3MC9A

Potra1-2 of the periplasmic domain of omp85 from anabaena
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
161
Chain Sequence
TEPRVLVSEVLVRPQSGQLTPELETQVYNVIRTQPGRTTTRSQLQEDINAIFGTGFFSNVQASPEDTPLGVRVSFIVQPNPVLSKVEIQANPPSVLPQATADEIFRAQYGKILNLRDLQEGIKELTKRYQDQGYVLANVVGAPQVSENGVVTLQVAEGVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved properties of polypeptide transport-associated (POTRA) domains derived from cyanobacterial Omp85.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Membrane protein
molecule keywords Alr2269 protein
total genus 44
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF08479 POTRA_2 POTRA domain, ShlB-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A02
2VH2A 4XGAB 2X8XX 3MC9A 4K3CA 2VH1A 2MHJA 4C00A 4QAYA 2QDFA 2V9HA 4C4VA 3NJTA 4K3BA 3EFCA 4BZAA 2QCZA 4PK1A 3MC8A 4C4VB 3OG5A 3Q6BA
chains in the Genus database with same CATH superfamily
2ZPNA 1TS3A 3L17A 2RDHA 1QKZA 3OJ4B 1J0GA 5EDSA 3B08A 5EE1A 4HRSA 2IO1B 4B0EA 4G3XB 3IAM1 2KJRA 4WIPA 3LXFA 3H8HA 4KGRA 1XLOA 4FHJA 2DZKA 1NI2A 3ZO5B 4LNFA 4JPSA 2N0SB 4B0MA 1L4DB 3AE3B 1P3QU 4AJWA 1WX7A 2UU7A 1WYGA 5L95C 2YVCA 2ZVNA 1K52A 1KH0A 3PRZA 3P1MA 1JWMD 1OEYA 2CKHB 2NBVB 2ICIA 4WQMA 3K9OB 2QSDA 3TSSA 2WP9B 3IXSA 2TSSA 2D07B 4M00A 1ZDXA 1IYFA 4BVUC 2LVPA 2MHJA 4L23A 4HEA1 1IUEA 3JW0X 3BK2A 4P1BC 3APFA 2INDC 3JSVA 3H7PA 1UBQA 1V5TA 2R2QA 2GBNA 5IOIA 3CF6E 2RGFA 2AEHA 3U8ZA 1SE9A 4NJ7A 4MGYE 1YN4A 1CK1A 2C5LC 3BVGA 4HJGE 3SHQA 4OW0A 3DDCB 4YTPB 4NJ6A 2Z59B 4KZCA 1E7VA 4KKIA 1PQSA 2BQQA 3MFGA 1LO5D 1JRPA 2GBKA 3TL5A 3UF8A 1E8YA 2RMMA 2JQRB 1P9DU 2WXQA 3D32A 4YTMB 4MT5A 1XD3B 3BZDB 4HPLB 1TS4A 3QX1A 3PO0A 4NQKE 2KO3A 3KWLA 1XLQA 1YOVB 3VH3B 1P98A 3RNEC 2ZJDA 3WALA 4YSYB 1DOXA 2AWTA 2N7JA 2PE9A 2W9NA 1GG3A 1JCKB 4W9FA 3BYTB 2FIDA 3UGBB 2NR2A 2R61A 2FAZA 4YL8A 2WU5B 1I4HA 2MJEA 5G2NA 2RD0A 4DDGD 4YWGG 2V0GA 2FBWB 2KKCA 2UWQA 4ASWC 4ACFA 2AQ1B 5H92C 5LLIA 1TS5A 3DCGA 2CHZA 1M4VA 1WYWB 1V8CA 3V62A 3A33B 2KTRB 3V05A 1HQRD 2K25A 4ANUA 1IP9A 2WXJA 3M95A 3AU4A 1WRDB 2KLCA 2BKFA 4RNAA 2NMQA 3P63A 5GXGB 3UQBA 1EM7A 3APDA 1NVID 1EU4A 3WIMA 3PZDA 1C4CA 2JY6A 2KANA 4XWWA 4I6PA 3ZTCA 3Q8FA 4CHKA 4A55A 1E90A 1QOAA 3V61A 1OQYA 2AL3A 1MFWA 3E9SA 1XF5L 4NAMA 1TBEA 1QLBB 3NJTA 2LVOA 2KWUB 4K3BA 3VH4B 3VTVA 5IN7A 2VZKD 4LDTB 5EE3A 4IWOA 2JRIB 3HVDA 1XQQA 3OG5A 5E6PA 1WFYA 2C7NB 3SFEB 4EKUA 4BKSA 3GP7A 2J0MA 1NYQA 2ONQA 1I35A 4CQNA 3CSFA 1KOTA 3NVWA 4TQ0A 3KUDB 2PPHA 1ACCA 1GAQB 1GOZA 2G9HD 3NVVA 4HKQA 3MTNB 5D3DA 2CHXA 1YMHE 4WJNA 1C77A 4XC2A 3DBLI 4HKZE 3W1SC 5IP4D 2Q5WD 1P1AA 2R2OA 1FXIA 3GZNI 3AEEB 1ZP0B 1IGDA 4PK1A 3VUXA 3DVGY 1QOBA 2N9XA 2IY1B 2MP2B 4PS8A 3ZDMC 4WWMA 1XCTL 1FCLA 2WWZA 4GB9A 4A20A 2FIFA 4W9KA 2QDFA 4IM3A 4US9A 2PW9A 4BBNF 3ZKJC 4DXAB 2WU2B 2CJOA 1JALA 2LFIA 2NTSA 1VZ6A 3Q8CA 2N9KA 1WZ3A 4MDKE 2O2VA 3PPAA 1WGRA 4WJOA 4OVUA 2D3BA 3GZNB 2RPQA 2BWES 2YEPB 3NZSA 5BO4B 3PGEA 3KW5B 3QQ8B 1K53A 1SBBB 1VZ7A 3ML8A 4EZJA 2HE7A 3AV8A 1V49A 3PT2B 3L08A 3RZWC 3VR9B 3DVNV 1F52A 3N1XC 3A9JA 3W1SA 1EF1A 2MH7A 5E6JA 2AQ2B 3ZXRA 2DZMA 3C0RB 3SR6A 3ZQ4A 4DHJB 4DBGA 4OZCA 1RFAA 1I4PA 1VLBA 4KIKA 2KWVB 4JWUC 1FXTB 3P4PB 2PJHA 4LNOA 3EC8A 2KFKB 1YN5A 3GS2A 3ABVB 2XEWA 1G6JA 1I4QA 1WIAA 2KWCA 1E8WA 4ZYSA 2L0FA 4BOZB 2G4DB 2QJLA 4GIVA 1ZPSA 2MBEA 2I38A 5G55A 3LYYA 3R2IA 3TEXA 3Q3OC 1E7UA 1Q1OA 1L0YB 1ENFA 3ZNHB 1FXAA 5FK9C 2KOXA 2WXIA 4J3OD 1ZXHA 4FBJB 1D5XC 2L76A 1K51A 2KN4A 1WXMA 3JVZX 4XDCA 3I57A 4K7WA 2LXCA 4WWNA 2DLBA 4MH8A 5BMGA 2YLMA 3DBLB 4FJYA 2KN5A 4W9EA 5J2RA 3P4SB 1WR1A 2INPE 3KYDD 1IBXB 2MWSB 1XLPA 2ZVOA 3RT3B 1Q0WB 1KF6B 1KRHA 2BYTA 2KZRA 4HROA 3HHMA 1QILA 