3MC6C

Crystal structure of scdpl1
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
450
structure length
424
Chain Sequence
b'SQLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSEDKLIVGFLDALYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sphingosine-1-phosphate lyase
publication title Structure and Function of Sphingosine-1-Phosphate Lyase, a Key Enzyme of Sphingolipid Metabolism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
total genus 114
structure length 424
sequence length 450
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3mc6C03
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3mc6C02
4AO9A 3FZ6A 5EAAA 2NMPA 2VGZA 4F5GA 3FKDA 2W8VA 4W1WA 5D95A 1IAXA 1AMRA 3OKSA 3NU7A 3P1TA 4P3MA 1YJYA 5LH9A 4KYOA 2VGVA 3NDNA 1W7NA 3IHJA 1JF9A 3A9XA 3ZZKA 1AMQA 2FN6A 2VGWA 1RVYA 3DR7A 3JTXA 1BKGA 1I41A 3HQTA 4MQPA 2EPJA 2X5FA 3B8XA 4ZDLA 1TARA 3I4JA 2CJDA 4UQVA 1TPLA 1JS3A 2ZUKA 3E2ZA 1OXPA 4DBCA 4RM1A 1ARTA 1XEYA 4GE7A 3GZCA 4IXZA 5TF5A 1AJSA 1I43A 1G4VA 2ZC0A 3HDOA 3BC8A 3MC6C 4BQ0A 2PB2A 3FQ8A 4XJLA 1ASNA 1SVVA 2OKKA 3GSBA 4E3RA 4ZWVA 2BYJA 1PFFA 2R2NA 1ASCA 1M6SA 1UKJA 2D63A 2Z9UA 1D7UA 1B9HA 2VMYA 3NU8A 2AY9A 4A72A 4LW4A 4W1XA 2ZP7A 1DGEA 2V1PA 1KMJA 3RBLA 2VLFA 1FG7A 1KL2A 1BJOB 1GEYA 2C7TA 3BWNC 1GEXA 1PMMA 4JEZA 5E4ZA 3LY1A 1GC3A 4MGRA 4GRXA 4O6ZA 1KL1A 2GB3A 2OKJA 4EB5A 1GDEA 4L0OA 5M49A 1MDZA 1GC0A 3LVKA 1C0NA 4E1OA 1DJ9A 1W7MA 2JJFA 2EGYA 4IYOB 4RITA 4GSAA 1D7RA 1WKGA 2HUIA 2CH2A 4F5IA 3USFA 5HXXA 1DFOA 2BHXA 1AIAA 5BJ3A 4WP0A 1TOKA 3BWNA 3AENB 3AEOA 1QIRA 3ZRPA 1ASFA 2OGEA 4AH3A 3H7FA 3WCOA 1X0MA 3KGWA 2XH1A 4RKDA 4XJMA 3BN1A 2VI8A 3HBXA 4ADBA 2W7IA 4B9BA 1ASBA 5E5IA 2VMNA 3E77A 3R9AA 3G8MA 4EU1A 1ORDA 1X2AA 4LNMA 4W8IA 4WB0B 3ELEA 2D7YA 3FRKA 2GMSA 3HVYA 3T32A 4XEWA 1QZ9A 1AHEA 3BCXA 5EIGA 4E77A 1AY4A 2R5EA 1BJ4A 2EZ2A 3DXVA 4Y0HA 1FG3A 2OATA 4M2MA 4LNLA 1IAYA 3FVXA 3LG0A 3R4TA 4DGTA 2JG2A 2BIAA 4XJOA 3II0A 1CL1A 3DU4A 2D61A 2ZY5A 1C7GA 5M4DA 2O0RA 2BYLA 3AEJA 1B5OA 3HT4A 4CBRA 4MY5A 4JE5D 4ZM3A 1YJSA 3JU7A 2VGUA 3NX3A 3PJ0A 4JF0A 2VMWA 1M7YA 4WD2A 2JJEA 1WYVA 1MAQA 2HUFA 3HMUA 2QLRA 4WYFA 2DGKA 3TFUA 4OYTA 3TATA 1JG8A 4WYEA 3PA9A 2YRRA 3AEMC 3E2FA 1UU1A 1YJZA 2W7KA 3NUIA 4CVQA 3A9ZA 1O4SA 2E7IA 1S0AA 4UHNA 1N8PA 1EQBA 1CS1A 1AAMA 3E9KA 4WB0A 3QI6A 2BKWA 3FZ7A 1B8GA 4A0GA 1WYUB 1RV3A 1IX6A 1MAPA 2YCTA 4F5KA 2AATA 2CSTA 4U2HA 3AELA 3BB8A 3QN6A 4BHDA 2BWPA 2O1BA 1TATA 4OMAA 1M0OA 1ASEA 4GE9A 1VP4A 1IX8A 1MDXA 2HP2A 3FTBA 4JEWA 2WKAA 3AEMA 4ITXA 4HVKA 3WGBA 2Z1YA 4KXKA 2BI2A 4KAMA 4Q75A 4ZDPA 2W7DA 4FL0A 2ZY4A 7AATA 5EAVA 4ZDOA 1Z3ZA 4TMRA 4A6RA 4Q31A 3UE8A 4CBSA 3QPGA 2EH6A 3EI9A 1AHGA 1IVRA 1AX4A 2OGAA 2RFVA 4ADDA 1KMKA 2YKUA 2AY8A 1VJOA 3CAIA 4ADCA 3VAXA 1Z7DA 3PDBA 2CFBA 5E3KA 1OXOA 2ZY3A 4W1VA 3GETA 1B9IA 2DKJA 5DJ9A 2VMTA 3RUYA 4WYCA 3ZRQA 1MGVA 3MBBA 3N5MA 1GCKA 3W1JA 4QGRA 2VLHA 3L8AA 3EIBA 1AMSA 2BWOA 4IXOA 5AX8A 4JEVA 4R5FA 4Q6RA 4MKJA 1DJEA 3UAKA 5F8VA 1WKHA 4WXGA 5FT8A 3EI5A 3F6TA 1AKBA 2AEUA 4PFNA 1WYTB 2OQXA 3K40A 5J8QA 3WKRA 2Z20A 2EZ1A 1BJNA 3NNKA 3AV7A 3M5UA 2F8JA 1BW0A 3K7YA 4OC9A 2BI3A 4F5FA 3FD0A 3WY7A 5G4IA 2VIBA 2W8WA 2HOZA 5EUDA 1X28A 2VMSA 1QJ3A 4A6TA 3PPLA 1W7LA 3MC6A 4GE4A 1YIZA 3RCHB 2C81A 2AY7A 8AATA 4WXBA 5JAYA 2PB0A 2HOYA 3L44A 4ITGA 5K8BA 4A6UA 4Q76A 3E2YA 1ARSA 1LKCA 2CH1A 2W7GA 1YNUA 3AOWA 1BJWA 2BI5A 4LC3A 3N0LA 3COGA 5FT5A 1LW5A 3EZSA 3FQAA 4AO4A 3MAFB 3LWSA 1AMAA 1U08A 4MSOA 1P3WA 4W5KA 2CJHA 3MADA 3PD6B 1GC2A 1OATA 3NYTA 4IY7A 1O62A 1GEWA 1MDOA 2WK8A 3NUBA 2QB3A 4OBUA 4ISYA 3FDDA 2W7MA 4J5UA 3BWOA 1DJUA 3GWPA 2HP1A 4RLGA 2G6WA 1AICA 1C9CA 1BJOA 1OHVA 2HOXA 3MEBA 5FT6A 1Y4IA 3EI8A 3CBFA 1T3IA 1ZC9A 4R8DA 4Y0IA 4ZSYA 1WSTA 2D5YA 1C7OA 2W8JA 3OP7A 4N0BA 3VK4A 3JZLA 3WX9A 1ASGA 1I29A 1BT4A 1TOIA 4A0RA 1SF2A 2CY8A 5C6UA 3G7QA 1G4XA 3P6KA 4IYOA 1BQAA 5IWQA 5EFSA 2W7FA 4R5ZA 3NTJA 3PDXA 1O69A 3FCRA 1ARIA 3CQ6A 4MKKA 4RKCA 4ZM4A 3QHXA 3FQ7A 1TOEA 4XJPA 2VMOA 3AOVA 1BQDA 5I92A 1V2DA 3ATHA 3RI6A 1I48A 3ACZA 9AATA 2JJHA 2Z1ZA 3W1IA 4AOAA 1ZOBA 3HL2A 3EZ1A 2YHKA 3AENA 4K2BA 1YIYA 4BA4A 1SZUA 3B1CA 3FFRA 2YKVA 3DRDA 5BJ4A 1W3UA 3F9TA 3ASBA 5G4JA 4ADEA 2HZPA 4AZJA 4ZAHA 1M0NA 3GZDC 4I8AA 3WGCA 1CJ0A 3BS8A 5LHAA 2VGTA 3H14A 2QA3A 4IXSA 5G2QA 3ZZJA 1S07A 3ASAA 3MKJA 2C44A 1CL2A 1KKPA 2XBNA 2Z61A 3ISLA 1AAWA 4K2IA 1ZODA 1AHFA 3HLMA 3ZRRA 1C4KA 2FYFA 1LC8A 2W8TA 3TCMA 4BMKA 5M4BA 3JWBA 3TFTA 3AEPA 4OTLA 2FNUA 2BI9A 2E7JA 1GD9A 1TASA 2FM1A 4OCAA 4WYDA 1DGDA 3KE3A 2PO3A 5EQCA 1ASLA 4UHMA 3RQ1A 4U1TA 4A0HA 3F0HA 2ZSLA 1YAAA 1C7NA 3GZDA 1DTYA 1MLYA 4ZLVA 1QISA 3W1HA 1QJ5A 3IF2A 1SZSA 4CXRA 5F9SA 3E2ZB 5DX5A 4RJYA 1KKJA 1QITA 2AY1A 2YCPA 3B1DA 4XAUA 5HHYA 3QM2A 1G7WA 3PAAA 2D65A 1AJSB 2AY5A 3LVLB 1IBJA 2CTZA 1LS3A 3GJUA 1YOOA 4EFFA 3DYDA 3LVJA 4F5MA 1XI9A 1J04A 4XK1A 4JE5A 1GC4A 1AY5A 4F5JA 2V0YA 5FT4A 2DGLA 1BS0A 4XQ2A 3NYSA 2AEVA 4M2KA 2BI1A 1AY8A 4TN4A 1WYUA 2W7LA 3VK3A 2AY6A 1LC5A 4Y0DA 2JISA 2D66A 1E5FA 3DC1A 3CQ5A 1TOJA 2CANA 2Z9VA 1OHWA 4GEBA 2VMXA 1LK9A 2HUUA 2VI9A 3WZFA 3ELPA 2D7ZA 4A00A 3CQ4A 1M0QA 4WLJA 3WLXA 3DZZA 2DKBA 2VGSA 2JJGA 2YKXA 1ASAA 1FC4A 2DGMA 2ZY2A 2BIGA 2Z9WA 1ARGA 2W7JA 2X3LA 1SFFA 3NYUA 2GQNA 3AATA 5EUEA 3I16A 1GBNA 3ECDA 4RAEA 3WKSA 3FVSA 4PVFA 4BA5A 3GR9A 1D7SA 1V2EA 2AY4A 3UWCA 2R5CB 5EIGB 4F5HA 1N31A 4R2NA 1AIBA 3E6GA 3N75A 2CB1A 1E5EA 1SZKA 2BWNA 3BCAA 5M46A 1V2FA 1CZEA 1IJIA 3EUCA 4H51A 2YKYA 3A2BA 3EI7A 4RIZA 4ZASA 2VMVA 2ZYJA 4ZWMA 2VYCA 2VMZA 1UU0A 2W7HA 5D5SA 4GDYA 5DJ1A 1M32A 2YCNA 1WYTA 2GSAA 1ELQA 1JS6A 2YRIA 3RBFA 1W23A 2CINA 1CQ8A 1QGNA 2BIEA 4IW7A 1M4NA 1EG5A 1WYVB 4RJ0A 1SPAA 3BCBA 1J32A 4J8LA 2WK9A 1PG8A 1OHYA 3G0TA 4ATPA 1EJIA 2ORDA 5G09A 1V72A 3VOMA 2X5DA 1RVUA 5DB5A 1D2FA 2C0RA 1B4XA 2DOUA 1M0PA 3AEJC 4WXFA 2QBTA 3RCHA 3VK2A 4B98A 2WK7A 2AY3A 1ASMA 2YOBA 2ZJGA 3A8UX 4F5LA 3KGXA 2EO5A 1S06A 3FSLA 3DXWA 1D7VA 3A9YA 5HDMA 2R5CA 1AKAA 4AZKA 4JF1A 4MQQA 2Z67A 4F4EA 2FNIA 1AJRA 1X29A 3TQXA 2O7CA 4IX8A 2VMQA 1LW4A 3MAFA 2VMRA 1UU2A 3MAUA 3GBXA 3WCNA 4DQ6A 4WBTA 2AY2A 3EIAA 1ELUA 3I5TA 1AHYA 3FFHA 3PD6A 4LW2A 3FVUA 3QGUA 4WYGA 4UOYA 1CQ7A 4JEXA 5G2PA 1N2TA 2R0TA 1O61A 1G7XA 4E3QA 3VP6A 1RV4A 4PIWA 4CXQA 4M2JA 4K2MA 4OT8A 2E54A 1AKCA 3B1EA 4LNJA 4WYAA 4P7YA 2FQ6A 1ASDA 1B5PA 2E7UA 4ATQA 4EB7A 3NRAA 1PMOA 2Q7WA 1AHXA 4FFCA 3LVMA 1S09A 1VEFA 3FDBA 3PDBB 3D6KA 4OBVA 2TPLA 4W91A 2QMAA 3EI6A 2X8UA 1ECXA 2ZSMA 5G0AA 1H1CA 3Q8NA 3BV0A 1IX7A 3DODA 2VIAA 2D64A 2W7EA 1DKAA 2GMUA 2CJGA 2W8UA 3JWAA 3PIUA 2Z9XA 4N0WA 3PGYA 1CZCA 2QB2A 3K28A 3B46A 5EUNA 1IUGA 1H0CA 4TV7A 4WLHA 1S08A 2VMUA 3QBOA 2HORA 4JEYA 4ZSWA 3DR4A 4NOGA 4MQRA 1TOGA 3FZ8A 3KKIA 4PFFA 2JGTA 2VMPA 1ARHA 1CQ6A 1MLZA 4EMYA 4HF8A 3JW9A 1LC7A 3LV2A 2DR1A 4UHOA 4A0FA
