3MCBB

Crystal structure of nac domains of human nascent polypeptide-associated complex (nac)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
VNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nascent polypeptide-associated complex subunit alpha
publication title Crystal structures of NAC domains of human nascent polypeptide-associated complex (NAC) and its alphaNAC subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3mcbB00
3MCBB 3LKXA 3LKXB 3MCBA 1TR8A
chains in the Genus database with same CATH superfamily
2Q5AA 5E65A 2Y8NB 1RP5A 1O6WA 4E5RA 3KAGA 5CQ2A 2M8JA 2M8IA 4QIBA 1EG3A 2ITKA 3KABA 3MQHA 2YSHA 3FSCA 1PINA 1K9QA 4GLXA 5U47A 4U84A 2XPBA 3KADA 3KAHA 2XP3A 2YSFA 2ZQUA 2RE3A 2DJYA 5E64A 1TR8A 3KAIA 1WMVA 2ZR5A 2M3OW 2XP8A 1TK7A 2ZAJA 2XP9A 4REXA 2JV4A 3TC5A 1EG4A 4A0TA 1FLCA 3LKXB 3M7NA 2JXWA 2BA1A 3FSBA 3MQGA 3LKXA 3NTPA 3CNGA 2XP5A 1YW5A 3LE4A 2MDIA 4A0UA 3MCBB 2YSBA 1NMVA 1WR7A 2ZR6A 3TCZA 2WADA 3MCBA 2WAEA 4U86A 5E66A 3WH0A 3OOBA 2L4JA 2QRVA 1F8AB 2YAJB 3M85A 3KAFA 2EZ5W 2ZR4A 2DK1A 2ZQTA 3KCEA 2KXQA 2F21A 2DK7A 4U85A 3TDBA 3L4HA 2OWOA 2ZQVA 5E5WA 3FS8A 2LAJA 2E45A 2JMFA 2XPAA 2XP7A 2XP6A 2XP4A 2YSIA 2DWVA 2JX8A 1I5HW 3ODKA 5E62A 1JMQA 2DMVA 3PQHA 1K9RA 2YSGA 1ZCNA 2ZQSA 5AHTA
chains in the Genus database with same CATH topology
2Q5AA 5E65A 2Y8NB 1RP5A 1O6WA 4E5RA 3KAGA 5CQ2A 2M8JA 2M8IA 4QIBA 1EG3A 2ITKA 3KABA 3MQHA 2YSHA 3FSCA 1PINA 1K9QA 4GLXA 5U47A 4U84A 2XPBA 3KADA 3KAHA 2XP3A 2YSFA 2ZQUA 2RE3A 2DJYA 5E64A 1TR8A 3KAIA 1WMVA 2ZR5A 2M3OW 2XP8A 1TK7A 2ZAJA 2XP9A 4REXA 2JV4A 3TC5A 1EG4A 4A0TA 1FLCA 3LKXB 3M7NA 2JXWA 2BA1A 3FSBA 3MQGA 3LKXA 3NTPA 3CNGA 2XP5A 1YW5A 3LE4A 2MDIA 4A0UA 3MCBB 2YSBA 1NMVA 1WR7A 2ZR6A 3TCZA 2WADA 3MCBA 2WAEA 4U86A 5E66A 3WH0A 3OOBA 2L4JA 2QRVA 1F8AB 2YAJB 3M85A 3KAFA 2EZ5W 2ZR4A 2DK1A 2ZQTA 3KCEA 2KXQA 2F21A 2DK7A 4U85A 3TDBA 3L4HA 2OWOA 2ZQVA 5E5WA 3FS8A 2LAJA 2E45A 2JMFA 2XPAA 2XP7A 2XP6A 2XP4A 2YSIA 2DWVA 2JX8A 1I5HW 3ODKA 5E62A 1JMQA 2DMVA 3PQHA 1K9RA 2YSGA 1ZCNA 2ZQSA 5AHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCB B;  3LKX A;  3LKX B;  3MCB A;  1TR8 A; 
#chains in the Genus database with same CATH topology
