3MC9A

Potra1-2 of the periplasmic domain of omp85 from anabaena
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
161
Chain Sequence
TEPRVLVSEVLVRPQSGQLTPELETQVYNVIRTQPGRTTTRSQLQEDINAIFGTGFFSNVQASPEDTPLGVRVSFIVQPNPVLSKVEIQANPPSVLPQATADEIFRAQYGKILNLRDLQEGIKELTKRYQDQGYVLANVVGAPQVSENGVVTLQVAEGVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conserved properties of polypeptide transport-associated (POTRA) domains derived from cyanobacterial Omp85.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Membrane protein
molecule keywords Alr2269 protein
total genus 44
structure length 161
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07244 POTRA Surface antigen variable number repeat
A PF08479 POTRA_2 POTRA domain, ShlB-type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A01
3.10.20.310 Alpha Beta Roll Ubiquitin-like (UB roll) membrane protein fhac 3mc9A02
2V9HA 2VH2A 2QDFA 3MC9A 4PK1A 4K3CA 3NJTA 2MHJA 2VH1A 2X8XX 4C4VA 4C00A 2QCZA 4C4VB 4BZAA 3MC8A 4K3BA 3EFCA 3Q6BA 3OG5A 4XGAB 4QAYA
chains in the Genus database with same CATH superfamily
4P7IA 1QKZA 5L83A 1CZPA 2B3AA 1LGRA 4L23A 1TZ1A 3NZSA 2OEDA 1YN5A 3MP9A 1IGCA 2K6DB 1ZDVA 3PHXB 3RNCC 4M8MA 4WWPA 3JSVB 4XE0A 4BBNF 3NS1A 2M19A 1TZOA 1JALA 2LFIA 4BOSC 1Q1OA 4KDIC 1Q5WB 3DWMA 2NMQA 4XDCA 2I1JA 4JWSC 1LXDA 1ESFA 4GDKA 2JXTA 4MT5A 2LUMA 3DHIC 3VUWA 2IO2B 3Q6BA 4RF0A 1T0RC 2N9XA 5HI1A 5JZEB 2AL6A 1DOYA 4PYUA 1L0VB 1SE2A 3BYYB 2L0FA 2GBJA 3DQVA 4MJSB 5DPSA 3ZNHB 1SBBB 3DHHC 1P1AA 4M01A 4TMAB 3ZRCA 3P4QB 2IPKD 2QC8A 1H4RA 2LGDA 2JX5A 4NY0A 4C00A 4DXFA 1H8CA 4ZYSA 2PE6B 2N9PC 3IT4B 3RFZB 2C7NB 2LXCA 4M0WA 2EKEC 4A6QA 2AEHA 1HZ6A 4QAYA 1PYWD 2ZZPB 1ZDXA 2K25A 3RNEC 2MQJA 2DZMA 3B2FA 3QHTA 4A3PA 4WJPA 4HJKA 2JUOA 1K50A 3TSSA 3DBLB 5BMHA 1SJHD 4GDLB 4B6WA 4G3XB 5LNK1 2QDFA 2KX0A 5TSSA 1QT9A 1VZ6A 3PHWB 4ZOHC 1YJIA 2CHZA 1V97A 3MC8A 1MJDA 2ZJDA 1WZ0A 1I4GA 4G11A 1L6UA 3JYUA 3PPAA 2ZVOA 1NEKB 4HCPB 1K51A 1GAQB 2KDMA 4W9HA 3PVLA 4CHKA 2EELA 1MG4A 2FCSA 1D5ZC 2WXOA 1EU3A 2K1FA 2KZRA 2YEPF 3L0WB 2K8BA 1WI0A 1V5OA 2MBBB 2CJNA 2J52A 1XLPA 5D3DA 3ZNZB 3HM3A 1WFYA 2MHJA 4NJ6A 1YX6B 1L4DB 4HRSA 5CTRC 3VXWA 2FCQA 1VZ7A 2GLSA 2MWSB 4P16A 3T9LA 2IGGA 2WYQA 1VLBA 3U8ZA 2PW9A 3VAWA 4NZLB 2GRIA 3MC0B 1GC7A 2AWTA 3GP7A 3AEFB 1IBXA 2L3ZA 3L10B 4KGSA 4EZJA 1EWYC 2IDYA 4E71A 4F1SA 3LYYA 2C60A 4RFBA 4PYZA 1R4MB 1RRBA 1SEBD 1ZPSA 4IWPA 5EE3A 1E8YA 1NBFC 5E6JA 3A4RA 1JRUA 2KWUB 4WWMA 5LXIB 2IO0B 3C0RB 1VD2A 4BVUC 2MX2A 2PKOA 2LGSA 2KX3A 4XZ4A 3DBRI 2BS3B 4E3CA 1QOBA 4M02A 4AJWA 3HUIA 1E7VA 3N9YC 1I35A 1JWMD 2BB6A 2Z8LA 1WGKA 1WX8A 4HJGE 2N7JA 4GXBA 3DBHB 3KLSX 1TKGA 2WP9B 3TCAA 4N6EB 3QQ8B 3UQAA 3AECB 3VTVA 2IBIB 2DAFA 3OG5A 1HA5A 1V6EA 2LI5A 1YQBA 3QCAA 1FXTB 2CU3A 2KQSA 1WE6A 4H2AA 1RFAA 1OQRA 3NJTA 3Q14C 2WXIA 2ZW1A 4ARIA 3VTUA 1IGDA 2JZPA 2G3QB 3EC8A 2WDTB 1S3SG 1RLFA 2W3RA 3P42A 4OVUA 1FNVA 4D2KA 3NOBA 2L52A 2D3GA 1ZOYB 1NI2A 3L4PA 1FFVA 5C23A 2PJHA 2NBWB 3T3NA 4JL9A 1HXYD 2AYOB 5CX3A 3L54A 2WDVB 3PGEA 5HG2A 1E8WA 4GDLA 2MSED 3EA6A 4AJYB 1WM3A 3H1UA 2DBYA 4KX6B 5IN7A 2M8SA 2IZVB 3AE9B 3UGBB 3UQBA 1E10A 3V61A 4IOIE 4ZYNA 1E7PB 2V0GA 2SEBD 2FBWB 1LQBA 2CHXA 1J7CA 3PLUA 2JWUA 1ZGUB 3N1ZC 3KYCD 1OEYA 4FN2A 2KNBA 4HVBA 4EUTA 2HTME 1EUVB 4YL8A 2KK8A 3QIJA 1IPGA 2E3TA 1KLVA 4OVZA 1C4CA 4EFOA 1FXAA 3FAHA 2PVOD 4Q2JA 3ONSA 4IDIA 2WXKA 1Q10A 3DPDA 1QOGA 3NUHB 3GE3C 3RUIB 3ZJTA 2BKRB 1TJEA 3VR9B 2WLBA 3ZTCA 2Z0EB 1UBQA 5HKHA 1GB1A 2D07B 2HE7A 1I7HA 5IKCM 4A8XC 4GSWA 2JPHA 2LVPA 4TKNA 4WAAA 2LVOA 5D7GA 3TIXA 4DHZB 1TGZB 3IVFA 3MHSD 2ONQA 2KVRA 4NAMA 1WXVA 3B1LX 1FRDA 3RD2A 2W82A 3RYTA 1F9JA 1FM0D 1AWDA 3J9CA 5BMGA 2WX1A 4RM9A 3ZRFA 