chains in the Genus database with same CATH superfamily
4AO9A 3FZ6A 5EAAA 2NMPA 2VGZA 4F5GA 2QSRA 3FKDA 2W8VA 4W1WA 5D95A 1IAXA 1AMRA 3OKSA 3NU7A 3P1TA 4P3MA 1YJYA 5LH9A 4KYOA 2VGVA 3NDNA 1W7NA 3IHJA 1JF9A 3A9XA 3ZZKA 1AMQA 2FN6A 2VGWA 1RVYA 3DR7A 3JTXA 1BKGA 1I41A 3HQTA 4MQPA 2EPJA 2X5FA 3B8XA 4ZDLA 1TARA 3I4JA 2CJDA 4UQVA 1TPLA 1JS3A 2ZUKA 3E2ZA 1OXPA 4DBCA 4RM1A 1ARTA 1XEYA 4GE7A 3GZCA 4IXZA 5TF5A 1AJSA 1I43A 1G4VA 2ZC0A 3HDOA 3BC8A 3MC6C 4BQ0A 2PB2A 3FQ8A 4XJLA 1ASNA 1SVVA 2OKKA 3GSBA 4E3RA 4ZWVA 2BYJA 1PFFA 2R2NA 1ASCA 1M6SA 1UKJA 2D63A 2Z9UA 1D7UA 1B9HA 2VMYA 3NU8A 2AY9A 4A72A 4LW4A 4W1XA 2ZP7A 1DGEA 2V1PA 1KMJA 3RBLA 2VLFA 1FG7A 1KL2A 1BJOB 1GEYA 2C7TA 3BWNC 1GEXA 1PMMA 4JEZA 5E4ZA 3LY1A 1GC3A 4MGRA 4GRXA 4O6ZA 1KL1A 2GB3A 2OKJA 4EB5A 1GDEA 4L0OA 5M49A 1MDZA 1GC0A 3LVKA 1C0NA 4E1OA 1DJ9A 1W7MA 2JJFA 2EGYA 4IYOB 4RITA 4GSAA 1D7RA 1WKGA 2HUIA 2CH2A 4F5IA 3USFA 5HXXA 1DFOA 2BHXA 1AIAA 5BJ3A 4WP0A 1TOKA 3BWNA 3AENB 3AEOA 1QIRA 3ZRPA 1ASFA 2OGEA 4AH3A 3H7FA 3WCOA 1X0MA 3KGWA 2XH1A 4RKDA 4XJMA 3BN1A 2VI8A 3HBXA 4ADBA 2W7IA 4B9BA 1ASBA 5E5IA 2VMNA 3E77A 3R9AA 3G8MA 4EU1A 1ORDA 1X2AA 4LNMA 4W8IA 4WB0B 3ELEA 2D7YA 3FRKA 2GMSA 3HVYA 3T32A 4XEWA 1QZ9A 1AHEA 3BCXA 5EIGA 4E77A 1AY4A 2R5EA 1BJ4A 2EZ2A 3DXVA 4Y0HA 1FG3A 2OATA 4M2MA 4LNLA 1IAYA 3FVXA 3LG0A 3R4TA 4DGTA 2JG2A 2BIAA 4XJOA 3II0A 1CL1A 3DU4A 2D61A 2ZY5A 1C7GA 5M4DA 2O0RA 2BYLA 3AEJA 1B5OA 3HT4A 4CBRA 4MY5A 4JE5D 4ZM3A 1YJSA 3JU7A 2VGUA 3NX3A 3PJ0A 4JF0A 2VMWA 1M7YA 4WD2A 2JJEA 1WYVA 1MAQA 2HUFA 3HMUA 2QLRA 4WYFA 2DGKA 3TFUA 4OYTA 3TATA 1JG8A 4WYEA 3PA9A 2YRRA 3AEMC 3E2FA 1UU1A 1YJZA 2W7KA 3NUIA 4CVQA 3A9ZA 1O4SA 2E7IA 1S0AA 4UHNA 1N8PA 1EQBA 1CS1A 1AAMA 3E9KA 4WB0A 3QI6A 2BKWA 3FZ7A 1B8GA 4A0GA 2FKIA 1WYUB 1RV3A 1IX6A 1MAPA 2YCTA 4F5KA 2AATA 2CSTA 4U2HA 3AELA 3BB8A 3QN6A 4BHDA 2BWPA 2O1BA 1TATA 4OMAA 1M0OA 1ASEA 4GE9A 1VP4A 1IX8A 1MDXA 2HP2A 3FTBA 4JEWA 2WKAA 3AEMA 4ITXA 4HVKA 3WGBA 2Z1YA 4KXKA 2BI2A 4KAMA 4Q75A 4ZDPA 2W7DA 4FL0A 2ZY4A 7AATA 5EAVA 4ZDOA 1Z3ZA 4TMRA 4A6RA 4Q31A 3UE8A 4CBSA 3QPGA 2EH6A 3EI9A 1AHGA 1IVRA 1AX4A 2OGAA 2RFVA 4ADDA 1KMKA 2YKUA 2AY8A 1VJOA 3CAIA 4ADCA 3VAXA 1Z7DA 3PDBA 2CFBA 5E3KA 1OXOA 2ZY3A 4W1VA 3GETA 1B9IA 2DKJA 5DJ9A 2VMTA 3RUYA 4WYCA 3ZRQA 1MGVA 3MBBA 3N5MA 1GCKA 3W1JA 4QGRA 2VLHA 3L8AA 3EIBA 1AMSA 2BWOA 4IXOA 5AX8A 4JEVA 4R5FA 4Q6RA 4MKJA 1DJEA 3UAKA 5F8VA 1WKHA 4WXGA 5FT8A 3EI5A 3F6TA 1AKBA 2AEUA 4PFNA 1WYTB 2OQXA 3K40A 5J8QA 3WKRA 2Z20A 2EZ1A 1BJNA 3NNKA 3AV7A 3M5UA 2F8JA 1BW0A 3K7YA 4OC9A 2BI3A 4F5FA 3FD0A 3WY7A 5G4IA 2VIBA 2W8WA 2HOZA 5EUDA 1X28A 2VMSA 1QJ3A 4A6TA 3PPLA 1W7LA 3H9XA 3MC6A 4GE4A 1YIZA 3RCHB 2C81A 2AY7A 8AATA 4WXBA 5JAYA 2PB0A 2HOYA 3L44A 4ITGA 5K8BA 4A6UA 4Q76A 3E2YA 1ARSA 1LKCA 2CH1A 2W7GA 2EYQA 1YNUA 3AOWA 1BJWA 2BI5A 4LC3A 3N0LA 3COGA 5FT5A 1LW5A 3EZSA 3FQAA 4AO4A 3MAFB 3LWSA 1AMAA 1U08A 4MSOA 4H63Q 1P3WA 4W5KA 2CJHA 3MADA 3PD6B 1GC2A 1OATA 3NYTA 4IY7A 1O62A 1GEWA 1MDOA 2WK8A 3NUBA 2QB3A 4OBUA 4ISYA 3FDDA 2W7MA 4J5UA 3BWOA 1DJUA 3GWPA 2HP1A 4RLGA 2G6WA 1AICA 1C9CA 1BJOA 1OHVA 2HOXA 3MEBA 5FT6A 1Y4IA 3EI8A 3CBFA 1T3IA 1ZC9A 4R8DA 4Y0IA 4ZSYA 1WSTA 2D5YA 1C7OA 2W8JA 3OP7A 4N0BA 3VK4A 3JZLA 3WX9A 1ASGA 1I29A 1BT4A 1TOIA 4A0RA 1SF2A 2CY8A 5C6UA 3G7QA 1G4XA 3P6KA 4IYOA 1BQAA 5IWQA 5EFSA 2W7FA 4R5ZA 3NTJA 3PDXA 1O69A 3FCRA 1ARIA 3CQ6A 4MKKA 4RKCA 4ZM4A 3QHXA 3FQ7A 1TOEA 4XJPA 2VMOA 3AOVA 1BQDA 5I92A 1V2DA 3ATHA 3RI6A 1I48A 3ACZA 9AATA 2G7JA 2JJHA 2Z1ZA 3W1IA 4AOAA 1ZOBA 3HL2A 3EZ1A 2YHKA 3AENA 4K2BA 1YIYA 4BA4A 1SZUA 3B1CA 3FFRA 2YKVA 3DRDA 5BJ4A 1W3UA 3F9TA 3ASBA 5G4JA 4ADEA 2HZPA 4AZJA 4ZAHA 2A1VA 2KFPA 1M0NA 3GZDC 4I8AA 2WB6A 3WGCA 1CJ0A 3BS8A 5LHAA 2VGTA 3H14A 2QA3A 4IXSA 5G2QA 3ZZJA 1S07A 3ASAA 3MKJA 2C44A 1CL2A 1KKPA 2XBNA 2Z61A 3ISLA 1AAWA 4K2IA 1ZODA 1AHFA 3HLMA 3ZRRA 1C4KA 2FYFA 1LC8A 2W8TA 3TCMA 4BMKA 5M4BA 3JWBA 3TFTA 3AEPA 4OTLA 2FNUA 2BI9A 4K05A 2E7JA 1GD9A 1TASA 2FM1A 4OCAA 4WYDA 1DGDA 3KE3A 2PO3A 5EQCA 1ASLA 3N4SA 4UHMA 3RQ1A 4U1TA 4A0HA 3F0HA 2ZSLA 1YAAA 1C7NA 3GZDA 1DTYA 1MLYA 4ZLVA 1QISA 3W1HA 1QJ5A 3IF2A 1SZSA 4CXRA 5F9SA 3E2ZB 5DX5A 4RJYA 1KKJA 1QITA 2AY1A 2YCPA 3B1DA 4XAUA 5HHYA 3QM2A 1G7WA 3PAAA 2D65A 1AJSB 2AY5A 3LVLB 1IBJA 2CTZA 1LS3A 3GJUA 1YOOA 4EFFA 3DYDA 3LVJA 4F5MA 1XI9A 1J04A 4XK1A 4JE5A 1GC4A 1AY5A 4F5JA 2V0YA 5FT4A 2DGLA 1BS0A 4XQ2A 3NYSA 2AEVA 4M2KA 2BI1A 1AY8A 4TN4A 1WYUA 2W7LA 3VK3A 2AY6A 1LC5A 4Y0DA 2JISA 2D66A 1E5FA 3DC1A 3CQ5A 1TOJA 2CANA 2Z9VA 1OHWA 3N4XA 4GEBA 2VMXA 1LK9A 2HUUA 2VI9A 3WZFA 3ELPA 2D7ZA 4A00A 3CQ4A 1M0QA 4WLJA 3WLXA 3DZZA 2DKBA 2VGSA 2JJGA 2YKXA 1ASAA 1FC4A 2DGMA 2ZY2A 2BIGA 2Z9WA 1ARGA 2W7JA 2X3LA 1SFFA 3NYUA 2GQNA 3AATA 5EUEA 1KAFA 3I16A 1GBNA 3ECDA 4RAEA 3WKSA 3FVSA 4PVFA 4BA5A 3GR9A 1D7SA 1V2EA 2AY4A 3UWCA 2R5CB 5EIGB 4F5HA 1N31A 4R2NA 1AIBA 3E6GA 3N75A 2CB1A 1E5EA 1SZKA 2BWNA 3BCAA 5M46A 1V2FA 1CZEA 1IJIA 3EUCA 4H51A 2YKYA 3A2BA 3EI7A 4RIZA 4ZASA 2VMVA 2ZYJA 4ZWMA 2VYCA 2VMZA 1UU0A 2W7HA 5D5SA 4GDYA 5DJ1A 1M32A 2YCNA 1WYTA 2GSAA 1ELQA 1JS6A 