3MC9A

Potra1-2 of the periplasmic domain of omp85 from anabaena
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
161
Chain Sequence
b'TEPRVLVSEVLVRPQSGQLTPELETQVYNVIRTQPGRTTTRSQLQEDINAIFGTGFFSNVQASPEDTPLGVRVSFIVQPNPVLSKVEIQANPPSVLPQATADEIFRAQYGKILNLRDLQEGIKELTKRYQDQGYVLANVVGAPQVSENGVVTLQVAEGVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alr2269 protein
publication title Conserved properties of polypeptide transport-associated (POTRA) domains derived from cyanobacterial Omp85.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Membrane protein
total genus 44
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF08479 POTRA_2 POTRA domain, ShlB-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A02
4PK1A 4K3CA 4BZAA 2QDFA 3MC8A 3NJTA 2X8XX 4XGAB 4C4VA 4QAYA 2VH1A 2QCZA 3EFCA 3OG5A 2VH2A 2MHJA 4K3BA 3MC9A 4C4VB 4C00A 3Q6BA 2V9HA
chains in the Genus database with same CATH superfamily
3Q3OC 3AE1B 1OQQA 2M0XA 5E6OA 3ZTDA 1LXDA 1PFDA 5EE9A 4UDUC 1WJ4A 1AW7A 5LLIA 4IG7B 1Q1OA 3Q69A 3QARA 2ZNVB 2JF5A 4BVUC 4NJCA 1I4HA 2LGSA 3KH0A 2MQJA 4YSYB 1V1PA 4YXDB 5AZFA 4ASWC 3ZDTA 2CU1A 2JX5A 4K81A 2GOWA 2QHOA 3DBRI 2CS4A 5C1ZA 4US9A 3VTWA 5G5GA 3AV8A 4KGTA 1YD8U 4HROA 4KDLB 2XK5B 3LJ3A 4B0EA 4XZ4A 4EEWA 1PQSA 4FHKA 4HEA1 4A3OA 2WX1A 3PREA 4A20A 2WXJA 3PHWB 1T5XD 3VQIA 3WIMA 3AEDB 1VZ8A 2KDBA 1X1MA 4NQLB 4GB9A 3KQ4A 2WXMA 4WAFA 4GDKB 4BOSC 2BYFA 2ASQA 2HDEA 4ZRJA 1Z5SB 2L7RA 4RGTA 1EUVB 1WXAA 4MM3B 3VTUA 1L2NA 3ZRFA 3ML9A 5FK9C 2BYEA 1U4AA 2YEPF 1UH6A 2WDVB 5HG2A 4DQOC 2JWZA 2D3AA 1V9JA 2LEKA 2WXNA 4NQKE 2L0TA 1V8CA 1P3QU 1Y8RC 2LGDA 4KZCA 1KFYB 2K9XA 4B6WA 1PUTA 1OEYA 4W9LA 3DVGX 3QCAA 4B0MA 3NRZA 1KOTA 2K1FA 1E8WA 5BO4B 2BTEA 4KSLC 4A9AA 2C7HA 4ZRIA 3NZ3A 2DYMA 4NPNA 1UWMA 2D11A 1WX8A 1FNUA 1UBQA 3Q8CA 3DHGC 3HM3A 3K9PB 4G50A 2GBKA 2IPKD 1I4QA 3O13A 1M94A 3MJ5A 3SDLC 2N9KA 4MJSB 5LNK1 1ACCA 3VTVA 1WRDB 1CK1A 3NHEB 4MGYE 3P4RB 4GDKA 2K39A 4QAYA 1FO4A 1E5WA 1GJZA 2Z0EB 3H7PB 1QQRA 1E8ZA 1YOVB 1IPGA 1EO6A 2EKEC 3ZUNA 1RRBA 3AE8B 3M63B 3B0AA 1V5OA 1ZXHA 2B3AA 2DZKA 1I7HA 5FKAC 3TSSA 2C7MB 3A9KB 2G9HD 1KLVA 3QX1A 2VZKD 2INDC 2L83A 1DGJA 2R2QA 4IWPA 1F2RI 5EE3A 1YNTE 3X0WA 1NYQA 2DENB 1J7BA 2NBUA 2D3BA 4HDQA 3NS8A 5HKHA 2N9EB 5BYQA 4MSQB 3ZJUA 4W9HA 3Q14C 3SEBA 1SE3A 3EHVA 1EF5A 3TIXA 2KDEB 3WALA 2QEJC 3SU8X 4FHJA 2ZVOA 4A3PA 1YJJA 3FAHA 4G11A 3DWGC 2JYEA 2J4XA 3QJZA 2FUHB 2K6DB 4RH6A 5C23A 3T8MA 1R7SA 4WWPA 1JWBD 3Q6BA 2G1EA 4JQWC 4USAA 2J52A 2FCMA 1DYQA 1ENFA 4GLSC 3SFDB 2KXJA 2TSSA 3H7PA 4N6EB 2UU7A 1VJKA 2ZW0A 2MHJA 3E56A 3DVGY 2SAKA 1UZXB 4ZOHC 3A9KA 3RFZB 3IVFA 1JALA 2IJ0A 2KFKB 4ZYSA 3RNFC 3ZTCA 2RPQA 2D10A 2H88B 4HPMB 4KIKB 3AEFB 4XDDA 3NVWA 2WHIA 1C77A 1XLQA 2X38A 2ZPYA 1WR6E 3ZKJC 2J0KA 3RULA 3W2DA 1SE4A 3AEBB 3Q3NC 1XF5L 4D2KA 2ACZB 1D5XC 3DHHC 2KDFB 5EDSA 5GMVA 3A4RA 2KWVB 3N1ZC 3RI7C 4BFRA 3M3JA 2KACA 3U7ZA 2DYOA 3HVDA 2BWES 4FLHA 2LGYA 1L0XB 4C4VB 2JVCA 1GUAB 2DYBA 3ML8A 1JROA 4OW0A 5D6JB 4KZ0A 2L05A 3B9JA 3ETRA 3L17A 4FJVB 3U4EG 3UQAA 2ZPNA 3KUZA 1DOXA 4OZBA 2NTTA 1GPXA 3NS1A 3M95A 2C7NB 1WGYA 3PSEB 2KFKA 4TSSA 4H2AA 2KNBA 3DHIC 5IOIA 2M8SA 2KYWA 1L6VA 2GRIA 1WF9A 1T0QC 3AE2B 1GC7A 4IM2A 1FIQA 3NJTA 1LO5D 2NCNA 4PYZA 4HPLB 1C76A 2KKCA 5TSSA 2RDHA 1TZOA 4EKUA 3DOWA 3AEGB 1PGXA 4MDKE 2V4IB 1SJED 4IC7B 3PRPB 4Q2JA 2W82A 2L00B 3PVLA 1V2YA 3ZJVA 4GSWA 1WJNA 2DZIA 2LRWA 2PMVA 4ICUA 1F9JA 1NBFC 2ZCBA 4P6VF 2BS4B 2ZW1A 4GDLA 4IM0A 2KJHB 3RMKC 5JHBA 2QC8A 1FD6A 2N9LA 2LJIA 3Q3JA 1R4NI 4HCNB 5E6PA 1E7VA 1N5WA 1GAQB 1MHXA 1AWDA 4F8CB 5IO9A 4CQNA 1WJUA 2MBQA 3UIOB 2FCNA 3NY5A 5HHDG 3ZVVA 3VUWA 2WYQA 2I1JA 4C7YA 2MLBA 3QIJA 2IO1B 3MHZA 2KMAA 