3MCBB

Crystal structure of nac domains of human nascent polypeptide-associated complex (nac)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
58
structure length
58
Chain Sequence
b'VNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nascent polypeptide-associated complex subunit alpha
publication title Crystal structures of NAC domains of human nascent polypeptide-associated complex (NAC) and its alphaNAC subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 11
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.30 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3mcbB00
1TR8A 3MCBA 3LKXB 3LKXA 3MCBB
chains in the Genus database with same CATH superfamily
5U47A 2DK1A 2YSGA 2M8JA 1ZCNA 4E5RA 3KAHA 1NMVA 2QRVA 3LKXA 4U85A 3FSBA 2ZQUA 2ZQTA 3KAIA 2OWOA 2XPBA 3MQHA 2XP9A 3TC5A 2XP6A 3LE4A 2DJYA 3M7NA 1EG4A 1WMVA 4GLXA 2M3OW 2LAJA 1O6WA 2WADA 2XPAA 2YSIA 1FLCA 2ZQVA 5E66A 5E65A 2ZR4A 3TCZA 2DWVA 2XP7A 3FS8A 2JMFA 5AHTA 4A0UA 2YSFA 2Q5AA 5E62A 3TDBA 3MQGA 2XP5A 3KABA 3ODKA 4A0TA 5E5WA 2RE3A 2ITKA 1K9RA 5E64A 2M8IA 3LKXB 2MDIA 3FSCA 2E45A 2EZ5W 5CQ2A 1EG3A 1TK7A 3KCEA 2YAJB 1RP5A 3KAGA 2JV4A 2DK7A 2ZQSA 4QIBA 1K9QA 2YSHA 4U84A 2WAEA 2YSBA 2ZR6A 1JMQA 1F8AB 2XP3A 2BA1A 3M85A 2XP4A 2L4JA 2XP8A 2JX8A 2KXQA 2F21A 2ZAJA 3L4HA 2Y8NB 3WH0A 1I5HW 4U86A 2JXWA 3PQHA 1WR7A 3KADA 3KAFA 1TR8A 3MCBA 1YW5A 3NTPA 3OOBA 2DMVA 3CNGA 1PINA 2ZR5A 4REXA 3MCBB
chains in the Genus database with same CATH topology
5U47A 2DK1A 2YSGA 2M8JA 1ZCNA 4E5RA 3KAHA 1NMVA 2QRVA 3LKXA 4U85A 3FSBA 2ZQUA 2ZQTA 3KAIA 2OWOA 2XPBA 3MQHA 2XP9A 3TC5A 2XP6A 3LE4A 2DJYA 3M7NA 1EG4A 1WMVA 4GLXA 2M3OW 2LAJA 1O6WA 2WADA 2XPAA 2YSIA 1FLCA 2ZQVA 5E66A 5E65A 2ZR4A 3TCZA 2DWVA 2XP7A 3FS8A 2JMFA 5AHTA 4A0UA 2YSFA 2Q5AA 5E62A 3TDBA 3MQGA 2XP5A 3KABA 3ODKA 4A0TA 5E5WA 2RE3A 2ITKA 1K9RA 5E64A 2M8IA 3LKXB 2MDIA 3FSCA 2E45A 2EZ5W 5CQ2A 1EG3A 1TK7A 3KCEA 2YAJB 1RP5A 3KAGA 2JV4A 2DK7A 2ZQSA 4QIBA 1K9QA 2YSHA 4U84A 2WAEA 2YSBA 2ZR6A 1JMQA 1F8AB 2XP3A 2BA1A 3M85A 2XP4A 2L4JA 2XP8A 2JX8A 2KXQA 2F21A 2ZAJA 3L4HA 2Y8NB 3WH0A 1I5HW 4U86A 2JXWA 3PQHA 1WR7A 3KADA 3KAFA 1TR8A 3MCBA 1YW5A 3NTPA 3OOBA 2DMVA 3CNGA 1PINA 2ZR5A 4REXA 3MCBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR8 A;  3MCB A;  3LKX B;  3LKX A;  3MCB B; 