3PS6A 2KACA 4MH0E 2KMCA 2OEDA 2N1WA 2V9HA 3HM6X 1JQ4A 4S17A 4B6WA 4RFBA 5HFYA 5I4DA 4K1RB 3Q3JA 4W9CA 1SIJA 4WJQA 3L16A 4MGZE 2W3SA 5HG2A 2WDVB 1AYFA 1N6ZA 4K7UA 4KX6B 3J9CA 2LRWA 2FCSA 3ZJUA 2PVOD 2N7DA 1YX6B 3AI5A 1V5OA 3BYYB 5GMVA 2XN9C 1L2NA 4G11A 1JRUA 2Z0DB 4NAWB 3RNGC 2EKIA 1UELA 3NHEB 2ZCCA 3TEYA 2MBQA 1YD8U 4DXFA 1BUIC 1VR9A 4MM3B 5DPRA 4II3B 1LGRA 2GRIA 1OFFA 2WX1A 1PGXA 1MHXA 1UZXB 2HDEA 2L52A 4LNIA 1I42A 3AEBB 3VDZA 3N30A 2RPVA 3C8YA 1TJEA 4ICUA 2AL6A 3B9JA 2KD0A 3JSVB 2I1KA 4EEWA 1HXYD 4GDLA 2CHWA 1TZOA 2LRUA 3RNBC 2DHZA 4N59A 3Q3NC 4NNJB 2ZNVB 5G5HA 1Z2MA 1S3SG 3TBLD 1FO4A 2CS4A 2V3NA 3I63C 4DWFA 1BT0A 4FJZA 5TR5A 2MRPA 1GB1A 1UD7A 1H8CA 1F9JA 1VDVA 1L0XB 1NYRA 2FUG1 3T3NA 3P4QB 1N62A 1ET9A 3DVNU 1QZEA 4IKGA 3TCAA 4BFRA 4NZLB 3ALBA 1UGJA 5HHDG 3GE3C 3AE1B 3NY5A 2GLSA 5BMIA 1EWCA 2K3UA 2IY0B 4E3CA 4JLCA 3KH0A 3ZLZA 1L0VB 2A5UA 2QEJC 1ROEA 2KJHB 1WXVA 1FNWA 3R3MA 1XO3A 3GB1A 1BXTA 2Y3AA 4KGSA 4MELA 4WH4A 1GJZA 4REZA 3LJ3A 2Y5CA 4LTUA 1TZ1A 4ZOHC 4TQ1A 2LXAA 3DOWA 5IKCM 3AU5A 2KMAA 2ZCBA 4WAAA 1OGWA 4ANXA 1E10A 2FE8A 4O1NA 3FAHA 5CHFA 2YEPF 3NS8A 4K7SA 2LASA 2ZW0A 4RM8A 5CHVC 5EE9A 4IW0A 2IGDA 2PVGC 3AMZA 3ECIA 1SJED 5AUIA 3EFUA 1EO6A 3RD2A 1E7PB 2WS3B 1LXDA 2KXJA 1I4RA 4HPPA 1ISNA 2NVUI 3WAPA 4C00A 4DXGA 3UIPB 2C7HA 4ZRJA 2JRHA 2LGIA 2BT6A 4DHJD 5MPOA 3SEBA 5LXIB 2ON8A 4BKTA 1L6UA 2WDTB 4HDQA 2LGYA 3O13A 4A90A 1N60A 1TY2A 2MX2A 3WAOA 2EKEC 2LVQA 4GXBA 4WWPA 2KX0A 1SE2A 3H9DA 2QHOA 3P4RB 3MJ5A 2L05A 2LEKA 4MM3A 3A4RA 4ZRQA 2W55A 4ZYNA 1STEA 1WR6E 3B0AA 4BKGA 1TKGA 1ZUD2 3R7QA 1TS2A 1HZ6A 1JMLA 3GE8C 3RMKC 4ICVA 1JW9D 2WXPA 2L00B 2KLGA 2L8JA 4GDLB 1LM8B 5CTRC 1R7SA 1VD2A 3KQ4A 2EMTA 3DPDA 1MPEA 3Q6BA 1V9JA 3AECB 2MQJA 1DOIA 3N1ZC 1OEYJ 3ZNID 3L13A 4FN2A 1WM2A 3P2BA 4LNKA 3KYCD 4IOIE 2WXGA 3W2DA 4PS7A 2IGGA 3B2FA 2LHDA 1A70A 1F2RI 5J18A 1WH3A 1Y56A 4WJPA 3BVZA 2JZ3B 4AP4C 5BYRA 1V97A 2JU6X 2KDFB 4LK0M 2IBIB 3V6EB 3ZRFA 1WMHA 4ARIA 4MGIE 4B9KA 5BMHA 2PIAA 2W54A 1R4NB 4MGKE 1C79A 2L1AA 4BZAA 1E9MA 4HJKA 4ZRIA 1FCCC 1Y8RC 5AZHA 2JX5A 3PZ8A 2FNJB 4BOSC 2OOBB 4W9JA 3VAWA 3SU8X 2G4SA 2X38A 3ZIMA 4YXDB 4MEMA 2RDBC 1GB4A 3AN1A 2ZW1A 2INCC 1MJDA 3PRPB 2K0PA 4RCOA 2IO3B 4C7ZA 3PTFC 2BBCA 4L1BA 2V4LA 2QCZA 1CQVA 2JUOA 3PRMB 1JWUD 4RGOS 4FADA 2WDRB 1J8CA 3R66C 5KHQA 4BAXA 2QIEB 1XXGA 4C56C 4F8CB 2KVZA 1GPXA 1F0ZA 2DNFA 3AE4B 4F1SA 2N7EA 2WXMA 3PZ7A 2XK5A 1JROA 2NPTB 4K81A 3E56A 5JZEB 1UBIA 3VTWA 1HEZE 1BMLC 3N9YC 1RFKA 3EA6A 2GBJA 2X8XX 2LD9A 3HIZA 2D3CA 2N9LA 3ZXVA 3BVMA 2OJRA 3RZFA 3I3TB 1ET6A 5DPTA 1GNUA 4ARCA 1TGZB 2SEBD 2WXHA 2MSED 2KQSA 4EZKA 2BPSA 5C1ZA 1R4MB 4EZLA 4J6IA 2ZZPB 2V1YA 3PVLA 3LDZE 2WHIA 4AJYB 2IO0B 4MSQB 2NCNA 1SE3A 1K50A 1T6BX 3VTUA 3AULA 3IVFA 1NDDA 4LCDE 4YTNB 3TJPA 2K9XA 1C1YB 4DK5A 3U52E 1U4AA 2LMCA 1FD6A 2MBBB 5E6OA 1S1QB 1CJEA 2NPTA 4FXCA 3BY4B 1N61A 2LGSA 3T9LA 5D7GA 1QF6A 3LB8C 2JF5A 4HK2A 2K8HA 3Q3MC 4EE2A 3VRAB 1SSNA 1LQBA 1ZGUB 1SXTA 3N20C 1D3ZA 4M0WA 3VUYA 3W5VB 5JHBA 3AB5A 3H6NA 3EHVA 1VCBA 3RNFC 3EECA 4KZ0A 1B1ZA 4M8NA 3ZNGC 3VR8B 1OTRB 2KTFA 4RM9A 2DX5B 3AE2B 2M0XA 2KDBA 1WI0A 1WX8A 3V6CB 4H2AA 1ZXIA 2DAFA 5BYQA 2N1VA 2HJ8A 4X57B 1SEBD 3QK0A 4WWOA 3PV1A 1L5PA 2LJ5A 1WF9A 1PDXA 3W9CB 1PGBA 3W1YA 3APCA 2GB1A 1T0SC 2JWUA 3ZNZB 3NVZA 2O6VD 2KK8A 5JH5C 3WANA 2KTRA 1TTNA 2E6XA 4XWTA 4CO7A 1ZDVA 4HVBA 3A1QA 1UH6A 1FPYA 1AARA 4A3PA 2JZZA 1PGAA 1UWXA 2DBYA 2M56B 4KSKC 2MCNB 1H4RA 1E5WA 1WJNA 4IM2A 1TY0A 4A9AA 4JX1C 2MJDA 4HLEA 1KM7A 3KWVA 3NVYA 3VVWB 2PE6B 1QOGA 5C3JB 4JE3B 3AE7B 2HJ1A 2NTTA 5LXHA 4TV3A 4GOCA 4XYCA 4ANWA 4E74A 1CMXB 3Q3FA 2J53A 1C4PA 2WDQB 2E3TA 1RLFA 2KQ4X 2QILA 3C19A 1WX9A 5TSSA 4Q2JA 4EUTA 