2WP9B 2WXLA 3P4PB 3OJ4B 4DHZB 3N30A 4XWWA 4HWIB 1WI0A 2WU5B 3KUDB 1V1OA 2LGIA 4AJWA 2VRRB 4NY0A 1I4XA 2LUMA 3A4SC 4YWGG 2FNJB 3U52E 1H4RA 4FULA 1FMAD 1I4RA 3L13A 4MACA 2N0SB 3APCA 1NEKB 3DBHI 4MT5A 4PYUA 1ZDVA 2K3UA 4DHZE 2M1MA 3R7RA 1VZ7A 4P7IA 1J7AA 4XYCA 2L3ZA 1T0SC 2PE9A 1IYFA 2CHXA 2NPTB 3VRAB 3HVZA 2KWUB 2LXCA 4FADA 1ROEA 2XNAC 3IT4B 4RMAA 3WANA 3NVVA 4MGKE 2OHFA 3VUXA 1R4MB 1XT9B 1JRPA 1ET6A 4RCOA 1YJIA 3DPDA 1TIFA 2MBOA 4GN1A 2KFJA 3V6CB 2CHZA 3R2TA 4I6NB 3LYYA 2V3SA 4HXDA 2BKRB 1TT5B 2MH7A 4K3BA 1EU4A 2RD0A 3ZLZA 4IKGA 5IN7A 1N5XA 5CHWA 3V62A 3ZNID 4F7ZA 3U8ZA 2BPSA 2KJRA 4PK1A 3UF8A 1WGHA 2WNMA 3MC0B 4KGSA 3KUCB 3SR6A 3PHXB 2FCSA 2BS3B 2O2VB 2X8XX 2KC1A 3LDZE 1V1PB 4ZRKA 2NPTA 2NVUI 2BS2B 2WXOA 4M8MA 1F77A 1QOGA 5FR3A 3AE9B 2NTSA 1E0ZA 3PRZA 3BVGA 3IBEA 4R3DA 5IA7A 1HZ5A 3QQ8B 4G0NB 3T3NA 2JYTA 3AE7B 1TYGB 5DPSA 3WAOA 4TMAB 3S2AA 1G6JA 1SIFA 3WA0A 2MWSB 4L2YA 2VH1A 2QCZA 3ZO5B 3ZW3A 1JCKB 1E6EB 3AMZA 3Q8AA 1QZEA 2C60A 2MJEA 4LJOB 4OVUA 5IP4D 4HLEA 3H8HA 3N1YC 1T0YA 1MG4A 2MX2A 2JY6A 1YN3A 2PEAA 2KQ4X 1Q5WB 4LNOA 2W9NA 5FR6A 2MBHA 3R3MA 4I6PA 5BYRA 2JUOA 4JWUC 1SF0A 3DBSA 2W54A 4TQ1A 3CMMB 3BY4B 2O2VA 3GZNI 3JW0X 2AL3A 1FNVA 1XD3B 4MH8A 2A4ZA 4HKZE 4II3B 2JPHA 1WSPA 2SEBD 3T9LA 2HJ8A 2WDRB 3VRBB 5LXIB 4YT0B 2M0AA 3HK0A 2RPVA 4M01A 2PVOD 1TGZB 2UYZB 2CJOA 4G3XB 3AEAB 3L10B 2L32A 4LDTD 3H9DA 3I5JC 1SXTA 3AU5A 3D32A 4O1NA 2NR2A 2HJ1A 3BVZA 3ALBA 2PW9A 5JHAA 1EWYC 4RGMA 4BBNC 4PS7A 2J0MA 4HPPA 1C3TA 3RPFC 2KN5A 4W9EA 1F2RC 2GBNA 2OOBB 1PGAA 1RWSA 3TMPB 2MCNB 4II2B 2HTHA 4E71A 2KC2A 2QDFA 5BMGA 1WE6A 3QAQA 1OGWA 3QHTA 4JE3B 3KW5B 2K25A 4ACFA 2N1WA 3SFEB 2RGFA 1C4PA 5D94A 3V61A 4P1BC 5CHVC 3K9OB 2VZKB 2RSUA 5DPRA 2PPHA 3WAMA 4YL8A 1P9DU 2KWDA 2XEWA 5D7GA 3AU4A 2WX0A 4LCDE 2BBCA 2DNFA 1LQBA 3P42A 2WGSA 2V4LA 4DHJD 1ET9A 1WYGA 1V6EA 1HTQA 2MJ3A 3AE5B 3OLMD 5HFYA 5G55A 2UWQA 3MHSD 5TR5A 1C9FA 3SHQA 4OZAA 4EZJA 1JWMD 4HKQA 3MJWA 4JPSA 2I38A 2WS3B 2MP2B 2D07B 4M02A 2H89B 4FJZA 2D3GA 1UELA 1WWTA 3R7QA 4HJKA 1V49A 5AUIA 1UBIA 4N9F4 4LLGM 4JIOU 3MP9A 4URKA 2C5LC 1JQ4A 3EA6A 4MGIE 2PJHA 4M0WB 4MH0E 4DXGA 2YLMA 5H92C 4YTPB 4ZHOA 3ZNHB 2M17A 3ECIA 1ZE3D 1EU3A 4A6QA 2KANA 1LGRA 3PV1A 2DZMA 4GOCA 1N60A 3AH7A 1WM2A 5KHOA 1WR1A 2Z59B 4RGOS 5KHQA 4KV2A 4JLCA 4JL9A 2N1VA 4GGQA 1TS4A 4K7WA 3KWLA 1FCCC 3ZIMA 3ZNGC 2PIAA 3B1LX 1MG8A 3T3OA 2MP2A 3U7DA 1C78A 3FKYA 4AWJA 2PVGC 3KYDD 4HCPB 3VFKA 4W9FA 4OHJA 4ICVA 2WXIA 1SE9A 2B76B 4M00A 1WH3A 1T3QA 1CMXB 3NZSA 2JZ3B 4P1CC 3EUB2 1IUEA 2WXQA 1CJEA 4US8A 3MFGA 2NBVB 1BT0A 2W3SA 2AQ3B 1AARA 3QK0A 4M0WA 3R66C 1P7EA 2OJRA 3BVMA 2QMTA 1MPEA 4W9JA 5G5HA 4GMVA 2OJWA 1A5RA 2M4NA 5J18A 4NJ6A 2FAZA 2PLPA 4HJGE 2KLGA 2GLSA 1I4GA 3NVZA 3GE8C 1TZ1A 4B9KA 1Q10A 3TUOA 2DHZA 3DBLI 1S1QB 4HDOA 1XLPA 2K22A 2ZVNA 4HRSA 3QA8A 2KDIA 4LTUA 1WXSA 3RNEC 3PZ7A 5AUKA 4A8XC 2Z0DB 2LD9A 3SD5A 3EFCA 3BYTB 1IP9A 3ENEA 2GBMA 2LASA 1MFWA 2FBWB 4ITKA 1S3SG 3GB1A 3E9SA 4ZYNA 2V3NA 4GDLB 2WXRA 2BWFA 3PRMB 1FEHA 3UI3A 2QSDA 2Y5BB 1VR9A 1BUIC 3DCGA 4J6IA 4WURA 3IT6B 4WQMA 3RUIB 4WQOB 3PZ8A 3MTNB 2WXHA 4S0RA 2K5PA 4EZKA 2I1KA 1K51A 2FCQA 4BKSA 1WGDA 5DPWA 3H6NA 1PDXA 2MJDA 3DVNV 1UGJA 2R2OA 2KO3A 2LWPA 2N9PC 4MSMB 1EM7A 1SIJA 2KQ7A 4LK0M 3OG5A 3RD2A 3CSTA 3W1SC 2YEPB 4RGNA 4A90A 3A9JB 4XWTA 3TCAA 3L16A 1WX9A 3NOBA 3GS2A 4EFOA 2INPE 1WGGA 1UNSA 1J8CA 4KDIC 2KTRB 5BMHA 3L08A 1MI0A 3BINA 4DBGA 1WGRA 2A5UA 4RM9A 2PTLA 3KVFB 3Q8EA 4TV3A 2WWZA 5AEKB 4ANXA 2INNE 2REXA 2KN4A 3O65B 2JZZA 3U2SC 1IGCA 4W9IA 1MVKA 2KMCA 3V3XA 1FFUA 1WZ3A 4ANWA 2K8HA 3H7SA 1D5MC 2R61A 1XCTL 3PO0A 3I9V1 2WXKA 4IDIA 1V5TA 1YQ4B 1KM7A 3H1UA 5BYSA 1VDVA 1SE2A 5MPOA 3A9JA 3IHPC 