3W9CB 1KF6B 2L00B 3VR8B 2KWDA 2KAJA 4HXDA 2NR2A 4MJSA 2KOXA 1RFKA 3EECA 2ACZB 3KWVA 4DBGA 4LJOB 1WYGA 5AUKA 2LGYA 1B9RA 2QEJC 5E6NA 4IM3A 2MH7A 4MGYE 3VVWB 3FKYA 2YLMA 3EHVA 5IA7A 4HCNB 5KHQA 3DHGC 3KWLA 3MTNB 1XXGA 1FNUA 5J17A 2FAZA 1WZ3A 2LJ5A 5KHOA 2LUEA 3LJ3A 1S1QB 1XLOA 4GOCA 4EZLA 3UIPB 4JX1C 2BB5A 2KYWA 5I4DA 1JCKB 5DPRA 2AQ1B 2VH1A 2H89B 1C77A 1MI0A 3PS6A 1V2YA 3ZXRA 4TV3A 1C4PA 2DYOA 3H7SA 3RCZA 3SHQA 4KSKC 2KACA 3CF6E 1JW9D 4MDKE 2NS5A 4XDDA 3I3TB 1M94A 3QC8B 1B1ZA 3V3XA 4ZHPA 1FPYA 2O6VA 3A9JA 4DHJB 4LJPB 4XX5A 2N7EA 3DOWA 3I63C 1C3TA 3ZJUA 2BS4B 1WMHB 3BK2A 3DWGC 3IXSA 4A20A 3ZDTA 3CWIA 1C78A 2JT4B 3AXCA 2BYVE 1UUPA 3ZUNA 2VH2A 2IYDB 2JXXA 1UELA 2KN4A 1DOIA 2BF8B 2BYFA 3K9OB 3Q8CA 1WX9A 4HKZE 3N3KB 1WMHA 5D94A 4ARCA 5J2RA 1TS5A 4ZRQA 3A1QA 5H8YE 3ZO5B 2DYBA 2HD5B 2X38A 3TEWA 1WJNA 3AE6B 3DBRB 5J18A 3NVWA 2N0SB 3HVZA 3B0AA 4YSZB 3BVZA 4ZRKA 2M4NA 1CJEA 3RPFC 1WSPA 2RR9A 2JY6A 4WAFA 2HDEA 1DGJA 1E7UA 1V81A 2LMCA 4JLCA 3M95A 3BWUD 4WH4A 1WGYA 1D3ZA 3PT2B 2WXLA 1QQRA 2V3SA 2Y5BB 4W9FA 5IO9A 1E8XA 2C7MB 4S0RA 3L08A 1E90A 1GUAB 3HK0A 3Q8EA 3QARA 4M0WB 4B9KA 2KJ6A 5GXGB 2XN9C 1E0ZA 3HHMA 2N9EB 2BT6A 4HPPA 2KVZA 4A9AA 2JRIB 3NZ3A 3X23A 4DXAB 1WX7A 4ZRPA 1TKYA 2HJ1A 1EM7A 4IC7B 3PREA 2CR5A 2K8CA 2C5LC 3VFKA 1FIQA 4N9F4 5AUIA 4MGIE 1QF6A 1YOVB 1OEYJ 4K81A 3TL5A 3SEBA 1JWBD 2ZNVB 4LLGM 4WJOA 2LGXA 1GJZA 2INNE 3ZNID 1N5XA 5AZHA 2WWZA 3KUDB 1ZP0B 1WWTA 1IYFA 3Q69A 1E5WA 4EEWA 3TEXA 1ZW7A 4W9IA 2LZ6A 1KH0A 2NTSA 2XK5A 1P9DU 1OGWA 2W55A 2BYEA 3AU5A 3ZNGC 4WWOA 1CMXB 1HE8A 2DX5B 4GGQA 1P7FA 1I4PA 4WJQA 1ET6A 2L83A 5D6JB 2I38A 4M8NA 2INCC 4L2YA 3W1SC 2JF5A 4ANVA 3N32A 3M63B 2RGFA 3NS8A 1DOXA 2G4SA 4ICVA 3DVNV 1LFDA 3AE1B 4FXCA 1N63A 4RM8A 1WF9A 4BZAA 4HLEA 2WQYB 4ASWC 4C56C 2DZJA 1N5WA 3AEBB 3P63A 2FIDA 3AB5A 1J7AA 1K8RB 2OJWA 3DVNU 3WALA 3HM6X 3IFWB 4IG7B 4RF1A 1UZXB 2LRUA 2BTEA 1STEA 2KC1A 2KQ4X 4FJZA 5AZGA 2AQ3B 1MFWA 4OZAA 2MBHA 4GIVA 1BXTA 1R7SA 2J7QB 3CIRB 3NVVA 3ZIMA 4ITKA 5EDSA 4X57B 4NAWB 4N59A 4LNIA 3MFGA 1BUIC 2JZ3B 2MBQA 1T3QA 2RDGA 5IAAC 1J8CA 5FK9C 4HROA 4KKIA 1I4QA 2LD9A 2DZKA 4IKGA 4HPLB 5BMIA 4EOYA 1UGMA 4MELA 1ET9A 5JHAA 4JE3B 2BWFA 1QZEA 1KRHA 4YTPB 2Y5PA 2NBUA 2RDHA 1TY2A 4II2B 1TYGB 2Z59B 3IG3A 3AE2B 1ZUD2 4RGNA 5LLIA 5DPWA 3RN9C 4FJVB 2BPSA 4RH6A 2Y5CA 2MBEA 2M0AA 2N4FA 2R2OA 5TR5A 4EE2A 2IGHA 1IP9A 4I6NB 4FHJA 2KTRB 4ZRIA 5G5HA 2LRWA 3W1SA 2MW5A 3Q8AA 4MH0E 1WGHA 5CHWA 5LXHA 2NCNA 2O6VB 3WAPA 2KFKA 1U4AA 3BK1A 2L05A 3VUYA 1J19A 1YJ1A 2FIFA 1XO3A 5AZFA 3RNGC 3PO0A 1UWMA 2WU2B 2D5GA 3ECIA 2C9WB 4OZBA 3NVYA 4KV2A 1VRAB 1FEHA 2ZNVC 1K53A 3AE8B 4LNFA 1C9FA 4FULA 3Q3OC 1PUTA 2IO1B 2AX5A 2UWQA 2WU5B 2O6VD 3ZTDA 3TJPA 5C1ZA 2M17A 2EMSA 2LVQA 1QLBB 4AOFA 2RMMA 1UH6A 1FRRA 1NDDA 2K5PA 4YWGG 3B9JA 2MBOA 1SE4A 4A3OA 2QJLA 1PFDA 2JRHA 4P6VF 3AM9A 3U30A 3CMMB 2YEPB 2J42A 4TQ0A 3A4SC 1XLNA 3IAM1 1V9JA 2WXQA 4J6IA 4BKSD 2KMMA 2V4LA 1FMAD 2DWQA 1TKEA 5GMVA 1L5PA 2LXAA 3O13A 3I57A 2WXRA 3T3OA 3ZGZA 3I9V1 2LHDA 2RDBC 4XWWA 3ZJVA 4GN1A 2X8XX 4JQWC 4US9A 4IW0A 1GB4A 2D3AA 3LDZE 2ASQA 4MM3B 1WY8A 1HZ5A 1V5TA 2UU7A 1SIJA 1L2NA 1SE3A 3M62B 3OJ3A 2KKCA 1F2RI 2KDIA 2KD0A 1PGXA 1ACCA 5DPTA 1NVID 2GMIC 1J7BA 3AN1A 3V6EB 4USAA 3UINB 3NG0A 2XK5B 1RM6C 1AN8A 2V3PA 2VRRB 2BYTA 3JW0X 2RD0A 4O1NA 3IT6B 2BWES 2A5UA 2N1WA 3AULA 3R7QA 3U7DA 2QHOA 3OWEB 4WIPA 1WGDA 4W9LA 1I4HA 3AEGB 3KQ4A 5AEKB 4IM0A 3EUB2 3BINA 1T5XD 1ROEA 4S17A 3V62A 3V60A 2PE9A 2ZCBA 3HVDA 3BYTB 4AUQC 1YIWA 3PRPB 4F8CB 3ALBA 3DVGY 1A5RA 1N6ZA 2WXJA 1JQ4A 2HJ8A 3GZNB 2WHIA 4CQNA 2MEKA 5D2MB 4WWNA 4C7YA 4FJYA 3U2SC 2D11A 2DNFA 3P1MA 1JWSD 2MLBA 2G9HD 4P1CC 4DDID 1NENB 3B08A 3PV1A 3RNAC 3QX1A 1MHHE 2DHZA 