3MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 34
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg102
4QTIH 5D1ZA 1CLZL 4F58H 5IHZA 5EZOH 4GKSB 1HEZB 3H3BC 4G6MH 3AAZA 3N85H 5GS0C 3C5ZA 1KV3A 3EJYC 2R69L 2IPTL 3AY4A 1KLFA 3QFJB 3GJFA 4BFIA 3CLEH 3WN5A 3O3BB 2X42A 1JGVH 2PXYA 3VXME 5D6DA 2Y36L 4J1UA 5D6CA 1OGAD 1FG9C 2BSTB 5DEGA 1CGYA 3CPLA 4NRXA 3ARRA 4RGOL 5ELIA 3QZWB 2YEZB 3LIZL 4S1SL 4JRWA 2X70A 3PE9A 1EA9C 2DQCL 2DDQH 1VFUA 5FGCE 1EEYB 5BV7C 4NKOB 4BZ1L 2MQ3A 2R2EB 4NQUA 2XTJC 4PLNC 5KW9H 1U8QA 25C8L 4ZXBB 1MCSA 2A6KA 2Y5EA 4M62H 4AZ8A 1FL5B 1U3HD 5HYJE 4APQB 2NMSA 2VN4A 3KDMA 4QY8B 1FYTD 4MAYA 2VLRE 2Z93B 2VC2H 1JHKL 2YPVL 3L3KB 3FFDA 4XXDA 4JAMA 5JXEC 1WQVT 4OZHE 2XPGB 4OCRH 4W4NA 2D4FA 3ETBF 5IF0B 1M7XA 2F5BL 1MH5A 3TIEA 5JNYB 2OZ4A 5DURD 2V9TA 3DBXA 1EMTH 5T5NG 3W39A 2PCPB 3QCVH 3U82B 2A9ML 2HWZH 3QEHA 4R3SA 2DQHL 1J05B 5KVGH 2EDLA 3PWPB 1UXWA 5GGSA 3ALWA 2LVEA 2Z4QA 4J12A 5C0EB 35C8L 2CRYA 3FOMA 4GT7A 4YHKH 4EI5B 5HI5C 3U0TA 3BUTA 4O58L 1H3VA 2DWDB 3F58H 1EVTC 3KPRE 2YD6A 4K71B 4QOKD 5JXAL 1XGPB 5KBNC 2J12B 2Q8BL 1S9YB 4X4XB 4P23B 1UWEH 3QIWC 5JQHC 1Z9SA 4V1DA 1LILA 4ZTPL 2FB4L 3BP7A 4U0QB 1UJTA 5HDBE 4WFHD 5DQJA 1XR9A 3ZKXB 3PJSB 1DLFL 1P4BL 2HMID 5M95B 5GGSY 2FX9L 3QPXH 1HI6A 1SEBA 4PJEB 4GW5A 3AU1B 4L4TB 1QRNB 1L0XA 2J6EL 4X6DF 1Y6MR 3I3DA 3NIFE 1RURH 2XN9E 4HUNB 3L3JA 5BO1L 3QPQD 3G6AA 5KJRL 3HI6L 4ODSL 1HQ4A 3RNKB 2QQNH 4RSVA 3BGFB 3QUZA 3HNSL 2OMNA 1PEWA 4OIIL 3SJVD 1X5AA 2YC1B 2E8ZA 4YDLB 4X6EA 4PLJD 3D9AL 2BVEA 3Q3GB 3PGCA 1QP1A 5E03A 4MHHI 4NM4L 4ODVH 5SV3A 3IVKB 3HAEH 4RGNC 1EHLL 4ZODA 1IM9B 4NPYB 2MKLC 4ZG1A 2X4NB 3FT4B 2C1PA 4QRPD 5EOQL 3TO2B 1HNFA 4XBPA 3LEXB 3QH3A 4PGEA 3TJHC 1JNJA 5F6HJ 3GRWH 4ONGH 2OTWA 4JHWL 3C6SB 3UTTE 1HSAB 3HE6C 3HZYB 1NCAL 1B0GA 2IEPA 2K9UA 4FQ1L 2H6PA 2AJVH 1U8LA 2X89A 1A9BB 4TNWF 5ISZE 1QQDB 3DMMA 4NSKB 3REVA 3ZKSD 3OKLA 3O6ML 2C3VB 2F15A 4OSUH 5HYSG 3KS0H 3M17B 4DTGH 3P3YA 5BRZD 5EUOA 3QHZH 1HHGB 4W70A 3Q2CA 4LLMA 2VLJD 3VXSD 3B9KC 4RNRA 1R3LA 1SJXA 3HKFA 1MFEL 2JJSC 4ZMAT 1JZ2A 1R3HB 3FAXA 3GJFH 1BZ9A 4NUGL 4XCEA 2CLRA 4K94C 2R29L 5J1AA 3NPSC 5T3XL 3I3EA 5H35B 2EDXA 2XWTA 4NZTH 4M6ML 4BSVB 1JF1B 1RK0A 3KPSA 5FYKU 3UPCA 1ZLSH 1EBPA 4R9HA 3PHQA 4K07A 4FTVD 4LDEB 3RU8H 2CUHA 3NMEA 4HKZB 2XXMB 4PG2C 5GZNC 2F19H 3TN0B 5FOBB 3BIKB 5JTWA 1JBJA 4IRJC 3DX8B 5IW6A 1MRFL 1WIUA 4YH6A 4O5LH 5D2LB 3DO3A 2NY3B 4HKBB 2VYRE 4LSDA 2CDGA 5K33A 5C9KA 4KXZH 5IBUG 5FM8A 1FO0A 2BNQD 4C56A 2YPKA 5IB5A 4FQIH 3SDXE 4D9QD 3ARFA 3GSNH 4KY1L 4I8DA 3T4AB 3CZJA 3UYPA 3TBVA 1KJ3H 4LVHB 4OM0H 2D03H 4YFLI 2SEBB 3EYOB 1CGXA 1RZJL 4I3SL 2H26B 3QXUA 5F9AC 3N1QC 5I1LA 3E3QC 4TUJB 4EUPB 2D7TH 2ADJB 1XH3A 4GRLB 3UO1L 4FQCL 4JJ5A 5FDWB 5IB3B 2I07B 3B5HA 1NMBL 3G6DL 4KVNL 2OZ4H 3MPCA 3RVVD 4MWFB 4J3TA 4P2OB 4OUUB 4QCIA 4RZCA 3LEYH 5C0BD 4G9FD 2IWGA 1KG0B 2W07A 4G8GB 