4A55A 1CZPA 3AM9A 1QOFA 3ZXRA 2KTFA 1L6UA 3V6EB 5J17A 1JWAD 1D4BA 5L95C 2IO0B 3IG3A 2N9XA 1Z2MA 4WJOA 2BKFA 2WXFA 3WCQA 1B9RA 4EZLA 2GI9A 2KK8A 4EE2A 2KTRA 2N4FA 2L0FA 1E8XA 2KZRA 1TY0A 2BW2A 2XBBC 1XXGA 1TJEA 1HXYD 4MEMA 1ZOYB 1BMLC 2QIEB 3IAS1 3PLVA 1SSNA 3KWVA 3ZYYX 3URYA 4LNFA 1XLOA 1WJ6A 2IDYA 3DBHB 4IWOA 2C9WB 4AOFA 1WX7A 3AN1A 1QT9A 3P1MA 4AJYB 4KSKC 4NAWA 2KOXA 4FBJB 2J7QB 3B2FA 1FXTB 3GOEA 2RDBC 4NAMA 4RM8A 3L4PA 2LHDA 1A70A 3L54A 4NNJB 3ABVB 3UINB 3PLUA 1V80A 1LM8B 1YN5A 3C0RB 2KVZA 2MEKA 1KH0A 5E6JA 3OWEB 2FIFA 3AULA 3UQBA 3Q3MC 2GBRA 1IBXB 3TBLD 2INCC 4HVBA 1L4DB 2HD5B 1TKGA 2MRPA 1EF1A 3P4SB 2L52A 2JRIB 2O6VD 4DK5A 4C56C 1VLBA 2EKIA 1UD7A 3WAPA 2LGXA 1CQVA 2LVPA 4J3OD 2Q5WD 3IFWB 4WJQA 3VXWA 1HE8A 3AECB 4CHKA 3BZDB 4W9KA 3A33B 2LRUA 4KX6B 2RDGA 1SBBB 3MC8A 3W9CB 1YMHE 3W1SA 1RAXA 4RF0A 4XC2A 2BF8B 2KLCA 3CF6E 2BVCA 2IY1B 4X57B 4KVGB 3TEZA 2IO2B 1J7CA 1T0RC 2JZPA 2LJ5A 3KLSX 3ZXVA 1RYJA 3GP7A 1K52A 1QF6A 1ESFA 1IBXA 1OFFA 5AZGA 3GE3C 4YSZB 4YSXB 1OQRA 1JWSD 1ZW7A 1YJ1A 1D5ZC 1NENB 3TL5A 3RZWC 4ZRPA 4NJ7A 2ZEQA 1ZP0B 3B08A 1GB4A 4W9GA 2KDMA 5DCNA 4L1BA 2Y3AA 1P1AA 3HIZA 3ZGZA 3C8YA 3QWZB 1L4ZB 4DDID 2AYOB 1E90A 4WIPA 4DHJB 1VZ6A 1XLNA 1M4VA 2BB6A 3HM6X 3GZNB 4IOIE 4AQ7A 2G45B 5CX3A 1MHHE 1GC6A 1KJTA 4BKTA 4IM3A 4K1RB 2LMCA 1QOBA 1PYWD 3DBRB 3HHMA 2QJLA 1WIAA 3APDA 3PS6A 3BWUD 4WWOA 2KAJA 2Y5PA 4W9DA 1TS3A 4E74A 2J53A 1ISNA 2BYVE 2PKOA 3DDCB 1TBEA 3DVNU 1FXIA 5I4DA 1OTRB 3I57A 3IXSA 4P16A 2PE6B 2WLBA 3NVYA 3AE4B 3R2IA 1HQRD 2V0GA 2CR5A 3EC8A 3NZUA 4YTMB 4JX1C 4C00A 1C4CA 1SEBD 1YX6B 4ANVA 4C80A 3VVWB 3VAWA 1EWCA 4BZAA 1L0YB 1XQQA 3HRDD 1F1HA 5E6NA 1N61A 2MW5A 3M62B 5BMIA 3Q8BA 1KLUD 1C79A 4DWFA 5HI1A 2N7JA 1AYFA 1GOZA 2Z8LA 2NMQA 3ZJTA 1QLBB 3ZQ4A 2N7DA 1J19A 2XK5A 3UIPB 3AE3B 4OZCA 1F0ZA 2ICIA 2L8JA 3TEYA 3AXCA 4W9CA 1KTKA 1FXAA 2HE7A 3NG0A 1I42A 5GXGB 4I6LB 2CKHB 3CIRB 2W3RA 1XCQL 2DZJA 1N63A 1K50A 1WXVA 1ZKHA 4TKNA 4NZLB 2GMIC 4MM3A 1T6BX 2K8BA 4BOZB 1QILA 1HA5A 2OEDA 1QOAA 5L83A 2V3PA 4EOYA 1V97A 2EMSA 1E9MA 4DXFA 2AQ2B 2JU6X 4KKJA 1DOIA 1D6EC 3V05A 1TS2A 2MBEA 4AUQC 2J0JA 3AB5A 3RNAC 1XEEA 2GB1A 2WU2B 1WRIA 1WE7A 3P63A 1N62A 3VUYA 4WH4A 1L0VB 2NBWB 2ZCCA 5H8YE 2JQRB 1FFVA 1GG3A 3C19A 5AZHA 1VD2A 1PGBA 2KX0A 3CWIA 4TUUA 3N3KB 1FCLA 4MJSA 2IGDA 3N1XC 4IUMB 3ZDMC 4ANUA 4YTNB 1K53A 5C2TB 2KMMA 4L23A 1JMLA 2ZJDA 2BT6A 1KRHA 3PTFC 4F1SA 2ONQA 3JVZX 4LNIA 1V86A 4JWSC 2IGHA 1NVID 3RNCC 3VDZA 1OQYA 4WJNA 2V9HA 3ZRCA 2N7EA 2E6XA 1B1ZA 3JSVB 4DDGD 1N6ZA 5CHFA 4ARCA 1JWUD 3LB8C 3JYUA 2W55A 1L7YA 4K7UA 4FA6A 3PGEA 2FE8A 4M8NA 2LI5A 3DBLB 2DAFA 4K3CA 2D2QA 3VHTC 2KT7A 1H8CA 1J0GA 1AN8A 1P98A 2QILA 2M56B 4PS8A 2KHWB 4C7ZA 1WY8A 2IO3B 4RF1A 3HUIA 1C4AA 1SB3C 4FJYA 4KGRA 1ZDXA 3BYYB 4WWMA 3UGBB 2HTME 4EUTA 2K0PA 2JXTA 2ON8A 1FM0D 3AI5A 5JXVA 4REZA 1YQBA 1SJHD 3L0WB 3TJPA 1K8RB 3P2BA 3RZFA 2EMTA 3B2GA 2JXXA 2BB5A 3EGRA 4XGAB 1C1YB 3VH4B 1I4PA 2IY0B 3U30A 2YVCA 3JSVA 1BXTA 4BKSD 4KIKA 4GIVA 4WAAA 2LFIA 3P4QB 3OJ3A 1WMHB 2K8CA 3NUHB 1E8YA 1YN4A 1NI3A 3RNBC 3VR8B 2M19A 1P0RA 4TQ0A 4S17A 5EE0A 3KYCD 5J2RA 3J9CA 3W5VB 1TKYA 2G3QB 2FUG1 1JRUA 2AQ1B 4RNAA 2K6QA 2DAJA 4ARIA 1ZPSA 2CHWA 1HTOA 1ZGUB 2XN9C 3CSFA 1L5PA 2BYTA 4PT5A 3PPAA 4N58A 1RFKA 2KX3A 2BQQA 2I2YA 5EE1A 1JW9D 1VCBA 3PT2B 1RLFA 1TS5A 1NI2A 1YIWA 4C4VA 4XDCA 5D2MB 5D3IB 1FPYA 4FXCA 4ZRQA 3RCZA 2DBYA 3FILB 4AP4C 1SGHA 3N9YC 4WWNA 4LJPB 3Q2AC 1YQ3B 3AEEB 1R4NB 2KQSA 4HK2A 1XO3A 4NAWB 2WDQB 4LNKA 1I35A 5D3DA 2WDTB 2L76A 2RR9A 3A1QB 1TKEA 2JT4B 3RYTA 1E10A 1WMHA 3R8BA 1RM6C 4CO7A 2IBIB 1Y56A 1LFDA 3V60A 5LXHA 2IGGA 2JWUA 4GXBA 2O6VB 1TTNA 5G2NA 1TY2A 4CYEA 3FC4A 4MGZE 1DOYA 4K7SA 2DLBA 1ZUD2 