2YRIA 3RBFA 1W23A 2CINA 1CQ8A 1QGNA 2BIEA 4IW7A 1M4NA 1EG5A 1WYVB 4RJ0A 1SPAA 3BCBA 1J32A 4J8LA 2WK9A 1PG8A 1OHYA 3G0TA 4ATPA 1EJIA 2ORDA 5G09A 1V72A 3VOMA 2X5DA 1RVUA 5DB5A 1D2FA 2C0RA 1B4XA 2DOUA 1M0PA 3AEJC 4WXFA 2QBTA 3RCHA 3VK2A 4B98A 2WK7A 2AY3A 1ASMA 2YOBA 2ZJGA 3A8UX 4F5LA 3KGXA 2EO5A 1S06A 3FSLA 3DXWA 1D7VA 3A9YA 5HDMA 2R5CA 1AKAA 4AZKA 3N7NA 4JF1A 4MQQA 2Z67A 4F4EA 2FNIA 1AJRA 1X29A 3TQXA 2O7CA 4IX8A 2VMQA 1LW4A 3MAFA 2VMRA 1UU2A 3MAUA 3GBXA 3WCNA 4DQ6A 4WBTA 2AY2A 3EIAA 1ELUA 3I5TA 1AHYA 3FFHA 3PD6A 4LW2A 3FVUA 3QGUA 4WYGA 4UOYA 1CQ7A 4JEXA 5G2PA 1N2TA 2R0TA 1O61A 1G7XA 4E3QA 3VP6A 1RV4A 4PIWA 4CXQA 4M2JA 4K2MA 4OT8A 2E54A 1AKCA 3B1EA 4LNJA 4WYAA 4P7YA 2FQ6A 1ASDA 1B5PA 2E7UA 4ATQA 4EB7A 3NRAA 1PMOA 2Q7WA 3N4RA 1AHXA 4FFCA 3LVMA 1S09A 1VEFA 3FDBA 3PDBB 3D6KA 4OBVA 2TPLA 4W91A 2QMAA 3EI6A 2X8UA 1ECXA 2ZSMA 5G0AA 1H1CA 3Q8NA 3BV0A 1IX7A 3DODA 2VIAA 2D64A 2W7EA 1DKAA 2GMUA 2CJGA 2W8UA 3JWAA 3PIUA 2Z9XA 4N0WA 3PGYA 1CZCA 2QB2A 3K28A 3B46A 5EUNA 1IUGA 1H0CA 4TV7A 4WLHA 1S08A 2VMUA 3QBOA 2HORA 4JEYA 5KTBA 4ZSWA 3DR4A 4NOGA 4MQRA 1TOGA 3FZ8A 3KKIA 4PFFA 2JGTA 2VMPA 1ARHA 1CQ6A 1MLZA 4EMYA 4HF8A 3JW9A 1LC7A 3LV2A 2DR1A 4UHOA 4A0FA
chains in the Genus database with same CATH topology
4AO9A 3FZ6A 5EAAA 2NMPA 2VGZA 4F5GA 2QSRA 3FKDA 2W8VA 4W1WA 5D95A 1IAXA 1AMRA 3OKSA 3NU7A 3P1TA 4P3MA 1YJYA 5LH9A 4KYOA 2VGVA 3NDNA 1W7NA 3IHJA 1JF9A 3A9XA 3ZZKA 1AMQA 2FN6A 2VGWA 1RVYA 3DR7A 3JTXA 1BKGA 1I41A 3HQTA 4MQPA 2EPJA 2X5FA 3B8XA 4ZDLA 1TARA 3I4JA 2CJDA 4UQVA 1TPLA 1JS3A 2ZUKA 3E2ZA 1OXPA 4DBCA 4RM1A 1ARTA 1XEYA 4GE7A 3GZCA 4IXZA 5TF5A 1AJSA 1I43A 1G4VA 2ZC0A 3HDOA 3BC8A 3MC6C 4BQ0A 2PB2A 3FQ8A 4XJLA 1ASNA 1SVVA 2OKKA 3GSBA 4E3RA 4ZWVA 2BYJA 1PFFA 2R2NA 1ASCA 1M6SA 1UKJA 2D63A 2Z9UA 1D7UA 1B9HA 2VMYA 3NU8A 2AY9A 4A72A 4LW4A 4W1XA 2ZP7A 1DGEA 2V1PA 1KMJA 3RBLA 2VLFA 1FG7A 1KL2A 1BJOB 1GEYA 2C7TA 3BWNC 1GEXA 1PMMA 4JEZA 5E4ZA 3LY1A 1GC3A 4MGRA 4GRXA 4O6ZA 1KL1A 2GB3A 2OKJA 4EB5A 1GDEA 4L0OA 5M49A 1MDZA 1GC0A 3LVKA 1C0NA 4E1OA 1DJ9A 1W7MA 2JJFA 2EGYA 4IYOB 4RITA 4GSAA 1D7RA 1WKGA 2HUIA 2CH2A 4F5IA 3USFA 5HXXA 1DFOA 2BHXA 1AIAA 5BJ3A 4WP0A 1TOKA 3BWNA 3AENB 3AEOA 1QIRA 3ZRPA 1ASFA 2OGEA 4AH3A 3H7FA 3WCOA 1X0MA 3KGWA 2XH1A 4RKDA 4XJMA 3BN1A 2VI8A 3HBXA 4ADBA 2W7IA 4B9BA 1ASBA 5E5IA 2VMNA 3E77A 3R9AA 3G8MA 4EU1A 1ORDA 1X2AA 4LNMA 4W8IA 4WB0B 3ELEA 2D7YA 3FRKA 2GMSA 3HVYA 3T32A 4XEWA 1QZ9A 1AHEA 3BCXA 5EIGA 4E77A 1AY4A 2R5EA 1BJ4A 2EZ2A 3DXVA 4Y0HA 1FG3A 2OATA 4M2MA 4LNLA 1IAYA 3FVXA 3LG0A 3R4TA 4DGTA 2JG2A 2BIAA 4XJOA 3II0A 1CL1A 3DU4A 2D61A 2ZY5A 1C7GA 5M4DA 2O0RA 2BYLA 3AEJA 1B5OA 3HT4A 4CBRA 4MY5A 4JE5D 4ZM3A 1YJSA 3JU7A 2VGUA 3NX3A 3PJ0A 4JF0A 2VMWA 1M7YA 4WD2A 2JJEA 1WYVA 1MAQA 2HUFA 3HMUA 2QLRA 4WYFA 2DGKA 3TFUA 4OYTA 3TATA 1JG8A 4WYEA 3PA9A 2YRRA 3AEMC 3E2FA 1UU1A 1YJZA 2W7KA 3NUIA 4CVQA 3A9ZA 1O4SA 2E7IA 1S0AA 4UHNA 1N8PA 1EQBA 1CS1A 1AAMA 3E9KA 4WB0A 3QI6A 2BKWA 3FZ7A 1B8GA 4A0GA 2FKIA 1WYUB 1RV3A 1IX6A 1MAPA 2YCTA 4F5KA 2AATA 2CSTA 4U2HA 3AELA 3BB8A 3QN6A 4BHDA 2BWPA 2O1BA 1TATA 4OMAA 1M0OA 1ASEA 4GE9A 1VP4A 1IX8A 1MDXA 2HP2A 3FTBA 4JEWA 2WKAA 3AEMA 4ITXA 4HVKA 3WGBA 2Z1YA 4KXKA 2BI2A 4KAMA 4Q75A 4ZDPA 2W7DA 4FL0A 2ZY4A 7AATA 5EAVA 4ZDOA 1Z3ZA 4TMRA 4A6RA 4Q31A 3UE8A 4CBSA 3QPGA 2EH6A 3EI9A 1AHGA 1IVRA 1AX4A 2OGAA 2RFVA 4ADDA 1KMKA 2YKUA 2AY8A 1VJOA 3CAIA 4ADCA 3VAXA 1Z7DA 3PDBA 2CFBA 5E3KA 1OXOA 2ZY3A 4W1VA 3GETA 1B9IA 2DKJA 5DJ9A 2VMTA 3RUYA 4WYCA 3ZRQA 1MGVA 3MBBA 3N5MA 1GCKA 3W1JA 4QGRA 2VLHA 3L8AA 3EIBA 1AMSA 2BWOA 4IXOA 5AX8A 4JEVA 4R5FA 4Q6RA 4MKJA 1DJEA 3UAKA 5F8VA 1WKHA 4WXGA 5FT8A 3EI5A 3F6TA 1AKBA 2AEUA 4PFNA 1WYTB 2OQXA 3K40A 5J8QA 3WKRA 2Z20A 2EZ1A 1BJNA 3NNKA 3AV7A 3M5UA 2F8JA 1BW0A 3K7YA 4OC9A 2BI3A 4F5FA 3FD0A 3WY7A 5G4IA 2VIBA 2W8WA 2HOZA 5EUDA 1X28A 2VMSA 1QJ3A 4A6TA 3PPLA 1W7LA 3H9XA 3MC6A 4GE4A 1YIZA 3RCHB 2C81A 2AY7A 8AATA 4WXBA 5JAYA 2PB0A 2HOYA 3L44A 4ITGA 5K8BA 4A6UA 4Q76A 3E2YA 1ARSA 1LKCA 2CH1A 2W7GA 2EYQA 1YNUA 3AOWA 1BJWA 2BI5A 4LC3A 3N0LA 3COGA 5FT5A 1LW5A 3EZSA 3FQAA 4AO4A 3MAFB 3LWSA 1AMAA 1U08A 4MSOA 4H63Q 1P3WA 4W5KA 2CJHA 3MADA 3PD6B 1GC2A 1OATA 3NYTA 4IY7A 1O62A 1GEWA 1MDOA 2WK8A 3NUBA 2QB3A 4OBUA 4ISYA 3FDDA 2W7MA 4J5UA 3BWOA 1DJUA 3GWPA 2HP1A 4RLGA 2G6WA 1AICA 1C9CA 1BJOA 1OHVA 2HOXA 3MEBA 5FT6A 1Y4IA 3EI8A 3CBFA 1T3IA 1ZC9A 4R8DA 4Y0IA 4ZSYA 1WSTA 2D5YA 1C7OA 2W8JA 3OP7A 4N0BA 3VK4A 3JZLA 3WX9A 1ASGA 1I29A 1BT4A 1TOIA 4A0RA 1SF2A 2CY8A 5C6UA 3G7QA 1G4XA 3P6KA 4IYOA 1BQAA 5IWQA 5EFSA 2W7FA 4R5ZA 3NTJA 3PDXA 1O69A 3FCRA 1ARIA 3CQ6A 4MKKA 4RKCA 4ZM4A 3QHXA 3FQ7A 1TOEA 4XJPA 2VMOA 3AOVA 1BQDA 5I92A 1V2DA 3ATHA 3RI6A 1I48A 3ACZA 9AATA 2G7JA 2JJHA 2Z1ZA 3W1IA 4AOAA 1ZOBA 3HL2A 3EZ1A 2YHKA 3AENA 4K2BA 1YIYA 4BA4A 1SZUA 3B1CA 3FFRA 2YKVA 3DRDA 5BJ4A 1W3UA 3F9TA 3ASBA 5G4JA 4ADEA 2HZPA 4AZJA 4ZAHA 2A1VA 2KFPA 1M0NA 3GZDC 4I8AA 2WB6A 3WGCA 1CJ0A 3BS8A 5LHAA 2VGTA 3H14A 2QA3A 4IXSA 5G2QA 3ZZJA 1S07A 3ASAA 3MKJA 2C44A 1CL2A 1KKPA 2XBNA 2Z61A 3ISLA 1AAWA 4K2IA 1ZODA 1AHFA 3HLMA 3ZRRA 1C4KA 2FYFA 1LC8A 2W8TA 3TCMA 4BMKA 5M4BA 3JWBA 3TFTA 3AEPA 4OTLA 2FNUA 2BI9A 4K05A 2E7JA 1GD9A 1TASA 2FM1A 4OCAA 4WYDA 1DGDA 3KE3A 2PO3A 5EQCA 1ASLA 3N4SA 4UHMA 3RQ1A 4U1TA 4A0HA 3F0HA 2ZSLA 1YAAA 1C7NA 3GZDA 1DTYA 1MLYA 4ZLVA 1QISA 3W1HA 1QJ5A 3IF2A 1SZSA 4CXRA 5F9SA 3E2ZB 5DX5A 4RJYA 1KKJA 1QITA 2AY1A 2YCPA 3B1DA 4XAUA 5HHYA 3QM2A 1G7WA 3PAAA 2D65A 1AJSB 2AY5A 3LVLB 1IBJA 2CTZA 1LS3A 3GJUA 1YOOA 4EFFA 3DYDA 3LVJA 4F5MA 1XI9A 1J04A 4XK1A 4JE5A 1GC4A 1AY5A 4F5JA 2V0YA 5FT4A 2DGLA 1BS0A 4XQ2A 3NYSA 2AEVA 4M2KA 2BI1A 1AY8A 4TN4A 1WYUA 2W7LA 3VK3A 2AY6A 1LC5A 4Y0DA 2JISA 2D66A 1E5FA 3DC1A 3CQ5A 1TOJA 2CANA 2Z9VA 1OHWA 3N4XA 4GEBA 2VMXA 1LK9A 2HUUA 2VI9A 3WZFA 3ELPA 2D7ZA 4A00A 3CQ4A 1M0QA 4WLJA 3WLXA 3DZZA 2DKBA 2VGSA 2JJGA 2YKXA 1ASAA 1FC4A 2DGMA 2ZY2A 2BIGA 2Z9WA 1ARGA 2W7JA 2X3LA 1SFFA 3NYUA 2GQNA 3AATA 5EUEA 3I16A 1GBNA 3ECDA 4RAEA 3WKSA 3FVSA 4PVFA 4BA5A 3GR9A 1D7SA 1V2EA 2AY4A 3UWCA 2R5CB 5EIGB 4F5HA 1N31A 4R2NA 1AIBA 3E6GA 3N75A 2CB1A 1E5EA 1SZKA 2BWNA 3BCAA 5M46A 1V2FA 1CZEA 1IJIA 3EUCA 4H51A 2YKYA 3A2BA 3EI7A 4RIZA 4ZASA 2VMVA 2ZYJA 4ZWMA 2VYCA 2VMZA 1UU0A 2W7HA 5D5SA 4GDYA 5DJ1A 1M32A 2YCNA 1WYTA 2GSAA 1ELQA 1JS6A 2YRIA 3RBFA 1W23A 2CINA 1CQ8A 1QGNA 2BIEA 4IW7A 1M4NA 1EG5A 1WYVB 4RJ0A 1SPAA 3BCBA 1J32A 4J8LA 2WK9A 1PG8A 1OHYA 3G0TA 4ATPA 1EJIA 2ORDA 5G09A 1V72A 3VOMA 2X5DA 1RVUA 5DB5A 1D2FA 2C0RA 1B4XA 2DOUA 1M0PA 3AEJC 4WXFA 2QBTA 3RCHA 3VK2A 4B98A 2WK7A 2AY3A 1ASMA 2YOBA 2ZJGA 3A8UX 4F5LA 3KGXA 2EO5A 1S06A 3FSLA 3DXWA 1D7VA 3A9YA 5HDMA 2R5CA 1AKAA 4AZKA 3N7NA 4JF1A 4MQQA 2Z67A 4F4EA 2FNIA 1AJRA 1X29A 3TQXA 2O7CA 4IX8A 2VMQA 1LW4A 3MAFA 2VMRA 1UU2A 3MAUA 3GBXA 3WCNA 4DQ6A 4WBTA 2AY2A 3EIAA 1ELUA 3I5TA 1AHYA 3FFHA 3PD6A 4LW2A 3FVUA 3QGUA 4WYGA 4UOYA 1CQ7A 4JEXA 5G2PA 1N2TA 2R0TA 1O61A 1G7XA 4E3QA 3VP6A 1RV4A 4PIWA 4CXQA 4M2JA 4K2MA 4OT8A 2E54A 1AKCA 3B1EA 4LNJA 4WYAA 4P7YA 2FQ6A 1ASDA 1B5PA 2E7UA 4ATQA 4EB7A 3NRAA 1PMOA 2Q7WA 3N4RA 1AHXA 4FFCA 3LVMA 1S09A 1VEFA 3FDBA 3PDBB 3D6KA 4OBVA 2TPLA 4W91A 2QMAA 3EI6A 2X8UA 1ECXA 2ZSMA 5G0AA 1H1CA 3Q8NA 3BV0A 1IX7A 3DODA 2VIAA 2D64A 2W7EA 1DKAA 2GMUA 2CJGA 2W8UA 3JWAA 3PIUA 2Z9XA 4N0WA 3PGYA 1CZCA 2QB2A 3K28A 3B46A 5EUNA 1IUGA 1H0CA 4TV7A 4WLHA 1S08A 2VMUA 3QBOA 2HORA 4JEYA 5KTBA 4ZSWA 3DR4A 4NOGA 4MQRA 1TOGA 3FZ8A 3KKIA 4PFFA 2JGTA 2VMPA 1ARHA 1CQ6A 1MLZA 4EMYA 4HF8A 3JW9A 1LC7A 3LV2A 2DR1A 4UHOA 4A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AO9 A;  3FZ6 A;  5EAA A;  2NMP A;  2VGZ A;  4F5G A;  3FKD A;  2W8V A;  4W1W A;  5D95 A;  1IAX A;  1AMR A;  3OKS A;  3NU7 A;  3P1T A;  4P3M A;  1YJY A;  5LH9 A;  4KYO A;  2VGV A;  3NDN A;  1W7N A;  3IHJ A;  1JF9 A;  3A9X A;  3ZZK A;  1AMQ A;  2FN6 A;  2VGW A;  1RVY A;  3DR7 A;  3JTX A;  1BKG A;  1I41 A;  3HQT A;  4MQP A;  2EPJ A;  2X5F A;  3B8X A;  4ZDL A;  1TAR A;  3I4J A;  2CJD A;  4UQV A;  1TPL A;  1JS3 A;  2ZUK A;  3E2Z A;  1OXP A;  4DBC A;  4RM1 A;  1ART A;  1XEY A;  4GE7 A;  3GZC A;  4IXZ A;  5TF5 A;  1AJS A;  1I43 A;  1G4V A;  2ZC0 A;  3HDO A;  3BC8 A;  3MC6 C;  4BQ0 A;  2PB2 A;  3FQ8 A;  4XJL A;  1ASN A;  1SVV A;  2OKK A;  3GSB A;  4E3R A;  4ZWV A;  2BYJ A;  1PFF A;  2R2N A;  1ASC A;  1M6S A;  1UKJ A;  2D63 A;  2Z9U A;  1D7U A;  1B9H A;  2VMY A;  3NU8 A;  2AY9 A;  4A72 A;  4LW4 A;  4W1X A;  2ZP7 A;  1DGE A;  2V1P A;  1KMJ A;  3RBL A;  2VLF A;  1FG7 A;  1KL2 A;  1BJO B;  1GEY A;  2C7T A;  3BWN C;  1GEX A;  1PMM A;  4JEZ A;  5E4Z A;  3LY1 A;  1GC3 A;  4MGR A;  4GRX A;  4O6Z A;  1KL1 A;  2GB3 A;  2OKJ A;  4EB5 A;  1GDE A;  4L0O A;  5M49 A;  1MDZ A;  1GC0 A;  3LVK A;  1C0N A;  4E1O A;  1DJ9 A;  1W7M A;  2JJF A;  2EGY A;  4IYO B;  4RIT A;  4GSA A;  1D7R A;  1WKG A;  2HUI A;  2CH2 A;  4F5I A;  3USF A;  5HXX A;  1DFO A;  2BHX A;  1AIA A;  5BJ3 A;  4WP0 A;  1TOK A;  3BWN A;  3AEN B;  3AEO A;  1QIR A;  3ZRP A;  1ASF A;  2OGE A;  4AH3 A;  3H7F A;  3WCO A;  1X0M A;  3KGW A;  2XH1 A;  4RKD A;  4XJM A;  3BN1 A;  2VI8 A;  3HBX A;  4ADB A;  2W7I A;  4B9B A;  1ASB A;  5E5I A;  2VMN A;  3E77 A;  3R9A A;  3G8M A;  4EU1 A;  1ORD A;  1X2A A;  4LNM A;  4W8I A;  4WB0 B;  3ELE A;  2D7Y A;  3FRK A;  2GMS A;  3HVY A;  3T32 A;  4XEW A;  1QZ9 A;  1AHE A;  3BCX A;  5EIG A;  4E77 A;  1AY4 A;  2R5E A;  1BJ4 A;  2EZ2 A;  3DXV A;  4Y0H A;  1FG3 A;  2OAT A;  4M2M A;  4LNL A;  1IAY A;  3FVX A;  3LG0 A;  3R4T A;  4DGT A;  2JG2 A;  2BIA A;  4XJO A;  3II0 A;  1CL1 A;  3DU4 A;  2D61 A;  2ZY5 A;  1C7G A;  5M4D A;  2O0R A;  2BYL A;  3AEJ A;  1B5O A;  3HT4 A;  4CBR A;  4MY5 A;  4JE5 D;  4ZM3 A;  1YJS A;  3JU7 A;  2VGU A;  3NX3 A;  3PJ0 A;  4JF0 A;  2VMW A;  1M7Y A;  4WD2 A;  2JJE A;  1WYV A;  1MAQ A;  2HUF A;  3HMU A;  2QLR A;  4WYF A;  2DGK A;  3TFU A;  4OYT A;  3TAT A;  1JG8 A;  4WYE A;  3PA9 A;  2YRR A;  3AEM C;  3E2F A;  1UU1 A;  1YJZ A;  2W7K A;  3NUI A;  4CVQ A;  3A9Z A;  1O4S A;  2E7I A;  1S0A A;  4UHN A;  1N8P A;  1EQB A;  1CS1 A;  1AAM A;  3E9K A;  4WB0 A;  3QI6 A;  2BKW A;  3FZ7 A;  1B8G A;  4A0G A;  1WYU B;  1RV3 A;  1IX6 A;  1MAP A;  2YCT A;  4F5K A;  2AAT A;  2CST A;  4U2H A;  3AEL A;  3BB8 A;  3QN6 A;  4BHD A;  2BWP A;  2O1B A;  1TAT A;  4OMA A;  1M0O A;  1ASE A;  4GE9 A;  1VP4 A;  1IX8 A;  1MDX A;  2HP2 A;  3FTB A;  4JEW A;  2WKA A;  3AEM A;  4ITX A;  4HVK A;  3WGB A;  2Z1Y A;  4KXK A;  2BI2 A;  4KAM A;  4Q75 A;  4ZDP A;  2W7D A;  4FL0 A;  2ZY4 A;  7AAT A;  5EAV A;  4ZDO A;  1Z3Z A;  4TMR A;  4A6R A;  4Q31 A;  3UE8 A;  4CBS A;  3QPG A;  2EH6 A;  3EI9 A;  1AHG A;  1IVR A;  1AX4 A;  2OGA A;  2RFV A;  4ADD A;  1KMK A;  2YKU A;  2AY8 A;  1VJO A;  3CAI A;  4ADC A;  3VAX A;  1Z7D A;  3PDB A;  2CFB A;  5E3K A;  1OXO A;  2ZY3 A;  4W1V A;  3GET A;  1B9I A;  2DKJ A;  5DJ9 A;  2VMT A;  3RUY A;  4WYC A;  3ZRQ A;  1MGV A;  3MBB A;  3N5M A;  1GCK A;  3W1J A;  4QGR A;  2VLH A;  3L8A A;  3EIB A;  1AMS A;  2BWO A;  4IXO A;  5AX8 A;  4JEV A;  4R5F A;  4Q6R A;  4MKJ A;  1DJE A;  3UAK A;  5F8V A;  1WKH A;  4WXG A;  5FT8 A;  3EI5 A;  3F6T A;  1AKB A;  2AEU A;  4PFN A;  1WYT B;  2OQX A;  3K40 A;  5J8Q A;  3WKR A;  2Z20 A;  2EZ1 A;  1BJN A;  3NNK A;  3AV7 A;  3M5U A;  2F8J A;  1BW0 A;  3K7Y A;  4OC9 A;  2BI3 A;  4F5F A;  3FD0 A;  3WY7 A;  5G4I A;  2VIB A;  2W8W A;  2HOZ A;  5EUD A;  1X28 A;  2VMS A;  1QJ3 A;  4A6T A;  3PPL A;  1W7L A;  3MC6 A;  4GE4 A;  1YIZ A;  3RCH B;  2C81 A;  2AY7 A;  8AAT A;  4WXB A;  5JAY A;  2PB0 A;  2HOY A;  3L44 A;  4ITG A;  5K8B A;  4A6U A;  4Q76 A;  3E2Y A;  1ARS A;  1LKC A;  2CH1 A;  2W7G A;  1YNU A;  3AOW A;  1BJW A;  2BI5 A;  4LC3 A;  3N0L A;  3COG A;  5FT5 A;  1LW5 A;  3EZS A;  3FQA A;  4AO4 A;  3MAF B;  3LWS A;  1AMA A;  1U08 A;  4MSO A;  1P3W A;  4W5K A;  2CJH A;  3MAD A;  3PD6 B;  1GC2 A;  1OAT A;  3NYT