3MC9A

Potra1-2 of the periplasmic domain of omp85 from anabaena
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
161
Chain Sequence
TEPRVLVSEVLVRPQSGQLTPELETQVYNVIRTQPGRTTTRSQLQEDINAIFGTGFFSNVQASPEDTPLGVRVSFIVQPNPVLSKVEIQANPPSVLPQATADEIFRAQYGKILNLRDLQEGIKELTKRYQDQGYVLANVVGAPQVSENGVVTLQVAEGVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alr2269 protein
publication title Conserved properties of polypeptide transport-associated (POTRA) domains derived from cyanobacterial Omp85.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Membrane protein
total genus 44
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF08479 POTRA_2 POTRA domain, ShlB-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A02
4C4VA 2QDFA 3Q6BA 2VH1A 4K3CA 4C00A 3EFCA 4QAYA 3NJTA 3MC9A 2V9HA 4XGAB 2X8XX 4PK1A 2MHJA 3MC8A 3OG5A 4K3BA 4BZAA 4C4VB 2QCZA 2VH2A
chains in the Genus database with same CATH superfamily
2O2VB 3ZNID 2L1AA 2WU5B 1WR1A 2Z0DB 3AEEB 2WXFA 3EA6A 3CMMB 1AW7A 2BB5A 4P16A 2MSED 2LXCA 3DHHC 4USAA 4XWTA 1HE8A 3IFWB 2JWUA 2PVGC 2JZPA 2CKHB 1FIQA 4KSKC 1Q5WB 3AEDB 1WF9A 4M8MA 1YD8U 4IWQA 5D7GA 2WWZA 2ZW0A 1VR9A 1WMHB 4ARIA 4S0RA 2AWTA 1SBBB 1JWMD 2V3SA 4LDTD 4TV3A 2CHWA 4TQ0A 2BS4B 2O6VB 2YEPF 2KOXA 3AE6B 3V6EB 2KJ6A 4GXBA 2BVCA 1R4NI 4ICVA 2VZKD 3ZNGC 1KLUD 4MJSB 3RYTA 1BT0A 2YVCA 2BKFA 1YJIA 4GMVA 2KWVB 2MBBB 4YL8A 1KH0A 4TUUA 1WXSA 3HUIA 5CX3A 2J0MA 4MT5A 4AP4C 1WE7A 4BFRA 1S3SG 4BKSD 2WDVB 3RNGC 2PIAA 4K7UA 1F1HA 4YXDB 1RRBA 4OVZA 4OZAA 1CQVA 4BKSA 1N6ZA 2WHIA 3PZ7A 2IY0B 4KKJA 3KQ4A 5TSSA 3ZKJC 3I63C 5G5GA 1SE4A 3FKYA 4KZCA 1YN5A 3OAWA 2FCSA 1DOXA 2KANA 1E8XA 2C7NB 1V97A 4LNOA 4XDDA 4IWPA 1Z5SB 3KYDD 3DBSA 4MSMB 3AE3B 5AZFA 2KWCA 4B95A 3RT3B 3DWGC 1MPEA 5H92C 4OVUA 2Z0EB 1F9JA 4N9F4 2KFKA 3DVGY 1ESFA 4W9DA 1UBIA 3Q8CA 1D5ZC 4CO7A 2QIEB 3BY4B 1YN3A 2JXTA 2JYEA 4YWGG 3B08A 2KQ4X 2HD5B 4RM9A 4JX1C 2RPQA 2BB6A 2FUG1 3GS2A 1FNVA 2G1EA 4JWUC 1ZDXA 2RDGA 2DAFA 3A1QA 4FADA 4IWOA 4PS7A 3JW0X 2BKRB 1NYQA 4GN1A 4GB9A 2LGIA 3ZJTA 3RD2A 4EKUA 1TS3A 1YX5B 4XE0A 4NZLB 1TS4A 2NPTA 4AJWA 4KVGB 1ZP0B 5HI1A 2OJRA 1WE6A 4AQ7A 1Y56A 1FRDA 3N32A 1FMAD 4BVUC 2DNFA 2JPHA 1SGHA 3DCGA 1XLQA 2PTLA 4LCDE 4YSZB 2K3UA 2REXA 3JSVB 4MGZE 2QCZA 1E90A 3E56A 5EE1A 3URYA 1K53A 4DXAB 3D32A 3T3NA 2BPSA 3FC4A 4MH8A 1FPYA 1ZXIA 4TSSA 4PYUA 2K5PA 2J4XA 2JT4B 4TMAB 3AE5B 1XCTL 2MA9B 3IAS1 4C56C 1BXTA 2NBUA 2LI5A 2VH2A 1GAQB 3PSEB 1JQ4A 3VRBB 4PYZA 4XC2A 2AX5A 1YQ4B 3SEBA 2JX5A 3MC9A 3ML9A 1E9MA 1WXQA 3PRZA 2LVQA 1C77A 2IPKD 2FAZA 2GRIA 3AEBB 4K7SA 1SB3C 3A33B 4HLEA 5G2NA 3SFEB 2NS5A 3Q14C 3MHZA 5EDSA 2B76B 5DPRA 3SU8X 2BTEA 2ICIA 2WXOA 1MFWA 2CU3A 3HVZA 1EUVB 2I1JA 5DCNA 1UWXA 4US8A 5LNK1 2KZRA 4DBGA 1EO6A 3ABVB 1T0YA 2VH1A 4HDQA 1QOFA 2N9KA 3AB5A 2FE8A 4YSYB 2KWDA 4LTUA 1NBFC 1QT9A 2PEAA 1V81A 2RSUA 3FILA 4FLHA 1MG8A 4TKNA 1I4QA 2KMAA 5I4DA 4FJYA 5IO9A 1JW9D 3I3TB 2G4DB 3RCZA 3LXFA 4EZJA 3ZJVA 4GSWA 3ZQ4A 1WI0A 3N30A 4AUQC 4XWWA 5J2RA 2NBVB 1E7VA 2AQ1B 2LVPA 1XLOA 4ANXA 4OHJA 4RNAA 1E10A 2M0XA 2KVZA 2KWUB 3A9JA 5AEKB 2LUEA 1JWSD 1PUTA 4J6IA 2IO1B 1MJDA 2M4NA 2N7DA 3L54A 3ZDTA 1JWBD 2GOWA 2MJ3A 3BINA 4MGIE 1PDXA 1YQBA 1V8CA 2DZMA 1N61A 1P7FA 2LJ5A 1M4VA 1TY2A 2V3PA 4A55A 1LM8B 3R7RA 2BWFA 3RPFC 1KM7A 1GNUA 1OTRB 1ZKHA 3DBHB 3RI7C 3DOWA 4WWNA 3WALA 3UI3A 1ZE3D 4M0WB 1WY8A 5DPWA 4UDUC 3DBHI 3PGEA 2Y3AA 3Q8AA 3PRPB 2PJHA 1RFAA 1N62A 2PE9A 3NS1A 4WAAA 1SE3A 2MJEA 2IY1B 4HWIB 1LO5D 3B9JA 1MI0A 1C4CA 4NJ7A 3KWVA 2J7QB 1JWUD 2W9NA 4WJOA 2N7EA 2EKEC 2MBOA 4IUMB 1AARA 4KDIC 1FCCC 5D6JB 2Z8LA 1JALA 2D10A 1J7CA 3AE2B 3H6NA 3RNFC 1D6EC 4R3DA 3J9CA 3IT6B 1LGRA 3VR9B 2CHXA 3LDZE 2C9WB 4YTMB 