2LXAA 2LHEA 2RMMA 4OVVA 4PS3A 4RFBA 2KJ6A 4JGHB 2AL6A 3PZDA 1WXMA 3W5UB 1NDDA 3RNGC 2AEHA 1WFYA 3W1YA 3TEXA 3VR9B 5IKCM 3ONSA 1FNWA 1R4MI 1WXQA 2GBJA 2ZNVC 3FILA 2AX5A 1FRDA 4KKIA 3N20C 2LVOA 3RN9C 2DWQA 1IGDA 1VRAB 2FIDA 2ZZPB 2Y5CA 4AS1A 2IYDB 4IWQA 1UF0A 5IAAC 2LUEA 4BKGA 1HZ6A 1ZXIA 3ZNZB 2JSVX 1STEA 3QC8B 2AWTA 3A1QA 1E7PB 4BAXA 1KF6B 1HEZE 2DX5B 2G4DB 5JZEB 1Q0WB 2WXGA 3APFA 1E7UA 2MA9B 1P7FA 5T8IA 1V81A 2O6VA 3I63C 1OEYJ 2IZVB 5C3JB 2KWCA 3Q8FA 3I3TB 5JH5C 2BGFA 4GU2A 2WQYB 2WXPA 3IAM1 3LXFA 2D5GA 1UUPA 3AE6B 3OAWA 4WJPA 2LZ6A 1NYRA 3N32A 1UWXA 2VH2A 2NS5A 3DQVA 2L1AA 3EFUA 3MC9A 2JRHA 5CTRC 3X23A 4IW0A 4FN2A 1UGMA 3EECA 1QKZA 1WM3A 3DWMA 3TEWA 2J42A 4N59A 4LNNA 2LVQA 4LDTB 4XX5A 3BIID 4BBNF 2MSED 3VH3B 2CJNA 1YX5B 1WZ0A 3RT3B 1FRRA 2V1YA 3Q3FA 4XE0A 4OVZA 2E3TA 1GNUA 2MBBB 2CU3A 1GB1A 1RFAA 4ZHPA 4MELA 4B95A 1F52A 4E3CA 4ZDVA 1WGKA 2D3CA 2EELA 2G4SA 2KVRA 5DPTA 1MJDA 1WYWB 3BK2A 1KLGD 4DXAB 2KD0A 3BK1A 1D3ZA
chains in the Genus database with same CATH topology
4PK1A 4K3CA 4BZAA 2QDFA 3MC8A 3NJTA 2X8XX 4XGAB 4C4VA 4QAYA 2VH1A 2QCZA 3EFCA 3OG5A 2VH2A 2MHJA 4K3BA 3MC9A 4C4VB 4C00A 3Q6BA 2V9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK1 A;  4K3C A;  4BZA A;  2QDF A;  3MC8 A;  3NJT A;  2X8X X;  4XGA B;  4C4V A;  4QAY A;  2VH1 A;  2QCZ A;  3EFC A;  3OG5 A;  2VH2 A;  2MHJ A;  4K3B A;  3MC9 A;  4C4V B;  4C00 A;  3Q6B A;  2V9H A; 
#chains in the Genus database with same CATH topology
 3Q3O C;  3AE1 B;  1OQQ A;  2M0X A;  5E6O A;  3ZTD A;  1LXD A;  1PFD A;  5EE9 A;  4UDU C;  1WJ4 A;  1AW7 A;  5LLI A;  4IG7 B;  1Q1O A;  3Q69 A;  3QAR A;  2ZNV B;  2JF5 A;  4BVU C;  4NJC A;  1I4H A;  2LGS A;  3KH0 A;  2MQJ A;  4YSY B;  1V1P A;  4YXD B;  5AZF A;  4ASW C;  3ZDT A;  2CU1 A;  2JX5 A;  4K81 A;  2GOW A;  2QHO A;  3DBR I;  2CS4 A;  5C1Z A;  4US9 A;  3VTW A;  5G5G A;  3AV8 A;  4KGT A;  1YD8 U;  4HRO A;  4KDL B;  2XK5 B;  3LJ3 A;  4B0E A;  4XZ4 A;  4EEW A;  1PQS A;  4FHK A;  4HEA 1;  4A3O A;  2WX1 A;  3PRE A;  4A20 A;  2WXJ A;  3PHW B;  1T5X D;  3VQI A;  3WIM A;  3AED B;  1VZ8 A;  2KDB A;  1X1M A;  4NQL B;  4GB9 A;  3KQ4 A;  2WXM A;  4WAF A;  4GDK B;  4BOS C;  2BYF A;  2ASQ A;  2HDE A;  4ZRJ A;  1Z5S B;  2L7R A;  4RGT A;  1EUV B;  1WXA A;  4MM3 B;  3VTU A;  1L2N A;  3ZRF A;  3ML9 A;  5FK9 C;  2BYE A;  1U4A A;  2YEP F;  1UH6 A;  2WDV B;  5HG2 A;  4DQO C;  2JWZ A;  2D3A A;  1V9J A;  2LEK A;  2WXN A;  4NQK E;  2L0T A;  1V8C A;  1P3Q U;  1Y8R C;  2LGD A;  4KZC A;  1KFY B;  2K9X A;  4B6W A;  1PUT A;  1OEY A;  4W9L A;  3DVG X;  3QCA A;  4B0M A;  3NRZ A;  1KOT A;  2K1F A;  1E8W A;  5BO4 B;  2BTE A;  4KSL C;  4A9A A;  2C7H A;  4ZRI A;  3NZ3 A;  2DYM A;  4NPN A;  1UWM A;  2D11 A;  1WX8 A;  1FNU A;  1UBQ A;  3Q8C A;  3DHG C;  3HM3 A;  3K9P B;  4G50 A;  2GBK A;  2IPK D;  1I4Q A;  3O13 A;  1M94 A;  3MJ5 A;  3SDL C;  2N9K A;  4MJS B;  5LNK 1;  1ACC A;  3VTV A;  1WRD B;  1CK1 A;  3NHE B;  4MGY E;  3P4R B;  4GDK A;  2K39 A;  4QAY A;  1FO4 A;  1E5W A;  1GJZ A;  2Z0E B;  3H7P B;  1QQR A;  1E8Z A;  1YOV B;  1IPG A;  1EO6 A;  2EKE C;  3ZUN A;  1RRB A;  3AE8 B;  3M63 B;  3B0A A;  1V5O A;  1ZXH A;  2B3A A;  2DZK A;  1I7H A;  5FKA C;  3TSS A;  2C7M B;  3A9K B;  2G9H D;  1KLV A;  3QX1 A;  2VZK D;  2IND C;  2L83 A;  1DGJ A;  2R2Q A;  4IWP A;  1F2R I;  5EE3 A;  1YNT E;  3X0W A;  1NYQ A;  2DEN B;  1J7B A;  2NBU A;  2D3B A;  4HDQ A;  3NS8 A;  5HKH A;  2N9E B;  5BYQ A;  4MSQ B;  3ZJU A;  4W9H A;  3Q14 C;  3SEB A;  1SE3 A;  3EHV A;  1EF5 A;  3TIX A;  2KDE B;  3WAL A;  2QEJ C;  3SU8 X;  4FHJ A;  2ZVO A;  4A3P A;  1YJJ A;  3FAH A;  4G11 A;  3DWG C;  2JYE A;  2J4X A;  3QJZ A;  2FUH B;  2K6D B;  4RH6 A;  5C23 A;  3T8M A;  1R7S A;  4WWP A;  1JWB D;  3Q6B A;  2G1E A;  4JQW C;  4USA A;  2J52 A;  2FCM A;  1DYQ A;  1ENF A;  4GLS C;  3SFD B;  2KXJ A;  2TSS A;  3H7P A;  4N6E B;  2UU7 A;  1VJK A;  2ZW0 A;  2MHJ A;  3E56 A;  3DVG Y;  2SAK A;  1UZX B;  4ZOH C;  3A9K A;  3RFZ B;  3IVF A;  1JAL A;  2IJ0 A;  2KFK B;  4ZYS A;  3RNF C;  3ZTC A;  2RPQ A;  2D10 A;  2H88 B;  4HPM B;  4KIK B;  3AEF B;  4XDD A;  3NVW A;  2WHI A;  1C77 A;  1XLQ A;  2X38 A;  2ZPY A;  1WR6 E;  3ZKJ C;  2J0K A;  3RUL A;  3W2D A;  1SE4 A;  3AEB B;  3Q3N C;  1XF5 L;  4D2K A;  2ACZ B;  1D5X C;  3DHH C;  2KDF B;  5EDS A;  5GMV A;  3A4R A;  2KWV B;  3N1Z C;  3RI7 C;  4BFR A;  3M3J A;  2KAC A;  3U7Z A;  2DYO A;  3HVD A;  2BWE S;  4FLH A;  2LGY A;  1L0X B;  4C4V B;  2JVC A;  1GUA B;  2DYB A;  3ML8 A;  1JRO A;  4OW0 A;  5D6J B;  4KZ0 A;  2L05 A;  3B9J A;  3ETR A;  3L17 A;  4FJV B;  3U4E G;  3UQA A;  2ZPN A;  3KUZ A;  1DOX A;  4OZB A;  2NTT A;  1GPX A;  3NS1 A;  3M95 A;  2C7N B;  1WGY A;  3PSE B;  2KFK A;  4TSS A;  4H2A A;  2KNB A;  3DHI C;  5IOI A;  2M8S A;  2KYW A;  1L6V A;  2GRI A;  1WF9 A;  1T0Q C;  3AE2 B;  1GC7 A;  4IM2 A;  1FIQ A;  3NJT A;  1LO5 D;  2NCN A;  4PYZ A;  4HPL B;  1C76 A;  2KKC A;  5TSS A;  2RDH A;  1TZO A;  4EKU A;  3DOW A;  3AEG B;  1PGX A;  4MDK E;  2V4I B;  1SJE D;  4IC7 B;  3PRP B;  4Q2J A;  2W82 A;  2L00 B;  3PVL A;  1V2Y A;  3ZJV A;  4GSW A;  1WJN A;  2DZI A;  2LRW A;  2PMV A;  4ICU A;  1F9J A;  1NBF C;  2ZCB A;  4P6V F;  2BS4 B;  2ZW1 A;  4GDL A;  4IM0 A;  2KJH B;  3RMK C;  5JHB A;  2QC8 A;  1FD6 A;  2N9L A;  2LJI A;  3Q3J A;  1R4N I;  4HCN B;  5E6P A;  1E7V A;  1N5W A;  1GAQ B;  1MHX A;  1AWD A;  4F8C B;  5IO9 A;  4CQN A;  1WJU A;  2MBQ A;  3UIO B;  2FCN A;  3NY5 A;  5HHD G;  3ZVV A;  3VUW A;  2WYQ A;  2I1J A;  4C7Y A;  2MLB A;  3QIJ A;  2IO1 B;  3MHZ A;  2KMA A;  2WP9 B;  2WXL A;  3P4P B;  3OJ4 B;  4DHZ B;  3N30 A;  4XWW A;  4HWI B;  1WI0 A;  2WU5 B;  3KUD B;  1V1O A;  2LGI A;  4AJW A;  2VRR B;  4NY0 A;  1I4X A;  2LUM A;  3A4S C;  4YWG G;  2FNJ B;  3U52 E;  1H4R A;  4FUL A;  1FMA D;  1I4R A;  3L13 A;  4MAC A;  2N0S B;  3APC A;  1NEK B;  3DBH I;  4MT5 A;  4PYU A;  1ZDV A;  2K3U A;  4DHZ E;  2M1M A;  3R7R A;  1VZ7 A;  4P7I A;  1J7A A;  4XYC A;  2L3Z A;  1T0S C;  2PE9 A;  1IYF A;  2CHX A;  2NPT B;  3VRA B;  3HVZ A;  2KWU B;  2LXC A;  4FAD A;  1ROE A;  2XNA C;  3IT4 B;  4RMA A;  3WAN A;  3NVV A;  4MGK E;  2OHF A;  3VUX A;  1R4M B;  1XT9 B;  1JRP A;  1ET6 A;  4RCO A;  1YJI A;  3DPD A;  1TIF A;  2MBO A;  4GN1 A;  2KFJ A;  3V6C B;  2CHZ A;  3R2T A;  4I6N B;  3LYY A;  2V3S A;  4HXD A;  2BKR B;  1TT5 B;  2MH7 A;  4K3B A;  1EU4 A;  2RD0 A;  3ZLZ A;  4IKG A;  5IN7 A;  1N5X A;  5CHW A;  3V62 A;  3ZNI D;  4F7Z A;  3U8Z A;  2BPS A;  2KJR A;  4PK1 A;  3UF8 A;  1WGH A;  2WNM A;  3MC0 B;  4KGS A;  3KUC B;  3SR6 A;  3PHX B;  2FCS A;  2BS3 B;  2O2V B;  2X8X X;  2KC1 A;  3LDZ E;  1V1P B;  4ZRK A;  2NPT A;  2NVU I;  2BS2 B;  2WXO A;  4M8M A;  1F77 A;  1QOG A;  5FR3 A;  3AE9 B;  2NTS A;  1E0Z A;  3PRZ A;  3BVG A;  3IBE A;  4R3D A;  5IA7 A;  1HZ5 A;  3QQ8 B;  4G0N B;  3T3N A;  2JYT A;  3AE7 B;  1TYG B;  5DPS A;  3WAO A;  4TMA B;  3S2A A;  1G6J A;  1SIF A;  3WA0 A;  2MWS B;  4L2Y A;  2VH1 A;  2QCZ A;  3ZO5 B;  3ZW3 A;  1JCK B;  1E6E B;  3AMZ A;  3Q8A A;  1QZE A;  2C60 A;  2MJE A;  4LJO B;  4OVU A;  5IP4 D;  4HLE A;  3H8H A;  3N1Y C;  1T0Y A;  1MG4 A;  2MX2 A;  2JY6 A;  1YN3 A;  2PEA A;  2KQ4 X;  1Q5W B;  4LNO A;  2W9N A;  5FR6 A;  2MBH A;  3R3M A;  4I6P A;  5BYR A;  2JUO A;  4JWU C;  1SF0 A;  3DBS A;  2W54 A;  4TQ1 A;  3CMM B;  3BY4 B;  2O2V A;  3GZN