3HRDD 1PDXA 2PPHA 2OOBB 3APFA 3SD5A 2K22A 4DDGD 5FR6A 4MM3A 3U7ZA 3WAOA 4I6PA 1C1YB 3VRAB 4KVGB 3DBHI 3QAQA 2JWZA 1E9MA 4K1RB 3FC4A 3JVZX 3U4EG 3H7PB 3RI7C 1FFUA 4K3BA 1ZE3D 3BZDB 4LNNA 2WDRB 2V1YA 1R4NB 2A4ZA 4YT0B 1TIFA 3W1YA 1P7EA 1N61A 2V3NA 3Q8BA 3SDLC 2NPTA 2IO3B 1WR6E 2JZZA 2UYZB 2Y3AA 1IBXB 4W9CA 4N58A 4W9KA 1YX5B 2DYMA 2PVGC 2BGFA 1SXTA 4OW0A 3IBEA 1VZ8A 3RMKC 5H92C 4JGHB 3FILB 4ICUA 2WXPA 1V1PB 2NPTB 2AQ2B 2GBRA 1OTRB 5C2TB 4JWUC 2PEAA 1SJED 1I4RA 2KJHB 2KQ7A 4UDUC 2KN5A 4HDOA 3Q3FA 2W3SA 2L8JA 3KUZA 3R3MA 1BT0A 2GBKA 1F52A 1HEZE 2OHFA 1C4AA 1M4VA 1IUEA 1T6BX 4K7UA 2BKFA 3CSTA 2WNMA 4DK5A 4ZRJA 1GOZA 3A9KA 2WXGA 2D3CA 4PK1A 2BW2A 1WJUA 1E6EB 1NI3A 4I6LB 2J0JA 1OFFA 4OHJA 2ICIA 3SR6A 3SU8X 2K39A 3N1YC 3AE5B 2NTTA 3GB1A 4R3DA 4W9DA 1AYFA 4MSQB 1FCCC 3DVGX 3Q2AC 5HHDG 1JRPA 2G1EA 4URKA 2K9XA 4DQOC 1SE9A 2M0XA 2IGDA 4EZKA 3QWZB 2KMAA 4EKUA 4K7WA 3B2GA 1SIFA 1N60A 3P4PB 1WRIA 1XEEA 4ZDVA 2YVCA 3A1QB 3TBLD 1PGAA 2W9NA 3H8HA 4BKSA 1V8CA 3DCGA 4RNAA 5BYRA 2VZKB 4B0MA 2CU1A 1WJ4A 3A9KB 3IHPC 3UF8A 3ZQ4A 3ML8A 3ML9A 3N20C 2K8HA 5FKAC 1NYRA 1EF1A 1VR9A 3QK0A 2KT7A 4NAWA 5CHFA 4WQMA 2L0TA 4DWFA 1P0RA 4BFRA 2K6QA 4W9GA 4DHJD 3TEZA 3A9JB 4BOZB 4MGKE 4PS3A 3RZWC 2N7DA 1V86A 3K9PB 3Q3MC 1ZXHA 1V49A 1V1OA 2H88B 1FNWA 1WH3A 4XWTA 3C8YA 3PZDA 1L6VA 5D3IB 3KW5B 3HIZA 3MJ5A 2WXNA 3L17A 1WR1A 1AARA 1JMLA 2J0MA 3PZ7A 1K52A 2KTFA 4PT5A 3SFDB 2LEKA 2PLPA 1GG3A 3WANA 5C3JB 1KOTA 1WRDB 1C79A 1D5MC 2KFKB 4G50A 4MGZE 4LDTB 4FA6A 3KYDD 3NHEB 2WS3B 4REZA 2LJIA 2LHEA 5JH5C 5DCNA 4HK2A 2N9LA 3W5UB 4P1BC 1ZXIA 3A33B 1P3QU 2M1MA 2CS4A 2RPVA 4OZCA 4KIKA 2MJDA 3VDZA 2JU6X 1GPXA 3H9DA 3P4SB 4LDTD 1F2RC 1MVKA 2INPE 3FILA 5E6OA 4ZHOA 2KO3A 3GE8C 3ZKJC 3OJ4B 1LO5D 4C80A 2PMVA 2IY1B 2ZVNA 4OVVA 2KMCA 3R7RA 2LASA 1OQYA 3GZNI 4ANWA 4KSLC 3AH7A 1XCQL 1E8ZA 1XT9B 5BYSA 4CO7A 1SF0A 2MP2A 4YSYB 2G4DB 5EE0A 4GLSC 4BAXA 4B95A 3H6NA 4IM2A 1TS2A 3R2TA 1XLQA 2K3UA 2BVCA 2QILA 3VH4B 3OLMD 4RGOS 2JQRB 1DYQA 4KIKB 3UI3A 1FXIA 2W54A 3D32A 3S2AA 2RPQA 1C76A 2DZIA 1KLGD 3CSFA 4TSSA 1KJTA 4FBJB 4B0EA 5L95C 4BBNC 3MC9A 3BVMA 3H7PA 1T0QC 3LXFA 4G0NB 3TMPB 4ANXA 3URYA 4WQOB 4LK0M 4A55A 5MPOA 1XF5L 2I2YA 3AMZA 3RNFC 1L4ZB 2QIEB 4RGTA 2D3BA 3U52E 3MJWA 4BKTA 1YN3A 3P2BA 1VCBA 4KGRA 2KDEB 4HWIB 5G2NA 4IUMB 3IAS1 1Y8RC 2XNAC 5E6PA 2V9HA 1FCLA 2QMTA 4FADA 3Q3JA 4MEMA 1L0YB 1ENFA 3APDA 1V1PA 4II3B 1UGJA 1UBIA 1F0ZA 2WXFA 1KTKA 1X1MA 1YQ3B 2R61A 1YJJA 3QA8A 1L0XB 3DBLI 1UF0A 1QOAA 3WAMA 1PQSA 4AS1A 2C7HA 1Y56A 2IJ0A 3VHTC 1WYWB 3ZDMC 4GMVA 3ZW3A 2KJRA 1R4NI 3GOEA 5BYQA 2REXA 4DHZE 2FUHB 2KWVB 1P98A 3VRBB 1EU4A 1XD3B 2N9KA 3APCA 4RCOA 3VTWA 3AU4A 3T8MA 5BO4B 4MSMB 3Q8FA 4MACA 2KFJA 2JYEA 5EE9A 4C4VB 1D6EC 3EFCA 2J4XA 2V4IB 3R2IA 1KFYB 4WJNA 2O2VB 1FD6A 5T8IA 2WX0A 3SFEB 1T0SC 1LM8B 3BVGA 1TY0A 2L32A 3VH3B 2WXMA 4KKJA 4LNKA 4KZCA 3VQIA 1NYQA 2MRPA 4YSXB 3LB8C 4LTUA 2ZCCA 1UD7A 4C4VA 2QCZA 5EE1A 1SB3C 2O2VA 3AV8A 3EGRA 4JPSA 2R2QA 4YTNB 2GBNA 1EO6A 1QILA 2VZKD 3L16A 4E74A 5HFYA 3PLVA 2EKIA 5FR3A 1RAXA 3E9SA 1TS3A 2KXJA 4NJCA 1F77A 2DLBA 5IP4D 3ABVB 2KTRA 2KANA 1RYJA 5JXVA 1WGRA 1EWCA 3AEAB 4YXDB 1VJKA 3P4RB 1I4XA 2NBVB 2L1AA 2WGSA 1D5XC 3W2DA 4KDLB 3ZLZA 3Q3NC 2L7RA 3E56A 3I5JC 3L13A 3BY4B 1D4BA 1CQVA 4FLHA 2MA9B 1AW7A 3V05A 2EMTA 2BS2B 2J53A 2WDQB 4PS7A 1KLUD 4GB9A 4A90A 4W9EA 2MCNB 1WM2A 3PRZA 4ACFA 3EFUA 3PRMB 2L76A 2MJEA 4AP4C 3NY5A 5G5GA 1HQRD 2FCMA 2DAJA 2ON8A 1WXSA 1OQQA 3VUXA 4C7ZA 3RZFA 4US8A 3NVZA 2JSVX 1EF5A 1A70A 3BIID 2GBMA 4IWQA 3RULA 3ZVVA 4XC2A 4LCDE 2Z0DB 2HTHA 1JWUD 1GC6A 4ANUA 2GI9A 2WXHA 1HTOA 2LWPA 4HKQA 2LGIA 3OAWA 3ETRA 4W9JA 1UWXA 3ENEA 3KUCB 4KZ0A 3TUOA 1J0GA 3AI5A 2CKHB 2I1KA 1RWSA 2GB1A 2KLCA 