3IT4B 3Q2AC 1XF5L 4K1RB 3TJPA 2LEKA 3PTFC 1TS5A 5BO4B 1P0RA 1G6JA 2MH7A 4A6QA 3RULA 2JSVX 4HRSA 2CJOA 2C7HA 4RGMA 2H88B 3LJ3A 4FULA 3MC8A 2DZKA 2NR2A 5AUIA 2MJDA 3OJ3A 1C4AA 3N1ZC 1SE2A 2JRHA 3RUIB 1T0RC 2DZJA 2KTRA 4OVVA 2FUHB 2JZ3B 4KIKA 2H89B 3A9KA 2UYZB 4BOSC 3VUYA 3UINB 4HKQA 4K7WA 2DAJA 2LXAA 5JHAA 1V5OA 3W5VB 3VH3B 2KC1A 1S1QB 1L7YA 4JPSA 2K22A 3BK2A 1NENB 4WWPA 1FRRA 3QA8A 3APFA 1PGXA 2N9PC 3L08A 4ANWA 3NZUA 1IPGA 1N60A 1WWTA 2RDHA 4NAMA 1STEA 2WDTB 3SD5A 2KX0A 3L4PA 3AI5A 5CTRC 2EELA 4DHJB 4DHZE 1UD7A 5MPOA 3N9YC 2N9LA 2ZPYA 4EFOA 5L83A 3N3KB 4HCPB 5IP4D 3RN9C 1GC7A 1LXDA 4S17A 1KF6B 3ZLZA 3A1QB 1GPXA 4G11A 3QCAA 3RNEC 3QAQA 4KKIA 3GZNB 3TEZA 1UF0A 3ALBA 2JRIB 4MEMA 3EECA 3GZNI 5T8IA 4C80A 3RMKC 2BQQA 1CZPA 3KVFB 4FA6A 2WXHA 1PFDA 1WH3A 4P6VF 3JYUA 2LGXA 2SAKA 3MP9A 3VDZA 2CR5A 2IGHA 2G45B 1F2RI 1A70A 3V05A 1NYRA 2WXPA 3KH0A 3PVLA 2LGDA 3HHMA 2DZIA 3T9LA 5EE3A 1QOAA 1UGJA 4W9LA 4NQLB 2DWQA 3Q3FA 5JH5C 3ZTCA 3AN1A 1T6BX 1IBXA 2OEDA 2DENB 4LNNA 1L0XB 3H1UA 4D2KA 3R8BA 2D3BA 3TEWA 3QQ8B 2Z59B 4RFBA 4ZHOA 1E0ZA 2ZEQA 3B2FA 1OEYJ 1HQRD 3U8ZA 1TZ1A 1HTQA 1V2YA 4M00A 1I4GA 3T8MA 2DYMA 3OG5A 2G4SA 3DPDA 4B0EA 2GBKA 3DBRB 3RNBC 4YTPB 5E6PA 4WJQA 2KDFB 4ZOHC 3QK0A 1V6EA 3PHWB 3DBRI 4WWMA 5BYRA 4GDKB 1V1PB 4A8XC 3RNAC 2V4LA 5BYQA 1Q10A 2JWZA 3ZXVA 1WZ0A 2EKIA 3PRMB 4NAWA 5L95C 4WQMA 4W9KA 1D3ZA 5EE0A 4DDID 4KSLC 1NEKB 1UBQA 2IO3B 3I57A 2M19A 2WX0A 1R7SA 2LD9A 3PO0A 2MLBA 3OWEB 2JVCA 1WSPA 1NVID 3O65B 2KDBA 1XEEA 3L13A 3QHTA 5AUKA 1AN8A 5BMIA 4CQNA 4NPNA 4LLGM 3Q3OC 5G5HA 2JYTA 1Q0WB 4ICUA 4WJPA 3BVMA 5FR3A 3DQVA 1LFDA 2GBMA 1SIFA 4RF1A 2K39A 4F1SA 1WFYA 1YX6B 2XK5A 5HHDG 4BBNC 2ZNVB 1UWMA 1JRUA 1IP9A 1V5TA 1EF5A 3NZ3A 4Q2JA 3LYYA 2BF8B 4BKGA 1C1YB 3MJ5A 2MW5A 1D5MC 3EHVA 3IG3A 2DYBA 1GG3A 3R7QA 1J19A 2KNBA 2WX1A 1YMHE 1WYWB 1ZDVA 3A9JB 4EZLA 1E8WA 3V3XA 3HRDD 3TCAA 4FN2A 2KMMA 2QJLA 4IDIA 3OJ4B 4RF0A 1HTOA 5LXIB 5GXGB 4RM8A 3ZW3A 4JIOU 3E9SA 1WX8A 4ZHPA 1SIJA 4MELA 2ZVOA 2FCQA 1X1MA 4A20A 1AYFA 3R2IA 3Q6BA 5LXHA 3P42A 2O2VA 4MM3B 3ZIMA 1UNSA 3K9OB 3NJTA 1ENFA 3AEFB 3S2AA 1E8ZA 2J0JA 2QILA 1DOYA 3H7SA 4J3OD 2J0KA 4HJGE 3MTNB 1SE9A 3AEAB 4HDOA 1SEBD 4DXFA 1TYGB 2C5LC 1XCQL 1ZPSA 4HKZE 2W55A 2FCNA 2MBEA 2XN9C 2HTME 1FXAA 3PLVA 1UELA 1WMHA 3ONSA 1YIWA 3PLUA 2O6VD 2K6DB 5IA7A 2O6VA 1FEHA 1C76A 3O13A 3DVGX 4HJKA 1XD3B 3DWMA 1SXTA 2D3AA 4DK5A 2KDMA 2JQRB 1WJNA 5D3IB 2GI9A 1L0YB 3WIMA 3ZRCA 2PW9A 1Q1OA 3ZO5B 1FD6A 1DYQA 3NS8A 4KV2A 4MDKE 3EC8A 2I38A 2KJRA 4DHZB 3C0RB 2FIFA 3C19A 1WM2A 2LRUA 3NVZA 1Z2MA 1D4BA 5C1ZA 4YTNB 1V9JA 1WR6E 1P9DU 4I6LB 1H4RA 1HA5A 1OFFA 4C4VB 2ZW1A 2N0SB 5JHBA 3UIPB 2MX2A 3GOEA 2INDC 4GDLB 3QC8B 4O1NA 2NBWB 1QF6A 1E8YA 4WIPA 4N58A 1XO3A 2R2OA 4KIKB 3TUOA 3P4PB 3QWZB 2R61A 2MQJA 2WXRA 3SDLC 2NCNA 2W3RA 3AU4A 4REZA 1V49A 5TR5A 4AOFA 3CSTA 2W82A 2WNMA 4W9CA 3VTUA 1ISNA 1IGCA 1N5XA 4GU2A 3ECIA 4C00A 4E71A 5BYSA 4NQKE 4IM0A 2WDQB 3VHTC 3KYCD 1YJ1A 2LMCA 3GE3C 2V9HA 1UUPA 4HK2A 3BWUD 4ZRJA 4BBNF 3NVYA 1TY0A 1TZOA 3ETRA 4K3BA 3IAM1 2M0AA 5KHOA 2LZ6A 3ENEA 5E6JA 2L0TA 3ZNZB 1WX7A 1NI3A 2IYDB 3ZVVA 1ZW7A 4GLSC 2ON8A 3M62B 4HPMB 1FNUA 1WXMA 2JU6X 1SJHD 3AE9B 3HK0A 1SF0A 2A4ZA 4NJ6A 4PK1A 3HM6X 1B9RA 2Y5PA 3NOBA 2KT7A 4DWFA 3JSVA 1UGMA 4LJPB 2E3TA 2OOBB 2IBIB 3M95A 4FJZA 1PGAA 4P1CC 2K0PA 3EGRA 1QKZA 1R4MB 2KFJA 4HXDA 3L16A 1EM7A 2OHFA 5C3JB 3PREA 2D5GA 3ZNHB 4YT0B 1R4MI 4CYEA 1C3TA 3APCA 2QDFA 4MGYE 4ZDVA 1TJEA 2N4FA 4W9HA 4G50A 2WS3B 4CHKA 4BOZB 1XT9B 4P7IA 2AQ3B 1L6VA 4WH4A 4W9IA 3R66C 2BS2B 1GUAB 3AE7B 4P1BC 2AL6A 4FJVB 4EUTA 3BVGA 4WWOA 4XZ4A 3C8YA 1WGGA 4PS3A 1TT5B 1CJEA 2C7MB 3APDA 2KLCA 2LJIA 2N1WA 2W54A 5IOIA 3U2SC 2KO3A 1C79A 