I;  3JW0 X;  2AL3 A;  1FNV A;  1XD3 B;  4MH8 A;  2A4Z A;  4HKZ E;  4II3 B;  2JPH A;  1WSP A;  2SEB D;  3T9L A;  2HJ8 A;  2WDR B;  3VRB B;  5LXI B;  4YT0 B;  2M0A A;  3HK0 A;  2RPV A;  4M01 A;  2PVO D;  1TGZ B;  2UYZ B;  2CJO A;  4G3X B;  3AEA B;  3L10 B;  2L32 A;  4LDT D;  3H9D A;  3I5J C;  1SXT A;  3AU5 A;  3D32 A;  4O1N A;  2NR2 A;  2HJ1 A;  3BVZ A;  3ALB A;  2PW9 A;  5JHA A;  1EWY C;  4RGM A;  4BBN C;  4PS7 A;  2J0M A;  4HPP A;  1C3T A;  3RPF C;  2KN5 A;  4W9E A;  1F2R C;  2GBN A;  2OOB B;  1PGA A;  1RWS A;  3TMP B;  2MCN B;  4II2 B;  2HTH A;  4E71 A;  2KC2 A;  2QDF A;  5BMG A;  1WE6 A;  3QAQ A;  1OGW A;  3QHT A;  4JE3 B;  3KW5 B;  2K25 A;  4ACF A;  2N1W A;  3SFE B;  2RGF A;  1C4P A;  5D94 A;  3V61 A;  4P1B C;  5CHV C;  3K9O B;  2VZK B;  2RSU A;  5DPR A;  2PPH A;  3WAM A;  4YL8 A;  1P9D U;  2KWD A;  2XEW A;  5D7G A;  3AU4 A;  2WX0 A;  4LCD E;  2BBC A;  2DNF A;  1LQB A;  3P42 A;  2WGS A;  2V4L A;  4DHJ D;  1ET9 A;  1WYG A;  1V6E A;  1HTQ A;  2MJ3 A;  3AE5 B;  3OLM D;  5HFY A;  5G55 A;  2UWQ A;  3MHS D;  5TR5 A;  1C9F A;  3SHQ A;  4OZA A;  4EZJ A;  1JWM D;  4HKQ A;  3MJW A;  4JPS A;  2I38 A;  2WS3 B;  2MP2 B;  2D07 B;  4M02 A;  2H89 B;  4FJZ A;  2D3G A;  1UEL A;  1WWT A;  3R7Q A;  4HJK A;  1V49 A;  5AUI A;  1UBI A;  4N9F 4;  4LLG M;  4JIO U;  3MP9 A;  4URK A;  2C5L C;  1JQ4 A;  3EA6 A;  4MGI E;  2PJH A;  4M0W B;  4MH0 E;  4DXG A;  2YLM A;  5H92 C;  4YTP B;  4ZHO A;  3ZNH B;  2M17 A;  3ECI A;  1ZE3 D;  1EU3 A;  4A6Q A;  2KAN A;  1LGR A;  3PV1 A;  2DZM A;  4GOC A;  1N60 A;  3AH7 A;  1WM2 A;  5KHO A;  1WR1 A;  2Z59 B;  4RGO S;  5KHQ A;  4KV2 A;  4JLC A;  4JL9 A;  2N1V A;  4GGQ A;  1TS4 A;  4K7W A;  3KWL A;  1FCC C;  3ZIM A;  3ZNG C;  2PIA A;  3B1L X;  1MG8 A;  3T3O A;  2MP2 A;  3U7D A;  1C78 A;  3FKY A;  4AWJ A;  2PVG C;  3KYD D;  4HCP B;  3VFK A;  4W9F A;  4OHJ A;  4ICV A;  2WXI A;  1SE9 A;  2B76 B;  4M00 A;  1WH3 A;  1T3Q A;  1CMX B;  3NZS A;  2JZ3 B;  4P1C C;  3EUB 2;  1IUE A;  2WXQ A;  1CJE A;  4US8 A;  3MFG A;  2NBV B;  1BT0 A;  2W3S A;  2AQ3 B;  1AAR A;  3QK0 A;  4M0W A;  3R66 C;  1P7E A;  2OJR A;  3BVM A;  2QMT A;  1MPE A;  4W9J A;  5G5H A;  4GMV A;  2OJW A;  1A5R A;  2M4N A;  5J18 A;  4NJ6 A;  2FAZ A;  2PLP A;  4HJG E;  2KLG A;  2GLS A;  1I4G A;  3NVZ A;  3GE8 C;  1TZ1 A;  4B9K A;  1Q10 A;  3TUO A;  2DHZ A;  3DBL I;  1S1Q B;  4HDO A;  1XLP A;  2K22 A;  2ZVN A;  4HRS A;  3QA8 A;  2KDI A;  4LTU A;  1WXS A;  3RNE C;  3PZ7 A;  5AUK A;  4A8X C;  2Z0D B;  2LD9 A;  3SD5 A;  3EFC A;  3BYT B;  1IP9 A;  3ENE A;  2GBM A;  2LAS A;  1MFW A;  2FBW B;  4ITK A;  1S3S G;  3GB1 A;  3E9S A;  4ZYN A;  2V3N A;  4GDL B;  2WXR A;  2BWF A;  3PRM B;  1FEH A;  3UI3 A;  2QSD A;  2Y5B B;  1VR9 A;  1BUI C;  3DCG A;  4J6I A;  4WUR A;  3IT6 B;  4WQM A;  3RUI B;  4WQO B;  3PZ8 A;  3MTN B;  2WXH A;  4S0R A;  2K5P A;  4EZK A;  2I1K A;  1K51 A;  2FCQ A;  4BKS A;  1WGD A;  5DPW A;  3H6N A;  1PDX A;  2MJD A;  3DVN V;  1UGJ A;  2R2O A;  2KO3 A;  2LWP A;  2N9P C;  4MSM B;  1EM7 A;  1SIJ A;  2KQ7 A;  4LK0 M;  3OG5 A;  3RD2 A;  3CST A;  3W1S C;  2YEP B;  4RGN A;  4A90 A;  3A9J B;  4XWT A;  3TCA A;  3L16 A;  1WX9 A;  3NOB A;  3GS2 A;  4EFO A;  2INP E;  1WGG A;  1UNS A;  1J8C A;  4KDI C;  2KTR B;  5BMH A;  3L08 A;  1MI0 A;  3BIN A;  4DBG A;  1WGR A;  2A5U A;  4RM9 A;  2PTL A;  3KVF B;  3Q8E A;  4TV3 A;  2WWZ A;  5AEK B;  4ANX A;  2INN E;  2REX A;  2KN4 A;  3O65 B;  2JZZ A;  3U2S C;  1IGC A;  4W9I A;  1MVK A;  2KMC A;  3V3X A;  1FFU A;  1WZ3 A;  4ANW A;  2K8H A;  3H7S A;  1D5M C;  2R61 A;  1XCT L;  3PO0 A;  3I9V 1;  2WXK A;  4IDI A;  1V5T A;  1YQ4 B;  1KM7 A;  3H1U A;  5BYS