3I5JC 1HTOA 3M3JA 4MJSB 1WZ0A 1EWYC 2CU3A 2QC8A 4KDIC 4HWIB 3DBHB 3DHIC 5FKAC 1F77A 3BK1A 4XE0A 4AUQC 1XEEA 2UYZB 5HI1A 2M0AA 1WGDA 4W9LA 2D5GA 3TUOA 1Z5SB 1PYWD 2B3AA 1J7AA 1C3TA 1YJ1A 4OHJA 3QAQA 2C7MB 3IHPC 1C9FA 1FFVA 2RSUA 1AN8A 4DHZB 4JWSC 4KKJA 1CZPA 1YJIA 3GOEA 4IC7B 2M1MA 1KJTA 4QAYA 1FM0D 2W3RA 3IAS1 2LUEA 1F1HA 5DCNA 3CSTA 2C9WB 1HZ5A 2W82A 3RI7C 3AXCA 1XCQL 3MHZA 1AW7A 2WXFA 1WJ4A 4JGHB 3KVFB 2M17A 4KDLB 1KTKA 1N5WA 1C4AA 2J0KA 1YQBA 4ZDVA 2CJNA 3RNAC 1SGHA 3QJZA 1T0RC 3MC0B 5JXVA 4S0RA 2ZPYA 2HTHA 3NUHB 1V81A 2M19A 1DGJA 2WXRA 1RRBA 4IG7B 4HPMB 3DWMA 2JWZA 3EUB2 1E6EB 1V86A 2KYWA 3U2SC 2WX0A 4CYEA 4AOFA 3ENEA 2BS2B 5C23A 1WSPA 1L7YA 4EOYA 2J42A 5JHAA 4YSZB 2BB5A 2GMIC 4HDOA 4WAFA 1UGMA 3ZGZA 2G1EA 1KLUD 3ZJTA 3TMPB 4JQWC 3ZVVA 4KVGB 3X23A 5AZFA 1FIQA 2BTEA 3A9JB 2DZIA 2J52A 3CWIA 3M63B 3PREA 4UDUC 4M8MA 2WXKA 3QWZB 2KDMA 2MLBA 3QA8A 3PLUA 3UIOB 5DPWA 2L3ZA 1JWAD 4P6VF 4NAWA 3B2GA 4TMAB 1GUAB 3H7SA 2Y5BB 2IDYA 2WYQA 2KWDA 5D94A 1MI0A 2AYOB 1MVKA 1J7BA 3FC4A 4MSMB 2L0TA 2LJIA 2JZPA 3N32A 4GSWA 4W9GA 3KLSX 1P0RA 4OVZA 4W9DA 3NOBA 3P42A 1NBFC 3L0WB 4RF0A 3DBRB 4WQOB 5KHOA 3ZTDA 1WGYA 3H1UA 3HK0A 3AE9B 2K6DB 3DHGC 3DBHI 1ZE3D 3X0WA 1V1PA 3UQAA 2FUHB 2KDIA 2D3GA 5FR3A 1FEHA 3Q69A 5D6JB 4ITKA 4OZAA 2Z8LA 1MHHE 3RYTA 3NRZA 5D3IB 2MA9B 3QCAA 2OHFA 3FILB 2N9EB 3CMMB 4C80A 3RULA 2WGSA 1A5RA 1FNVA 1F2RC 3AE5B 2VRRB 2WQYB 3VQIA 2HTME 4ZRPA 4JIOU 3MP9A 3MC9A 1SF0A 2K6QA 4LJOB 2LI5A 1FMAD 5DPSA 3V60A 2DYOA 3A1QB 2K8CA 3NZ3A 1NI3A 3B1LX 2PLPA 1XLNA 4HXDA 1YIWA 2LZ6A 1V6EA 3ZW3A 1EUVB 3SDLC 1V80A 3O65B 4LLGM 2B76B 2J0JA 3Q14C 4A8XC 2HD5B 2VH2A 2NBUA 1R4MI 2O6VA 1SB3C 2IO2B 2ZEQA 4L2YA 4OVVA 2AX5A 2PMVA 3HUIA 2D11A 4NY0A 4C4VA 3QARA 4IWPA 4WURA 1D6EC 1UF0A 2BKRB 2KMMA 3W5UB 3ZYYX 2IJ0A 2K5PA 2BYVE 3V3XA 1P7EA 1QQRA 4LJPB 2NS5A 1WGKA 2OJWA 3AEGB 3PHXB 1Q10A 3MHSD 4MJSA 4XX5A 1WE6A 1WJ6A 3ML9A 2GI9A 1EU3A 4EFOA 2PKOA 4PYUA 1FRDA 3OJ3A 4RH6A 3OWEB 1RWSA 2GBRA 2M8SA 4NJCA 1ZOYB 1RAXA 4A6QA 1PUTA 3RCZA 2PTLA 2K8BA 1YJJA 2XNAC 2L7RA 4GGQA 3RFZB 3FKYA 1NENB 1T0QC 4FA6A 4LNNA 3MJWA 5IAAC 3TEWA 3TEZA 5L83A 2IZVB 2G3QB 1WGGA 4I6NB 2KFJA 1TKEA 1I4GA 1IBXA 2BYFA 3WAMA 2JSVX 2O2VB 3PHWB 4DHZE 3A4SC 3BINA 4TKNA 4XZ4A 2KAJA 2WXNA 5FR6A 2GOWA 3IT6B 3DVGX 2IPKD 4R3DA 2DYMA 2REXA 4N9F4 2BS4B 4AS1A 3RUIB 1M94A 3Q2AC 1SE4A 2BWFA 3H7PB 1L6VA 2MEKA 1J7CA 2RR9A 4USAA 3R2TA 4JL9A 2WXOA 3DHHC 1E8XA 2JXXA 3KUZA 1XT9B 3AEDB 2LGDA 1T0YA 4GLSC 4DDID 2JVCA 3AE6B 4HCNB 1V1OA 2XK5B 3Q8AA 1YX5B 2KC2A 3ETRA 2V4IB 1I7HA 2QMTA 5J17A 2KFKA 3FILA 2BW2A 5C2TB 4IWQA 3RNCC 2K39A 3AH7A 1R4NI 2KQ7A 2EMSA 4MACA 4W9IA 1ZKHA 2VH1A 1J19A 4GU2A 4N58A 1VJKA 1UUPA 4TSSA 3DBRI 4PYZA 4P7IA 3NZUA 2ACZB 5IO9A 4E71A 2KJ6A 2DENB 4G50A 1L4ZB 2FCNA 4BBNC 3WCQA 2IYDB 1WY8A 4G0NB 2DZJA 1B9RA 1UWMA 2BGFA 1RM6C 1D4BA 3RPFC 2GBMA 4I6LB 1MG4A 4GDKA 1UNSA 1C76A 1T5XD 3RN9C 3I9V1 4US8A 3HM3A 1VZ8A 4C7YA 1WE7A 2XBBC 4A3OA 1QOFA 3N1YC 2KX3A 2V3PA 1TIFA 2LWPA 4N6EB 4NPNA 2ASQA 4ANVA 5T8IA 3IT4B 1YNTE 5H8YE 4P1CC 4RMAA 2Y5PA 4GMVA 3U4EG 3WA0A 3VXWA 1D5ZC 2KDEB 4M0WB 1YQ4B 2H89B 2Z0EB 5EE0A 1JWBD 2BB6A 3N3KB 2KVRA 1E0ZA 2WXLA 3Q8EA 3HRDD 3L54A 4XGAB 1HE8A 3BIID 2PEAA 4YT0B 3DWGC 2L32A 1WGHA 2CU1A 1T3QA 5AZGA 1Q5WB 2KC1A 1SJHD 1RYJA 1DYQA 1QT9A 2H88B 4IM0A 5AUKA 1YQ3B 1EF5A 1IPGA 4ZHPA 3ZUNA 3ONSA 1KLGD 2LUMA 2JPHA 5E6NA 2IGHA 1FNUA 3NG0A 3AE8B 3VHTC 2MP2A 4KSLC 2DWQA 2N9PC 3UI3A 1TKYA 4FHKA 2D3AA 1HTQA 2DYBA 2LHEA 1VRAB 4RF1A 2KNBA 3CIRB 4ZRKA 2KT7A 3URYA 1V2YA 5CX3A 4B95A 1WMHB 4FJVB 2CR5A 2ZNVC 4C4VB 1JWSD 3SD5A 5HKHA 3SFDB 3R7RA 2FCQA 1MG8A 1DOYA 3NS1A 2JYTA 4ZHOA 3VFKA 4OZBA 2RDGA 2J7QB 1GC7A 2BF8B 3U30A 1GC6A 