A;  4IY7 A;  1O62 A;  1GEW A;  1MDO A;  2WK8 A;  3NUB A;  2QB3 A;  4OBU A;  4ISY A;  3FDD A;  2W7M A;  4J5U A;  3BWO A;  1DJU A;  3GWP A;  2HP1 A;  4RLG A;  2G6W A;  1AIC A;  1C9C A;  1BJO A;  1OHV A;  2HOX A;  3MEB A;  5FT6 A;  1Y4I A;  3EI8 A;  3CBF A;  1T3I A;  1ZC9 A;  4R8D A;  4Y0I A;  4ZSY A;  1WST A;  2D5Y A;  1C7O A;  2W8J A;  3OP7 A;  4N0B A;  3VK4 A;  3JZL A;  3WX9 A;  1ASG A;  1I29 A;  1BT4 A;  1TOI A;  4A0R A;  1SF2 A;  2CY8 A;  5C6U A;  3G7Q A;  1G4X A;  3P6K A;  4IYO A;  1BQA A;  5IWQ A;  5EFS A;  2W7F A;  4R5Z A;  3NTJ A;  3PDX A;  1O69 A;  3FCR A;  1ARI A;  3CQ6 A;  4MKK A;  4RKC A;  4ZM4 A;  3QHX A;  3FQ7 A;  1TOE A;  4XJP A;  2VMO A;  3AOV A;  1BQD A;  5I92 A;  1V2D A;  3ATH A;  3RI6 A;  1I48 A;  3ACZ A;  9AAT A;  2JJH A;  2Z1Z A;  3W1I A;  4AOA A;  1ZOB A;  3HL2 A;  3EZ1 A;  2YHK A;  3AEN A;  4K2B A;  1YIY A;  4BA4 A;  1SZU A;  3B1C A;  3FFR A;  2YKV A;  3DRD A;  5BJ4 A;  1W3U A;  3F9T A;  3ASB A;  5G4J A;  4ADE A;  2HZP A;  4AZJ A;  4ZAH A;  1M0N A;  3GZD C;  4I8A A;  3WGC A;  1CJ0 A;  3BS8 A;  5LHA A;  2VGT A;  3H14 A;  2QA3 A;  4IXS A;  5G2Q A;  3ZZJ A;  1S07 A;  3ASA A;  3MKJ A;  2C44 A;  1CL2 A;  1KKP A;  2XBN A;  2Z61 A;  3ISL A;  1AAW A;  4K2I A;  1ZOD A;  1AHF A;  3HLM A;  3ZRR A;  1C4K A;  2FYF A;  1LC8 A;  2W8T A;  3TCM A;  4BMK A;  5M4B A;  3JWB A;  3TFT A;  3AEP A;  4OTL A;  2FNU A;  2BI9 A;  2E7J A;  1GD9 A;  1TAS A;  2FM1 A;  4OCA A;  4WYD A;  1DGD A;  3KE3 A;  2PO3 A;  5EQC A;  1ASL A;  4UHM A;  3RQ1 A;  4U1T A;  4A0H A;  3F0H A;  2ZSL A;  1YAA A;  1C7N A;  3GZD A;  1DTY A;  1MLY A;  4ZLV A;  1QIS A;  3W1H A;  1QJ5 A;  3IF2 A;  1SZS A;  4CXR A;  5F9S A;  3E2Z B;  5DX5 A;  4RJY A;  1KKJ A;  1QIT A;  2AY1 A;  2YCP A;  3B1D A;  4XAU A;  5HHY A;  3QM2 A;  1G7W A;  3PAA A;  2D65 A;  1AJS B;  2AY5 A;  3LVL B;  1IBJ A;  2CTZ A;  1LS3 A;  3GJU A;  1YOO A;  4EFF A;  3DYD A;  3LVJ A;  4F5M A;  1XI9 A;  1J04 A;  4XK1 A;  4JE5 A;  1GC4 A;  1AY5 A;  4F5J A;  2V0Y A;  5FT4 A;  2DGL A;  1BS0 A;  4XQ2 A;  3NYS A;  2AEV A;  4M2K A;  2BI1 A;  1AY8 A;  4TN4 A;  1WYU A;  2W7L A;  3VK3 A;  2AY6 A;  1LC5 A;  4Y0D A;  2JIS A;  2D66 A;  1E5F A;  3DC1 A;  3CQ5 A;  1TOJ A;  2CAN A;  2Z9V A;  1OHW A;  4GEB A;  2VMX A;  1LK9 A;  2HUU A;  2VI9 A;  3WZF A;  3ELP A;  2D7Z A;  4A00 A;  3CQ4 A;  1M0Q A;  4WLJ A;  3WLX A;  3DZZ A;  2DKB A;  2VGS A;  2JJG A;  2YKX A;  1ASA A;  1FC4 A;  2DGM A;  2ZY2 A;  2BIG A;  2Z9W A;  1ARG A;  2W7J A;  2X3L A;  1SFF A;  3NYU A;  2GQN A;  3AAT A;  5EUE A;  3I16 A;  1GBN A;  3ECD A;  4RAE A;  3WKS A;  3FVS A;  4PVF A;  4BA5 A;  3GR9 A;  1D7S A;  1V2E A;  2AY4 A;  3UWC A;  2R5C B;  5EIG B;  4F5H A;  1N31 A;  4R2N A;  1AIB A;  3E6G A;  3N75 A;  2CB1 A;  1E5E A;  1SZK A;  2BWN A;  3BCA A;  5M46 A;  1V2F A;  1CZE A;  1IJI A;  3EUC A;  4H51 A;  2YKY A;  3A2B A;  3EI7 A;  4RIZ A;  4ZAS A;  2VMV A;  2ZYJ A;  4ZWM A;  2VYC A;  2VMZ A;  1UU0 A;  2W7H A;  5D5S A;  4GDY A;  5DJ1 A;  1M32 A;  2YCN A;  1WYT A;  2GSA A;  1ELQ A;  1JS6 A;  2YRI A;  3RBF A;  1W23 A;  2CIN A;  1CQ8 A;  1QGN A;  2BIE A;  4IW7 A;  1M4N A;  1EG5 A;  1WYV B;  4RJ0 A;  1SPA A;  3BCB A;  1J32 A;  4J8L A;  2WK9 A;  1PG8 A;  1OHY A;  3G0T A;  4ATP A;  1EJI A;  2ORD A;  5G09 A;  1V72 A;  3VOM A;  2X5D A;  1RVU A;  5DB5 A;  1D2F A;  2C0R A;  1B4X A;  2DOU A;  1M0P A;  3AEJ C;  4WXF A;  2QBT A;  3RCH A;  3VK2 A;  4B98 A;  2WK7 A;  2AY3 A;  1ASM A;  2YOB A;  2ZJG A;  3A8U X;  4F5L A;  3KGX A;  2EO5 A;  1S06 A;  3FSL A;  3DXW A;  1D7V A;  3A9Y A;  5HDM A;  2R5C A;  1AKA A;  4AZK A;  4JF1 A;  4MQQ A;  2Z67 A;  4F4E A;  2FNI A;  1AJR A;  1X29 A;  3TQX A;  2O7C A;  4IX8 A;  2VMQ A;  1LW4 A;  3MAF A;  2VMR A;  1UU2 A;  3MAU A;  3GBX A;  3WCN A;  4DQ6 A;  4WBT A;  2AY2 A;  3EIA A;  1ELU A;  3I5T A;  1AHY A;  3FFH A;  3PD6 A;  4LW2 A;  3FVU A;  3QGU A;  4WYG A;  4UOY A;  1CQ7 A;  4JEX A;  5G2P A;  1N2T A;  2R0T A;  1O61 A;  1G7X A;  4E3Q A;  3VP6 A;  1RV4 A;  4PIW A;  4CXQ A;  4M2J A;  4K2M A;  4OT8 A;  2E54 A;  1AKC A;  3B1E A;  4LNJ A;  4WYA A;  4P7Y A;  2FQ6 A;  1ASD A;  1B5P A;  2E7U A;  4ATQ A;  4EB7 A;  3NRA A;  1PMO A;  2Q7W A;  1AHX A;  4FFC A;  3LVM A;  1S09 A;  1VEF A;  3FDB A;  3PDB B;  3D6K A;  4OBV A;  2TPL A;  4W91 A;  2QMA A;  3EI6 A;  2X8U A;  1ECX A;  2ZSM A;  5G0A A;  1H1C A;  3Q8N A;  3BV0 A;  1IX7 A;  3DOD A;  2VIA A;  2D64 A;  2W7E A;  1DKA A;  2GMU A;  2CJG A;  2W8U A;  3JWA A;  3PIU A;  2Z9X A;  4N0W A;  3PGY A;  1CZC A;  2QB2 A;  3K28 A;  3B46 A;  5EUN A;  1IUG A;  1H0C A;  4TV7 A;  4WLH A;  1S08 A;  2VMU A;  3QBO A;  2HOR A;  4JEY A;  4ZSW A;  3DR4 A;  4NOG A;  4MQR A;  1TOG A;  3FZ8 A;  3KKI A;  4PFF A;  2JGT A;  2VMP A;  1ARH A;  1CQ6 A;  1MLZ A;  4EMY A;  4HF8 A;  3JW9 A;  1LC7 A;  3LV2 A;  2DR1 A;  4UHO A;  4A0F A; 
#chains in the Genus database with same CATH topology
 4AO9 A;  3FZ6 A;  5EAA A;  2NMP A;  2VGZ A;  4F5G A;  2QSR A;  3FKD A;  2W8V A;  4W1W A;  5D95 A;  1IAX A;  1AMR A;  3OKS A;  3NU7 A;  3P1T A;  4P3M A;  1YJY A;  5LH9 A;  4KYO A;  2VGV A;  3NDN A;  1W7N A;  3IHJ A;  1JF9 A;  3A9X A;  3ZZK A;  1AMQ A;  2FN6 A;  2VGW A;  1RVY A;  3DR7 A;  3JTX A;  1BKG A;  1I41 A;  3HQT A;  4MQP A;  2EPJ A;  2X5F A;  3B8X A;  4ZDL A;  1TAR A;  3I4J A;  2CJD A;  4UQV A;  1TPL A;  1JS3 A;  2ZUK A;  3E2Z A;  1OXP A;  4DBC A;  4RM1 A;  1ART A;  1XEY A;  4GE7 A;  3GZC A;  4IXZ A;  5TF5 A;  1AJS A;  1I43 A;  1G4V A;  2ZC0 A;  3HDO A;  3BC8 A;  3MC6 C;  4BQ0 A;  2PB2 A;  3FQ8 A;  4XJL A;  1ASN A;  1SVV A;  2OKK A;  3GSB A;  4E3R A;  4ZWV A;  2BYJ A;  1PFF A;  2R2N A;  1ASC A;  1M6S A;  1UKJ A;  2D63 A;  2Z9U A;  1D7U A;  1B9H A;  2VMY A;  3NU8 A;  2AY9 A;  4A72 A;  4LW4 A;  4W1X A;  2ZP7 A;  1DGE A;  2V1P A;  1KMJ A;  3RBL A;  2VLF A;  1FG7 A;  1KL2 A;  1BJO B;  1GEY A;  2C7T A;  3BWN C;  1GEX A;  1PMM