3D3VA 3MGOA 5IQ9B 1ZHKB 1YECH 3QIUB 2OXGA 1UWXK 4P2YA 2FWOB 1DN0A 1W0YT 3FMGL 3FTGA 1DBKL 2VZVA 3QDMD 2DBLH 3VXUD 3TBWA 3WIFB 3S3JA 5KAQG 4GRWH 3WUWA 4G6AD 3RKPA 2JELL 5TH2A 2WUCL 2Q6WB 1RZKL 2IAMA 4LSQL 3GSQB 5SWZE 1UM5H 3ZKND 5I76B 4LLYA 3TNNB 1QLEH 3V0AC 4MYWB 3ULSB 1AE6L 4GBXC 5GRUL 2R8SL 1MJUH 3ECBB 2P5EE 1G9MH 2FYYB 5E9DE 3KPNB 4OCYH 3CFEA 5BV7B 2NYYD 4NC0B 4OZGA 4QTIL 5E56A 4F58L 3KPQA 5EZOL 4PPTA 3SHSA 1A22B 2NY2C 2WM0A 2AXHA 3FN0H 4G6ML 3MRNA 3N85L 5DFWH 3BMWA 5ALCH 4POZD 1GXEA 5F3BA 1IC1A 4MSWA 4PP1D 4KI5D 2GK0B 4KGLA 2XQYK 4IJ3C 3CLEL 3V5HA 5CKGA 3RL1A 1JGVL 4BH7A 1J8KA 3C60D 3FOLB 2BX5A 3WO4B 3QIBD 4ZQKB 1JZ8A 5GSRA 4ELMB 3CCHB 4XRCA 3C5SA 4G43B 5IB4A 2IANE 4KZEH 1IAKA 3K81A 2DDQL 5C07B 1Z5LA 3VXNB 1PJ9A 4HS6A 5E1HB 3CFBB 3TLRA 1Q8MA 4E5XB 1G7IB 4X98A 3B83A 4M62L 1UB6B 1R6VA 2J8UF 3LKQB 3IDMA 1AKJA 2J3SA 3HC3H 5I6XB 2GJ6E 4UTAH 4LKXA 4NO0A 5D7JB 1QR1A 2VC2L 4YZFE 1P6FA 5DQ9B 4P2RE 3UPRB 5DZNA 4L3ED 4KRPC 4L5FH 2PW2A 3N1GC 3IDYB 1KN2H 4GUPA 4OCRL 4NFCA 1C1EH 4HHAA 2DYPA 4S1QH 3DWTA 5HHOB 2AK4D 2RB8A 4GOSA 5IJKC 2MWCA 4W4OA 1EMTL 1CTNA 3QCVL 2Z8RA 3WE6A 3S9DB 1OLLA 2DKMA 1G0DA 4UILH 1AQKH 2HWZL 4OFIA 2LTQB 5KVGL 3QEQB 1KJMA 3TA3B 4BELD 3R0MA 1SM3H 4RMTA 4E41A 4PJAF 3NN8A 4YHKL 2BCKA 2APXA 4JGJA 3F58L 4M43H 2M8XA 1RMFH 4PRIA 3AS3A 4QTHA 2ZSWB 3RHWK 3OR7B 1V05A 5FYJD 3DVNB 1JNNH 1K3IA 1WWBX 3LQZB 1YNTA 4X8JB 3Q6GH 1UWEL 4NQXB 3RWJA 3CVIH 3FQRB 4LU5H 3MRCB 4W6XB 2ZKHH 1CICB 3QDJE 4Z7VE 1HH6A 3FT3A 1FO0H 1FRGH 1Q0YH 5CP3A 3CSBA 2BOBB 1A6TB 3U48A 1D6EA 2A6IA 3MOQA 5DHYA 1QSEE 3QPXL 5J1SC 1FZJB 3TT3H 1D7FA 4IMLB 3GDBA 4OI9A 3L6FB 1RURL 4GG6E 4DN4H 3WNOA 4IRZH 3U36A 3WFZA 3OHXB 1VGEH 3QUXD 4XTRD 4FQLH 4UNVA 1FNEA 5J11B 1P1ZB 3QDGE 2QQNL 5CEXB 4P46D 3K46A 4F7MB 1VCAA 3DSNA 4CBPA 4UQ3A 4MJIE 3ULUD 2W60A 3CFCL 3LEVH 2AK1H 2EIDA 3OKMB 5D5MA 4ENED 5ILTH 1WIOA 4WO4A 3S34H 4M3JA 3RWGA 3FFCE 3KJ6H 1IEBB 4GO6B 1VFOA 1F3DJ 4ODVL 1OP3H 3O4OB 1EAJA 2HJKB 1HHKA 2DLTA 4H25A 2ATKA 2WINB 2AI0H 2VDKH 3GRWL 4ONGL 4HWUA 5DD1H 3ISWA 2X4TA 4P5TB 1N3NB 1RD6A 1O7SA 1KTDA 1L6XA 4MD0A 4UIMA 2AJVL 2BMKA 1FVCB 4JFHD 3S5LB 4LKCA 4N0RA 4OSUL 3OAYK 4DTGL 4QRRD 2GTWA 3PQYE 3QHZL 4I2XB 3MFGB 1DEEB 5EO0A 1D9KC 4Q9QH 4D8PA 4WWKB 1RQ5A 4JFOB 4BK5A 4C58B 3LN5A 1S7SB 2VKWA 5FV2A 3SDCC 1XGRA 2ZOKA 4IRSB 4L8SC 3KPLB 1G7JB 5LCVH 5EN2B 3GI8H 1M6OA 2AP2A 4CVZA 4YHNB 2VLMD 4EZMA 4MA1C 5JQ6H 1I4FB 2NTSP 4Y5XC 2YD8A 4EI6A 1XT5A 4NZTL 2AGJH 5GSVA 4PJFE 2AXFB 3DX7B 4JN1H 1ZLSL 3WDIA 1H0DA 5E8OB 2HG5B 1PKQB 3RU8L 3VFVB 5IW1B 4F7PB 2GUOB 2VL5A 4XP9H 1S7WA 2F19L 3L7FB 4JJHA 1U93A 2VZTA 3VXOB 3FB7A 4WFEE 1K85A 5JPMB 4O5LL 2E27H 3FO9B 5HXMA 4PRHA 3SE3C 4WDIB 3MV8D 2IMMA 2D9CA 5I16B 1FGNH 5C08B 4FQIL 1R5WB 2I26N 2JCCE 2ADGB 3KYNA 4QHLB 3GSNL 3RUGA 4LIQH 2GHWB 1KJ3L 4H8WH 3FT2B 4OM0L 2D03L 4J2XA 4K7FB 3BZDA 5HI4C 1YJDH 3M1BB 1YYLH 3B5GA 2CK0H 