3EFCA 4BKSD 3EGRA 1YN3A 1WM3A 1WRIA 3UINB 2J4XA 1SIFA 2C60A 1K8RB 3JYUA 5AEKB 3BWUD 1FRRA 1WXQA 4YSXB 1C78A 1LFDA 4FULA 4RGNA 3U7ZA 3ZRCA 2I2YA 1TYGB 3IFWB 2MBOA 4TUUA 2EELA 2VZKB 4LDTD 4PS3A 3QC8B 1V1PB 4URKA 3IBEA 3AEAB 3L10B 1OQQA 3Q8BA 3OLMD 2DAJA 4GN1A 2M4NA 1FFUA 1D5MC 2V3SA 4KIKB 3AEFB 4HCPB 5IA7A 4IDIA 3PLVA 2N4FA 3R8BA 3KUCB 3K9PB 4M01A 3TIXA 1WJUA 3OAWA 3AM9A 2MJ3A 2D10A 2BYEA 2MBHA 3HVZA 1AWDA 1IGCA 4K3CA 3ZDTA 1X1MA 3A9KB 2LGXA 3IG3A 3VRBB 4FLHA 2JXTA 2K22A 4IUMB 2A4ZA 4GDKB 1WXSA 1ESFA 4XDDA 2MW5A 1TT5B 3U7DA 2KHWB 2JYEA 5BYSA 1KLVA 1P7FA 1N5XA 2I1JA 4AQ7A 1E8ZA 5LNK1 1ZW7A 1HA5A 3QHTA 1KFYB 2NBWB 5CHWA 3ZJVA 2G45B 4II2B 4RGMA 2FCMA 4RGTA 2BVCA 3QIJA 3DBSA 4KV2A 2JT4B 4AWJA 4KGTA 2L83A 1I4XA 2SAKA 2D2QA 1NEKB 4P16A 2WNMA 2WLBA 4NQLB 1OQRA 1N63A 3T8MA 3DQVA 2AQ3B 4M02A 3A9KA 2BS3B 5G5GA 1PFDA 1WXAA 3L4PA 4W9HA 3MC8A 3T3OA 3S2AA 1WWTA 5D2MB 4D2KA 4F7ZA 4DQOC 3VUWA 2INNE 2K1FA 3PSEB 4PT5A 3M62B 2O6VB
chains in the Genus database with same CATH topology
2VH2A 4XGAB 2X8XX 3MC9A 4K3CA 2VH1A 2MHJA 4C00A 4QAYA 2QDFA 2V9HA 4C4VA 3NJTA 4K3BA 3EFCA 4BZAA 2QCZA 4PK1A 3MC8A 4C4VB 3OG5A 3Q6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VH2 A;  4XGA B;  2X8X X;  3MC9 A;  4K3C A;  2VH1 A;  2MHJ A;  4C00 A;  4QAY A;  2QDF A;  2V9H A;  4C4V A;  3NJT A;  4K3B A;  3EFC A;  4BZA A;  2QCZ A;  4PK1 A;  3MC8 A;  4C4V B;  3OG5 A;  3Q6B A; 
#chains in the Genus database with same CATH topology
 2ZPN A;  1TS3 A;  3L17 A;  2RDH A;  1QKZ A;  3OJ4 B;  1J0G A;  5EDS A;  3B08 A;  5EE1 A;  4HRS A;  2IO1 B;  4B0E A;  4G3X B;  3IAM 1;  2KJR A;  4WIP A;  3LXF A;  3H8H A;  4KGR A;  1XLO A;  4FHJ A;  2DZK A;  1NI2 A;  3ZO5 B;  4LNF A;  4JPS A;  2N0S B;  4B0M A;  1L4D B;  3AE3 B;  1P3Q U;  4AJW A;  1WX7 A;  2UU7 A;  1WYG A;  5L95 C;  2YVC A;  2ZVN A;  1K52 A;  1KH0 A;  3PRZ A;  3P1M A;  1JWM D;  1OEY A;  2CKH B;  2NBV B;  2ICI A;  4WQM A;  3K9O B;  2QSD A;  3TSS A;  2WP9 B;  3IXS A;  2TSS A;  2D07 B;  4M00 A;  1ZDX A;  1IYF A;  4BVU C;  2LVP A;  2MHJ A;  4L23 A;  4HEA 1;  1IUE A;  3JW0 X;  3BK2 A;  4P1B C;  3APF A;  2IND C;  3JSV A;  3H7P A;  1UBQ A;  1V5T A;  2R2Q A;  2GBN A;  5IOI A;  3CF6 E;  2RGF A;  2AEH A;  3U8Z A;  1SE9 A;  4NJ7 A;  4MGY E;  1YN4 A;  1CK1 A;  2C5L C;  3BVG A;  4HJG E;  3SHQ A;  4OW0 A;  3DDC B;  4YTP B;  4NJ6 A;  2Z59 B;  4KZC A;  1E7V A;  4KKI A;  1PQS A;  2BQQ A;  3MFG A;  1LO5 D;  1JRP A;  2GBK A;  3TL5 A;  3UF8 A;  1E8Y A;  2RMM A;  2JQR B;  1P9D U;  2WXQ A;  3D32 A;  4YTM B;  4MT5 A;  1XD3 B;  3BZD B;  4HPL B;  1TS4 A;  3QX1 A;  3PO0 A;  4NQK E;  2KO3 A;  3KWL A;  1XLQ A;  1YOV B;  3VH3 B;  1P98 A;  3RNE C;  2ZJD A;  3WAL A;  4YSY B;  1DOX A;  2AWT A;  2N7J A;  2PE9 A;  2W9N A;  1GG3 A;  1JCK B;  4W9F A;  3BYT B;  2FID A;  3UGB B;  2NR2 A;  2R61 A;  2FAZ A;  4YL8 A;  2WU5 B;  1I4H A;  2MJE A;  5G2N A;  2RD0 A;  4DDG D;  4YWG G;  2V0G A;  2FBW B;  2KKC A;  2UWQ A;  4ASW C;  4ACF A;  2AQ1 B;  5H92 C;  5LLI A;  1TS5 A;  3DCG A;  2CHZ A;  1M4V A;  1WYW B;  1V8C A;  3V62 A;  3A33 B;  2KTR B;  3V05 A;  1HQR D;  2K25 A;  4ANU A;  1IP9 A;  2WXJ A;  3M95 A;  3AU4 A;  1WRD B;  2KLC A;  2BKF A;  4RNA A;  2NMQ A;  3P63 A;  5GXG B;  3UQB A;  1EM7 A;  3APD A;  1NVI D;  1EU4 A;  3WIM A;  3PZD A;  1C4C A;  2JY6 A;  2KAN A;  4XWW A;  4I6P A;  3ZTC A;  3Q8F A;  4CHK A;  4A55 A;  1E90 A;  1QOA A;  3V61 A;  1OQY A;  2AL3 A;  1MFW A;  3E9S A;  1XF5 L;  4NAM A;  1TBE A;  1QLB B;  3NJT A;  2LVO A;  2KWU B;  4K3B A;  3VH4 B;  3VTV A;  5IN7 A;  2VZK D;  4LDT B;  5EE3 A;  4IWO A;  2JRI B;  3HVD A;  1XQQ A;  3OG5 A;  5E6P A;  1WFY A;  2C7N B;  3SFE B;  