A;  4JEZ A;  5E4Z A;  3LY1 A;  1GC3 A;  4MGR A;  4GRX A;  4O6Z A;  1KL1 A;  2GB3 A;  2OKJ A;  4EB5 A;  1GDE A;  4L0O A;  5M49 A;  1MDZ A;  1GC0 A;  3LVK A;  1C0N A;  4E1O A;  1DJ9 A;  1W7M A;  2JJF A;  2EGY A;  4IYO B;  4RIT A;  4GSA A;  1D7R A;  1WKG A;  2HUI A;  2CH2 A;  4F5I A;  3USF A;  5HXX A;  1DFO A;  2BHX A;  1AIA A;  5BJ3 A;  4WP0 A;  1TOK A;  3BWN A;  3AEN B;  3AEO A;  1QIR A;  3ZRP A;  1ASF A;  2OGE A;  4AH3 A;  3H7F A;  3WCO A;  1X0M A;  3KGW A;  2XH1 A;  4RKD A;  4XJM A;  3BN1 A;  2VI8 A;  3HBX A;  4ADB A;  2W7I A;  4B9B A;  1ASB A;  5E5I A;  2VMN A;  3E77 A;  3R9A A;  3G8M A;  4EU1 A;  1ORD A;  1X2A A;  4LNM A;  4W8I A;  4WB0 B;  3ELE A;  2D7Y A;  3FRK A;  2GMS A;  3HVY A;  3T32 A;  4XEW A;  1QZ9 A;  1AHE A;  3BCX A;  5EIG A;  4E77 A;  1AY4 A;  2R5E A;  1BJ4 A;  2EZ2 A;  3DXV A;  4Y0H A;  1FG3 A;  2OAT A;  4M2M A;  4LNL A;  1IAY A;  3FVX A;  3LG0 A;  3R4T A;  4DGT A;  2JG2 A;  2BIA A;  4XJO A;  3II0 A;  1CL1 A;  3DU4 A;  2D61 A;  2ZY5 A;  1C7G A;  5M4D A;  2O0R A;  2BYL A;  3AEJ A;  1B5O A;  3HT4 A;  4CBR A;  4MY5 A;  4JE5 D;  4ZM3 A;  1YJS A;  3JU7 A;  2VGU A;  3NX3 A;  3PJ0 A;  4JF0 A;  2VMW A;  1M7Y A;  4WD2 A;  2JJE A;  1WYV A;  1MAQ A;  2HUF A;  3HMU A;  2QLR A;  4WYF A;  2DGK A;  3TFU A;  4OYT A;  3TAT A;  1JG8 A;  4WYE A;  3PA9 A;  2YRR A;  3AEM C;  3E2F A;  1UU1 A;  1YJZ A;  2W7K A;  3NUI A;  4CVQ A;  3A9Z A;  1O4S A;  2E7I A;  1S0A A;  4UHN A;  1N8P A;  1EQB A;  1CS1 A;  1AAM A;  3E9K A;  4WB0 A;  3QI6 A;  2BKW A;  3FZ7 A;  1B8G A;  4A0G A;  2FKI A;  1WYU B;  1RV3 A;  1IX6 A;  1MAP A;  2YCT A;  4F5K A;  2AAT A;  2CST A;  4U2H A;  3AEL A;  3BB8 A;  3QN6 A;  4BHD A;  2BWP A;  2O1B A;  1TAT A;  4OMA A;  1M0O A;  1ASE A;  4GE9 A;  1VP4 A;  1IX8 A;  1MDX A;  2HP2 A;  3FTB A;  4JEW A;  2WKA A;  3AEM A;  4ITX A;  4HVK A;  3WGB A;  2Z1Y A;  4KXK A;  2BI2 A;  4KAM A;  4Q75 A;  4ZDP A;  2W7D A;  4FL0 A;  2ZY4 A;  7AAT A;  5EAV A;  4ZDO A;  1Z3Z A;  4TMR A;  4A6R A;  4Q31 A;  3UE8 A;  4CBS A;  3QPG A;  2EH6 A;  3EI9 A;  1AHG A;  1IVR A;  1AX4 A;  2OGA A;  2RFV A;  4ADD A;  1KMK A;  2YKU A;  2AY8 A;  1VJO A;  3CAI A;  4ADC A;  3VAX A;  1Z7D A;  3PDB A;  2CFB A;  5E3K A;  1OXO A;  2ZY3 A;  4W1V A;  3GET A;  1B9I A;  2DKJ A;  5DJ9 A;  2VMT A;  3RUY A;  4WYC A;  3ZRQ A;  1MGV A;  3MBB A;  3N5M A;  1GCK A;  3W1J A;  4QGR A;  2VLH A;  3L8A A;  3EIB A;  1AMS A;  2BWO A;  4IXO A;  5AX8 A;  4JEV A;  4R5F A;  4Q6R A;  4MKJ A;  1DJE A;  3UAK A;  5F8V A;  1WKH A;  4WXG A;  5FT8 A;  3EI5 A;  3F6T A;  1AKB A;  2AEU A;  4PFN A;  1WYT B;  2OQX A;  3K40 A;  5J8Q A;  3WKR A;  2Z20 A;  2EZ1 A;  1BJN A;  3NNK A;  3AV7 A;  3M5U A;  2F8J A;  1BW0 A;  3K7Y A;  4OC9 A;  2BI3 A;  4F5F A;  3FD0 A;  3WY7 A;  5G4I A;  2VIB A;  2W8W A;  2HOZ A;  5EUD A;  1X28 A;  2VMS A;  1QJ3 A;  4A6T A;  3PPL A;  1W7L A;  3H9X A;  3MC6 A;  4GE4 A;  1YIZ A;  3RCH B;  2C81 A;  2AY7 A;  8AAT A;  4WXB A;  5JAY A;  2PB0 A;  2HOY A;  3L44 A;  4ITG A;  5K8B A;  4A6U A;  4Q76 A;  3E2Y A;  1ARS A;  1LKC A;  2CH1 A;  2W7G A;  2EYQ A;  1YNU A;  3AOW A;  1BJW A;  2BI5 A;  4LC3 A;  3N0L A;  3COG A;  5FT5 A;  1LW5 A;  3EZS A;  3FQA A;  4AO4 A;  3MAF B;  3LWS A;  1AMA A;  1U08 A;  4MSO A;  4H63 Q;  1P3W A;  4W5K A;  2CJH A;  3MAD A;  3PD6 B;  1GC2 A;  1OAT A;  3NYT A;  4IY7 A;  1O62 A;  1GEW A;  1MDO A;  2WK8 A;  3NUB A;  2QB3 A;  4OBU A;  4ISY A;  3FDD A;  2W7M A;  4J5U A;  3BWO A;  1DJU A;  3GWP A;  2HP1 A;  4RLG A;  2G6W A;  1AIC A;  1C9C A;  1BJO A;  1OHV A;  2HOX A;  3MEB A;  5FT6 A;  1Y4I A;  3EI8 A;  3CBF A;  1T3I A;  1ZC9 A;  4R8D A;  4Y0I A;  4ZSY A;  1WST A;  2D5Y A;  1C7O A;  2W8J A;  3OP7 A;  4N0B A;  3VK4 A;  3JZL A;  3WX9 A;  1ASG A;  1I29 A;  1BT4 A;  1TOI A;  4A0R A;  1SF2 A;  2CY8 A;  5C6U A;  3G7Q A;  1G4X A;  3P6K A;  4IYO A;  1BQA A;  5IWQ A;  5EFS A;  2W7F A;  4R5Z A;  3NTJ A;  3PDX A;  1O69 A;  3FCR A;  1ARI A;  3CQ6 A;  4MKK A;  4RKC A;  4ZM4 A;  3QHX A;  3FQ7 A;  1TOE A;  4XJP A;  2VMO A;  3AOV A;  1BQD A;  5I92 A;  1V2D A;  3ATH A;  3RI6 A;  1I48 A;  3ACZ A;  9AAT A;  2G7J A;  2JJH A;  2Z1Z A;  3W1I A;  4AOA A;  1ZOB A;  3HL2 A;  3EZ1 A;  2YHK A;  3AEN A;  4K2B A;  1YIY A;  4BA4 A;  1SZU A;  3B1C A;  3FFR A;  2YKV A;  3DRD A;  5BJ4 A;  1W3U A;  3F9T A;  3ASB A;  5G4J A;  4ADE A;  2HZP A;  4AZJ A;  4ZAH A;  2A1V A;  2KFP A;  1M0N A;  3GZD C;  4I8A A;  2WB6 A;  3WGC A;  1CJ0 A;  3BS8 A;  5LHA A;  2VGT A;  3H14 A;  2QA3 A;  4IXS A;  5G2Q A;  3ZZJ A;  1S07 A;  3ASA A;  3MKJ A;  2C44 A;  1CL2 A;  1KKP A;  2XBN A;  2Z61 A;  3ISL A;  1AAW A;  4K2I A;  1ZOD A;  1AHF A;  3HLM A;  3ZRR A;  1C4K A;  2FYF A;  1LC8 A;  2W8T A;  3TCM A;  4BMK A;  5M4B A;  3JWB A;  3TFT A;  3AEP A;  4OTL A;  2FNU A;  2BI9 A;  4K05 A;  2E7J A;  1GD9 A;  1TAS A;  2FM1 A;  4OCA A;  4WYD A;  1DGD A;  3KE3 A;  2PO3 A;  5EQC A;  1ASL A;  3N4S A;  4UHM A;  3RQ1 A;  4U1T A;  4A0H A;  3F0H A;  2ZSL A;  1YAA A;  1C7N A;  3GZD A;  1DTY A;  1MLY A;  4ZLV A;  1QIS A;  3W1H A;  1QJ5 A;  3IF2 A;  1SZS A;  4CXR A;  5F9S A;  3E2Z B;  5DX5 A;  4RJY A;  1KKJ A;  1QIT A;  2AY1 A;  2YCP A;  3B1D A;  4XAU A;  5HHY A;  3QM2 A;  1G7W A;  3PAA A;  2D65 A;  1AJS B;  2AY5 A;  3LVL B;  1IBJ A;  2CTZ A;  1LS3 A;  3GJU A;  1YOO A;  4EFF A;  3DYD A;  3LVJ A;  4F5M A;  1XI9 A;  1J04 A;  4XK1 A;  4JE5 A;  1GC4 A;  1AY5 A;  4F5J A;  2V0Y A;  5FT4 A;  2DGL A;  1BS0 A;  4XQ2 A;  3NYS A;  2AEV A;  4M2K A;  2BI1 A;  1AY8 A;  4TN4 A;  1WYU A;  2W7L A;  3VK3 A;  2AY6 A;  1LC5 A;  4Y0D A;  2JIS A;  2D66 A;  1E5F A;  3DC1 A;  3CQ5 A;  1TOJ A;  2CAN A;  2Z9V A;  1OHW A;  3N4X A;  4GEB A;  2VMX A;  1LK9 A;  2HUU A;  2VI9 A;  3WZF A;  3ELP A;  2D7Z A;  4A00 A;  3CQ4 A;  1M0Q A;  4WLJ A;  3WLX A;  3DZZ A;  2DKB A;  2VGS A;  2JJG A;  2YKX A;  1ASA A;  1FC4 A;  2DGM A;  2ZY2 A;  2BIG A;  2Z9W A;  