3IBEA 2B3AA 1TTNA 3Q8FA 1KFYB 2FCMA 2LHDA 2KAJA 4HVBA 2ZVNA 2L8JA 4LDTB 2L00B 2N7JA 3VFKA 4ZYNA 1GB1A 2FIDA 3M63B 4HROA 4HEA1 3HVDA 4GOCA 1EU3A 2HJ8A 3WANA 2VZKB 2ZPNA 4AWJA 2IO2B 1RAXA 2WDRB 1E6EB 2ZCBA 3CWIA 1TGZB 3QX1A 1I42A 2N1VA 1I4RA 1KTKA 2LRWA 3DVNU 4ZRKA 2QSDA 3DHGC 2FNJB 1F2RC 2LHEA 2ACZB 2PVOD 1XLPA 2INCC 3H7PA 3AE8B 1WM3A 1ET9A 2INPE 1WJ6A 1ZGUB 1EWCA 2DLBA 3WCQA 1P3QU 1F77A 1XLNA 2K8HA 2YEPB 4GIVA 1VRAB 4WURA 3ZTDA 3AMZA 5AZGA 3P63A 2KFKB 3JVZX 4WJNA 3M3JA 3QJZA 3AE1B 2WXJA 2K6QA 2DBYA 3P1MA 3TMPB 1OEYA 2WXNA 3MFGA 4IM3A 1JRPA 2L52A 2PPHA 3P4SB 4RMAA 1YOVB 4M8NA 3U30A 3ZJUA 3MHSD 2IGGA 1VZ6A 1WXVA 2N9EB 4W9GA 1BUIC 1F52A 3UQBA 4XGAB 2KDIA 2KC2A 2NPTB 4EEWA 4M0WA 1WGDA 2KD0A 2CU1A 1ET6A 2INNE 3BVZA 2MP2A 2PMVA 2IO0B 4ITKA 3Q3MC 4ZRPA 2Q5WD 2MBQA 1DOIA 3U4EG 1K8RB 5DPTA 3TEYA 2X8XX 5HKHA 1FO4A 2AEHA 4KDLB 5HG2A 4YSXB 3P4RB 5JXVA 1NDDA 2XEWA 4KGSA 4WAFA 5FR6A 3TIXA 4EZKA 2SEBD 2K25A 2RGFA 3UGBB 3GE8C 2RPVA 2KJHB 2RDBC 4AJYB 2BT6A 2WP9B 1P7EA 3NVVA 4RGNA 1PYWD 4BKTA 3VRAB 4XYCA 2BBCA 1LQBA 1MVKA 3VH4B 1V86A 4ASWC 3HIZA 2M56B 2N9XA 3NY5A 2KKCA 3PT2B 2ZNVC 3R2TA 3ZYYX 3AU5A 3PHXB 1QLBB 1VZ7A 1TKYA 2WXGA 2K9XA 1ZOYB 1GB4A 4BAXA 1TIFA 3QARA 3KW5B 1R4NB 2GBNA 2EMSA 4A90A 4NJCA 2NTSA 5GMVA 2UU7A 3CF6E 3N1XC 2NTTA 2KK8A 2XNAC 4M01A 5J18A 2NVUI 2UWQA 1WXAA 2IDYA 4AS1A 4LNKA 2V1YA 1J7BA 2KTFA 2Y5CA 1HZ6A 2A5UA 2K8CA 2QC8A 3SFDB 3V61A 3NRZA 3H9DA 4II3B 4ACFA 2Y5BB 3VR8B 5C2TB 3EUB2 1E7UA 4TQ1A 1D5XC 5DPSA 3GP7A 4IW0A 3IVFA 3KUZA 2D3GA 3P4QB 3DDCB 1MHXA 3EFCA 3FILB 1P1AA 4C7ZA 2KN4A 1HXYD 4W9EA 1U4AA 1EF1A 3UQAA 1BMLC 5H8YE 5CHVC 2FBWB 2ASQA 2LUMA 4HPLB 3KUCB 1KLGD 2DHZA 1YNTE 1RWSA 3CSFA 2KHWB 1SJED 3MC0B 4DHJD 4II2B 2KVRA 3HM3A 3K9PB 1L5PA 3Q3NC 3TBLD 5J17A 3I5JC 4BZAA 4JGHB 3WAMA 2KX3A 2AQ2B 2MRPA 1K52A 4FHKA 2WYQA 4A3OA 2NMQA 1HEZE 2KQ7A 2J52A 3DBLB 3U7ZA 3AE4B 3NZSA 1FNWA 1RLFA 3NHEB 3DBLI 3ZXRA 4WQOB 1FM0D 1RYJA 4OW0A 4OZCA 3UF8A 1ACCA 2WXMA 3W2DA 4DXGA 4ANUA 3AM9A 2ZJDA 1I4PA 2MBHA 4N6EB 2L32A 4RH6A 1QZEA 1E5WA 1C4PA 5AZHA 4E74A 4IOIE 2WXLA 3DHIC 1T3QA 2KYWA 4L23A 3VVWB 1WX9A 3ZGZA 1J0GA 4NNJB 1GOZA 2C60A 1C9FA 3SR6A 5D2MB 3H8HA 4IM2A 1VD2A 3TSSA 5FKAC 4B6WA 4RCOA 2R2QA 1J8CA 5LLIA 3EFUA 1OGWA 5FK9C 1FXTB 1ROEA 3AV8A 5IKCM 1FCLA 2L83A 3Q8EA 4JQWC 4URKA 2KN5A 3AECB 3BYYB 3R3MA 2PKOA 4E3CA 2GLSA 1KRHA 2RD0A 4JLCA 5D94A 4NY0A 2ZCCA 1QQRA 2KXJA 2LWPA 2CS4A 2KMCA 4H2AA 4MJSA 2WLBA 4ARCA 2BYVE 3U52E 4DQOC 1XQQA 1CMXB 1KOTA 4GDKA 1V1PA 1JCKB 1UH6A 2AYOB 2IZVB 1WGHA 4F7ZA 1PGBA 1IGDA 1M94A 3CIRB 1FFVA 2QEJC 4L2YA 1N63A 2W3SA 3KWLA 1VJKA 2BYEA 3A4SC 2EMTA 2V0GA 1ZXHA 2JZZA 3V62A 1MG4A 2LGSA 2GBJA 4KZ0A 3PV1A 4W9FA 1KLVA 5JZEB 2BS3B 1QOGA 1QOBA 3W1SC 3VUWA 2X38A 2G3QB 3RZFA 2QHOA 2KTRB 4K3CA 4M02A 3VTVA 4G3XB 2QMTA 2RMMA 3L10B 3WA0A 5G55A 3VAWA 3PPAA 3A9KB 1P98A 3AEGB 2E6XA 1E7PB 3ZUNA 2KACA 4RGTA 1CK1A 4OZBA 1SSNA 3PS6A 4I6NB 2J53A 3H7PB 2IGDA 2RR9A 4HPPA 2D07B 3NVWA 3P2BA 3V6CB 1T0SC 2I2YA 1N5WA 2KDEB 4MACA 4QAYA 1VLBA 2M17A 2OJWA 1T0QC 2BYFA 3LB8C 2M8SA 5D3DA 2IJ0A 2D11A 2HJ1A 4ANVA 3X0WA 2LASA 4X57B 4HCNB 3BIID 3FAHA 1UZXB 3BZDB 3PZDA 3ML8A 1C78A 5BMGA 3KUDB 2KQSA 3IXSA 5E6NA 1K50A 1DGJA 1FFUA 4W9JA 4G0NB 1I4HA 4K81A 3W5UB 2PE6B 3T3OA 1GJZA 3B2GA 4EOYA 2GMIC 2D3CA 1WIAA 3Q3JA 1K51A 1T5XD 4RGOS 2V3NA 2I1KA 1H8CA 1L2NA 1I7HA 2G9HD 4MM3A 2CJNA 2XBBC 1WJ4A 2J42A 2KLGA 3BYTB 2CHZA 5HFYA 3I9V1 1KJTA 3Q69A 3ZRFA 2HE7A 2MP2B 2V4IB 4MGKE 5E6OA 2BW2A 1XXGA 4LK0M 3ZDMC 1VDVA 4A9AA 1WYGA 3U7DA 1J7AA 2DYOA 3AULA 1WGYA 4IKGA 3AXCA 4IG7B 4LNIA 2WXIA 2AL3A 3QIJA 5BMHA 1IBXB 2YLMA 1NI2A 1ZUD2 3VTWA 1EU4A 2M1MA 2WXKA 4EE2A 2WU2B 3A4RA 3RZWC 4B0MA 2WXQA 