2O61B 5DQDH 4MMZC 3AS0A 2D7TL 2OI9B 1SYVB 3CVHB 4I3GA 3AMLA 1R3KA 1BFOB 3WFHB 2XYCA 2OZ4L 3CU7A 4NUJB 1HWGB 2R2HA 3EO9H 4KKAC 1EHAA 2CLVA 4BKLA 3WV0A 5IMLA 4XWGH 2EEDA 1I7ZA 4Y4HA 4JVWA 3LEYL 4KH2A 5IB1A 4U3HA 1BD2B 5FO9A 4EVNA 4G8FB 2H45A 5DJDA 4K23H 3EZ8A 1YECL 4LQ1A 4P3DB 4GSDH 2JIXB 2DBLL 3MUZ1 1Q9WA 5E2WH 2BXYA 3UTSB 2O26U 4LFHG 1UM5L 1E6OH 1SJVA 4NNPH 1QLEL 1YPZA 4NNYB 1FZOA 5EPMA 2OJEB 3IU3B 4WEBH 3MLVH 4K7PH 1MJUL 5A2LH 1AI1H 4O51B 1IGJA 3T09A 5H2BA 5LGJA 2KZ1B 1G9ML 3DUSB 4LEOB 4LP5A 4C4KO 4KJQD 2MTPA 4NC1E 4OCYL 1MWAB 3T1FB 1VADA 5F89A 5KSAA 1FFPB 5HHMB 2HKHH 3GSVB 5CP3H 1QSFB 4PJ8D 5I75B 4BFEA 4W6YB 3GMMA 3FN0L 3F6IA 1AH1A 2XKSA 5ALCL 3VD9A 4UDTB 3EUUA 4JFHE 2FJHB 3B5TA 3ESVF 5DFTA 5IROC 2R1WB 5L2KE 1JF5A 1NJ9B 1JGDB 4JM2F 3OB8A 1NSNL 4YWGH 2MJWA 3KXFD 2BY1A 3VFSB 5F88A 3ARBD 4H1LB 5CSZA 5IFJA 1BWMA 2NPLX 3QA3B 4NQDB 5B38G 3C87A 1TPXB 4MJ5B 5TDNA 2VLKD 4PGJA 2VLME 4PJ7B 4CUCA 5HY9B 4KZEL 1KULA 4WTZG 4NKMA 2X4QA 2PYED 1MCCA 1PYWA 2O5YH 5GPRA 1T5XB 2BC4B 1L6ZA 4HS3B 4L8DB 2OTUB 3AM8C 3GFUA 4MQXD 4K3DH 4NZRH 1BIIB 1HYSD 1WEJH 4LNVA 4ZUWB 4GKSA 3HC3L 4KKLC 4U1MB 1GZQB 2CD0A 1HEZA 4UTAL 3ARPA 1HSBB 1QBAA 3ZT7A 1JTOA 1ZT7B 5GS1C 4PV8B 1F13A 4L5FL 3GKWH 3V6OE 3QFJA 5DI8B 1KN2L 1I3UA 2AXGB 3MLYH 1C1EL 4S1QL 3T0EE 3THMH 3O3BA 3NCYP 1JFQH 4C55A 3W9EB 2NX5B 2E9WA 2BSTA 4I0CC 2ICWI 3TPKA 1A7NH 3BQUD 4XVTH 4UUJB 3QZWA 5SWSD 2D7PA 2YEZA 1AQKL 4UILL 4KKCD 4EJ1C 3O4LE 3OXRB 1U8OA 4ZUSB 1XGQB 4ZYKB 1SM3L 5KZCD 1EEYA 4NKOA 3JVGA 2R2EA 1N26A 3C5JB 2DTSA 3OJMB 4M43L 1NFDF 1E4JA 4ZXBA 4WTWA 4KJYB 1MI5E 1RMFL 1FL5A 3BDYH 4WI7A 5ESVB 4APQA 2J8UB 1JNNL 4QY8A 5ICZB 4LMQE 4Z5RB 2Z93A 3L3KA 3Q6GL 3QUKB 4FABH 4I48B 4BQ6A 5HVWA 3CVIL 1BOYA 3OKOB 4LU5L 5T5NF 2ZKHL 2XPGA 1FO0L 1FRGL 1Q0YL 4NO3B 4ONHB 2BZDA 5IF0A 1ZLUH 3GMLB 4YLQT 2A73B 5J1TC 3RZCB 1SMAA 4HXBH 2CR6A 3TT3L 1I8IB 1W2KT 3TM6A 1S78D 2PCPA 2ESVD 3WHXB 4DN4L 4IRZL 1VGEL 4ZUUB 4D0CB 1J05A 4FQLL 4X7FC 2HVJB 1WFTA 3PWPA 4IDLA 1MQ8A 5DMKB 3D2UD 3IRPX 5C0EA 3F62A 3VD5A 3LEVL 1X7QB 2AK1L 4EI5A 3K8KA 3MGAA 4URTB 3Q5YA 3OAZH 2DWDA 5ILTL 2E7HA 3S34L 4X7CC 3KJ6L 4UOJA 2ERJB 1XGPA 3SO3B 4HFWB 3EGSB 1L0QA 1IKNC 3U83A 1S9YA 4X4XA 2NQCA 2V5RA 3MLUH 4P23A 3W0WB 3MV9E 3NPZB 3HAEG 3MUJA 2AI0L 2VDKL 1QSZA 3O0RH 5DD1L 3PJSA 4OZHF 4X99B 3T2PA 2J5LB 4JHZA 1JRHH 3AROA 4NO2B 4PJEA 3AU1A 4L4TA 1T7WA 1QRNA 1X6NA 2I27N 4XHJD 4Y2DC 4NN6C 3NABH 1QFWM 5KTEH 4ODTH 4XPFH 5MI0B 4S1RH 3ARFC 3BKJH 1NC2A 1CU4H 1ZHBB 3RNKA 4Q9QL 2VQTA 3EHBC 1II4E 2YXMA 5LBSH 3G5VB 1WZ1H 3O9WB 3VWKC 1ZV5A 4RFNB 2YC1A 4UBDD 5LCVL 4F15C 3GI8L 4LASH 2F54B 3WDHA 1E0OB 2DL9A 2KQMA 2JTDA 2LV4A 3MV7B 3Q3GA 5JQ6L 4LCIH 3IVKA 2AGJL 1QFPA 1UJ3C 1IM9A 4JN1L 4NPYA 2X4NA 3FT4A 2P1YA 3TO2A 3QEGH 4GRWE 3LEXA 4G6FB 4XP9L 1NAKH 2QV2A 3C6SA 3DYPA 1HSAA 4Y8DC 4PGCB 3HZYA 3BW9B 3U46B 5HDBF 1U95B 3BPLB 1FH5H 2E27L 1A9BA 1QPXA 