 2Q5A A;  5E65 A;  2Y8N B;  1RP5 A;  1O6W A;  4E5R A;  3KAG A;  5CQ2 A;  2M8J A;  2M8I A;  4QIB A;  1EG3 A;  2ITK A;  3KAB A;  3MQH A;  2YSH A;  3FSC A;  1PIN A;  1K9Q A;  4GLX A;  5U47 A;  4U84 A;  2XPB A;  3KAD A;  3KAH A;  2XP3 A;  2YSF A;  2ZQU A;  2RE3 A;  2DJY A;  5E64 A;  1TR8 A;  3KAI A;  1WMV A;  2ZR5 A;  2M3O W;  2XP8 A;  1TK7 A;  2ZAJ A;  2XP9 A;  4REX A;  2JV4 A;  3TC5 A;  1EG4 A;  4A0T A;  1FLC A;  3LKX B;  3M7N A;  2JXW A;  2BA1 A;  3FSB A;  3MQG A;  3LKX A;  3NTP A;  3CNG A;  2XP5 A;  1YW5 A;  3LE4 A;  2MDI A;  4A0U A;  3MCB B;  2YSB A;  1NMV A;  1WR7 A;  2ZR6 A;  3TCZ A;  2WAD A;  3MCB A;  2WAE A;  4U86 A;  5E66 A;  3WH0 A;  3OOB A;  2L4J A;  2QRV A;  1F8A B;  2YAJ B;  3M85 A;  3KAF A;  2EZ5 W;  2ZR4 A;  2DK1 A;  2ZQT A;  3KCE A;  2KXQ A;  2F21 A;  2DK7 A;  4U85 A;  3TDB A;  3L4H A;  2OWO A;  2ZQV A;  5E5W A;  3FS8 A;  2LAJ A;  2E45 A;  2JMF A;  2XPA A;  2XP7 A;  2XP6 A;  2XP4 A;  2YSI A;  2DWV A;  2JX8 A;  1I5H W;  3ODK A;  5E62 A;  1JMQ A;  2DMV A;  3PQH A;  1K9R A;  2YSG A;  1ZCN A;  2ZQS A;  5AHT A; 
#chains in the Genus database with same CATH homology
 2Q5A A;  5E65 A;  2Y8N B;  1RP5 A;  1O6W A;  4E5R A;  3KAG A;  5CQ2 A;  2M8J A;  2M8I A;  4QIB A;  1EG3 A;  2ITK A;  3KAB A;  3MQH A;  2YSH A;  3FSC A;  1PIN A;  1K9Q A;  4GLX A;  5U47 A;  4U84 A;  2XPB A;  3KAD A;  3KAH A;  2XP3 A;  2YSF A;  2ZQU A;  2RE3 A;  2DJY A;  5E64 A;  1TR8 A;  3KAI A;  1WMV A;  2ZR5 A;  2M3O W;  2XP8 A;  1TK7 A;  2ZAJ A;  2XP9 A;  4REX A;  2JV4 A;  3TC5 A;  1EG4 A;  4A0T A;  1FLC A;  3LKX B;  3M7N A;  2JXW A;  2BA1 A;  3FSB A;  3MQG A;  3LKX A;  3NTP A;  3CNG A;  2XP5 A;  1YW5 A;  3LE4 A;  2MDI A;  4A0U A;  3MCB B;  2YSB A;  1NMV A;  1WR7 A;  2ZR6 A;  3TCZ A;  2WAD A;  3MCB A;  2WAE A;  4U86 A;  5E66 A;  3WH0 A;  3OOB A;  2L4J A;  2QRV A;  1F8A B;  2YAJ B;  3M85 A;  3KAF A;  2EZ5 W;  2ZR4 A;  2DK1 A;  2ZQT A;  3KCE A;  2KXQ A;  2F21 A;  2DK7 A;  4U85 A;  3TDB A;  3L4H A;  2OWO A;  2ZQV A;  5E5W A;  3FS8 A;  2LAJ A;  2E45 A;  2JMF A;  2XPA A;  2XP7 A;  2XP6 A;  2XP4 A;  2YSI A;  2DWV A;  2JX8 A;  1I5H W;  3ODK A;  5E62 A;  1JMQ A;  2DMV A;  3PQH A;  1K9R A;  2YSG A;  1ZCN A;  2ZQS A;  5AHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...