4HPMB 5CHVC 3X0WA 2MP2B 3NZUA 1Q0WB 1WE7A 2Q5WD 2KDBA 3RT3B 4TQ1A 1YMHE 2XBBC 4XYCA 4GU2A 4NPNA 2BQQA 1T0YA 2ZW0A 2KLGA 4WURA 2IY0B 4GDKB 1WXMA 3UIOB 4NJ7A 4IWOA 4PS8A 2CHWA 1ISNA 2K0PA 2D2QA 1MHXA 1UNSA 2NVUI 3ZXVA 4KGTA 3AE3B 5JHBA 1TT5B 4TUUA 2KHWB 3PSEB 3NRZA 1XCTL 1L7YA 2KWCA 4YTMB 2G45B 1WGGA 2PIAA 1VDVA 2FE8A 3C19A 2J0KA 1Z2MA 1SSNA 3WA0A 1JROA 2SAKA 3WIMA 4RMAA 1R4MI 4NQLB 4J3OD 1MPEA 1QOFA 4RGMA 2XEWA 2JVCA 2B76B 1TTNA 3RNBC 2RSUA 1ZKHA 1PGBA 5IOIA 2AL3A 3N1XC 4FHKA 1WXAA 4L1BA 1TS4A 3JSVA 2FCNA 1HTQA 3AE4B 3ZYYX 1MG8A 2INDC 2FUG1 3DDCB 4CYEA 2KDFB 4K3CA 2ZEQA 1JWAD 2QSDA 3AE7B 3TEYA 1YN4A 3R66C 3WCQA 5G55A 3KVFB 2PTLA 4AWJA 1CK1A 1I42A 2CJOA 2D10A 1YQ4B 2MJ3A 1TBEA 1F1HA 4JIOU 4NQKE 3AEDB 2BBCA 3PTFC 3V6CB 4AQ7A 2KC2A 1WIAA 4HDQA 1YD8U 1N62A 1SGHA 1XQQA 3W5VB 1FO4A 2N1VA 3O65B 1WJ6A 4DXGA 4NNJB 1GNUA 4BKGA 2FNJB 1YNTE 4MH8A 2ZPNA 2TSSA 4K7SA 3R8BA 1BMLC 2JYTA 4LNOA 4M00A 3DBSA 2DENB 3KH0A 3PZ8A 3MHZA 1KM7A 4HEA1 3GS2A 1G6JA 1V80A 2GOWA 2M56B 4F7ZA 3N30A 2OJRA 2ZPYA 1WXQA 3AEEB 3M3JA 4XGAB 1Z5SB 2E6XA 3QJZA
chains in the Genus database with same CATH topology
2V9HA 2VH2A 2QDFA 3MC9A 4PK1A 4K3CA 3NJTA 2MHJA 2VH1A 2X8XX 4C4VA 4C00A 2QCZA 4C4VB 4BZAA 3MC8A 4K3BA 3EFCA 3Q6BA 3OG5A 4XGAB 4QAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9H A;  2VH2 A;  2QDF A;  3MC9 A;  4PK1 A;  4K3C A;  3NJT A;  2MHJ A;  2VH1 A;  2X8X X;  4C4V A;  4C00 A;  2QCZ A;  4C4V B;  4BZA A;  3MC8 A;  4K3B A;  3EFC A;  3Q6B A;  3OG5 A;  4XGA B;  4QAY A; 
#chains in the Genus database with same CATH topology
 4P7I A;  1QKZ A;  5L83 A;  1CZP A;  2B3A A;  1LGR A;  4L23 A;  1TZ1 A;  3NZS A;  2OED A;  1YN5 A;  3MP9 A;  1IGC A;  2K6D B;  1ZDV A;  3PHX B;  3RNC C;  4M8M A;  4WWP A;  3JSV B;  4XE0 A;  4BBN F;  3NS1 A;  2M19 A;  1TZO A;  1JAL A;  2LFI A;  4BOS C;  1Q1O A;  4KDI C;  1Q5W B;  3DWM A;  2NMQ A;  4XDC A;  2I1J A;  4JWS C;  1LXD A;  1ESF A;  4GDK A;  2JXT A;  4MT5 A;  2LUM A;  3DHI C;  3VUW A;  2IO2 B;  3Q6B A;  4RF0 A;  1T0R C;  2N9X A;  5HI1 A;  5JZE B;  2AL6 A;  1DOY A;  4PYU A;  1L0V B;  1SE2 A;  3BYY B;  2L0F A;  2GBJ A;  3DQV A;  4MJS B;  5DPS A;  3ZNH B;  1SBB B;  3DHH C;  1P1A A;  4M01 A;  4TMA B;  3ZRC A;  3P4Q B;  2IPK D;  2QC8 A;  1H4R A;  2LGD A;  2JX5 A;  4NY0 A;  4C00 A;  4DXF A;  1H8C A;  4ZYS A;  2PE6 B;  2N9P C;  3IT4 B;  3RFZ B;  2C7N B;  2LXC A;  4M0W A;  2EKE C;  4A6Q A;  2AEH A;  1HZ6 A;  4QAY A;  1PYW D;  2ZZP B;  1ZDX A;  2K25 A;  3RNE C;  2MQJ A;  2DZM A;  3B2F A;  3QHT A;  4A3P A;  4WJP A;  4HJK A;  2JUO A;  1K50 A;  3TSS A;  3DBL B;  5BMH A;  1SJH D;  4GDL B;  4B6W A;  4G3X B;  5LNK 1;  2QDF A;  2KX0 A;  5TSS A;  1QT9 A;  1VZ6 A;  3PHW B;  4ZOH C;  1YJI A;  2CHZ A;  1V97 A;  3MC8 A;  1MJD A;  2ZJD A;  1WZ0 A;  1I4G A;  4G11 A;  1L6U A;  3JYU A;  3PPA A;  2ZVO A;  1NEK B;  4HCP B;  1K51 A;  1GAQ B;  2KDM A;  4W9H A;  3PVL A;  4CHK A;  2EEL A;  1MG4 A;  2FCS A;  1D5Z C;  2WXO A;  1EU3 A;  2K1F A;  2KZR A;  2YEP F;  3L0W B;  2K8B A;  1WI0 A;  1V5O A;  2MBB B;  2CJN A;  2J52 A;  1XLP A;  5D3D A;  3ZNZ B;  3HM3 A;  1WFY A;  2MHJ A;  4NJ6 A;  1YX6 B;  1L4D B;  4HRS A;  5CTR C;  3VXW A;  2FCQ A;  1VZ7 A;  2GLS A;  2MWS B;  4P16 A;  3T9L A;  2IGG A;  2WYQ A;  1VLB A;  3U8Z A;  2PW9 A;  3VAW A;  4NZL B;  2GRI A;  3MC0 B;  1GC7 A;  2AWT A;  3GP7 A;  3AEF B;  1IBX A;  2L3Z A;  3L10 B;  4KGS A;  4EZJ A;  1EWY C;  2IDY A;  4E71 A;  4F1S A;  3LYY A;  2C60 A;  4RFB A;  4PYZ A;  1R4M B;  1RRB A;  1SEB D;  1ZPS A;  4IWP A;  5EE3 A;  1E8Y A;  1NBF C;  5E6J A;  3A4R A;  1JRU A;  2KWU B;  4WWM A;  5LXI B;  2IO0 B;  3C0R B;  1VD2 A;  4BVU C;  2MX2 A;  2PKO A;  2LGS