5IN7A 2WGSA 1A5RA 4LJOB 4KGTA 4ZRQA 1Y8RC 3NG0A 1WRDB 2L0FA 1JMLA 2TSSA 1TBEA 1YQ3B 2MEKA 1OQRA 3GB1A 3V60A 2D2QA 3L0WB 4JWSC 2BYTA 1TKGA 1L4DB 4KX6B 2GB1A 4JL9A 1GC6A 2PLPA 3DVNV 4F8CB 5C23A 2WQYB 1V1OA 2LVOA 3WAOA 1RFKA 2VRRB 1WRIA 3PZ8A 3KLSX 5KHQA 3W9CB 1I4XA 2LFIA 1WZ3A 2DX5B 1IYFA 4NAWB 3VQIA 1OQYA 3X23A 1JWAD 1WJUA 3L17A 5CHWA 3RFZB 3OLMD 5IAAC 4C4VA 1L0VB 2MCNB 4XX5A 1I35A 1EWYC 2L7RA 3N20C 3W1YA 4L1BA 4GDLA 1OQQA 2BGFA 4ZYSA 2L3ZA 3Q8BA 1L6UA 4MH0E 4PS8A 3B0AA 4FXCA 2JUOA 2MHJA 4IC7B 1VCBA 2K1FA 3BK1A 1V80A 4MSQB 2LGYA 1JROA 2HTHA 3TL5A 2JF5A 4DDGD 5EE9A 3TEXA 4US9A 3IHPC 1VZ8A 3AH7A 4FHJA 1YN4A 2JXXA 4ZRIA 2XK5B 4JE3B 1IUEA 4KGRA 4N59A 2L05A 4LNFA 4A3PA 2JY6A 2GBRA 3B1LX 2K8BA 1RM6C 1QILA 3SHQA 4GGQA 1WGRA 1B1ZA 4PT5A 3MJWA 1MHHE 1TKEA 3VXWA 1L4ZB 2ZZPB 1AWDA 2L76A 3RNCC 3WAPA 3W1SA 1TS2A 2MWSB 1HZ5A 5CHFA 1YJJA 4I6PA 3NUHB 4FBJB 4XDCA 1F0ZA 1WGKA 2BWES 4B9KA 1PQSA 3N1YC 2ONQA 4C7YA 1FXIA 3VUXA 3UIOB 2HDEA
chains in the Genus database with same CATH topology
4C4VA 2QDFA 3Q6BA 2VH1A 4K3CA 4C00A 3EFCA 4QAYA 3NJTA 3MC9A 2V9HA 4XGAB 2X8XX 4PK1A 2MHJA 3MC8A 3OG5A 4K3BA 4BZAA 4C4VB 2QCZA 2VH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V A;  2QDF A;  3Q6B A;  2VH1 A;  4K3C A;  4C00 A;  3EFC A;  4QAY A;  3NJT A;  3MC9 A;  2V9H A;  4XGA B;  2X8X X;  4PK1 A;  2MHJ A;  3MC8 A;  3OG5 A;  4K3B A;  4BZA A;  4C4V B;  2QCZ A;  2VH2 A; 
#chains in the Genus database with same CATH topology
 2O2V B;  3ZNI D;  2L1A A;  2WU5 B;  1WR1 A;  2Z0D B;  3AEE B;  2WXF A;  3EA6 A;  3CMM B;  1AW7 A;  2BB5 A;  4P16 A;  2MSE D;  2LXC A;  3DHH C;  4USA A;  4XWT A;  1HE8 A;  3IFW B;  2JWU A;  2PVG C;  2JZP A;  2CKH B;  1FIQ A;  4KSK C;  1Q5W B;  3AED B;  1WF9 A;  4M8M A;  1YD8 U;  4IWQ A;  5D7G A;  2WWZ A;  2ZW0 A;  1VR9 A;  1WMH B;  4ARI A;  4S0R A;  2AWT A;  1SBB B;  1JWM D;  2V3S A;  4LDT D;  4TV3 A;  2CHW A;  4TQ0 A;  2BS4 B;  2O6V B;  2YEP F;  2KOX A;  3AE6 B;  3V6E B;  2KJ6 A;  4GXB A;  2BVC A;  1R4N I;  4ICV A;  2VZK D;  3ZNG C;  1KLU D;  4MJS B;  3RYT A;  1BT0 A;  2YVC A;  2BKF A;  1YJI A;  4GMV A;  2KWV B;  2MBB B;  4YL8 A;  1KH0 A;  4TUU A;  1WXS A;  3HUI A;  5CX3 A;  2J0M A;  4MT5 A;  4AP4 C;  1WE7 A;  4BFR A;  1S3S G;  4BKS D;  2WDV B;  3RNG C;  2PIA A;  4K7U A;  1F1H A;  4YXD B;  1RRB A;  4OVZ A;  4OZA A;  1CQV A;  4BKS A;  1N6Z A;  2WHI A;  3PZ7 A;  2IY0 B;  4KKJ A;  3KQ4 A;  5TSS A;  3ZKJ C;  3I63 C;  5G5G A;  1SE4 A;  3FKY A;  4KZC A;  1YN5 A;  3OAW A;  2FCS A;  1DOX A;  2KAN A;  1E8X A;  2C7N B;  1V97 A;  4LNO A;  4XDD A;  4IWP A;  1Z5S B;  3KYD D;  3DBS A;  4MSM B;  3AE3 B;  5AZF A;  2KWC A;  4B95 A;  3RT3 B;  3DWG C;  1MPE A;  5H92 C;  4OVU A;  2Z0E B;  1F9J A;  4N9F 4;  2KFK A;  3DVG Y;  1ESF A;  4W9D A;  1UBI A;  3Q8C A;  1D5Z C;  4CO7 A;  2QIE B;  3BY4 B;  1YN3 A;  2JXT A;  2JYE A;  4YWG G;  3B08 A;  2KQ4 X;  2HD5 B;  4RM9 A;  4JX1 C;  2RPQ A;  2BB6 A;  2FUG 1;  3GS2 A;  1FNV A;  2G1E A;  4JWU C;  1ZDX A;  2RDG A;  2DAF A;  3A1Q A;  4FAD A;  4IWO A;  4PS7 A;  3JW0 X;  2BKR B;  1NYQ A;  4GN1 A;  4GB9 A;  2LGI A;  3ZJT A;  3RD2 A;  4EKU A;  1TS3 A;  1YX5 B;  4XE0 A;  4NZL B;  1TS4 A;  2NPT A;  4AJW A;  4KVG B;  1ZP0 B;  5HI1 A;  2OJR A;  1WE6 A;  4AQ7 A;  1Y56 A;  1FRD A;  3N32 A;  1FMA D;  4BVU C;  2DNF A;  2JPH A;  1SGH A;  3DCG A;  1XLQ A;  2PTL A;  4LCD E;  4YSZ B;  2K3U A;  2REX A;  3JSV B;  4MGZ E;  2QCZ A;  1E90 A;  3E56 A;  5EE1 A;  3URY A;  1K53 A;  4DXA B;  3D32 A;  3T3N A;  2BPS A;  3FC4 A;  4MH8 A;  1FPY A;  1ZXI A;  4TSS A;  4PYU A;  2K5P A;  2J4X A;  2JT4 B;  4TMA B;  3AE5 B;  1XCT L;  2MA9 B;  3IAS 1;  4C56 C;  1BXT