1T20B 3SE8H 1QQDA 4NSKA 1OTTC 4P57A 1I8KB 1RI8A 1FGNL 4V1DE 2C3VA 4DEPB 1IARB 3M17A 1BP3B 3NIFF 1HHGA 1S7UB 2DD8H 4LIQL 3U6RB 2AVGA 3EFFB 4WV1B 4H8WL 5D9SB 3NOIA 5C09D 1YJDL 1YYLL 3M45A 3KPTA 2CK0L 4CRPA 3HG1B 3KLAA 2VZSA 2KUTA 5DQDL 1R3HA 3RDTC 3CFKB 4UB0H 3UTZB 1KCRH 3OR6B 3VXTB 5H35A 1V3MA 1N0XH 4BSVA 1JF1A 3EO9L 3RJQB 2JK5B 1RUAH 1QFWH 3HR5B 4XWGL 2AQ1A 4PJGE 5FYJU 3WLBB 1BX2A 2O93L 4HKZA 4MAUH 3RGVB 5FOBA 5FYLD 3BIKA 3TN0A 2FEDD 3UTOA 4K23L 1J88A 3DX8A 5AYQA 2H1PH 4GSDL 3GSXB 4I0PB 1JWSB 5D2LA 3T2QA 4HKBA 4JQIH 3OWEA 3GSOB 4JRYB 2ZP0T 1YQVH 3O6FD 5E2WL 3OSKA 1E6OL 1IAMA 4NNPL 4BJLA 1WCQA 4MS8C 3PP4H 3HC4H 3T4AA 4WUUD 4WEBL 1A7RH 5HYEA 3MLVL 4NJ9H 4K7PL 2NLJB 4K9EC 1AI1L 2P5WE 2QQLH 4LSUH 2SEBA 3EYOA 1UM4H 2G60H 1Z9OA 2H26A 5JZ7C 1UADC 4XC3H 2HKHL 4TUJA 4EUPA 4J7RA 2ADJA 4GRLA 5J9PB 3SDAB 4H8WC 1A9EB 3R8QA 5IB3A 1HILB 5FDWA 2I07A 3REWB 1YZZA 5IQ7H 5KAQF 1A3QA 2DLGA 3ARVA 4MWFA 3KLDA 4LVEA 4ZS7H 3LB6D 4P2OA 4OUUA 4KQ3H 4FZ8H 1KG0A 4G8GA 5F6HI 4YWGL 4MXVE 3QNXB 5IQ9A 5CIPB 4OBSA 3QIUA 1NC4B 2FWOA 1ADQH 4W4OC 2FLRT 3WIFA 5ESQB 3KPSE 4PREB 3U1SH 5JHDD 5J7CC 4G8EB 2Q6WA 2H2PC 3GSQA 4FHBD 3SBWA 5MEQB 5I76A 3GMPB 5D93C 1T1ZB 4Y16B 3ULSA 2P48B 3SDXF 3ECBA 1YEHH 2FYYA 2QQKH 2O5YL 2MKWA 3UP1A 2QADC 1AO7E 2YPLD 3KPNA 1A3RH 2AJUH 3JXAA 1KCLA 4K3DL 1GPOH 4NYLB 4NZRL 4C56E 5F7NC 43C9B 4Z7OE 1WEJL 1M71B 1NBQA 5DWUH 3V4VH 4KKBC 3ARTA 3SKJH 4WNQB 2VERN 1S9KC 4FQXB 3GKWL 2GK0A 4CGTA 3MLYL 3K2MC 1I7UB 2FBOJ 3ARXA 3THML 5CKAA 4JM2B 2EZ0D 1JFQL 1KELH 3FOLA 3GIVB 5H37H 1NGXB 4K7PX 4ZQKA 1A7NL 4ELMA 1U41A 1HOCB 3CCHA 4XVTL 2EXYC 3X3FH 2FEEL 4G43A 5E6YA 4U1NB 4UOW0 3ZT5A 1FG2B 4RFEB 4LCCB 2Z8WC 3D3VE 5C07A 3MROB 3QEUB 3VXNA 4R90H 4ELKB 3SCMB 2HLAB 2R9HC 3AB0B 2FGWH 5DDHB 3CFBA 3U79A 4E5XA 4JY5H 1G7IA 1X5XA 1LP9B 4XPAH 3T4YB 2HA1A 4BSJA 1CN4A 4WO4C 2VAAB 3PWNB 1UB6A 5GS0D 3BDYL 3JUZA 3LKQA 3EJYD 4J4PA 5D7JA 4FABL 5DQ9A 3OAUH 3UPRA 3TH3T 3PL6C 2VN7A 1QLRB 4Y88A 4XMKH 5GXBB 5DXWA 2X9WA 1LE5B 1WZLA 1DQLH 4QXGH 4OZGE 4J3SA 5I74B 1I85C 4M1CC 5HHOA 1HDMB 4F7EB 4HXBL 2ZWLT 2EE9A 5FCUH 3MR9B 1OP5H 1HKLH 1JWUB 3I2CH 1EEQA 5JIIA 1KIUA 1BQSA 5HHPB 5C0GB 3QEQA 1BJ1H 3S3SA 3TA3A 1KGCD 2XTJD 1MRCH 3NIGE 3EOTH 4U0RC 2DJSA 2OR9H 3ET9F 2BHYA 1A6UH 3K80A 1BAFH 1FQ9C 3RA7H 4RISH 2OSLB 5EZIH 3WDJA 4OD3H 2ZSWA 5DR5H 3OR7A 5E2TH 3DVNA 5JXED 4HGMA 3DX9B 4EIGB 3MLUL 3LQZA 3QCUH 4X8JA 4NQXA 3D18B 3L3IB 3TIDB 3UZVB 1TQCC 3FQRA 3MRCA 4YZFF 1CICA 4JE4B 5TE6H 1PY9A 3BKCH 3O0RL 2WWKO 2WV3A 3WUWG 4ONFH 2BOBA 1A6TA 2VXUH 3G9VA 1HZHH 2IFGA 3BVNB 1JRHL 4LIQE 3N0PB 4KMTH 1MRDH 1FZJA 4IMLA 3HRPA 3L6FA 5J0BA 3H9SB 3G5YB 1IZJA 2VZ1A 3WMSA 1CWVA 1LVEA 4N90D 4HJGB 1NBZB 3LPFA 1F5WA 3NABL 4ODTL 3SGEI 3JSSA 7CGTA 5KTEL 4XPFL 1T7VA 4S1RL 4EUPH 3BKJL 5A2JH 1T21B 1I8MB 1CU4L 1P1ZA 1JF6A 5CEXA 1LD9B 5L2JB 2X4PB 5HI5D 4F7MA 2W9LA 1P9MC 5LBSL 2RBLA 1WZ1L 4WW2F 