A;  2KX3 A;  4XZ4 A;  3DBR I;  2BS3 B;  4E3C A;  1QOB A;  4M02 A;  4AJW A;  3HUI A;  1E7V A;  3N9Y C;  1I35 A;  1JWM D;  2BB6 A;  2Z8L A;  1WGK A;  1WX8 A;  4HJG E;  2N7J A;  4GXB A;  3DBH B;  3KLS X;  1TKG A;  2WP9 B;  3TCA A;  4N6E B;  3QQ8 B;  3UQA A;  3AEC B;  3VTV A;  2IBI B;  2DAF A;  3OG5 A;  1HA5 A;  1V6E A;  2LI5 A;  1YQB A;  3QCA A;  1FXT B;  2CU3 A;  2KQS A;  1WE6 A;  4H2A A;  1RFA A;  1OQR A;  3NJT A;  3Q14 C;  2WXI A;  2ZW1 A;  4ARI A;  3VTU A;  1IGD A;  2JZP A;  2G3Q B;  3EC8 A;  2WDT B;  1S3S G;  1RLF A;  2W3R A;  3P42 A;  4OVU A;  1FNV A;  4D2K A;  3NOB A;  2L52 A;  2D3G A;  1ZOY B;  1NI2 A;  3L4P A;  1FFV A;  5C23 A;  2PJH A;  2NBW B;  3T3N A;  4JL9 A;  1HXY D;  2AYO B;  5CX3 A;  3L54 A;  2WDV B;  3PGE A;  5HG2 A;  1E8W A;  4GDL A;  2MSE D;  3EA6 A;  4AJY B;  1WM3 A;  3H1U A;  2DBY A;  4KX6 B;  5IN7 A;  2M8S A;  2IZV B;  3AE9 B;  3UGB B;  3UQB A;  1E10 A;  3V61 A;  4IOI E;  4ZYN A;  1E7P B;  2V0G A;  2SEB D;  2FBW B;  1LQB A;  2CHX A;  1J7C A;  3PLU A;  2JWU A;  1ZGU B;  3N1Z C;  3KYC D;  1OEY A;  4FN2 A;  2KNB A;  4HVB A;  4EUT A;  2HTM E;  1EUV B;  4YL8 A;  2KK8 A;  3QIJ A;  1IPG A;  2E3T A;  1KLV A;  4OVZ A;  1C4C A;  4EFO A;  1FXA A;  3FAH A;  2PVO D;  4Q2J A;  3ONS A;  4IDI A;  2WXK A;  1Q10 A;  3DPD A;  1QOG A;  3NUH B;  3GE3 C;  3RUI B;  3ZJT A;  2BKR B;  1TJE A;  3VR9 B;  2WLB A;  3ZTC A;  2Z0E B;  1UBQ A;  5HKH A;  1GB1 A;  2D07 B;  2HE7 A;  1I7H A;  5IKC M;  4A8X C;  4GSW A;  2JPH A;  2LVP A;  4TKN A;  4WAA A;  2LVO A;  5D7G A;  3TIX A;  4DHZ B;  1TGZ B;  3IVF A;  3MHS D;  2ONQ A;  2KVR A;  4NAM A;  1WXV A;  3B1L X;  1FRD A;  3RD2 A;  2W82 A;  3RYT A;  1F9J A;  1FM0 D;  1AWD A;  3J9C A;  5BMG A;  2WX1 A;  4RM9 A;  3ZRF A;  3W9C B;  1KF6 B;  2L00 B;  3VR8 B;  2KWD A;  2KAJ A;  4HXD A;  2NR2 A;  4MJS A;  2KOX A;  1RFK A;  3EEC A;  2ACZ B;  3KWV A;  4DBG A;  4LJO B;  1WYG A;  5AUK A;  2LGY A;  1B9R A;  2QEJ C;  5E6N A;  4IM3 A;  2MH7 A;  4MGY E;  3VVW B;  3FKY A;  2YLM A;  3EHV A;  5IA7 A;  4HCN B;  5KHQ A;  3DHG C;  3KWL A;  3MTN B;  1XXG A;  1FNU A;  5J17 A;  2FAZ A;  1WZ3 A;  2LJ5 A;  5KHO A;  2LUE A;  3LJ3 A;  1S1Q B;  1XLO A;  4GOC A;  4EZL A;  3UIP B;  4JX1 C;  2BB5 A;  2KYW A;  5I4D A;  1JCK B;  5DPR A;  2AQ1 B;  2VH1 A;  2H89 B;  1C77 A;  1MI0 A;  3PS6 A;  1V2Y A;  3ZXR A;  4TV3 A;  1C4P A;  2DYO A;  3H7S A;  3RCZ A;  3SHQ A;  4KSK C;  2KAC A;  3CF6 E;  1JW9 D;  4MDK E;  2NS5 A;  4XDD A;  3I3T B;  1M94 A;  3QC8 B;  1B1Z A;  3V3X A;  4ZHP A;  1FPY A;  2O6V A;  3A9J A;  4DHJ B;  4LJP B;  4XX5 A;  2N7E A;  3DOW A;  3I63 C;  1C3T A;  3ZJU A;  2BS4 B;  1WMH B;  3BK2 A;  3DWG C;  3IXS A;  4A20 A;  3ZDT A;  3CWI A;  1C78 A;  2JT4 B;  3AXC A;  2BYV E;  1UUP A;  3ZUN A;  2VH2 A;  2IYD B;  2JXX A;  1UEL A;  2KN4 A;  1DOI A;  2BF8 B;  2BYF A;  3K9O B;  3Q8C A;  1WX9 A;  4HKZ E;  3N3K B;  1WMH A;  5D94 A;  4ARC A;  5J2R A;  1TS5 A;  4ZRQ A;  3A1Q A;  5H8Y E;  3ZO5 B;  2DYB A;  2HD5 B;  2X38 A;  3TEW A;  1WJN A;  3AE6 B;  3DBR B;  5J18 A;  3NVW A;  2N0S B;  3HVZ A;  3B0A A;  4YSZ B;  3BVZ A;  4ZRK A;  2M4N A;  1CJE A;  3RPF C;  1WSP A;  2RR9 A;  2JY6 A;  4WAF A;  2HDE A;  1DGJ A;  1E7U A;  1V81 A;  2LMC A;  4JLC A;  3M95 A;  3BWU D;  4WH4 A;  1WGY A;  1D3Z A;  3PT2 B;  2WXL A;  1QQR A;  2V3S A;  2Y5B B;  4W9F A;  5IO9 A;  1E8X A;  2C7M B;  4S0R A;  3L08 A;  1E90 A;  1GUA B;  3HK0 A;  3Q8E A;  3QAR A;  4M0W B;  4B9K A;  2KJ6 A;  5GXG B;  2XN9 C;  1E0Z A;  3HHM A;  2N9E B;  2BT6 A;  4HPP A;  2KVZ A;  4A9A A;  2JRI B;  3NZ3 A;  3X23 A;  4DXA B;  1WX7 A;  4ZRP A;  1TKY A;  2HJ1 A;  1EM7 A;  4IC7 B;  3PRE A;  2CR5 A;  2K8C A;  2C5L C;  3VFK A;  