A;  2NBU A;  2LI5 A;  2VH2 A;  1GAQ B;  3PSE B;  1JQ4 A;  3VRB B;  4PYZ A;  4XC2 A;  2AX5 A;  1YQ4 B;  3SEB A;  2JX5 A;  3MC9 A;  3ML9 A;  1E9M A;  1WXQ A;  3PRZ A;  2LVQ A;  1C77 A;  2IPK D;  2FAZ A;  2GRI A;  3AEB B;  4K7S A;  1SB3 C;  3A33 B;  4HLE A;  5G2N A;  3SFE B;  2NS5 A;  3Q14 C;  3MHZ A;  5EDS A;  2B76 B;  5DPR A;  3SU8 X;  2BTE A;  2ICI A;  2WXO A;  1MFW A;  2CU3 A;  3HVZ A;  1EUV B;  2I1J A;  5DCN A;  1UWX A;  4US8 A;  5LNK 1;  2KZR A;  4DBG A;  1EO6 A;  3ABV B;  1T0Y A;  2VH1 A;  4HDQ A;  1QOF A;  2N9K A;  3AB5 A;  2FE8 A;  4YSY B;  2KWD A;  4LTU A;  1NBF C;  1QT9 A;  2PEA A;  1V81 A;  2RSU A;  3FIL A;  4FLH A;  1MG8 A;  4TKN A;  1I4Q A;  2KMA A;  5I4D A;  4FJY A;  5IO9 A;  1JW9 D;  3I3T B;  2G4D B;  3RCZ A;  3LXF A;  4EZJ A;  3ZJV A;  4GSW A;  3ZQ4 A;  1WI0 A;  3N30 A;  4AUQ C;  4XWW A;  5J2R A;  2NBV B;  1E7V A;  2AQ1 B;  2LVP A;  1XLO A;  4ANX A;  4OHJ A;  4RNA A;  1E10 A;  2M0X A;  2KVZ A;  2KWU B;  3A9J A;  5AEK B;  2LUE A;  1JWS D;  1PUT A;  4J6I A;  2IO1 B;  1MJD A;  2M4N A;  2N7D A;  3L54 A;  3ZDT A;  1JWB D;  2GOW A;  2MJ3 A;  3BIN A;  4MGI E;  1PDX A;  1YQB A;  1V8C A;  2DZM A;  1N61 A;  1P7F A;  2LJ5 A;  1M4V A;  1TY2 A;  2V3P A;  4A55 A;  1LM8 B;  3R7R A;  2BWF A;  3RPF C;  1KM7 A;  1GNU A;  1OTR B;  1ZKH A;  3DBH B;  3RI7 C;  3DOW A;  4WWN A;  3WAL A;  3UI3 A;  1ZE3 D;  4M0W B;  1WY8 A;  5DPW A;  4UDU C;  3DBH I;  3PGE A;  2Y3A A;  3Q8A A;  3PRP B;  2PJH A;  1RFA A;  1N62 A;  2PE9 A;  3NS1 A;  4WAA A;  1SE3 A;  2MJE A;  2IY1 B;  4HWI B;  1LO5 D;  3B9J A;  1MI0 A;  1C4C A;  4NJ7 A;  3KWV A;  2J7Q B;  1JWU D;  2W9N A;  4WJO A;  2N7E A;  2EKE C;  2MBO A;  4IUM B;  1AAR A;  4KDI C;  1FCC C;  5D6J B;  2Z8L A;  1JAL A;  2D10 A;  1J7C A;  3AE2 B;  3H6N A;  3RNF C;  1D6E C;  4R3D A;  3J9C A;  3IT6 B;  1LGR A;  3VR9 B;  2CHX A;  3LDZ E;  2C9W B;  4YTM B;  3IT4 B;  3Q2A C;  1XF5 L;  4K1R B;  3TJP A;  2LEK A;  3PTF C;  1TS5 A;  5BO4 B;  1P0R A;  1G6J A;  2MH7 A;  4A6Q A;  3RUL A;  2JSV X;  4HRS A;  2CJO A;  2C7H A;  4RGM A;  2H88 B;  3LJ3 A;  4FUL A;  3MC8 A;  2DZK A;  2NR2 A;  5AUI A;  2MJD A;  3OJ3 A;  1C4A A;  3N1Z C;  1SE2 A;  2JRH A;  3RUI B;  1T0R C;  2DZJ A;  2KTR A;  4OVV A;  2FUH B;  2JZ3 B;  4KIK A;  2H89 B;  3A9K A;  2UYZ B;  4BOS C;  3VUY A;  3UIN B;  4HKQ A;  4K7W A;  2DAJ A;  2LXA A;  5JHA A;  1V5O A;  3W5V B;  3VH3 B;  2KC1 A;  1S1Q B;  1L7Y A;  4JPS A;  2K22 A;  3BK2 A;  1NEN B;  4WWP A;  1FRR A;  3QA8 A;  3APF A;  1PGX A;  2N9P C;  3L08 A;  4ANW A;  3NZU A;  1IPG A;  1N60 A;  1WWT A;  2RDH A;  4NAM A;  1STE A;  2WDT B;  3SD5 A;  2KX0 A;  3L4P A;  3AI5 A;  5CTR C;  2EEL A;  4DHJ B;  4DHZ E;  1UD7 A;  5MPO A;  3N9Y C;  2N9L A;  2ZPY A;  4EFO A;  5L83 A;  3N3K B;  4HCP B;  5IP4 D;  3RN9 C;  1GC7 A;  1LXD A;  4S17 A;  1KF6 B;  3ZLZ A;  3A1Q B;  1GPX A;  4G11 A;  3QCA A;  3RNE C;  3QAQ A;  4KKI A;  3GZN B;  3TEZ A;  1UF0 A;  3ALB A;  2JRI B;  4MEM A;  3EEC A;  3GZN I;  5T8I A;  4C80 A;  3RMK C;  2BQQ A;  1CZP A;  3KVF B;  4FA6 A;  2WXH A;  1PFD A;  1WH3 A;  4P6V F;  3JYU A;  2LGX A;  2SAK A;  3MP9 A;  3VDZ A;  2CR5 A;  2IGH A;  2G45 B;  1F2R I;  1A70 A;  3V05 A;  1NYR A;  2WXP A;  3KH0 A;  3PVL A;  2LGD A;  3HHM A;  2DZI A;  3T9L A;  5EE3 A;  1QOA A;  1UGJ A;  4W9L A;  4NQL B;  2DWQ A;  3Q3F A;  5JH5 C;  3ZTC A;  3AN1 A;  1T6B X;  1IBX A;  2OED A;  2DEN B;  4LNN A;  1L0X B;  3H1U A;  4D2K A;  3R8B A;  2D3B A;  3TEW A;  3QQ8 B;  2Z59 B;  4RFB A;  4ZHO A;  1E0Z A;  2ZEQ A;  3B2F A;  1OEY J;  1HQR D;  3U8Z A;  1TZ1 A;  1HTQ A;  1V2Y A;  4M00 A;  1I4G A;  3T8M A;  2DYM A;  3OG5 A;  2G4S A;  3DPD A;  4B0E A;  2GBK