1NFIB 5D1XB 5KOMC 3OKMA 1F4XH 4LASL 2APWA 3OBAA 1IEBA 5FUZH 3QIWD 4LCIL 3AFLA 2HJKA 4CAGA 3NIDE 1NKRA 3QEGL 2XY1A 5HYJB 2ZJSH 3DYOA 4E41E 2WINA 2VLRB 1NAKL 2A9NH 4X8XA 3J7HA 1RK1B 1KACB 2BK8A 3KYOB 4P5TA 1N3NA 4PRIE 1A6AA 1FH5L 5DT1H 1FVCA 3SE8L 2DMCA 1EUTA 3S5LA 1WBZB 5M7QA 4PY8I 4I2XA 4XPGH 3VFOB 2DD8L 1DEEA 2X1OA 4WWKA 1UQSB 4JFOA 4OJFH 3Q6FB 2X09A 2Z31B 1G7HB 1S7SA 1KOAA 5F21B 5FM5M 1XEDA 1MCPH 3KWWB 4IRSA 5GRWA 3WEXB 3KPLA 1G7JA 5EN2A 2FO4B 4KI5F 4RGND 4UB0L 5KSAC 1KCRL 4YHNA 2UZYB 4JKWA 1I4FA 2FL5B 5TDPB 1WICA 2Y1VA 3M8OH 1N0XL 4K8RH 1RSFA 4KI1A 3TVMC 5F9WC 1CDJA 2AXFA 2KQNA 3DX7A 3TJHD 3KPRB 2V2TB 1RUAL 1YEKH 1QFWL 5E8OA 2HG5A 1PKQA 3ESUF 3HE6D 3VFVA 1KJVB 5IW1A 5T1KB 4F7PA 2GUOA 5C8JB 4MAUL 3OZ9H 3L7FA 5L7XH 5JPNB 2FZ3B 4L3CB 1ZXQA 3VXOA 4XVJH 3C8DA 1ZT4B 2H1PL 5JPMA 3U4EB 4DFIA 2RFXB 3FO9A 3PHSA 4JQIL 1YQVL 5I16A 4LPVA 5C08A 3C9NB 3B9KD 1R5WA 1CDBA 1EBAA 1DP0A 2ADGA 4PS4H 3PP4L 1FSKC 3HC4L 1YEEH 4QHLA 1OCWH 1A7RL 4NJ9L 4KGJA 1IE5A 3FT2A 1PFCA 2QQLL 4Y5VB 4LSUL 2EH8H 4K7FA 1UM4L 2G60L 3M1BA 1JPST 3H9ZA 2O61A 4XC3L 5B22A 4YE4H 4X4MA 2FCBA 1SYVA 3CVHA 2GT9B 2UVEA 4F9LA 4FQPA 4CVXB 1BFOA 3WFHA 3T77B 4U1GB 4NUJA 3O3EB 5GZND 5IQ7L 4PJFF 4O2FB 4ZS7L 3IDUA 4IRJD 5B3JE 4KQ3L 4FZ8L 4NRYB 3ZTJH 1BD2A 4G8FA 1N5YH 1KEMH 5GGRY 1T5WB 4P3DA 2YXFA 5D7LD 2AW2A 4D0BB 2JIXA 1ADQL 3F7VB 4KK5C 1FL6B 5ICYB 5FXCH 4G7VH 3BKYH 3U1SL 3UTSA 3G04B 3IF1B 2D7QA 4GXUN 1FE8H 5ISZB 4NNYA 2QQQA 5E8PB 4HH9B 4ZUTB 1TTFA 2R15A 2XZQH 2OJEA 3IU3A 2B8OT 3DIFB 4O51A 1F11B 4NDMB 1HK6A 2P7TB 1YEHL 4QRQA 2QQKL 3DUSA 1RIHH 3JVGC 4LEOA 4PRHE 4Y5YB 1FYTB 1A3RL 2AJUL 5E4EB 1MWAA 4CJ1A 3T1FA 4NIKB 2YD1A 1GPOL 1FFPA 3GSVA 5C71A 1QSFA 5DWUL 3V4VL 2EYSB 4DGYH 3SKJL 4O9HH 4G3YH 4OGXH 2CR3A 4YHPB 5FKAB 3JUYA 2VE6B 3GBLA 1TZGH 4UDTA 4PR5B 2FJHA 5JMOC 5T3XD 5DURB 1H15B 2R1WA 1NJ9A 1JGDA 2BSED 1F02I 1CQKA 4UU9B 1KELL 3VFSA 1N2RA 5F9DC 3RIAK 4WENB 4H1LA 4DOHE 2IFFH 5EIQA 4PGDB 5E6ZA 1CXLA 3QA3A 2YUZA 4NQDA 4MJ5A 3X3FL 1KCUH 3PGFH 1P4IH 4BA8A 4HSQA 4GBXD 5E8DH 4PJ7A 5HY9A 4DKEH 4J3UA 1WAAE 3CNKA 3PV6B 4CN4A 1QOKA 4R90L 4QOKB 3SDXB 4CADB 2FGWL 1T5XA 2BC4A 4HS3A 4JY5L 4L8DA 4EI5C 4XPAL 2NY2D 4NZUH 3C09C 2OM5A 3SGDH 1RZ7H 4NQTA 1BIIA 5T1LD 5C0DB 4K71C 4POUB 2OR8A 4ZUWA 2F53E 4U1MA 1GZQA 1X5YA 2GY5A 1IC4H 5E6IC 1HSBA 1GGBH 1GC1H 1ZT7A 4F37K 3LPGA 4MQSB 4HT1H 4PV8A 3MACH 5I0ZA 4ZPVB 4XCYB 4J3OC 1GOGA 4XAKE 5FM5O 4XMKL 5DI8A 4P4KB 2AXGA 3BUYB 4UV7H 4G42B 3CJJA 4I4WB 3ZKXC 1DQLL 4QXGL 2VDRH 3NCFB 4X5XB 1DANU 2A83B 3W9EA 2NX5A 1T0NA 4KHTH 3PDGA 5FCUL 1HKLL 4UUJA 4HWBA 3I2CL 3SJVB 4C83B 1Q94B 1FCGA 4JKLA 3OXRA 1KSRA 4ZUSA 1MRCL 3EOTL 1XGQA 4ZYKA 1A7QH 2OR9L 3MC0A 1FVDB 1A6UL 1CGWA 1BAFL 3C5JA 4KJWC 3OGOE 1FZMB 3RA7L 4RISL 1DBAH 4KJYA 2XT1B 5EZIL 4OD3L 4BK4A 5DR5L 5ESVA 1BFSA 2J8UA 5E2TL 4KRPD 5ICZA 4X7DC 4Z5RA 3QCUL 3QUKA 4I48A 1X44A 3OKOA 3IDIB 5GRXG 