1FIQ A;  4N9F 4;  5AUI A;  4MGI E;  1QF6 A;  1YOV B;  1OEY J;  4K81 A;  3TL5 A;  3SEB A;  1JWB D;  2ZNV B;  4LLG M;  4WJO A;  2LGX A;  1GJZ A;  2INN E;  3ZNI D;  1N5X A;  5AZH A;  2WWZ A;  3KUD B;  1ZP0 B;  1WWT A;  1IYF A;  3Q69 A;  1E5W A;  4EEW A;  3TEX A;  1ZW7 A;  4W9I A;  2LZ6 A;  1KH0 A;  2NTS A;  2XK5 A;  1P9D U;  1OGW A;  2W55 A;  2BYE A;  3AU5 A;  3ZNG C;  4WWO A;  1CMX B;  1HE8 A;  2DX5 B;  4GGQ A;  1P7F A;  1I4P A;  4WJQ A;  1ET6 A;  2L83 A;  5D6J B;  2I38 A;  4M8N A;  2INC C;  4L2Y A;  3W1S C;  2JF5 A;  4ANV A;  3N32 A;  3M63 B;  2RGF A;  3NS8 A;  1DOX A;  2G4S A;  4ICV A;  3DVN V;  1LFD A;  3AE1 B;  4FXC A;  1N63 A;  4RM8 A;  1WF9 A;  4BZA A;  4HLE A;  2WQY B;  4ASW C;  4C56 C;  2DZJ A;  1N5W A;  3AEB B;  3P63 A;  2FID A;  3AB5 A;  1J7A A;  1K8R B;  2OJW A;  3DVN U;  3WAL A;  3HM6 X;  3IFW B;  4IG7 B;  4RF1 A;  1UZX B;  2LRU A;  2BTE A;  1STE A;  2KC1 A;  2KQ4 X;  4FJZ A;  5AZG A;  2AQ3 B;  1MFW A;  4OZA A;  2MBH A;  4GIV A;  1BXT A;  1R7S A;  2J7Q B;  3CIR B;  3NVV A;  3ZIM A;  4ITK A;  5EDS A;  4X57 B;  4NAW B;  4N59 A;  4LNI A;  3MFG A;  1BUI C;  2JZ3 B;  2MBQ A;  1T3Q A;  2RDG A;  5IAA C;  1J8C A;  5FK9 C;  4HRO A;  4KKI A;  1I4Q A;  2LD9 A;  2DZK A;  4IKG A;  4HPL B;  5BMI A;  4EOY A;  1UGM A;  4MEL A;  1ET9 A;  5JHA A;  4JE3 B;  2BWF A;  1QZE A;  1KRH A;  4YTP B;  2Y5P A;  2NBU A;  2RDH A;  1TY2 A;  4II2 B;  1TYG B;  2Z59 B;  3IG3 A;  3AE2 B;  1ZUD 2;  4RGN A;  5LLI A;  5DPW A;  3RN9 C;  4FJV B;  2BPS A;  4RH6 A;  2Y5C A;  2MBE A;  2M0A A;  2N4F A;  2R2O A;  5TR5 A;  4EE2 A;  2IGH A;  1IP9 A;  4I6N B;  4FHJ A;  2KTR B;  4ZRI A;  5G5H A;  2LRW A;  3W1S A;  2MW5 A;  3Q8A A;  4MH0 E;  1WGH A;  5CHW A;  5LXH A;  2NCN A;  2O6V B;  3WAP A;  2KFK A;  1U4A A;  3BK1 A;  2L05 A;  3VUY A;  1J19 A;  1YJ1 A;  2FIF A;  1XO3 A;  5AZF A;  3RNG C;  3PO0 A;  1UWM A;  2WU2 B;  2D5G A;  3ECI A;  2C9W B;  4OZB A;  3NVY A;  4KV2 A;  1VRA B;  1FEH A;  2ZNV C;  1K53 A;  3AE8 B;  4LNF A;  1C9F A;  4FUL A;  3Q3O C;  1PUT A;  2IO1 B;  2AX5 A;  2UWQ A;  2WU5 B;  2O6V D;  3ZTD A;  3TJP A;  5C1Z A;  2M17 A;  2EMS A;  2LVQ A;  1QLB B;  4AOF A;  2RMM A;  1UH6 A;  1FRR A;  1NDD A;  2K5P A;  4YWG G;  3B9J A;  2MBO A;  1SE4 A;  4A3O A;  2QJL A;  1PFD A;  2JRH A;  4P6V F;  3AM9 A;  3U30 A;  3CMM B;  2YEP B;  2J42 A;  4TQ0 A;  3A4S C;  1XLN A;  3IAM 1;  1V9J A;  2WXQ A;  4J6I A;  4BKS D;  2KMM A;  2V4L A;  1FMA D;  2DWQ A;  1TKE A;  5GMV A;  1L5P A;  2LXA A;  3O13 A;  3I57 A;  2WXR A;  3T3O A;  3ZGZ A;  3I9V 1;  2LHD A;  2RDB C;  4XWW A;  3ZJV A;  4GN1 A;  2X8X X;  4JQW C;  4US9 A;  4IW0 A;  1GB4 A;  2D3A A;  3LDZ E;  2ASQ A;  4MM3 B;  1WY8 A;  1HZ5 A;  1V5T A;  2UU7 A;  1SIJ A;  1L2N A;  1SE3 A;  3M62 B;  3OJ3 A;  2KKC A;  1F2R I;  2KDI A;  2KD0 A;  1PGX A;  1ACC A;  5DPT A;  1NVI D;  2GMI C;  1J7B A;  3AN1 A;  3V6E B;  4USA A;  3UIN B;  3NG0 A;  2XK5 B;  1RM6 C;  1AN8 A;  2V3P A;  2VRR B;  2BYT A;  3JW0 X;  2RD0 A;  4O1N A;  3IT6 B;  2BWE S;  2A5U A;  2N1W A;  3AUL A;  3R7Q A;  3U7D A;  2QHO A;  3OWE B;  4WIP A;  1WGD A;  4W9L A;  1I4H A;  3AEG B;  3KQ4 A;  5AEK B;  4IM0 A;  3EUB 2;  3BIN A;  1T5X D;  1ROE A;  4S17 A;  3V62 A;  3V60 A;  2PE9 A;  2ZCB A;  3HVD A;  3BYT B;  4AUQ C;  1YIW A;  3PRP B;  4F8C B;  3ALB A;  3DVG Y;  1A5R A;  1N6Z A;  2WXJ A;  1JQ4 A;  2HJ8 A;  3GZN B;  2WHI A;  4CQN A;  2MEK A;  5D2M B;  4WWN A;  4C7Y A;  4FJY A;  3U2S C;  2D11 A;  2DNF A;  3P1M A;  1JWS D;  2MLB A;  2G9H D;  4P1C C;  4DDI D;  1NEN B;  3B08 A;  3PV1 A;  3RNA C;  3QX1 A;  1MHH E;  2DHZ A;  3HRD D;  1PDX A;  2PPH A;  2OOB B;  3APF A;  3SD5 A;  2K22 A;  4DDG D;  5FR6 A;  4MM3 A;  