1ARG A;  2W7J A;  2X3L A;  1SFF A;  3NYU A;  2GQN A;  3AAT A;  5EUE A;  1KAF A;  3I16 A;  1GBN A;  3ECD A;  4RAE A;  3WKS A;  3FVS A;  4PVF A;  4BA5 A;  3GR9 A;  1D7S A;  1V2E A;  2AY4 A;  3UWC A;  2R5C B;  5EIG B;  4F5H A;  1N31 A;  4R2N A;  1AIB A;  3E6G A;  3N75 A;  2CB1 A;  1E5E A;  1SZK A;  2BWN A;  3BCA A;  5M46 A;  1V2F A;  1CZE A;  1IJI A;  3EUC A;  4H51 A;  2YKY A;  3A2B A;  3EI7 A;  4RIZ A;  4ZAS A;  2VMV A;  2ZYJ A;  4ZWM A;  2VYC A;  2VMZ A;  1UU0 A;  2W7H A;  5D5S A;  4GDY A;  5DJ1 A;  1M32 A;  2YCN A;  1WYT A;  2GSA A;  1ELQ A;  1JS6 A;  2YRI A;  3RBF A;  1W23 A;  2CIN A;  1CQ8 A;  1QGN A;  2BIE A;  4IW7 A;  1M4N A;  1EG5 A;  1WYV B;  4RJ0 A;  1SPA A;  3BCB A;  1J32 A;  4J8L A;  2WK9 A;  1PG8 A;  1OHY A;  3G0T A;  4ATP A;  1EJI A;  2ORD A;  5G09 A;  1V72 A;  3VOM A;  2X5D A;  1RVU A;  5DB5 A;  1D2F A;  2C0R A;  1B4X A;  2DOU A;  1M0P A;  3AEJ C;  4WXF A;  2QBT A;  3RCH A;  3VK2 A;  4B98 A;  2WK7 A;  2AY3 A;  1ASM A;  2YOB A;  2ZJG A;  3A8U X;  4F5L A;  3KGX A;  2EO5 A;  1S06 A;  3FSL A;  3DXW A;  1D7V A;  3A9Y A;  5HDM A;  2R5C A;  1AKA A;  4AZK A;  3N7N A;  4JF1 A;  4MQQ A;  2Z67 A;  4F4E A;  2FNI A;  1AJR A;  1X29 A;  3TQX A;  2O7C A;  4IX8 A;  2VMQ A;  1LW4 A;  3MAF A;  2VMR A;  1UU2 A;  3MAU A;  3GBX A;  3WCN A;  4DQ6 A;  4WBT A;  2AY2 A;  3EIA A;  1ELU A;  3I5T A;  1AHY A;  3FFH A;  3PD6 A;  4LW2 A;  3FVU A;  3QGU A;  4WYG A;  4UOY A;  1CQ7 A;  4JEX A;  5G2P A;  1N2T A;  2R0T A;  1O61 A;  1G7X A;  4E3Q A;  3VP6 A;  1RV4 A;  4PIW A;  4CXQ A;  4M2J A;  4K2M A;  4OT8 A;  2E54 A;  1AKC A;  3B1E A;  4LNJ A;  4WYA A;  4P7Y A;  2FQ6 A;  1ASD A;  1B5P A;  2E7U A;  4ATQ A;  4EB7 A;  3NRA A;  1PMO A;  2Q7W A;  3N4R A;  1AHX A;  4FFC A;  3LVM A;  1S09 A;  1VEF A;  3FDB A;  3PDB B;  3D6K A;  4OBV A;  2TPL A;  4W91 A;  2QMA A;  3EI6 A;  2X8U A;  1ECX A;  2ZSM A;  5G0A A;  1H1C A;  3Q8N A;  3BV0 A;  1IX7 A;  3DOD A;  2VIA A;  2D64 A;  2W7E A;  1DKA A;  2GMU A;  2CJG A;  2W8U A;  3JWA A;  3PIU A;  2Z9X A;  4N0W A;  3PGY A;  1CZC A;  2QB2 A;  3K28 A;  3B46 A;  5EUN A;  1IUG A;  1H0C A;  4TV7 A;  4WLH A;  1S08 A;  2VMU A;  3QBO A;  2HOR A;  4JEY A;  5KTB A;  4ZSW A;  3DR4 A;  4NOG A;  4MQR A;  1TOG A;  3FZ8 A;  3KKI A;  4PFF A;  2JGT A;  2VMP A;  1ARH A;  1CQ6 A;  1MLZ A;  4EMY A;  4HF8 A;  3JW9 A;  1LC7 A;  3LV2 A;  2DR1 A;  4UHO A;  4A0F A; 
#chains in the Genus database with same CATH homology
 4AO9 A;  3FZ6 A;  5EAA A;  2NMP A;  2VGZ A;  4F5G A;  2QSR A;  3FKD A;  2W8V A;  4W1W A;  5D95 A;  1IAX A;  1AMR A;  3OKS A;  3NU7 A;  3P1T A;  4P3M A;  1YJY A;  5LH9 A;  4KYO A;  2VGV A;  3NDN A;  1W7N A;  3IHJ A;  1JF9 A;  3A9X A;  3ZZK A;  1AMQ A;  2FN6 A;  2VGW A;  1RVY A;  3DR7 A;  3JTX A;  1BKG A;  1I41 A;  3HQT A;  4MQP A;  2EPJ A;  2X5F A;  3B8X A;  4ZDL A;  1TAR A;  3I4J A;  2CJD A;  4UQV A;  1TPL A;  1JS3 A;  2ZUK A;  3E2Z A;  1OXP A;  4DBC A;  4RM1 A;  1ART A;  1XEY A;  4GE7 A;  3GZC A;  4IXZ A;  5TF5 A;  1AJS A;  1I43 A;  1G4V A;  2ZC0 A;  3HDO A;  3BC8 A;  3MC6 C;  4BQ0 A;  2PB2 A;  3FQ8 A;  4XJL A;  1ASN A;  1SVV A;  2OKK A;  3GSB A;  4E3R A;  4ZWV A;  2BYJ A;  1PFF A;  2R2N A;  1ASC A;  1M6S A;  1UKJ A;  2D63 A;  2Z9U A;  1D7U A;  1B9H A;  2VMY A;  3NU8 A;  2AY9 A;  4A72 A;  4LW4 A;  4W1X A;  2ZP7 A;  1DGE A;  2V1P A;  1KMJ A;  3RBL A;  2VLF A;  1FG7 A;  1KL2 A;  1BJO B;  1GEY A;  2C7T A;  3BWN C;  1GEX A;  1PMM A;  4JEZ A;  5E4Z A;  3LY1 A;  1GC3 A;  4MGR A;  4GRX A;  4O6Z A;  1KL1 A;  2GB3 A;  2OKJ A;  4EB5 A;  1GDE A;  4L0O A;  5M49 A;  1MDZ A;  1GC0 A;  3LVK A;  1C0N A;  4E1O A;  1DJ9 A;  1W7M A;  2JJF A;  2EGY A;  4IYO B;  4RIT A;  4GSA A;  1D7R A;  1WKG A;  2HUI A;  2CH2 A;  4F5I A;  3USF A;  5HXX A;  1DFO A;  2BHX A;  1AIA A;  5BJ3 A;  4WP0 A;  1TOK A;  3BWN A;  3AEN B;  3AEO A;  1QIR A;  3ZRP A;  1ASF A;  2OGE A;  4AH3 A;  3H7F A;  3WCO A;  1X0M A;  3KGW A;  2XH1 A;  4RKD A;  4XJM A;  3BN1 A;  2VI8 A;  3HBX A;  4ADB A;  2W7I A;  4B9B A;  1ASB A;  5E5I A;  2VMN A;  3E77 A;  3R9A A;  3G8M A;  4EU1 A;  1ORD A;  1X2A A;  4LNM A;  4W8I A;  4WB0 B;  3ELE A;  2D7Y A;  3FRK A;  2GMS A;  3HVY A;  3T32 A;  4XEW A;  1QZ9 A;  1AHE A;  3BCX A;  5EIG A;  4E77 A;  1AY4 A;  2R5E A;  1BJ4 A;  2EZ2 A;  3DXV A;  4Y0H A;  1FG3 A;  2OAT A;  4M2M A;  4LNL A;  1IAY A;  3FVX A;  3LG0 A;  3R4T A;  4DGT A;  2JG2 A;  2BIA A;  4XJO A;  3II0 A;  1CL1 A;  3DU4 A;  2D61 A;  2ZY5 A;  1C7G A;  5M4D A;  2O0R A;  2BYL A;  3AEJ A;  1B5O A;  3HT4 A;  4CBR A;  4MY5 A;  4JE5 D;  4ZM3 A;  1YJS A;  3JU7 A;  2VGU A;  3NX3 A;  3PJ0 A;  4JF0 A;  2VMW A;  1M7Y A;  4WD2 A;  2JJE A;  1WYV A;  1MAQ A;  2HUF A;  3HMU A;  2QLR A;  4WYF A;  2DGK A;  3TFU A;  4OYT A;  3TAT A;  1JG8 A;  4WYE A;  3PA9 A;  2YRR A;  3AEM C;  3E2F A;  1UU1 A;  1YJZ A;  2W7K A;  3NUI A;  4CVQ A;  3A9Z A;  1O4S A;  2E7I A;  1S0A A;  4UHN A;  1N8P A;  1EQB A;  1CS1 A;  1AAM A;  3E9K A;  4WB0 A;  3QI6 A;  2BKW A;  3FZ7 A;  1B8G A;  4A0G A;  2FKI A;  1WYU B;  1RV3 A;  1IX6 A;  1MAP A;  2YCT A;  4F5K A;  2AAT A;  2CST A;  4U2H A;  3AEL A;  3BB8 A;  3QN6 A;  4BHD A;  2BWP A;  2O1B A;  1TAT A;  4OMA A;  1M0O A;  1ASE A;  4GE9 A;  1VP4 A;  1IX8 A;  1MDX A;  2HP2 A;  3FTB A;  4JEW A;  2WKA A;  3AEM A;  4ITX A;  4HVK A;  3WGB A;  2Z1Y A;  4KXK A;  2BI2 A;  4KAM A;  4Q75 A;  4ZDP A;  2W7D A;  4FL0 A;  2ZY4 A;  7AAT A;  5EAV A;  4ZDO A;  1Z3Z A;  4TMR A;  4A6R A;  4Q31 A;  3UE8 A;  4CBS A;  3QPG A;  2EH6 A;  3EI9 A;  1AHG A;  1IVR A;  1AX4 A;  2OGA A;  2RFV A;  4ADD A;  1KMK A;  2YKU A;  2AY8 A;  1VJO A;  3CAI A;  4ADC A;  3VAX A;  1Z7D A;  3PDB A;  2CFB A;  5E3K A;  1OXO A;  2ZY3 A;  4W1V A;  3GET A;  1B9I A;  2DKJ A;  5DJ9 A;  2VMT A;  3RUY A;  4WYC A;  3ZRQ A;  1MGV A;  3MBB A;  3N5M A;  1GCK A;  3W1J A;  4QGR A;  2VLH A;  3L8A A;  3EIB A;  1AMS A;  2BWO A;  4IXO