A;  3DBR B;  3RNB C;  4YTP B;  5E6P A;  4WJQ A;  2KDF B;  4ZOH C;  3QK0 A;  1V6E A;  3PHW B;  3DBR I;  4WWM A;  5BYR A;  4GDK B;  1V1P B;  4A8X C;  3RNA C;  2V4L A;  5BYQ A;  1Q10 A;  2JWZ A;  3ZXV A;  1WZ0 A;  2EKI A;  3PRM B;  4NAW A;  5L95 C;  4WQM A;  4W9K A;  1D3Z A;  5EE0 A;  4DDI D;  4KSL C;  1NEK B;  1UBQ A;  2IO3 B;  3I57 A;  2M19 A;  2WX0 A;  1R7S A;  2LD9 A;  3PO0 A;  2MLB A;  3OWE B;  2JVC A;  1WSP A;  1NVI D;  3O65 B;  2KDB A;  1XEE A;  3L13 A;  3QHT A;  5AUK A;  1AN8 A;  5BMI A;  4CQN A;  4NPN A;  4LLG M;  3Q3O C;  5G5H A;  2JYT A;  1Q0W B;  4ICU A;  4WJP A;  3BVM A;  5FR3 A;  3DQV A;  1LFD A;  2GBM A;  1SIF A;  4RF1 A;  2K39 A;  4F1S A;  1WFY A;  1YX6 B;  2XK5 A;  5HHD G;  4BBN C;  2ZNV B;  1UWM A;  1JRU A;  1IP9 A;  1V5T A;  1EF5 A;  3NZ3 A;  4Q2J A;  3LYY A;  2BF8 B;  4BKG A;  1C1Y B;  3MJ5 A;  2MW5 A;  1D5M C;  3EHV A;  3IG3 A;  2DYB A;  1GG3 A;  3R7Q A;  1J19 A;  2KNB A;  2WX1 A;  1YMH E;  1WYW B;  1ZDV A;  3A9J B;  4EZL A;  1E8W A;  3V3X A;  3HRD D;  3TCA A;  4FN2 A;  2KMM A;  2QJL A;  4IDI A;  3OJ4 B;  4RF0 A;  1HTO A;  5LXI B;  5GXG B;  4RM8 A;  3ZW3 A;  4JIO U;  3E9S A;  1WX8 A;  4ZHP A;  1SIJ A;  4MEL A;  2ZVO A;  2FCQ A;  1X1M A;  4A20 A;  1AYF A;  3R2I A;  3Q6B A;  5LXH A;  3P42 A;  2O2V A;  4MM3 B;  3ZIM A;  1UNS A;  3K9O B;  3NJT A;  1ENF A;  3AEF B;  3S2A A;  1E8Z A;  2J0J A;  2QIL A;  1DOY A;  3H7S A;  4J3O D;  2J0K A;  4HJG E;  3MTN B;  1SE9 A;  3AEA B;  4HDO A;  1SEB D;  4DXF A;  1TYG B;  2C5L C;  1XCQ L;  1ZPS A;  4HKZ E;  2W55 A;  2FCN A;  2MBE A;  2XN9 C;  2HTM E;  1FXA A;  3PLV A;  1UEL A;  1WMH A;  3ONS A;  1YIW A;  3PLU A;  2O6V D;  2K6D B;  5IA7 A;  2O6V A;  1FEH A;  1C76 A;  3O13 A;  3DVG X;  4HJK A;  1XD3 B;  3DWM A;  1SXT A;  2D3A A;  4DK5 A;  2KDM A;  2JQR B;  1WJN A;  5D3I B;  2GI9 A;  1L0Y B;  3WIM A;  3ZRC A;  2PW9 A;  1Q1O A;  3ZO5 B;  1FD6 A;  1DYQ A;  3NS8 A;  4KV2 A;  4MDK E;  3EC8 A;  2I38 A;  2KJR A;  4DHZ B;  3C0R B;  2FIF A;  3C19 A;  1WM2 A;  2LRU A;  3NVZ A;  1Z2M A;  1D4B A;  5C1Z A;  4YTN B;  1V9J A;  1WR6 E;  1P9D U;  4I6L B;  1H4R A;  1HA5 A;  1OFF A;  4C4V B;  2ZW1 A;  2N0S B;  5JHB A;  3UIP B;  2MX2 A;  3GOE A;  2IND C;  4GDL B;  3QC8 B;  4O1N A;  2NBW B;  1QF6 A;  1E8Y A;  4WIP A;  4N58 A;  1XO3 A;  2R2O A;  4KIK B;  3TUO A;  3P4P B;  3QWZ B;  2R61 A;  2MQJ A;  2WXR A;  3SDL C;  2NCN A;  2W3R A;  3AU4 A;  4REZ A;  1V49 A;  5TR5 A;  4AOF A;  3CST A;  2W82 A;  2WNM A;  4W9C A;  3VTU A;  1ISN A;  1IGC A;  1N5X A;  4GU2 A;  3ECI A;  4C00 A;  4E71 A;  5BYS A;  4NQK E;  4IM0 A;  2WDQ B;  3VHT C;  3KYC D;  1YJ1 A;  2LMC A;  3GE3 C;  2V9H A;  1UUP A;  4HK2 A;  3BWU D;  4ZRJ A;  4BBN F;  3NVY A;  1TY0 A;  1TZO A;  3ETR A;  4K3B A;  3IAM 1;  2M0A A;  5KHO A;  2LZ6 A;  3ENE A;  5E6J A;  2L0T A;  3ZNZ B;  1WX7 A;  1NI3 A;  2IYD B;  3ZVV A;  1ZW7 A;  4GLS C;  2ON8 A;  3M62 B;  4HPM B;  1FNU A;  1WXM A;  2JU6 X;  1SJH D;  3AE9 B;  3HK0 A;  1SF0 A;  2A4Z A;  4NJ6 A;  4PK1 A;  3HM6 X;  1B9R A;  2Y5P A;  3NOB A;  2KT7 A;  4DWF A;  3JSV A;  1UGM A;  4LJP B;  2E3T A;  2OOB B;  2IBI B;  3M95 A;  4FJZ A;  1PGA A;  4P1C C;  2K0P A;  3EGR A;  1QKZ A;  1R4M B;  2KFJ A;  4HXD A;  3L16 A;  1EM7 A;  2OHF A;  5C3J B;  3PRE A;  2D5G A;  3ZNH B;  4YT0 B;  1R4M I;  4CYE A;  1C3T A;  3APC A;  2QDF A;  4MGY E;  4ZDV A;  1TJE A;  2N4F A;  4W9H A;  4G50 A;  2WS3 B;  4CHK A;  4BOZ B;  1XT9 B;  4P7I A;  2AQ3 B;  1L6V A;  4WH4 A;  4W9I A;  3R66 C;  2BS2 B;  1GUA B;  3AE7 B;  4P1B C;  2AL6 A;  4FJV B;  4EUT A;  3BVG A;  4WWO A;  4XZ4 A;  3C8Y A;  1WGG A;  4PS3 A;  1TT5 B;  1CJE A;  2C7M B;  3APD A;  2KLC A;  2LJI