A;  1VDV A;  1SE2 A;  5MPO A;  3A9J A;  3IHP C;  4A55 A;  1CZP A;  3AM9 A;  1QOF A;  3ZXR A;  2KTF A;  1L6U A;  3V6E B;  5J17 A;  1JWA D;  1D4B A;  5L95 C;  2IO0 B;  3IG3 A;  2N9X A;  1Z2M A;  4WJO A;  2BKF A;  2WXF A;  3WCQ A;  1B9R A;  4EZL A;  2GI9 A;  2KK8 A;  4EE2 A;  2KTR A;  2N4F A;  2L0F A;  1E8X A;  2KZR A;  1TY0 A;  2BW2 A;  2XBB C;  1XXG A;  1TJE A;  1HXY D;  4MEM A;  1ZOY B;  1BML C;  2QIE B;  3IAS 1;  3PLV A;  1SSN A;  3KWV A;  3ZYY X;  3URY A;  4LNF A;  1XLO A;  1WJ6 A;  2IDY A;  3DBH B;  4IWO A;  2C9W B;  4AOF A;  1WX7 A;  3AN1 A;  1QT9 A;  3P1M A;  4AJY B;  4KSK C;  4NAW A;  2KOX A;  4FBJ B;  2J7Q B;  3B2F A;  1FXT B;  3GOE A;  2RDB C;  4NAM A;  4RM8 A;  3L4P A;  2LHD A;  1A70 A;  3L54 A;  4NNJ B;  3ABV B;  3UIN B;  3PLU A;  1V80 A;  1LM8 B;  1YN5 A;  3C0R B;  2KVZ A;  2MEK A;  1KH0 A;  5E6J A;  3OWE B;  2FIF A;  3AUL A;  3UQB A;  3Q3M C;  2GBR A;  1IBX B;  3TBL D;  2INC C;  4HVB A;  1L4D B;  2HD5 B;  1TKG A;  2MRP A;  1EF1 A;  3P4S B;  2L52 A;  2JRI B;  2O6V D;  4DK5 A;  4C56 C;  1VLB A;  2EKI A;  1UD7 A;  3WAP A;  2LGX A;  1CQV A;  2LVP A;  4J3O D;  2Q5W D;  3IFW B;  4WJQ A;  3VXW A;  1HE8 A;  3AEC B;  4CHK A;  3BZD B;  4W9K A;  3A33 B;  2LRU A;  4KX6 B;  2RDG A;  1SBB B;  3MC8 A;  3W9C B;  1YMH E;  3W1S A;  1RAX A;  4RF0 A;  4XC2 A;  2BF8 B;  2KLC A;  3CF6 E;  2BVC A;  2IY1 B;  4X57 B;  4KVG B;  3TEZ A;  2IO2 B;  1J7C A;  1T0R C;  2JZP A;  2LJ5 A;  3KLS X;  3ZXV A;  1RYJ A;  3GP7 A;  1K52 A;  1QF6 A;  1ESF A;  1IBX A;  1OFF A;  5AZG A;  3GE3 C;  4YSZ B;  4YSX B;  1OQR A;  1JWS D;  1ZW7 A;  1YJ1 A;  1D5Z C;  1NEN B;  3TL5 A;  3RZW C;  4ZRP A;  4NJ7 A;  2ZEQ A;  1ZP0 B;  3B08 A;  1GB4 A;  4W9G A;  2KDM A;  5DCN A;  4L1B A;  2Y3A A;  1P1A A;  3HIZ A;  3ZGZ A;  3C8Y A;  3QWZ B;  1L4Z B;  4DDI D;  2AYO B;  1E90 A;  4WIP A;  4DHJ B;  1VZ6 A;  1XLN A;  1M4V A;  2BB6 A;  3HM6 X;  3GZN B;  4IOI E;  4AQ7 A;  2G45 B;  5CX3 A;  1MHH E;  1GC6 A;  1KJT A;  4BKT A;  4IM3 A;  4K1R B;  2LMC A;  1QOB A;  1PYW D;  3DBR B;  3HHM A;  2QJL A;  1WIA A;  3APD A;  3PS6 A;  3BWU D;  4WWO A;  2KAJ A;  2Y5P A;  4W9D A;  1TS3 A;  4E74 A;  2J53 A;  1ISN A;  2BYV E;  2PKO A;  3DDC B;  1TBE A;  3DVN U;  1FXI A;  5I4D A;  1OTR B;  3I57 A;  3IXS A;  4P16 A;  2PE6 B;  2WLB A;  3NVY A;  3AE4 B;  3R2I A;  1HQR D;  2V0G A;  2CR5 A;  3EC8 A;  3NZU A;  4YTM B;  4JX1 C;  4C00 A;  1C4C A;  1SEB D;  1YX6 B;  4ANV A;  4C80 A;  3VVW B;  3VAW A;  1EWC A;  4BZA A;  1L0Y B;  1XQQ A;  3HRD D;  1F1H A;  5E6N A;  1N61 A;  2MW5 A;  3M62 B;  5BMI A;  3Q8B A;  1KLU D;  1C79 A;  4DWF A;  5HI1 A;  2N7J A;  1AYF A;  1GOZ A;  2Z8L A;  2NMQ A;  3ZJT A;  1QLB B;  3ZQ4 A;  2N7D A;  1J19 A;  2XK5 A;  3UIP B;  3AE3 B;  4OZC A;  1F0Z A;  2ICI A;  2L8J A;  3TEY A;  3AXC A;  4W9C A;  1KTK A;  1FXA A;  2HE7 A;  3NG0 A;  1I42 A;  5GXG B;  4I6L B;  2CKH B;  3CIR B;  2W3R A;  1XCQ L;  2DZJ A;  1N63 A;  1K50 A;  1WXV A;  1ZKH A;  4TKN A;  4NZL B;  2GMI C;  4MM3 A;  1T6B X;  2K8B A;  4BOZ B;  1QIL A;  1HA5 A;  2OED A;  1QOA A;  5L83 A;  2V3P A;  4EOY A;  1V97 A;  2EMS A;  1E9M A;  4DXF A;  2AQ2 B;  2JU6 X;  4KKJ A;  1DOI A;  1D6E C;  3V05 A;  1TS2 A;  2MBE A;  4AUQ C;  2J0J A;  3AB5 A;  3RNA C;  1XEE A;  2GB1 A;  2WU2 B;  1WRI A;  1WE7 A;  3P63 A;  1N62 A;  3VUY A;  4WH4 A;  1L0V B;  2NBW B;  2ZCC A;  5H8Y E;  2JQR B;  1FFV A;  1GG3 A;  3C19 A;  5AZH A;  1VD2 A;  1PGB A;  2KX0 A;  3CWI A;  4TUU A;  3N3K B;  1FCL A;  4MJS A;  2IGD A;  3N1X C;  4IUM B;  3ZDM C;  4ANU A;  4YTN B;  1K53 A;  5C2T B;  2KMM A;  4L23 A;  1JML A;  2ZJD A;  2BT6 A;  1KRH A;  3PTF C;  4F1S A;  2ONQ A;  3JVZ X;  4LNI