3U7Z A;  3WAO A;  4I6P A;  1C1Y B;  3VRA B;  4KVG B;  3DBH I;  3QAQ A;  2JWZ A;  1E9M A;  4K1R B;  3FC4 A;  3JVZ X;  3U4E G;  3H7P B;  3RI7 C;  1FFU A;  4K3B A;  1ZE3 D;  3BZD B;  4LNN A;  2WDR B;  2V1Y A;  1R4N B;  2A4Z A;  4YT0 B;  1TIF A;  3W1Y A;  1P7E A;  1N61 A;  2V3N A;  3Q8B A;  3SDL C;  2NPT A;  2IO3 B;  1WR6 E;  2JZZ A;  2UYZ B;  2Y3A A;  1IBX B;  4W9C A;  4N58 A;  4W9K A;  1YX5 B;  2DYM A;  2PVG C;  2BGF A;  1SXT A;  4OW0 A;  3IBE A;  1VZ8 A;  3RMK C;  5H92 C;  4JGH B;  3FIL B;  4ICU A;  2WXP A;  1V1P B;  2NPT B;  2AQ2 B;  2GBR A;  1OTR B;  5C2T B;  4JWU C;  2PEA A;  1SJE D;  1I4R A;  2KJH B;  2KQ7 A;  4UDU C;  2KN5 A;  4HDO A;  3Q3F A;  2W3S A;  2L8J A;  3KUZ A;  3R3M A;  1BT0 A;  2GBK A;  1F52 A;  1HEZ E;  2OHF A;  1C4A A;  1M4V A;  1IUE A;  1T6B X;  4K7U A;  2BKF A;  3CST A;  2WNM A;  4DK5 A;  4ZRJ A;  1GOZ A;  3A9K A;  2WXG A;  2D3C A;  4PK1 A;  2BW2 A;  1WJU A;  1E6E B;  1NI3 A;  4I6L B;  2J0J A;  1OFF A;  4OHJ A;  2ICI A;  3SR6 A;  3SU8 X;  2K39 A;  3N1Y C;  3AE5 B;  2NTT A;  3GB1 A;  4R3D A;  4W9D A;  1AYF A;  4MSQ B;  1FCC C;  3DVG X;  3Q2A C;  5HHD G;  1JRP A;  2G1E A;  4URK A;  2K9X A;  4DQO C;  1SE9 A;  2M0X A;  2IGD A;  4EZK A;  3QWZ B;  2KMA A;  4EKU A;  4K7W A;  3B2G A;  1SIF A;  1N60 A;  3P4P B;  1WRI A;  1XEE A;  4ZDV A;  2YVC A;  3A1Q B;  3TBL D;  1PGA A;  2W9N A;  3H8H A;  4BKS A;  1V8C A;  3DCG A;  4RNA A;  5BYR A;  2VZK B;  4B0M A;  2CU1 A;  1WJ4 A;  3A9K B;  3IHP C;  3UF8 A;  3ZQ4 A;  3ML8 A;  3ML9 A;  3N20 C;  2K8H A;  5FKA C;  1NYR A;  1EF1 A;  1VR9 A;  3QK0 A;  2KT7 A;  4NAW A;  5CHF A;  4WQM A;  2L0T A;  4DWF A;  1P0R A;  4BFR A;  2K6Q A;  4W9G A;  4DHJ D;  3TEZ A;  3A9J B;  4BOZ B;  4MGK E;  4PS3 A;  3RZW C;  2N7D A;  1V86 A;  3K9P B;  3Q3M C;  1ZXH A;  1V49 A;  1V1O A;  2H88 B;  1FNW A;  1WH3 A;  4XWT A;  3C8Y A;  3PZD A;  1L6V A;  5D3I B;  3KW5 B;  3HIZ A;  3MJ5 A;  2WXN A;  3L17 A;  1WR1 A;  1AAR A;  1JML A;  2J0M A;  3PZ7 A;  1K52 A;  2KTF A;  4PT5 A;  3SFD B;  2LEK A;  2PLP A;  1GG3 A;  3WAN A;  5C3J B;  1KOT A;  1WRD B;  1C79 A;  1D5M C;  2KFK B;  4G50 A;  4MGZ E;  4LDT B;  4FA6 A;  3KYD D;  3NHE B;  2WS3 B;  4REZ A;  2LJI A;  2LHE A;  5JH5 C;  5DCN A;  4HK2 A;  2N9L A;  3W5U B;  4P1B C;  1ZXI A;  3A33 B;  1P3Q U;  2M1M A;  2CS4 A;  2RPV A;  4OZC A;  4KIK A;  2MJD A;  3VDZ A;  2JU6 X;  1GPX A;  3H9D A;  3P4S B;  4LDT D;  1F2R C;  1MVK A;  2INP E;  3FIL A;  5E6O A;  4ZHO A;  2KO3 A;  3GE8 C;  3ZKJ C;  3OJ4 B;  1LO5 D;  4C80 A;  2PMV A;  2IY1 B;  2ZVN A;  4OVV A;  2KMC A;  3R7R A;  2LAS A;  1OQY A;  3GZN I;  4ANW A;  4KSL C;  3AH7 A;  1XCQ L;  1E8Z A;  1XT9 B;  5BYS A;  4CO7 A;  1SF0 A;  2MP2 A;  4YSY B;  2G4D B;  5EE0 A;  4GLS C;  4BAX A;  4B95 A;  3H6N A;  4IM2 A;  1TS2 A;  3R2T A;  1XLQ A;  2K3U A;  2BVC A;  2QIL A;  3VH4 B;  3OLM D;  4RGO S;  2JQR B;  1DYQ A;  4KIK B;  3UI3 A;  1FXI A;  2W54 A;  3D32 A;  3S2A A;  2RPQ A;  1C76 A;  2DZI A;  1KLG D;  3CSF A;  4TSS A;  1KJT A;  4FBJ B;  4B0E A;  5L95 C;  4BBN C;  3MC9 A;  3BVM A;  3H7P A;  1T0Q C;  3LXF A;  4G0N B;  3TMP B;  4ANX A;  3URY A;  4WQO B;  4LK0 M;  4A55 A;  5MPO A;  1XF5 L;  2I2Y A;  3AMZ A;  3RNF C;  1L4Z B;  2QIE B;  4RGT A;  2D3B A;  3U52 E;  3MJW A;  4BKT A;  1YN3 A;  3P2B A;  1VCB A;  4KGR A;  2KDE B;  4HWI B;  5G2N A;  4IUM B;  3IAS 1;  1Y8R C;  2XNA C;  5E6P A;  2V9H A;  1FCL A;  2QMT A;  4FAD A;  3Q3J A;  4MEM A;  1L0Y B;  1ENF A;  3APD A;  1V1P A;  4II3 B;  1UGJ A;  1UBI A;  1F0Z A;  2WXF A;  1KTK A;  1X1M A;  1YQ3 B;  2R61 A;  1YJJ A;  3QA8 A;  1L0X B;  3DBL I;  1UF0 A;  1QOA A;  3WAM A;  1PQS A;  4AS1 A;  2C7H A;  1Y56 A;  2IJ0 A;  3VHT C;  1WYW