A;  2N1W A;  2W54 A;  5IOI A;  3U2S C;  2KO3 A;  1C79 A;  3IBE A;  2B3A A;  1TTN A;  3Q8F A;  1KFY B;  2FCM A;  2LHD A;  2KAJ A;  4HVB A;  2ZVN A;  2L8J A;  4LDT B;  2L00 B;  2N7J A;  3VFK A;  4ZYN A;  1GB1 A;  2FID A;  3M63 B;  4HRO A;  4HEA 1;  3HVD A;  4GOC A;  1EU3 A;  2HJ8 A;  3WAN A;  2VZK B;  2ZPN A;  4AWJ A;  2IO2 B;  1RAX A;  2WDR B;  1E6E B;  2ZCB A;  3CWI A;  1TGZ B;  3QX1 A;  1I42 A;  2N1V A;  1I4R A;  1KTK A;  2LRW A;  3DVN U;  4ZRK A;  2QSD A;  3DHG C;  2FNJ B;  1F2R C;  2LHE A;  2ACZ B;  2PVO D;  1XLP A;  2INC C;  3H7P A;  3AE8 B;  1WM3 A;  1ET9 A;  2INP E;  1WJ6 A;  1ZGU B;  1EWC A;  2DLB A;  3WCQ A;  1P3Q U;  1F77 A;  1XLN A;  2K8H A;  2YEP B;  4GIV A;  1VRA B;  4WUR A;  3ZTD A;  3AMZ A;  5AZG A;  3P63 A;  2KFK B;  3JVZ X;  4WJN A;  3M3J A;  3QJZ A;  3AE1 B;  2WXJ A;  2K6Q A;  2DBY A;  3P1M A;  3TMP B;  1OEY A;  2WXN A;  3MFG A;  4IM3 A;  1JRP A;  2L52 A;  2PPH A;  3P4S B;  4RMA A;  1YOV B;  4M8N A;  3U30 A;  3ZJU A;  3MHS D;  2IGG A;  1VZ6 A;  1WXV A;  2N9E B;  4W9G A;  1BUI C;  1F52 A;  3UQB A;  4XGA B;  2KDI A;  2KC2 A;  2NPT B;  4EEW A;  4M0W A;  1WGD A;  2KD0 A;  2CU1 A;  1ET6 A;  2INN E;  3BVZ A;  2MP2 A;  2PMV A;  2IO0 B;  4ITK A;  3Q3M C;  4ZRP A;  2Q5W D;  2MBQ A;  1DOI A;  3U4E G;  1K8R B;  5DPT A;  3TEY A;  2X8X X;  5HKH A;  1FO4 A;  2AEH A;  4KDL B;  5HG2 A;  4YSX B;  3P4R B;  5JXV A;  1NDD A;  2XEW A;  4KGS A;  4WAF A;  5FR6 A;  3TIX A;  4EZK A;  2SEB D;  2K25 A;  2RGF A;  3UGB B;  3GE8 C;  2RPV A;  2KJH B;  2RDB C;  4AJY B;  2BT6 A;  2WP9 B;  1P7E A;  3NVV A;  4RGN A;  1PYW D;  4BKT A;  3VRA B;  4XYC A;  2BBC A;  1LQB A;  1MVK A;  3VH4 B;  1V86 A;  4ASW C;  3HIZ A;  2M56 B;  2N9X A;  3NY5 A;  2KKC A;  3PT2 B;  2ZNV C;  3R2T A;  3ZYY X;  3AU5 A;  3PHX B;  1QLB B;  1VZ7 A;  1TKY A;  2WXG A;  2K9X A;  1ZOY B;  1GB4 A;  4BAX A;  1TIF A;  3QAR A;  3KW5 B;  1R4N B;  2GBN A;  2EMS A;  4A90 A;  4NJC A;  2NTS A;  5GMV A;  2UU7 A;  3CF6 E;  3N1X C;  2NTT A;  2KK8 A;  2XNA C;  4M01 A;  5J18 A;  2NVU I;  2UWQ A;  1WXA A;  2IDY A;  4AS1 A;  4LNK A;  2V1Y A;  1J7B A;  2KTF A;  2Y5C A;  1HZ6 A;  2A5U A;  2K8C A;  2QC8 A;  3SFD B;  3V61 A;  3NRZ A;  3H9D A;  4II3 B;  4ACF A;  2Y5B B;  3VR8 B;  5C2T B;  3EUB 2;  1E7U A;  4TQ1 A;  1D5X C;  5DPS A;  3GP7 A;  4IW0 A;  3IVF A;  3KUZ A;  2D3G A;  3P4Q B;  3DDC B;  1MHX A;  3EFC A;  3FIL B;  1P1A A;  4C7Z A;  2KN4 A;  1HXY D;  4W9E A;  1U4A A;  1EF1 A;  3UQA A;  1BML C;  5H8Y E;  5CHV C;  2FBW B;  2ASQ A;  2LUM A;  4HPL B;  3KUC B;  1KLG D;  2DHZ A;  1YNT E;  1RWS A;  3CSF A;  2KHW B;  1SJE D;  3MC0 B;  4DHJ D;  4II2 B;  2KVR A;  3HM3 A;  3K9P B;  1L5P A;  3Q3N C;  3TBL D;  5J17 A;  3I5J C;  4BZA A;  4JGH B;  3WAM A;  2KX3 A;  2AQ2 B;  2MRP A;  1K52 A;  4FHK A;  2WYQ A;  4A3O A;  2NMQ A;  1HEZ E;  2KQ7 A;  2J52 A;  3DBL B;  3U7Z A;  3AE4 B;  3NZS A;  1FNW A;  1RLF A;  3NHE B;  3DBL I;  3ZXR A;  4WQO B;  1FM0 D;  1RYJ A;  4OW0 A;  4OZC A;  3UF8 A;  1ACC A;  2WXM A;  3W2D A;  4DXG A;  4ANU A;  3AM9 A;  2ZJD A;  1I4P A;  2MBH A;  4N6E B;  2L32 A;  4RH6 A;  1QZE A;  1E5W A;  1C4P A;  5AZH A;  4E74 A;  4IOI E;  2WXL A;  3DHI C;  1T3Q A;  2KYW A;  4L23 A;  3VVW B;  1WX9 A;  3ZGZ A;  1J0G A;  4NNJ B;  1GOZ A;  2C60 A;  1C9F A;  3SR6 A;  5D2M B;  3H8H A;  4IM2 A;  1VD2 A;  3TSS A;  5FKA C;  4B6W A;  4RCO A;  2R2Q A;  1J8C A;  5LLI A;  3EFU A;  1OGW A;  5FK9 C;  1FXT B;  1ROE A;  3AV8 A;  5IKC M;  1FCL A;  2L83 A;  3Q8E A;  4JQW C;  4URK A;  2KN5 A;  3AEC B;  3BYY B;  3R3M A;  2PKO A;  4E3C A;  2GLS A;  1KRH A;  2RD0 A;  4JLC A;  5D94 A;  4NY0 A;  2ZCC A;  1QQR A;  2KXJ A;  2LWP A;  2CS4 