4EKU A;  4BKS A;  3GP7 A;  2J0M A;  1NYQ A;  2ONQ A;  1I35 A;  4CQN A;  3CSF A;  1KOT A;  3NVW A;  4TQ0 A;  3KUD B;  2PPH A;  1ACC A;  1GAQ B;  1GOZ A;  2G9H D;  3NVV A;  4HKQ A;  3MTN B;  5D3D A;  2CHX A;  1YMH E;  4WJN A;  1C77 A;  4XC2 A;  3DBL I;  4HKZ E;  3W1S C;  5IP4 D;  2Q5W D;  1P1A A;  2R2O A;  1FXI A;  3GZN I;  3AEE B;  1ZP0 B;  1IGD A;  4PK1 A;  3VUX A;  3DVG Y;  1QOB A;  2N9X A;  2IY1 B;  2MP2 B;  4PS8 A;  3ZDM C;  4WWM A;  1XCT L;  1FCL A;  2WWZ A;  4GB9 A;  4A20 A;  2FIF A;  4W9K A;  2QDF A;  4IM3 A;  4US9 A;  2PW9 A;  4BBN F;  3ZKJ C;  4DXA B;  2WU2 B;  2CJO A;  1JAL A;  2LFI A;  2NTS A;  1VZ6 A;  3Q8C A;  2N9K A;  1WZ3 A;  4MDK E;  2O2V A;  3PPA A;  1WGR A;  4WJO A;  4OVU A;  2D3B A;  3GZN B;  2RPQ A;  2BWE S;  2YEP B;  3NZS A;  5BO4 B;  3PGE A;  3KW5 B;  3QQ8 B;  1K53 A;  1SBB B;  1VZ7 A;  3ML8 A;  4EZJ A;  2HE7 A;  3AV8 A;  1V49 A;  3PT2 B;  3L08 A;  3RZW C;  3VR9 B;  3DVN V;  1F52 A;  3N1X C;  3A9J A;  3W1S A;  1EF1 A;  2MH7 A;  5E6J A;  2AQ2 B;  3ZXR A;  2DZM A;  3C0R B;  3SR6 A;  3ZQ4 A;  4DHJ B;  4DBG A;  4OZC A;  1RFA A;  1I4P A;  1VLB A;  4KIK A;  2KWV B;  4JWU C;  1FXT B;  3P4P B;  2PJH A;  4LNO A;  3EC8 A;  2KFK B;  1YN5 A;  3GS2 A;  3ABV B;  2XEW A;  1G6J A;  1I4Q A;  1WIA A;  2KWC A;  1E8W A;  4ZYS A;  2L0F A;  4BOZ B;  2G4D B;  2QJL A;  4GIV A;  1ZPS A;  2MBE A;  2I38 A;  5G55 A;  3LYY A;  3R2I A;  3TEX A;  3Q3O C;  1E7U A;  1Q1O A;  1L0Y B;  1ENF A;  3ZNH B;  1FXA A;  5FK9 C;  2KOX A;  2WXI A;  4J3O D;  1ZXH A;  4FBJ B;  1D5X C;  2L76 A;  1K51 A;  2KN4 A;  1WXM A;  3JVZ X;  4XDC A;  3I57 A;  4K7W A;  2LXC A;  4WWN A;  2DLB A;  4MH8 A;  5BMG A;  2YLM A;  3DBL B;  4FJY A;  2KN5 A;  4W9E A;  5J2R A;  3P4S B;  1WR1 A;  2INP E;  3KYD D;  1IBX B;  2MWS B;  1XLP A;  2ZVO A;  3RT3 B;  1Q0W B;  1KF6 B;  1KRH A;  2BYT A;  2KZR A;  4HRO A;  3HHM A;  1QIL A;  3PS6 A;  2KAC A;  4MH0 E;  2KMC A;  2OED A;  2N1W A;  2V9H A;  3HM6 X;  1JQ4 A;  4S17 A;  4B6W A;  4RFB A;  5HFY A;  5I4D A;  4K1R B;  3Q3J A;  4W9C A;  1SIJ A;  4WJQ A;  3L16 A;  4MGZ E;  2W3S A;  5HG2 A;  2WDV B;  1AYF A;  1N6Z A;  4K7U A;  4KX6 B;  3J9C A;  2LRW A;  2FCS A;  3ZJU A;  2PVO D;  2N7D A;  1YX6 B;  3AI5 A;  1V5O A;  3BYY B;  5GMV A;  2XN9 C;  1L2N A;  4G11 A;  1JRU A;  2Z0D B;  4NAW B;  3RNG C;  2EKI A;  1UEL A;  3NHE B;  2ZCC A;  3TEY A;  2MBQ A;  1YD8 U;  4DXF A;  1BUI C;  1VR9 A;  4MM3 B;  5DPR A;  4II3 B;  1LGR A;  2GRI A;  1OFF A;  2WX1 A;  1PGX A;  1MHX A;  1UZX B;  2HDE A;  2L52 A;  4LNI A;  1I42 A;  3AEB B;  3VDZ A;  3N30 A;  2RPV A;  3C8Y A;  1TJE A;  4ICU A;  2AL6 A;  3B9J A;  2KD0 A;  3JSV B;  2I1K A;  4EEW A;  1HXY D;  4GDL A;  2CHW A;  1TZO A;  2LRU A;  3RNB C;  2DHZ A;  4N59 A;  3Q3N C;  4NNJ B;  2ZNV B;  5G5H A;  1Z2M A;  1S3S G;  3TBL D;  1FO4 A;  2CS4 A;  2V3N A;  3I63 C;  4DWF A;  1BT0 A;  4FJZ A;  5TR5 A;  2MRP A;  1GB1 A;  1UD7 A;  1H8C A;  1F9J A;  1VDV A;  1L0X B;  1NYR A;  2FUG 1;  3T3N A;  3P4Q B;  1N62 A;  1ET9 A;  3DVN U;  1QZE A;  4IKG A;  3TCA A;  4BFR A;  4NZL B;  3ALB A;  1UGJ A;  5HHD G;  3GE3 C;  3AE1 B;  3NY5 A;  2GLS A;  5BMI A;  1EWC A;  2K3U A;  2IY0 B;  4E3C A;  4JLC A;  3KH0 A;  3ZLZ A;  1L0V B;  2A5U A;  2QEJ C;  1ROE A;  2KJH B;  1WXV A;  1FNW A;  3R3M A;  1XO3 A;  3GB1 A;  1BXT A;  2Y3A A;  4KGS A;  4MEL A;  4WH4 A;  1GJZ A;  4REZ A;  3LJ3 A;  2Y5C A;  4LTU A;  1TZ1 A;  4ZOH C;  4TQ1 A;  2LXA A;  3DOW A;  5IKC M;  3AU5 A;  2KMA A;  2ZCB A;  4WAA A;  1OGW A;  4ANX A;  1E10 A;  2FE8 A;  4O1N A;  3FAH A;  5CHF A;  2YEP F;  3NS8 A;  4K7S A;  2LAS A;  2ZW0 A;  4RM8 A;  5CHV C;  5EE9 A;  4IW0 A;  2IGD A;  2PVG C;  