;  4XXR A;  1XKZ A;  2EX2 A;  1ERO A;  2H5S A;  4MBK A;  4OKP A;  4S2N A;  3DWZ A;  4EBP A;  3SS3 A;  4FSF A;  1KDS A;  1TDL A;  1BUE A;  4PM8 A;  1GCE A;  1JWV A;  1YM1 A;  2P9V B;  4K0W A;  4Y0U A;  3UPN A;  1ALQ A;  3P98 A;  4GDN A;  1SKF A;  4RX3 A;  4BD0 A;  4DKI A;  4FCF A;  4YFM A;  5FAS A;  2XFS A;  1XA1 A;  5AQ9 A;  1K56 A;  5F82 A;  3RXW A;  3N8R A;  1PW1 A;  1HTZ A;  4NET A;  3UPP A;  5CGX A;  2EXB A;  1EI5 A;  3MKE A;  1YQS A;  4LEN A;  5GHZ A;  4X68 A;  5DTT A;  4Y0T A;  1H8Y A;  2ZQ9 A;  1HZO A;  2CC1 A;  3PBN A;  1ONG A;  5GLD A;  1LL5 A;  3V39 A;  3O87 A;  3A3F A;  2H0Y A;  2JBF A;  2QMI A;  3HLG A;  5A90 A;  4MBH A;  4KG2 A;  3G4P A;  5DVA A;  2XD5 A;  2FFF B;  3LY3 A;  2HPB A;  1YT4 A;  3IWI A;  5FQM A;  1KGE A;  4PM5 A;  3MZF A;  5E2F A;  2Y2P A;  4R4R A;  3Q1F A;  3M6H A;  1NZU A;  3G2Y A;  3GTC A;  1ESU A;  2G2U A;  4PM6 A;  1I2S A;  1E3U D;  4ZDX A;  4WMC A;  1ES4 A;  5CER A;  3ZG5 A;  1W79 A;  1YLW A;  3BFE A;  4JLF A;  5GLA A;  1ZC2 A;  4MLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...