A;  2KMC A;  4H2A A;  4MJS A;  2WLB A;  4ARC A;  2BYV E;  3U52 E;  4DQO C;  1XQQ A;  1CMX B;  1KOT A;  4GDK A;  1V1P A;  1JCK B;  1UH6 A;  2AYO B;  2IZV B;  1WGH A;  4F7Z A;  1PGB A;  1IGD A;  1M94 A;  3CIR B;  1FFV A;  2QEJ C;  4L2Y A;  1N63 A;  2W3S A;  3KWL A;  1VJK A;  2BYE A;  3A4S C;  2EMT A;  2V0G A;  1ZXH A;  2JZZ A;  3V62 A;  1MG4 A;  2LGS A;  2GBJ A;  4KZ0 A;  3PV1 A;  4W9F A;  1KLV A;  5JZE B;  2BS3 B;  1QOG A;  1QOB A;  3W1S C;  3VUW A;  2X38 A;  2G3Q B;  3RZF A;  2QHO A;  2KTR B;  4K3C A;  4M02 A;  3VTV A;  4G3X B;  2QMT A;  2RMM A;  3L10 B;  3WA0 A;  5G55 A;  3VAW A;  3PPA A;  3A9K B;  1P98 A;  3AEG B;  2E6X A;  1E7P B;  3ZUN A;  2KAC A;  4RGT A;  1CK1 A;  4OZB A;  1SSN A;  3PS6 A;  4I6N B;  2J53 A;  3H7P B;  2IGD A;  2RR9 A;  4HPP A;  2D07 B;  3NVW A;  3P2B A;  3V6C B;  1T0S C;  2I2Y A;  1N5W A;  2KDE B;  4MAC A;  4QAY A;  1VLB A;  2M17 A;  2OJW A;  1T0Q C;  2BYF A;  3LB8 C;  2M8S A;  5D3D A;  2IJ0 A;  2D11 A;  2HJ1 A;  4ANV A;  3X0W A;  2LAS A;  4X57 B;  4HCN B;  3BII D;  3FAH A;  1UZX B;  3BZD B;  3PZD A;  3ML8 A;  1C78 A;  5BMG A;  3KUD B;  2KQS A;  3IXS A;  5E6N A;  1K50 A;  1DGJ A;  1FFU A;  4W9J A;  4G0N B;  1I4H A;  4K81 A;  3W5U B;  2PE6 B;  3T3O A;  1GJZ A;  3B2G A;  4EOY A;  2GMI C;  2D3C A;  1WIA A;  3Q3J A;  1K51 A;  1T5X D;  4RGO S;  2V3N A;  2I1K A;  1H8C A;  1L2N A;  1I7H A;  2G9H D;  4MM3 A;  2CJN A;  2XBB C;  1WJ4 A;  2J42 A;  2KLG A;  3BYT B;  2CHZ A;  5HFY A;  3I9V 1;  1KJT A;  3Q69 A;  3ZRF A;  2HE7 A;  2MP2 B;  2V4I B;  4MGK E;  5E6O A;  2BW2 A;  1XXG A;  4LK0 M;  3ZDM C;  1VDV A;  4A9A A;  1WYG A;  3U7D A;  1J7A A;  2DYO A;  3AUL A;  1WGY A;  4IKG A;  3AXC A;  4IG7 B;  4LNI A;  2WXI A;  2AL3 A;  3QIJ A;  5BMH A;  1IBX B;  2YLM A;  1NI2 A;  1ZUD 2;  3VTW A;  1EU4 A;  2M1M A;  2WXK A;  4EE2 A;  2WU2 B;  3A4R A;  3RZW C;  4B0M A;  2WXQ A;  5IN7 A;  2WGS A;  1A5R A;  4LJO B;  4KGT A;  4ZRQ A;  1Y8R C;  3NG0 A;  1WRD B;  2L0F A;  1JML A;  2TSS A;  1TBE A;  1YQ3 B;  2MEK A;  1OQR A;  3GB1 A;  3V60 A;  2D2Q A;  3L0W B;  4JWS C;  2BYT A;  1TKG A;  1L4D B;  4KX6 B;  2GB1 A;  4JL9 A;  1GC6 A;  2PLP A;  3DVN V;  4F8C B;  5C23 A;  2WQY B;  1V1O A;  2LVO A;  3WAO A;  1RFK A;  2VRR B;  1WRI A;  3PZ8 A;  3KLS X;  5KHQ A;  3W9C B;  1I4X A;  2LFI A;  1WZ3 A;  2DX5 B;  1IYF A;  4NAW B;  3VQI A;  1OQY A;  3X23 A;  1JWA D;  1WJU A;  3L17 A;  5CHW A;  3RFZ B;  3OLM D;  5IAA C;  4C4V A;  1L0V B;  2MCN B;  4XX5 A;  1I35 A;  1EWY C;  2L7R A;  3N20 C;  3W1Y A;  4L1B A;  4GDL A;  1OQQ A;  2BGF A;  4ZYS A;  2L3Z A;  3Q8B A;  1L6U A;  4MH0 E;  4PS8 A;  3B0A A;  4FXC A;  2JUO A;  2MHJ A;  4IC7 B;  1VCB A;  2K1F A;  3BK1 A;  1V80 A;  4MSQ B;  2LGY A;  1JRO A;  2HTH A;  3TL5 A;  2JF5 A;  4DDG D;  5EE9 A;  3TEX A;  4US9 A;  3IHP C;  1VZ8 A;  3AH7 A;  4FHJ A;  1YN4 A;  2JXX A;  4ZRI A;  2XK5 B;  4JE3 B;  1IUE A;  4KGR A;  4N59 A;  2L05 A;  4LNF A;  4A3P A;  2JY6 A;  2GBR A;  3B1L X;  2K8B A;  1RM6 C;  1QIL A;  3SHQ A;  4GGQ A;  1WGR A;  1B1Z A;  4PT5 A;  3MJW A;  1MHH E;  1TKE A;  3VXW A;  1L4Z B;  2ZZP B;  1AWD A;  2L76 A;  3RNC C;  3WAP A;  3W1S A;  1TS2 A;  2MWS B;  1HZ5 A;  5CHF A;  1YJJ A;  4I6P A;  3NUH B;  4FBJ B;  4XDC A;  1F0Z A;  1WGK A;  2BWE S;  4B9K A;  1PQS A;  3N1Y C;  2ONQ A;  4C7Y A;  1FXI A;  3VUX A;  3UIO B;  2HDE A; 
#chains in the Genus database with same CATH homology
 4C4V A;  2QDF A;  3Q6B A;  2VH1 A;  4K3C A;  4C00 A;  3EFC A;  4QAY A;  3NJT A;  3MC9 A;  2V9H A;  4XGA B;  2X8X X;  4PK1 A;  2MHJ A;  3MC8 A;  3OG5 A;  4K3B A;  4BZA A;  4C4V B;  2QCZ A;  2VH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...