3AMZ A;  3ECI A;  1SJE D;  5AUI A;  3EFU A;  1EO6 A;  3RD2 A;  1E7P B;  2WS3 B;  1LXD A;  2KXJ A;  1I4R A;  4HPP A;  1ISN A;  2NVU I;  3WAP A;  4C00 A;  4DXG A;  3UIP B;  2C7H A;  4ZRJ A;  2JRH A;  2LGI A;  2BT6 A;  4DHJ D;  5MPO A;  3SEB A;  5LXI B;  2ON8 A;  4BKT A;  1L6U A;  2WDT B;  4HDQ A;  2LGY A;  3O13 A;  4A90 A;  1N60 A;  1TY2 A;  2MX2 A;  3WAO A;  2EKE C;  2LVQ A;  4GXB A;  4WWP A;  2KX0 A;  1SE2 A;  3H9D A;  2QHO A;  3P4R B;  3MJ5 A;  2L05 A;  2LEK A;  4MM3 A;  3A4R A;  4ZRQ A;  2W55 A;  4ZYN A;  1STE A;  1WR6 E;  3B0A A;  4BKG A;  1TKG A;  1ZUD 2;  3R7Q A;  1TS2 A;  1HZ6 A;  1JML A;  3GE8 C;  3RMK C;  4ICV A;  1JW9 D;  2WXP A;  2L00 B;  2KLG A;  2L8J A;  4GDL B;  1LM8 B;  5CTR C;  1R7S A;  1VD2 A;  3KQ4 A;  2EMT A;  3DPD A;  1MPE A;  3Q6B A;  1V9J A;  3AEC B;  2MQJ A;  1DOI A;  3N1Z C;  1OEY J;  3ZNI D;  3L13 A;  4FN2 A;  1WM2 A;  3P2B A;  4LNK A;  3KYC D;  4IOI E;  2WXG A;  3W2D A;  4PS7 A;  2IGG A;  3B2F A;  2LHD A;  1A70 A;  1F2R I;  5J18 A;  1WH3 A;  1Y56 A;  4WJP A;  3BVZ A;  2JZ3 B;  4AP4 C;  5BYR A;  1V97 A;  2JU6 X;  2KDF B;  4LK0 M;  2IBI B;  3V6E B;  3ZRF A;  1WMH A;  4ARI A;  4MGI E;  4B9K A;  5BMH A;  2PIA A;  2W54 A;  1R4N B;  4MGK E;  1C79 A;  2L1A A;  4BZA A;  1E9M A;  4HJK A;  4ZRI A;  1FCC C;  1Y8R C;  5AZH A;  2JX5 A;  3PZ8 A;  2FNJ B;  4BOS C;  2OOB B;  4W9J A;  3VAW A;  3SU8 X;  2G4S A;  2X38 A;  3ZIM A;  4YXD B;  4MEM A;  2RDB C;  1GB4 A;  3AN1 A;  2ZW1 A;  2INC C;  1MJD A;  3PRP B;  2K0P A;  4RCO A;  2IO3 B;  4C7Z A;  3PTF C;  2BBC A;  4L1B A;  2V4L A;  2QCZ A;  1CQV A;  2JUO A;  3PRM B;  1JWU D;  4RGO S;  4FAD A;  2WDR B;  1J8C A;  3R66 C;  5KHQ A;  4BAX A;  2QIE B;  1XXG A;  4C56 C;  4F8C B;  2KVZ A;  1GPX A;  1F0Z A;  2DNF A;  3AE4 B;  4F1S A;  2N7E A;  2WXM A;  3PZ7 A;  2XK5 A;  1JRO A;  2NPT B;  4K81 A;  3E56 A;  5JZE B;  1UBI A;  3VTW A;  1HEZ E;  1BML C;  3N9Y C;  1RFK A;  3EA6 A;  2GBJ A;  2X8X X;  2LD9 A;  3HIZ A;  2D3C A;  2N9L A;  3ZXV A;  3BVM A;  2OJR A;  3RZF A;  3I3T B;  1ET6 A;  5DPT A;  1GNU A;  4ARC A;  1TGZ B;  2SEB D;  2WXH A;  2MSE D;  2KQS A;  4EZK A;  2BPS A;  5C1Z A;  1R4M B;  4EZL A;  4J6I A;  2ZZP B;  2V1Y A;  3PVL A;  3LDZ E;  2WHI A;  4AJY B;  2IO0 B;  4MSQ B;  2NCN A;  1SE3 A;  1K50 A;  1T6B X;  3VTU A;  3AUL A;  3IVF A;  1NDD A;  4LCD E;  4YTN B;  3TJP A;  2K9X A;  1C1Y B;  4DK5 A;  3U52 E;  1U4A A;  2LMC A;  1FD6 A;  2MBB B;  5E6O A;  1S1Q B;  1CJE A;  2NPT A;  4FXC A;  3BY4 B;  1N61 A;  2LGS A;  3T9L A;  5D7G A;  1QF6 A;  3LB8 C;  2JF5 A;  4HK2 A;  2K8H A;  3Q3M C;  4EE2 A;  3VRA B;  1SSN A;  1LQB A;  1ZGU B;  1SXT A;  3N20 C;  1D3Z A;  4M0W A;  3VUY A;  3W5V B;  5JHB A;  3AB5 A;  3H6N A;  3EHV A;  1VCB A;  3RNF C;  3EEC A;  4KZ0 A;  1B1Z A;  4M8N A;  3ZNG C;  3VR8 B;  1OTR B;  2KTF A;  4RM9 A;  2DX5 B;  3AE2 B;  2M0X A;  2KDB A;  1WI0 A;  1WX8 A;  3V6C B;  4H2A A;  1ZXI A;  2DAF A;  5BYQ A;  2N1V A;  2HJ8 A;  4X57 B;  1SEB D;  3QK0 A;  4WWO A;  3PV1 A;  1L5P A;  2LJ5 A;  1WF9 A;  1PDX A;  3W9C B;  1PGB A;  3W1Y A;  3APC A;  2GB1 A;  1T0S C;  2JWU A;  3ZNZ B;  3NVZ A;  2O6V D;  2KK8 A;  5JH5 C;  3WAN A;  2KTR A;  1TTN A;  2E6X A;  4XWT A;  4CO7 A;  1ZDV A;  4HVB A;  3A1Q A;  1UH6 A;  1FPY A;  1AAR A;  4A3P A;  2JZZ A;  1PGA A;  1UWX A;  2DBY A;  2M56 B;  4KSK C;  2MCN B;  1H4R A;  1E5W A;  1WJN A;  4IM2 A;  1TY0 A;  4A9A A;  4JX1 C;  2MJD A;  4HLE A;  1KM7 A;  3KWV A;  3NVY A;  3VVW B;  2PE6 B;  1QOG A;  5C3J B;  4JE3 B;  3AE7 B;  2HJ1 A;  2NTT A;  5LXH A;  4TV3 A;  4GOC A;  4XYC A;  4ANW A;  4E74 A;  1CMX B;  3Q3F A;  2J53 A;  1C4P A;  2WDQ B;  2E3T A;  1RLF A;  2KQ4 X;  