5TE6L 3D1MC 3BKCL 1YC7A 1JYVA 2QLVB 4NO3A 4ONHA 1S9VB 4ONFL 2YRZA 3EDDA 3GMLA 2VXUL 2A73A 3V95A 1HZHL 3RZCA 3BPCB 4BM7A 4KMTL 1MRDL 4J3VA 2VLJB 4K55A 1I8IA 4NN7B 4EEEA 4Z0BH 3WHXA 1NEZB 2ID5A 3L5IA 4ZUUA 3HI1B 4D0CA 3QFJE 2AEIT 4B50A 2HVJA 1J8HD 3CVHH 5DJCB 1DVFB 4KKNA 4TNVK 4L3AA 3VJ6B 5DMKA 5DRXB 1CGTA 1W8OA 4CNIB 4HLJA 1FFOB 1X7QA 5IOPB 1T22B 1F4XL 2YD4A 3CMOH 1WC7B 1Y6NR 3JV6B 1EFXD 2NR6C 5FUZL 4HFWA 3EGSA 1KC5H 4F3FB 3W0WA 3NGBB 2ZJSL 2A9NL 1YEDB 1I75A 4JZNB 4P2RB 2YOCA 3KJ4B 4X99A 2YRPA 5L0QB 2BNQB 2DI9A 2ICEB 1GOFA 4NO2A 1JI1A 5DT1L 2HN7B 1AIFB 2AKRB 2WNGA 4AEEA 4M61B 3NCBB 4HMCA 1S7XB 1DLHB 5ECJE 1MUJB 1MWAH 1X4XA 4WJ5B 4XPGL 4RX4D 3D87B 1ZHBA 1KB5B 5EH1A 1EAPB 4OJFL 1A6WH 4LVHC 2VDMH 1G1YA 3G5VA 4LAQH 3O9WA 1N59B 5BQ7B 2Q86B 1MCPL 1UGNA 2E9BA 4WW2B 3V5DB 1N7MH 2F54A 1MAJA 4NQED 4HG4J 4HUVB 3MV7A 4GRLC 4M9PA 3M8OL 4G9FB 4K8RL 1AJ7H 1RUQH 3PWPE 5CGMA 1YEKL 1IAOB 4LLWB 4KUCF 2C3XA 3QDMB 3RY4A 4NM8H 3PABB 3OZ9L 5L7XL 4ZPTB 4LPYA 4XVJL 3BW9A 3U46A 3QZWG 4IHOB 1U95A 2L4OA 3QIUC 1P7QD 2P44B 1CYGA 1XF1A 1T20A 1F8TH 3RI5K 1I8KA 3VXPB 1D9KD 3HLAB 2LU7A 1UH2A 3ULVC 2DQJH 2JJWA 4PS4L 1YEEL 1OCWL 2DKSA 4U1LB 3U6RA 3SDCD 3EFFA 4U1SB 4WV1A 5D9SA 1VSCA 4JQVA 5MEOB 2EH8L 4L1DA 3H2WA 4PJEE 4U31A 3HN3A 3HG1A 3QDGB 4L4TE 1UWXH 1T6WA 4Y7MA 1QRNE 3BEVB 3O3AB 1CDCA 1F4WH 3TNMB 4YE4L 3CFKA 3UTZA 3MBEC 5K59E 3OR6A 3VXTA 4XH2B 3MGTB 4FS0A 3MRMB 3EDFA 2AXJA 3GK8H 4JFQB 5IUSA 3EYQC 1ZVYA 2JK5A 3MRQA 3C60B 4LHUD 3HR5A 4Y89A 3WLBA 3QIBB 5HVHB 4HWBH 3ARUA 4I0KA 3BRDA 1TZIB 2GSIB 3RGVA 4GRWF 1N5YL 1KEML 3SKNA 4XCNB 4TYUA 5IVXB 3ZMRA 4IMKC 3GSXA 4I0PA 3WO4C 1JWSA 3V6BR 2BVUA 5KOVC 4G7VL 3BKYL 4JRYA 3GSOA 3NFSH 1U8KB 1J18A 1WZKA 3I85A 1FE8L 5HI4D 1BWWA 2XZQL 1ZLWK 2NLJA 3PQYB 1RIHL 1MCIA 2NXZB 3H9HB 1B6UA 3DO7B 2G9HB 1CCZA 4XNZB 4KKAD 3SQBA 4DGYL 5J9PA 3SDAA 4O9HL 4G3YL 1A9EA 4OGXL 4H0IA 1HILA 5D7JC 3REWA 5I1AB 4JM4H 2CQVA 4PJ5D 1TZGL 2AK4B 1BVKB 2K7PA 4F57H 1T83A 2EDQA 4PJFB 4PJ9B 4UINH 2P43B 4PJGF 4HK3N 2VTFA 3W11C 2QBWA 1L7TH 3QNXA 5CIPA 2CO6B 1NC4A 3IT8D 2IFFL 2AJZB 2C5DC 2ATPB 2X1PA 4Z78B 4X6FB 1A1OB 5ESQA 4PREA 2UZIH 3E0GA 4G8EA 1KCUL 3PGFL 1P4IL 4TTDC 5MEQA 5E8DL 3GMPA 2CXKA 4R7DB 5CD5C 4DKEL 1E4KC 2FNBA 2YR3A 3LQAC 1T1ZA 1I8LA 4Y16A 1J0KA 2DLIA 3G5XB 4PUBH 3WKMH 3ZDXE 4Q9RH 1JN6B 3WS3B 1DQMH 3SGJA 1QA9B 2KH2B 3ARDA 2B1HH 4NZUL 4NYLA 3VFGH 1RZ7L 43C9A 1M71A 4OFYA 4K3HA 1IC4L 4OF7A 3OL2A 4WNQA 1GGBL 1GC1L 2UWEE 4OCMC 1MVUB 4FQXA 4PRBB 1BLNB 4HT1L 3MACL 1JZ7A 2HTKC 4YHMH 5HSFA 4JHBA 4UV7L 1I7UA 2F74B 3TP4A 4CMMB 1AD0B 2WP3T 1T6VN 4JM2A 2VDRL 1J12A 5IMOB 1FFQA 4EQ3A 1IAII 1NAMB 3GIVA 4R0LC 3MA7B 3QUXB 4U2YA 4KHTL 3V52H 3VRIB 3D39A 1QFUH 3JTSB 4P46B 1HOCA 1RPQA 2FO1A 4U1NA 1YC8A 2DWEA 1EHXA 2Q3AA 2FATH 3BZ4B 4G8GE 1FG2A 4GKNB 1FYHB 4RFEA 4LCCA 5CHNB 2HRPH 1A7PH 1AHWB 3MROA 3QEUA 1A7QL 4ELKA 3SCMA 2HLAA 5HHVH 5DDHA 