B;  3ZDM C;  4GMV A;  3ZW3 A;  2KJR A;  1R4N I;  3GOE A;  5BYQ A;  2REX A;  4DHZ E;  2FUH B;  2KWV B;  1P98 A;  3VRB B;  1EU4 A;  1XD3 B;  2N9K A;  3APC A;  4RCO A;  3VTW A;  3AU4 A;  3T8M A;  5BO4 B;  4MSM B;  3Q8F A;  4MAC A;  2KFJ A;  2JYE A;  5EE9 A;  4C4V B;  1D6E C;  3EFC A;  2J4X A;  2V4I B;  3R2I A;  1KFY B;  4WJN A;  2O2V B;  1FD6 A;  5T8I A;  2WX0 A;  3SFE B;  1T0S C;  1LM8 B;  3BVG A;  1TY0 A;  2L32 A;  3VH3 B;  2WXM A;  4KKJ A;  4LNK A;  4KZC A;  3VQI A;  1NYQ A;  2MRP A;  4YSX B;  3LB8 C;  4LTU A;  2ZCC A;  1UD7 A;  4C4V A;  2QCZ A;  5EE1 A;  1SB3 C;  2O2V A;  3AV8 A;  3EGR A;  4JPS A;  2R2Q A;  4YTN B;  2GBN A;  1EO6 A;  1QIL A;  2VZK D;  3L16 A;  4E74 A;  5HFY A;  3PLV A;  2EKI A;  5FR3 A;  1RAX A;  3E9S A;  1TS3 A;  2KXJ A;  4NJC A;  1F77 A;  2DLB A;  5IP4 D;  3ABV B;  2KTR A;  2KAN A;  1RYJ A;  5JXV A;  1WGR A;  1EWC A;  3AEA B;  4YXD B;  1VJK A;  3P4R B;  1I4X A;  2NBV B;  2L1A A;  2WGS A;  1D5X C;  3W2D A;  4KDL B;  3ZLZ A;  3Q3N C;  2L7R A;  3E56 A;  3I5J C;  3L13 A;  3BY4 B;  1D4B A;  1CQV A;  4FLH A;  2MA9 B;  1AW7 A;  3V05 A;  2EMT A;  2BS2 B;  2J53 A;  2WDQ B;  4PS7 A;  1KLU D;  4GB9 A;  4A90 A;  4W9E A;  2MCN B;  1WM2 A;  3PRZ A;  4ACF A;  3EFU A;  3PRM B;  2L76 A;  2MJE A;  4AP4 C;  3NY5 A;  5G5G A;  1HQR D;  2FCM A;  2DAJ A;  2ON8 A;  1WXS A;  1OQQ A;  3VUX A;  4C7Z A;  3RZF A;  4US8 A;  3NVZ A;  2JSV X;  1EF5 A;  1A70 A;  3BII D;  2GBM A;  4IWQ A;  3RUL A;  3ZVV A;  4XC2 A;  4LCD E;  2Z0D B;  2HTH A;  1JWU D;  1GC6 A;  4ANU A;  2GI9 A;  2WXH A;  1HTO A;  2LWP A;  4HKQ A;  2LGI A;  3OAW A;  3ETR A;  4W9J A;  1UWX A;  3ENE A;  3KUC B;  4KZ0 A;  3TUO A;  1J0G A;  3AI5 A;  2CKH B;  2I1K A;  1RWS A;  2GB1 A;  2KLC A;  4HPM B;  5CHV C;  3X0W A;  2MP2 B;  3NZU A;  1Q0W B;  1WE7 A;  2Q5W D;  2KDB A;  3RT3 B;  4TQ1 A;  1YMH E;  2XBB C;  4XYC A;  4GU2 A;  4NPN A;  2BQQ A;  1T0Y A;  2ZW0 A;  2KLG A;  4WUR A;  2IY0 B;  4GDK B;  1WXM A;  3UIO B;  4NJ7 A;  4IWO A;  4PS8 A;  2CHW A;  1ISN A;  2K0P A;  2D2Q A;  1MHX A;  1UNS A;  2NVU I;  3ZXV A;  4KGT A;  3AE3 B;  5JHB A;  1TT5 B;  4TUU A;  2KHW B;  3PSE B;  3NRZ A;  1XCT L;  1L7Y A;  2KWC A;  4YTM B;  2G45 B;  1WGG A;  2PIA A;  1VDV A;  2FE8 A;  3C19 A;  2J0K A;  1Z2M A;  1SSN A;  3WA0 A;  1JRO A;  2SAK A;  3WIM A;  4RMA A;  1R4M I;  4NQL B;  4J3O D;  1MPE A;  1QOF A;  4RGM A;  2XEW A;  2JVC A;  2B76 B;  1TTN A;  3RNB C;  2RSU A;  1ZKH A;  1PGB A;  5IOI A;  2AL3 A;  3N1X C;  4FHK A;  1WXA A;  4L1B A;  1TS4 A;  3JSV A;  2FCN A;  1HTQ A;  3AE4 B;  3ZYY X;  1MG8 A;  2IND C;  2FUG 1;  3DDC B;  4CYE A;  2KDF B;  4K3C A;  2ZEQ A;  1JWA D;  2QSD A;  3AE7 B;  3TEY A;  1YN4 A;  3R66 C;  3WCQ A;  5G55 A;  3KVF B;  2PTL A;  4AWJ A;  1CK1 A;  1I42 A;  2CJO A;  2D10 A;  1YQ4 B;  2MJ3 A;  1TBE A;  1F1H A;  4JIO U;  4NQK E;  3AED B;  2BBC A;  3PTF C;  3V6C B;  4AQ7 A;  2KC2 A;  1WIA A;  4HDQ A;  1YD8 U;  1N62 A;  1SGH A;  1XQQ A;  3W5V B;  1FO4 A;  2N1V A;  3O65 B;  1WJ6 A;  4DXG A;  4NNJ B;  1GNU A;  4BKG A;  2FNJ B;  1YNT E;  4MH8 A;  2ZPN A;  2TSS A;  4K7S A;  3R8B A;  1BML C;  2JYT A;  4LNO A;  4M00 A;  3DBS A;  2DEN B;  3KH0 A;  3PZ8 A;  3MHZ A;  1KM7 A;  4HEA 1;  3GS2 A;  1G6J A;  1V80 A;  2GOW A;  2M56 B;  4F7Z A;  3N30 A;  2OJR A;  2ZPY A;  1WXQ A;  3AEE B;  3M3J A;  4XGA B;  1Z5S B;  2E6X A;  3QJZ A; 
#chains in the Genus database with same CATH homology
 2V9H A;  2VH2 A;  2QDF A;  3MC9 A;  4PK1 A;  4K3C A;  3NJT A;  2MHJ A;  2VH1 A;  2X8X X;  4C4V A;  4C00 A;  2QCZ A;  4C4V B;  4BZA A;  3MC8 A;  4K3B A;  3EFC A;  3Q6B A;  3OG5 A;  4XGA B;  4QAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...