2QIL A;  3C19 A;  1WX9 A;  5TSS A;  4Q2J A;  4EUT A;  3I5J C;  1HTO A;  3M3J A;  4MJS B;  1WZ0 A;  1EWY C;  2CU3 A;  2QC8 A;  4KDI C;  4HWI B;  3DBH B;  3DHI C;  5FKA C;  1F77 A;  3BK1 A;  4XE0 A;  4AUQ C;  1XEE A;  2UYZ B;  5HI1 A;  2M0A A;  1WGD A;  4W9L A;  2D5G A;  3TUO A;  1Z5S B;  1PYW D;  2B3A A;  1J7A A;  1C3T A;  1YJ1 A;  4OHJ A;  3QAQ A;  2C7M B;  3IHP C;  1C9F A;  1FFV A;  2RSU A;  1AN8 A;  4DHZ B;  4JWS C;  4KKJ A;  1CZP A;  1YJI A;  3GOE A;  4IC7 B;  2M1M A;  1KJT A;  4QAY A;  1FM0 D;  2W3R A;  3IAS 1;  2LUE A;  1F1H A;  5DCN A;  3CST A;  2C9W B;  1HZ5 A;  2W82 A;  3RI7 C;  3AXC A;  1XCQ L;  3MHZ A;  1AW7 A;  2WXF A;  1WJ4 A;  4JGH B;  3KVF B;  2M17 A;  4KDL B;  1KTK A;  1N5W A;  1C4A A;  2J0K A;  1YQB A;  4ZDV A;  2CJN A;  3RNA C;  1SGH A;  3QJZ A;  1T0R C;  3MC0 B;  5JXV A;  4S0R A;  2ZPY A;  2HTH A;  3NUH B;  1V81 A;  2M19 A;  1DGJ A;  2WXR A;  1RRB A;  4IG7 B;  4HPM B;  3DWM A;  2JWZ A;  3EUB 2;  1E6E B;  1V86 A;  2KYW A;  3U2S C;  2WX0 A;  4CYE A;  4AOF A;  3ENE A;  2BS2 B;  5C23 A;  1WSP A;  1L7Y A;  4EOY A;  2J42 A;  5JHA A;  4YSZ B;  2BB5 A;  2GMI C;  4HDO A;  4WAF A;  1UGM A;  3ZGZ A;  2G1E A;  1KLU D;  3ZJT A;  3TMP B;  4JQW C;  3ZVV A;  4KVG B;  3X23 A;  5AZF A;  1FIQ A;  2BTE A;  3A9J B;  2DZI A;  2J52 A;  3CWI A;  3M63 B;  3PRE A;  4UDU C;  4M8M A;  2WXK A;  3QWZ B;  2KDM A;  2MLB A;  3QA8 A;  3PLU A;  3UIO B;  5DPW A;  2L3Z A;  1JWA D;  4P6V F;  4NAW A;  3B2G A;  4TMA B;  1GUA B;  3H7S A;  2Y5B B;  2IDY A;  2WYQ A;  2KWD A;  5D94 A;  1MI0 A;  2AYO B;  1MVK A;  1J7B A;  3FC4 A;  4MSM B;  2L0T A;  2LJI A;  2JZP A;  3N32 A;  4GSW A;  4W9G A;  3KLS X;  1P0R A;  4OVZ A;  4W9D A;  3NOB A;  3P42 A;  1NBF C;  3L0W B;  4RF0 A;  3DBR B;  4WQO B;  5KHO A;  3ZTD A;  1WGY A;  3H1U A;  3HK0 A;  3AE9 B;  2K6D B;  3DHG C;  3DBH I;  1ZE3 D;  3X0W A;  1V1P A;  3UQA A;  2FUH B;  2KDI A;  2D3G A;  5FR3 A;  1FEH A;  3Q69 A;  5D6J B;  4ITK A;  4OZA A;  2Z8L A;  1MHH E;  3RYT A;  3NRZ A;  5D3I B;  2MA9 B;  3QCA A;  2OHF A;  3FIL B;  2N9E B;  3CMM B;  4C80 A;  3RUL A;  2WGS A;  1A5R A;  1FNV A;  1F2R C;  3AE5 B;  2VRR B;  2WQY B;  3VQI A;  2HTM E;  4ZRP A;  4JIO U;  3MP9 A;  3MC9 A;  1SF0 A;  2K6Q A;  4LJO B;  2LI5 A;  1FMA D;  5DPS A;  3V60 A;  2DYO A;  3A1Q B;  2K8C A;  3NZ3 A;  1NI3 A;  3B1L X;  2PLP A;  1XLN A;  4HXD A;  1YIW A;  2LZ6 A;  1V6E A;  3ZW3 A;  1EUV B;  3SDL C;  1V80 A;  3O65 B;  4LLG M;  2B76 B;  2J0J A;  3Q14 C;  4A8X C;  2HD5 B;  2VH2 A;  2NBU A;  1R4M I;  2O6V A;  1SB3 C;  2IO2 B;  2ZEQ A;  4L2Y A;  4OVV A;  2AX5 A;  2PMV A;  3HUI A;  2D11 A;  4NY0 A;  4C4V A;  3QAR A;  4IWP A;  4WUR A;  1D6E C;  1UF0 A;  2BKR B;  2KMM A;  3W5U B;  3ZYY X;  2IJ0 A;  2K5P A;  2BYV E;  3V3X A;  1P7E A;  1QQR A;  4LJP B;  2NS5 A;  1WGK A;  2OJW A;  3AEG B;  3PHX B;  1Q10 A;  3MHS D;  4MJS A;  4XX5 A;  1WE6 A;  1WJ6 A;  3ML9 A;  2GI9 A;  1EU3 A;  4EFO A;  2PKO A;  4PYU A;  1FRD A;  3OJ3 A;  4RH6 A;  3OWE B;  1RWS A;  2GBR A;  2M8S A;  4NJC A;  1ZOY B;  1RAX A;  4A6Q A;  1PUT A;  3RCZ A;  2PTL A;  2K8B A;  1YJJ A;  2XNA C;  2L7R A;  4GGQ A;  3RFZ B;  3FKY A;  1NEN B;  1T0Q C;  4FA6 A;  4LNN A;  3MJW A;  5IAA C;  3TEW A;  3TEZ A;  5L83 A;  2IZV B;  2G3Q B;  1WGG A;  4I6N B;  2KFJ A;  1TKE A;  1I4G A;  1IBX A;  2BYF A;  3WAM A;  2JSV X;  2O2V B;  3PHW B;  4DHZ E;  3A4S C;  3BIN A;  4TKN A;  4XZ4 A;  2KAJ A;  2WXN A;  5FR6 A;  2GOW A;  3IT6 B;  3DVG X;  2IPK D;  4R3D A;  2DYM A;  2REX A;  4N9F 4;  2BS4 B;  4AS1 A;  3RUI B;  1M94 A;  3Q2A C;  1SE4 A;  2BWF A;  3H7P B;  1L6V A;  2MEK A;  1J7C A;  2RR9 A;  4USA A;  3R2T A;  4JL9 A;  2WXO