A;  5AX8 A;  4JEV A;  4R5F A;  4Q6R A;  4MKJ A;  1DJE A;  3UAK A;  5F8V A;  1WKH A;  4WXG A;  5FT8 A;  3EI5 A;  3F6T A;  1AKB A;  2AEU A;  4PFN A;  1WYT B;  2OQX A;  3K40 A;  5J8Q A;  3WKR A;  2Z20 A;  2EZ1 A;  1BJN A;  3NNK A;  3AV7 A;  3M5U A;  2F8J A;  1BW0 A;  3K7Y A;  4OC9 A;  2BI3 A;  4F5F A;  3FD0 A;  3WY7 A;  5G4I A;  2VIB A;  2W8W A;  2HOZ A;  5EUD A;  1X28 A;  2VMS A;  1QJ3 A;  4A6T A;  3PPL A;  1W7L A;  3H9X A;  3MC6 A;  4GE4 A;  1YIZ A;  3RCH B;  2C81 A;  2AY7 A;  8AAT A;  4WXB A;  5JAY A;  2PB0 A;  2HOY A;  3L44 A;  4ITG A;  5K8B A;  4A6U A;  4Q76 A;  3E2Y A;  1ARS A;  1LKC A;  2CH1 A;  2W7G A;  2EYQ A;  1YNU A;  3AOW A;  1BJW A;  2BI5 A;  4LC3 A;  3N0L A;  3COG A;  5FT5 A;  1LW5 A;  3EZS A;  3FQA A;  4AO4 A;  3MAF B;  3LWS A;  1AMA A;  1U08 A;  4MSO A;  4H63 Q;  1P3W A;  4W5K A;  2CJH A;  3MAD A;  3PD6 B;  1GC2 A;  1OAT A;  3NYT A;  4IY7 A;  1O62 A;  1GEW A;  1MDO A;  2WK8 A;  3NUB A;  2QB3 A;  4OBU A;  4ISY A;  3FDD A;  2W7M A;  4J5U A;  3BWO A;  1DJU A;  3GWP A;  2HP1 A;  4RLG A;  2G6W A;  1AIC A;  1C9C A;  1BJO A;  1OHV A;  2HOX A;  3MEB A;  5FT6 A;  1Y4I A;  3EI8 A;  3CBF A;  1T3I A;  1ZC9 A;  4R8D A;  4Y0I A;  4ZSY A;  1WST A;  2D5Y A;  1C7O A;  2W8J A;  3OP7 A;  4N0B A;  3VK4 A;  3JZL A;  3WX9 A;  1ASG A;  1I29 A;  1BT4 A;  1TOI A;  4A0R A;  1SF2 A;  2CY8 A;  5C6U A;  3G7Q A;  1G4X A;  3P6K A;  4IYO A;  1BQA A;  5IWQ A;  5EFS A;  2W7F A;  4R5Z A;  3NTJ A;  3PDX A;  1O69 A;  3FCR A;  1ARI A;  3CQ6 A;  4MKK A;  4RKC A;  4ZM4 A;  3QHX A;  3FQ7 A;  1TOE A;  4XJP A;  2VMO A;  3AOV A;  1BQD A;  5I92 A;  1V2D A;  3ATH A;  3RI6 A;  1I48 A;  3ACZ A;  9AAT A;  2G7J A;  2JJH A;  2Z1Z A;  3W1I A;  4AOA A;  1ZOB A;  3HL2 A;  3EZ1 A;  2YHK A;  3AEN A;  4K2B A;  1YIY A;  4BA4 A;  1SZU A;  3B1C A;  3FFR A;  2YKV A;  3DRD A;  5BJ4 A;  1W3U A;  3F9T A;  3ASB A;  5G4J A;  4ADE A;  2HZP A;  4AZJ A;  4ZAH A;  2A1V A;  2KFP A;  1M0N A;  3GZD C;  4I8A A;  2WB6 A;  3WGC A;  1CJ0 A;  3BS8 A;  5LHA A;  2VGT A;  3H14 A;  2QA3 A;  4IXS A;  5G2Q A;  3ZZJ A;  1S07 A;  3ASA A;  3MKJ A;  2C44 A;  1CL2 A;  1KKP A;  2XBN A;  2Z61 A;  3ISL A;  1AAW A;  4K2I A;  1ZOD A;  1AHF A;  3HLM A;  3ZRR A;  1C4K A;  2FYF A;  1LC8 A;  2W8T A;  3TCM A;  4BMK A;  5M4B A;  3JWB A;  3TFT A;  3AEP A;  4OTL A;  2FNU A;  2BI9 A;  4K05 A;  2E7J A;  1GD9 A;  1TAS A;  2FM1 A;  4OCA A;  4WYD A;  1DGD A;  3KE3 A;  2PO3 A;  5EQC A;  1ASL A;  3N4S A;  4UHM A;  3RQ1 A;  4U1T A;  4A0H A;  3F0H A;  2ZSL A;  1YAA A;  1C7N A;  3GZD A;  1DTY A;  1MLY A;  4ZLV A;  1QIS A;  3W1H A;  1QJ5 A;  3IF2 A;  1SZS A;  4CXR A;  5F9S A;  3E2Z B;  5DX5 A;  4RJY A;  1KKJ A;  1QIT A;  2AY1 A;  2YCP A;  3B1D A;  4XAU A;  5HHY A;  3QM2 A;  1G7W A;  3PAA A;  2D65 A;  1AJS B;  2AY5 A;  3LVL B;  1IBJ A;  2CTZ A;  1LS3 A;  3GJU A;  1YOO A;  4EFF A;  3DYD A;  3LVJ A;  4F5M A;  1XI9 A;  1J04 A;  4XK1 A;  4JE5 A;  1GC4 A;  1AY5 A;  4F5J A;  2V0Y A;  5FT4 A;  2DGL A;  1BS0 A;  4XQ2 A;  3NYS A;  2AEV A;  4M2K A;  2BI1 A;  1AY8 A;  4TN4 A;  1WYU A;  2W7L A;  3VK3 A;  2AY6 A;  1LC5 A;  4Y0D A;  2JIS A;  2D66 A;  1E5F A;  3DC1 A;  3CQ5 A;  1TOJ A;  2CAN A;  2Z9V A;  1OHW A;  3N4X A;  4GEB A;  2VMX A;  1LK9 A;  2HUU A;  2VI9 A;  3WZF A;  3ELP A;  2D7Z A;  4A00 A;  3CQ4 A;  1M0Q A;  4WLJ A;  3WLX A;  3DZZ A;  2DKB A;  2VGS A;  2JJG A;  2YKX A;  1ASA A;  1FC4 A;  2DGM A;  2ZY2 A;  2BIG A;  2Z9W A;  1ARG A;  2W7J A;  2X3L A;  1SFF A;  3NYU A;  2GQN A;  3AAT A;  5EUE A;  3I16 A;  1GBN A;  3ECD A;  4RAE A;  3WKS A;  3FVS A;  4PVF A;  4BA5 A;  3GR9 A;  1D7S A;  1V2E A;  2AY4 A;  3UWC A;  2R5C B;  5EIG B;  4F5H A;  1N31 A;  4R2N A;  1AIB A;  3E6G A;  3N75 A;  2CB1 A;  1E5E A;  1SZK A;  2BWN A;  3BCA A;  5M46 A;  1V2F A;  1CZE A;  1IJI A;  3EUC A;  4H51 A;  2YKY A;  3A2B A;  3EI7 A;  4RIZ A;  4ZAS A;  2VMV A;  2ZYJ A;  4ZWM A;  2VYC A;  2VMZ A;  1UU0 A;  2W7H A;  5D5S A;  4GDY A;  5DJ1 A;  1M32 A;  2YCN A;  1WYT A;  2GSA A;  1ELQ A;  1JS6 A;  2YRI A;  3RBF A;  1W23 A;  2CIN A;  1CQ8 A;  1QGN A;  2BIE A;  4IW7 A;  1M4N A;  1EG5 A;  1WYV B;  4RJ0 A;  1SPA A;  3BCB A;  1J32 A;  4J8L A;  2WK9 A;  1PG8 A;  1OHY A;  3G0T A;  4ATP A;  1EJI A;  2ORD A;  5G09 A;  1V72 A;  3VOM A;  2X5D A;  1RVU A;  5DB5 A;  1D2F A;  2C0R A;  1B4X A;  2DOU A;  1M0P A;  3AEJ C;  4WXF A;  2QBT A;  3RCH A;  3VK2 A;  4B98 A;  2WK7 A;  2AY3 A;  1ASM A;  2YOB A;  2ZJG A;  3A8U X;  4F5L A;  3KGX A;  2EO5 A;  1S06 A;  3FSL A;  3DXW A;  1D7V A;  3A9Y A;  5HDM A;  2R5C A;  1AKA A;  4AZK A;  3N7N A;  4JF1 A;  4MQQ A;  2Z67 A;  4F4E A;  2FNI A;  1AJR A;  1X29 A;  3TQX A;  2O7C A;  4IX8 A;  2VMQ A;  1LW4 A;  3MAF A;  2VMR A;  1UU2 A;  3MAU A;  3GBX A;  3WCN A;  4DQ6 A;  4WBT A;  2AY2 A;  3EIA A;  1ELU A;  3I5T A;  1AHY A;  3FFH A;  3PD6 A;  4LW2 A;  3FVU A;  3QGU A;  4WYG A;  4UOY A;  1CQ7 A;  4JEX A;  5G2P A;  1N2T A;  2R0T A;  1O61 A;  1G7X A;  4E3Q A;  3VP6 A;  1RV4 A;  4PIW A;  4CXQ A;  4M2J A;  4K2M A;  4OT8 A;  2E54 A;  1AKC A;  3B1E A;  4LNJ A;  4WYA A;  4P7Y A;  2FQ6 A;  1ASD A;  1B5P A;  2E7U A;  4ATQ A;  4EB7 A;  3NRA A;  1PMO A;  2Q7W A;  3N4R A;  1AHX A;  4FFC A;  3LVM A;  1S09 A;  1VEF A;  3FDB A;  3PDB B;  3D6K A;  4OBV A;  2TPL A;  4W91 A;  2QMA A;  3EI6 A;  2X8U A;  1ECX A;  2ZSM A;  5G0A A;  1H1C A;  3Q8N A;  3BV0 A;  1IX7 A;  3DOD A;  2VIA A;  2D64 A;  2W7E A;  1DKA A;  2GMU A;  2CJG A;  2W8U A;  3JWA A;  3PIU A;  2Z9X A;  4N0W A;  3PGY A;  1CZC A;  2QB2 A;  3K28 A;  3B46 A;  5EUN A;  1IUG A;  1H0C A;  4TV7 A;  4WLH A;  1S08 A;  2VMU A;  3QBO A;  2HOR A;  4JEY A;  5KTB A;  4ZSW A;  3DR4 A;  4NOG A;  4MQR A;  1TOG A;  3FZ8 A;  3KKI A;  4PFF A;  2JGT A;  2VMP A;  1ARH A;  1CQ6 A;  1MLZ A;  4EMY A;  4HF8 A;  3JW9 A;  1LC7 A;  3LV2 A;  2DR1 A;  4UHO A;  4A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...