3J8F7 2VWEC 1LP9A 5FUOH 3T4YA 4KKLD 4LPUA 1DBAL 2VAAA 3PWNA 2PF6A 1XF3B 3VDAA 4HJ0C 5TF0A 1MY7A 4Z7OF 1KPRB 3FONB 3P4OB 1XGYH 4JZOB 1QLRA 1LE5A 4G80B 3IETB 4P5TC 5D72H 4PJHF 3VFTB 4QRRB 1HDMA 4F7EA 1QBLH 1GC1C 1PY4A 4D94A 2XNAB 3MR9A 4X7SH 4Z0BL 3ZLQC 2P46B 3K3QA 4IEFB 3ZDYE 1CR9H 1JWUA 1QR4A 3UBXB 3MXVH 5HHPA 3QAZC 5J57B 5C0GA 3CVHL 4X9HA 1MCOH 3HB3C 2DAVA 4EUPG 3FL7A 4EN3B 1F3RB 3EIFA 4IRSC 2OMBA 4ELME 3O2WH 1A5FH 3CMOL 4UT7H 2YN3A 4LBEA 2OSLA 4QRSB 5IESH 1KYOK 3T3PE 2EDDA 3BYTA 3DX9A 3BXNB 1KC5L 4D0DB 1RFDH 3D18A 3L3IA 1P7HL 3TIDA 3L3HB 2F8VA 5DGQA 2E6QA 1Q0XH 4GAGH 3MRPB 1T3FB 3E8UH 4MB5A 4I18B 3EDKA 4PYGA 3S36X 3BVNA 3HI5H 3EYSH 3T0EB 1FV1B 4PRDA 3H9SA 4J23A 3G5YA 4DK3A 5JOPE 1P84K 1T66C 5DO2C 1JYXA 4HJGA 4POYA 4XB7A 1W72B 1MWAL 1CFSB 1NBZA 4NHCH 4NCC2 1OW0C 2FH6A 3NAAH 1T21A 1I8MA 4ISVB 1OM3H 1A6WL 1LD9A 5L2JA 2VDML 2X4PA 3VG9C 4LAQL 4OKDA 1NCWH 4JPKH 1NFIA 3NIGF 4PRPE 5D1XA 3V5KB 3RY6C 1N7ML 3ZYJA 2OI9C 4JO1H 2W0FB 4F9LC 2OQJB 3QEQE 1NUFA 5CIPH 1AJ7L 1RUQL 4C57C 3HMXA 4QHMB 2QSQA 5HYJA 3LVEA 1B0WA 2DQTH 3EOYG 4PY7B 4NM8L 2VLRA 2D0HA 1VEOA 1RK1A 3RVTC 2VMFA 2WAHA 3KYOA 1PEZA 4JPIB 4Y2DD 4HFUH 1CT8B 2X1XR 1F8TL 2Q8AH 3MTRA 3ARFD 1WBZA 1F90H 3MUY1 5CJXA 3EHBD 4YQXH 2DQJL 3VFOA 3VWKD 2W1NA 6CGTA 1NPUA 3BZFB 1UQSA 2FD6H 3QQ4B 3Q6FA 2Z31A 4PJ8B 4MQ7B 3RX7A 5K9QG 3KWWA 3CU1A 3KG5A 3WEXA 1F4WL 2FO4A 1TVHB 5JO5B 4F9PA 2FL5A 5TDPA 5C0RH 3GK8L 3KPRA 3KXFB 2V2TA 3I02B 4OFKA 3ARBB 3NIDF 1KJVA 4HJJH 4HWBL 5T1KA 1KXVC 2BDNH 5C8JA 4ZOCA 4P5KB 3MV9B 5JPNA 1AFVH 4WUKH 2FZ3A 4L3CA 1T04B 2YK1H 1OTTD 1ZT4A 3ZTJG 3U4EA 2V5MA 5CZKA 4KPHH 1FBIH 5FUCE 3KPOB 3NFSL 5I73B 2QHRH 1TPXC 3GSNB 4ZO9A 2PYEB 4PG9B 3C9NA 1KEGH 5EU4B 3VRJB 4LHJB 1WGOA 4U1JB 3RBGA 2YRLA 4NQCE 4QRTB 4Y5VA 5C6TH 3RDTD 5I1EH 4DUVA 4U6VH 4KAQH 2GI7A 3QRGH 4Z7UB 2OCFD 5DJ6B 2GT9A 3GI9H 2HFEB 1SHMA 1U92B 4CVXA 3T77A 1X5GA 4JM4L 1SY6A 3O3EA 3PF2A 3QEHB 1BF2A 4ORZC 1OGAA 4O2FA 1P5UA 4WHTB 5DD6B 4F57L 1YA5A 4U6XB 4UINL 4YC2B 1RUKH 3BQUB 4NRYA 5I9QC 3P9LB 1L7TL 1T5WA 4JQXA 4D0BA 3M07A 2EIBA 4M1GH 3F7VA 1FL6A 5ICYA 4MS8D 2UZIL 3KGRA 1KF9B 5F6IB 3G04A 3IF1A 1PKQE 3P2TA 5ISZA 4BUGA 1DBJH 1OSZB 4FRWA 5E8PA 4HH9A 5GRYA 3CH8A 1I9EA 3HE7C 4ZUTA 4ZFZA 1K6QH 3DIFA 4HUWB 1ZKAA 5JZ7D 1CS6A 1F11A 4NDMA 2P7TA 4PUBL 5E95B 5FO7B 3WKML 4CW1B 4Q9RL 1DQML 2DQEH 4Y5YA 1FYTA 5LAXB 2B1HL 1AKJD 5DMIH 5EOCJ 3VGHA 5CGYC 3VFGL 4NO0D 1KT2B 4QHKI 1I9RH 2VO5A 2EYSA 1CDYA 1QPPA 2QSCH 2VAJA 1EH9A 5JOEA 4FFWC 5FKAA 2YUXA 1EIBA 2VE6A 4PR5A 1BQHB 4QLRA 1KUMA 4YHML 5J12B 1H15A 3RTQB 1PG7H 4HCRH 2YA1A 3SE4A 3FO0H 2KPNA 4UU9A 2BXZA 4KVCH 4X4ME 5B3JF 5ID0B 3S5LG 1T1XB 4D2NA 4PJGB 1KN4H 1OT1A 3V52L 2H2PD 4L4VD 2IJ0C 1Z6JT 4PGDA 1CLYH 4ZAKC 1QFUL 3BJ91 3EDEA 5AAWA 5EC1B 4U3XA 3D2UB 1F6AB 2AV7B 3OJ2C 2FATL 2QSVA 2E7LC 2OLDA 2VXQH 3PV6A 1IGMH 2HRPL 1A7PL 2QADD 4YFDB 4XBPB 5F7LB 4QOKA 3SDXA 