#chains in the Genus database with same CATH topology
 5U47 A;  2DK1 A;  2YSG A;  2M8J A;  1ZCN A;  4E5R A;  3KAH A;  1NMV A;  2QRV A;  3LKX A;  4U85 A;  3FSB A;  2ZQU A;  2ZQT A;  3KAI A;  2OWO A;  2XPB A;  3MQH A;  2XP9 A;  3TC5 A;  2XP6 A;  3LE4 A;  2DJY A;  3M7N A;  1EG4 A;  1WMV A;  4GLX A;  2M3O W;  2LAJ A;  1O6W A;  2WAD A;  2XPA A;  2YSI A;  1FLC A;  2ZQV A;  5E66 A;  5E65 A;  2ZR4 A;  3TCZ A;  2DWV A;  2XP7 A;  3FS8 A;  2JMF A;  5AHT A;  4A0U A;  2YSF A;  2Q5A A;  5E62 A;  3TDB A;  3MQG A;  2XP5 A;  3KAB A;  3ODK A;  4A0T A;  5E5W A;  2RE3 A;  2ITK A;  1K9R A;  5E64 A;  2M8I A;  3LKX B;  2MDI A;  3FSC A;  2E45 A;  2EZ5 W;  5CQ2 A;  1EG3 A;  1TK7 A;  3KCE A;  2YAJ B;  1RP5 A;  3KAG A;  2JV4 A;  2DK7 A;  2ZQS A;  4QIB A;  1K9Q A;  2YSH A;  4U84 A;  2WAE A;  2YSB A;  2ZR6 A;  1JMQ A;  1F8A B;  2XP3 A;  2BA1 A;  3M85 A;  2XP4 A;  2L4J A;  2XP8 A;  2JX8 A;  2KXQ A;  2F21 A;  2ZAJ A;  3L4H A;  2Y8N B;  3WH0 A;  1I5H W;  4U86 A;  2JXW A;  3PQH A;  1WR7 A;  3KAD A;  3KAF A;  1TR8 A;  3MCB A;  1YW5 A;  3NTP A;  3OOB A;  2DMV A;  3CNG A;  1PIN A;  2ZR5 A;  4REX A;  3MCB B; 
#chains in the Genus database with same CATH homology
 5U47 A;  2DK1 A;  2YSG A;  2M8J A;  1ZCN A;  4E5R A;  3KAH A;  1NMV A;  2QRV A;  3LKX A;  4U85 A;  3FSB A;  2ZQU A;  2ZQT A;  3KAI A;  2OWO A;  2XPB A;  3MQH A;  2XP9 A;  3TC5 A;  2XP6 A;  3LE4 A;  2DJY A;  3M7N A;  1EG4 A;  1WMV A;  4GLX A;  2M3O W;  2LAJ A;  1O6W A;  2WAD A;  2XPA A;  2YSI A;  1FLC A;  2ZQV A;  5E66 A;  5E65 A;  2ZR4 A;  3TCZ A;  2DWV A;  2XP7 A;  3FS8 A;  2JMF A;  5AHT A;  4A0U A;  2YSF A;  2Q5A A;  5E62 A;  3TDB A;  3MQG A;  2XP5 A;  3KAB A;  3ODK A;  4A0T A;  5E5W A;  2RE3 A;  2ITK A;  1K9R A;  5E64 A;  2M8I A;  3LKX B;  2MDI A;  3FSC A;  2E45 A;  2EZ5 W;  5CQ2 A;  1EG3 A;  1TK7 A;  3KCE A;  2YAJ B;  1RP5 A;  3KAG A;  2JV4 A;  2DK7 A;  2ZQS A;  4QIB A;  1K9Q A;  2YSH A;  4U84 A;  2WAE A;  2YSB A;  2ZR6 A;  1JMQ A;  1F8A B;  2XP3 A;  2BA1 A;  3M85 A;  2XP4 A;  2L4J A;  2XP8 A;  2JX8 A;  2KXQ A;  2F21 A;  2ZAJ A;  3L4H A;  2Y8N B;  3WH0 A;  1I5H W;  4U86 A;  2JXW A;  3PQH A;  1WR7 A;  3KAD A;  3KAF A;  1TR8 A;  3MCB A;  1YW5 A;  3NTP A;  3OOB A;  2DMV A;  3CNG A;  1PIN A;  2ZR5 A;  4REX A;  3MCB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...