A;  3DHH C;  1E8X A;  2JXX A;  3KUZ A;  1XT9 B;  3AED B;  2LGD A;  1T0Y A;  4GLS C;  4DDI D;  2JVC A;  3AE6 B;  4HCN B;  1V1O A;  2XK5 B;  3Q8A A;  1YX5 B;  2KC2 A;  3ETR A;  2V4I B;  1I7H A;  2QMT A;  5J17 A;  2KFK A;  3FIL A;  2BW2 A;  5C2T B;  4IWQ A;  3RNC C;  2K39 A;  3AH7 A;  1R4N I;  2KQ7 A;  2EMS A;  4MAC A;  4W9I A;  1ZKH A;  2VH1 A;  1J19 A;  4GU2 A;  4N58 A;  1VJK A;  1UUP A;  4TSS A;  3DBR I;  4PYZ A;  4P7I A;  3NZU A;  2ACZ B;  5IO9 A;  4E71 A;  2KJ6 A;  2DEN B;  4G50 A;  1L4Z B;  2FCN A;  4BBN C;  3WCQ A;  2IYD B;  1WY8 A;  4G0N B;  2DZJ A;  1B9R A;  1UWM A;  2BGF A;  1RM6 C;  1D4B A;  3RPF C;  2GBM A;  4I6L B;  1MG4 A;  4GDK A;  1UNS A;  1C76 A;  1T5X D;  3RN9 C;  3I9V 1;  4US8 A;  3HM3 A;  1VZ8 A;  4C7Y A;  1WE7 A;  2XBB C;  4A3O A;  1QOF A;  3N1Y C;  2KX3 A;  2V3P A;  1TIF A;  2LWP A;  4N6E B;  4NPN A;  2ASQ A;  4ANV A;  5T8I A;  3IT4 B;  1YNT E;  5H8Y E;  4P1C C;  4RMA A;  2Y5P A;  4GMV A;  3U4E G;  3WA0 A;  3VXW A;  1D5Z C;  2KDE B;  4M0W B;  1YQ4 B;  2H89 B;  2Z0E B;  5EE0 A;  1JWB D;  2BB6 A;  3N3K B;  2KVR A;  1E0Z A;  2WXL A;  3Q8E A;  3HRD D;  3L54 A;  4XGA B;  1HE8 A;  3BII D;  2PEA A;  4YT0 B;  3DWG C;  2L32 A;  1WGH A;  2CU1 A;  1T3Q A;  5AZG A;  1Q5W B;  2KC1 A;  1SJH D;  1RYJ A;  1DYQ A;  1QT9 A;  2H88 B;  4IM0 A;  5AUK A;  1YQ3 B;  1EF5 A;  1IPG A;  4ZHP A;  3ZUN A;  3ONS A;  1KLG D;  2LUM A;  2JPH A;  5E6N A;  2IGH A;  1FNU A;  3NG0 A;  3AE8 B;  3VHT C;  2MP2 A;  4KSL C;  2DWQ A;  2N9P C;  3UI3 A;  1TKY A;  4FHK A;  2D3A A;  1HTQ A;  2DYB A;  2LHE A;  1VRA B;  4RF1 A;  2KNB A;  3CIR B;  4ZRK A;  2KT7 A;  3URY A;  1V2Y A;  5CX3 A;  4B95 A;  1WMH B;  4FJV B;  2CR5 A;  2ZNV C;  4C4V B;  1JWS D;  3SD5 A;  5HKH A;  3SFD B;  3R7R A;  2FCQ A;  1MG8 A;  1DOY A;  3NS1 A;  2JYT A;  4ZHO A;  3VFK A;  4OZB A;  2RDG A;  2J7Q B;  1GC7 A;  2BF8 B;  3U30 A;  1GC6 A;  3EFC A;  4BKS D;  3EGR A;  1YN3 A;  1WM3 A;  1WRI A;  3UIN B;  2J4X A;  1SIF A;  2C60 A;  1K8R B;  3JYU A;  5AEK B;  3BWU D;  1FRR A;  1WXQ A;  4YSX B;  1C78 A;  1LFD A;  4FUL A;  4RGN A;  3U7Z A;  3ZRC A;  2I2Y A;  1TYG B;  3IFW B;  2MBO A;  4TUU A;  2EEL A;  2VZK B;  4LDT D;  4PS3 A;  3QC8 B;  1V1P B;  4URK A;  3IBE A;  3AEA B;  3L10 B;  1OQQ A;  3Q8B A;  3OLM D;  2DAJ A;  4GN1 A;  2M4N A;  1FFU A;  1D5M C;  2V3S A;  4KIK B;  3AEF B;  4HCP B;  5IA7 A;  4IDI A;  3PLV A;  2N4F A;  3R8B A;  3KUC B;  3K9P B;  4M01 A;  3TIX A;  1WJU A;  3OAW A;  3AM9 A;  2MJ3 A;  2D10 A;  2BYE A;  2MBH A;  3HVZ A;  1AWD A;  1IGC A;  4K3C A;  3ZDT A;  1X1M A;  3A9K B;  2LGX A;  3IG3 A;  3VRB B;  4FLH A;  2JXT A;  2K22 A;  4IUM B;  2A4Z A;  4GDK B;  1WXS A;  1ESF A;  4XDD A;  2MW5 A;  1TT5 B;  3U7D A;  2KHW B;  2JYE A;  5BYS A;  1KLV A;  1P7F A;  1N5X A;  2I1J A;  4AQ7 A;  1E8Z A;  5LNK 1;  1ZW7 A;  1HA5 A;  3QHT A;  1KFY B;  2NBW B;  5CHW A;  3ZJV A;  2G45 B;  4II2 B;  4RGM A;  2FCM A;  4RGT A;  2BVC A;  3QIJ A;  3DBS A;  4KV2 A;  2JT4 B;  4AWJ A;  4KGT A;  2L83 A;  1I4X A;  2SAK A;  2D2Q A;  1NEK B;  4P16 A;  2WNM A;  2WLB A;  4NQL B;  1OQR A;  1N63 A;  3T8M A;  3DQV A;  2AQ3 B;  4M02 A;  3A9K A;  2BS3 B;  5G5G A;  1PFD A;  1WXA A;  3L4P A;  4W9H A;  3MC8 A;  3T3O A;  3S2A A;  1WWT A;  5D2M B;  4D2K A;  4F7Z A;  4DQO C;  3VUW A;  2INN E;  2K1F A;  3PSE B;  4PT5 A;  3M62 B;  2O6V B; 
#chains in the Genus database with same CATH homology
 2VH2 A;  4XGA B;  2X8X X;  3MC9 A;  4K3C A;  2VH1 A;  2MHJ A;  4C00 A;  4QAY A;  2QDF A;  2V9H A;  4C4V A;  3NJT A;  4K3B A;  3EFC A;  4BZA A;  2QCZ A;  4PK1 A;  3MC8 A;  4C4V B;  3OG5 A;  3Q6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...