A;  1V86 A;  4JWS C;  2IGH A;  1NVI D;  3RNC C;  3VDZ A;  1OQY A;  4WJN A;  2V9H A;  3ZRC A;  2N7E A;  2E6X A;  1B1Z A;  3JSV B;  4DDG D;  1N6Z A;  5CHF A;  4ARC A;  1JWU D;  3LB8 C;  3JYU A;  2W55 A;  1L7Y A;  4K7U A;  4FA6 A;  3PGE A;  2FE8 A;  4M8N A;  2LI5 A;  3DBL B;  2DAF A;  4K3C A;  2D2Q A;  3VHT C;  2KT7 A;  1H8C A;  1J0G A;  1AN8 A;  1P98 A;  2QIL A;  2M56 B;  4PS8 A;  2KHW B;  4C7Z A;  1WY8 A;  2IO3 B;  4RF1 A;  3HUI A;  1C4A A;  1SB3 C;  4FJY A;  4KGR A;  1ZDX A;  3BYY B;  4WWM A;  3UGB B;  2HTM E;  4EUT A;  2K0P A;  2JXT A;  2ON8 A;  1FM0 D;  3AI5 A;  5JXV A;  4REZ A;  1YQB A;  1SJH D;  3L0W B;  3TJP A;  1K8R B;  3P2B A;  3RZF A;  2EMT A;  3B2G A;  2JXX A;  2BB5 A;  3EGR A;  4XGA B;  1C1Y B;  3VH4 B;  1I4P A;  2IY0 B;  3U30 A;  2YVC A;  3JSV A;  1BXT A;  4BKS D;  4KIK A;  4GIV A;  4WAA A;  2LFI A;  3P4Q B;  3OJ3 A;  1WMH B;  2K8C A;  3NUH B;  1E8Y A;  1YN4 A;  1NI3 A;  3RNB C;  3VR8 B;  2M19 A;  1P0R A;  4TQ0 A;  4S17 A;  5EE0 A;  3KYC D;  5J2R A;  3J9C A;  3W5V B;  1TKY A;  2G3Q B;  2FUG 1;  1JRU A;  2AQ1 B;  4RNA A;  2K6Q A;  2DAJ A;  4ARI A;  1ZPS A;  2CHW A;  1HTO A;  1ZGU B;  2XN9 C;  3CSF A;  1L5P A;  2BYT A;  4PT5 A;  3PPA A;  4N58 A;  1RFK A;  2KX3 A;  2BQQ A;  2I2Y A;  5EE1 A;  1JW9 D;  1VCB A;  3PT2 B;  1RLF A;  1TS5 A;  1NI2 A;  1YIW A;  4C4V A;  4XDC A;  5D2M B;  5D3I B;  1FPY A;  4FXC A;  4ZRQ A;  3RCZ A;  2DBY A;  3FIL B;  4AP4 C;  1SGH A;  3N9Y C;  4WWN A;  4LJP B;  3Q2A C;  1YQ3 B;  3AEE B;  1R4N B;  2KQS A;  4HK2 A;  1XO3 A;  4NAW B;  2WDQ B;  4LNK A;  1I35 A;  5D3D A;  2WDT B;  2L76 A;  2RR9 A;  3A1Q B;  1TKE A;  2JT4 B;  3RYT A;  1E10 A;  1WMH A;  3R8B A;  1RM6 C;  4CO7 A;  2IBI B;  1Y56 A;  1LFD A;  3V60 A;  5LXH A;  2IGG A;  2JWU A;  4GXB A;  2O6V B;  1TTN A;  5G2N A;  1TY2 A;  4CYE A;  3FC4 A;  4MGZ E;  1DOY A;  4K7S A;  2DLB A;  1ZUD 2;  2LXA A;  2LHE A;  2RMM A;  4OVV A;  4PS3 A;  4RFB A;  2KJ6 A;  4JGH B;  2AL6 A;  3PZD A;  1WXM A;  3W5U B;  1NDD A;  3RNG C;  2AEH A;  1WFY A;  3W1Y A;  3TEX A;  3VR9 B;  5IKC M;  3ONS A;  1FNW A;  1R4M I;  1WXQ A;  2GBJ A;  2ZNV C;  3FIL A;  2AX5 A;  1FRD A;  4KKI A;  3N20 C;  2LVO A;  3RN9 C;  2DWQ A;  1IGD A;  1VRA B;  2FID A;  2ZZP B;  2Y5C A;  4AS1 A;  2IYD B;  4IWQ A;  1UF0 A;  5IAA C;  2LUE A;  4BKG A;  1HZ6 A;  1ZXI A;  3ZNZ B;  2JSV X;  1STE A;  3QC8 B;  2AWT A;  3A1Q A;  1E7P B;  4BAX A;  1KF6 B;  1HEZ E;  2DX5 B;  2G4D B;  5JZE B;  1Q0W B;  2WXG A;  3APF A;  1E7U A;  2MA9 B;  1P7F A;  5T8I A;  1V81 A;  2O6V A;  3I63 C;  1OEY J;  2IZV B;  5C3J B;  2KWC A;  3Q8F A;  3I3T B;  5JH5 C;  2BGF A;  4GU2 A;  2WQY B;  2WXP A;  3IAM 1;  3LXF A;  2D5G A;  1UUP A;  3AE6 B;  3OAW A;  4WJP A;  2LZ6 A;  1NYR A;  3N32 A;  1UWX A;  2VH2 A;  2NS5 A;  3DQV A;  2L1A A;  3EFU A;  3MC9 A;  2JRH A;  5CTR C;  3X23 A;  4IW0 A;  4FN2 A;  1UGM A;  3EEC A;  1QKZ A;  1WM3 A;  3DWM A;  3TEW A;  2J42 A;  4N59 A;  4LNN A;  2LVQ A;  4LDT B;  4XX5 A;  3BII D;  4BBN F;  2MSE D;  3VH3 B;  2CJN A;  1YX5 B;  1WZ0 A;  3RT3 B;  1FRR A;  2V1Y A;  3Q3F A;  4XE0 A;  4OVZ A;  2E3T A;  1GNU A;  2MBB B;  2CU3 A;  1GB1 A;  1RFA A;  4ZHP A;  4MEL A;  4B95 A;  1F52 A;  4E3C A;  4ZDV A;  1WGK A;  2D3C A;  2EEL A;  2G4S A;  2KVR A;  5DPT A;  1MJD A;  1WYW B;  3BK2 A;  1KLG D;  4DXA B;  2KD0 A;  3BK1 A;  1D3Z A; 
#chains in the Genus database with same CATH homology
 4PK1 A;  4K3C A;  4BZA A;  2QDF A;  3MC8 A;  3NJT A;  2X8X X;  4XGA B;  4C4V A;  4QAY A;  2VH1 A;  2QCZ A;  3EFC A;  3OG5 A;  2VH2 A;  2MHJ A;  4K3B A;  3MC9 A;  4C4V B;  4C00 A;  3Q6B A;  2V9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...