1KB9J 3HMXH 5HHVL 5TF1H 4CADA 3CXHJ 4XWOC 5FUOL 3BRFA 4KKBD 3DI2B 3UTSE 2P5WB 1RV6X 2X1WL 4JR9H 5C0DA 2YZ8A 5IM7B 1FCCA 1FVEB 5FV1L 5B39B 4LCWD 1XGYL 3O41B 4ZPVA 5ADOH 4XCYA 5AAMA 2W0PA 4XVSH 5E1AB 3WJJA 3P0VH 4P4KA 3BUYA 4U7MA 4G42A 3SKMB 3UDWA 4I4WA 4Y4FB 5D72L 5HHME 4X5XA 3VI4E 2IALB 2A83A 2A6DB 1QSFE 2J5LC 1VPOH 1TTUA 2EXYD 1OB1B 3MRGB 1QBLL 4Q6YA 43CAB 3RIFF 3UTPD 1WBXB 4X7SL 3BIBX 1VDGA 3S97C 1CR9L 3QXAB 2ZUQB 3WUZA 1K5NB 3SJVA 4C83A 4Z76B 4N68A 4NFDA 3MXVL 3X13B 1Q94A 5HHXH 2R9HD 4FA8A 1MCOL 5D8JH 1C5DB 5SX5K 1WAAF 4Y4KC 4RFNC 4WO4D 2Y5TB 2W0LA 1I1AC 1FVDA 4LSTH 2AJYH 4NQDE 4LLUB 3O2WL 1A5FL 4UT7L 1FZMA 4N0YH 1FAIH 1AO7B 4PJ7E 2APTA 5IESL 1FNSH 3PL6D 2G2RB 5CUSH 5JA8B 4L9LB 2LABA 4HG4K 1RFDL 4JO2H 3K74B 1WFOA 3IDIA 4HIIB 1Q0XL 4GAGL 2CGRH 4YHIB 5SV4A 3E8UL 4M1CD 4HWNA 1GGIH 5BVPH 1S9VA 5FGSA 5IK3B 2BHUA 3HI5L 3WLWC 3EYSL 1S7TB 3BPCA 4PJHB 2VLJA 3IJYB 1S5IH 5C09B 3IYLW 1NEZA 3UJIH 4DEPC 1T2XA 2C26A 1OWWA 3HI1A 4LSRH 4NHCL 3NAAL 3VWJB 5EU3B 2NY5H 5DJCA 3MUHL 3VJ6A 5JA9A 4OGAC 1OM3L 5DRXA 4CNIA 4JQVC 2NX5E 4OFDA 5TQ2H 1G9NH 1NCWL 1SY6H 4JPKL 4HIEB 1LO4H 1FFOA 3WIHA 5IOPA 1T22A 5F9JB 3NA9H 2V5TA 5B8CB 1WC7A 3JV6A 4JO1L 4GMTH 1BREA 4PJXF 2P42B 1L0YA 4F3FA 3QFDB 1V3JA 2DQTL 1CD8A 3JV4B 1EK3A 4H1LG 5CBEB 3WBDA 4QEGA 5AD0B 1YEDA 4JZNA 3O6FB 4P2RA 2E9IA 2BNQA 1XCQB 1ODAA 2ICEA 1XCTB 4HFUL 2LE9A 1AIFA 2AKRA 5CCKH 2Q8AL 2P47B 1K2DA 4GW1B 4M61A 1F90L 1S7XA 2EC9U 4YDJB 1DLHA 1MUJA 4YQXL 2EC9T 3E2HC 1B4JH 3MRNB 4WJ5A 2IF7A 5CP7B 1H5BB 1MCEA 1KB5A 3S96B 3TGXA 1EAPA 3PIQB 4GAJH 2GK2A 2FD6L 1Q1JH 2AEQH 3WL9B 4LF3B 4BFBD 4XVUC 1N59A 5BQ7A 2Q86A 4JFZH 4PJIE 5E08H 5GGQH 4WW2A 3V5DA 5B4MC 1AXTH 4R8WH 3W5NA 1H3UA 5LKNA 1K3ZA 4HUVA 2R1YB 4FQHB 5C0RL 2NY0C 1G0XA 4G9FA 1KJ2B 3C5SB 1H9VA 3B43A 3QCTH 1JE6A 4JZJB 1IAOA 2NY7H 4LLWA 3SGEH 4HDIB 2P24B 3QDMA 4HJJL 1WFUA 2BDNL 1MCRA 5IIEB 3PABA 4LVOB 5JW4R 4ZPTA 1AFVL 1CGVA 1YMMD 4WUKL 1P6AB 2BOCB 2YK1L 5K9OB 5LJYH 4IHOA 1XIWC 4KPHL 1FBIL 5C6PB 3OXSB 2QHRL 5B3NA 3W0WE 3VXPA 3HLAA 1KEGL 5GRZA 3X3GH 4LKXB 2XY2A 3FRPA 1I8LC 4U1LA 2ARWA 1LGVA 4U1SA 2G75B 3SN6N 5C6TL 5MEOA 1ZGLB 5I1EL 5KSAD 4AEHH 4U6VL 3QDGA 5I15H 3SGJC 3BEVA 4S11A 3O3AA 3TNMA 4KAQL 3VFPB 5LGKA 3QRGL 3TVMD 4XH2A 3MGTA 3GI9L 3RBSA 3CC5B 1FNFA 1X5LA 4JFQA 3C60A 4UOW1 3T0VA 3QIBA 1RUKL 3BYYA 1TZIA 2GSIA 4JM2C 4XCNA 1NKOA 2J8OA 1W0VB 4HH8A 5IVXA 1TFHA 4M1GL 1MLCB 3DHJA 2CIIB 2AV1B 1N6VA 3JV5A 2CRMA 4QGYA 1AXSB 1U8KA 5CEZE 3VMPA 5KVDH 1C16B 1DBJL 3LCYA 4UDUB 1K6QL 4LCCC 3PQYA 3SCMC 3AB0C 4JG0H 5HPOA 3H9HA 3IDNB 3DO7A 5DMIL 4PJEF 2G9HA 1JIBA 3LHPH 1I9RL 2J1KA 1KBGH 5KSBB 3OX8A 2QSCL 2IG2H 5BMFH 4KQ4H 5IWLA 2D9QB 3IRZA 5K59F 5I1AA 3NZ8B 1X3DA 2AK4A 4KZDH 1BBDH 1BVKA 3VGEA 4HS8H 4PJFA 4PJ9A 3MRIB 1PG7L 4HCRL 2Q1EA 1DBMH 3DXAD 3FO0L 4KK5D 4KVCL 3U0WH 3NACH 1KN4L 2AJZA 1CLYL 2ATPA 4Z78A 4X6FA 4EDXB 3O8XC 1H8NA 4MNGB 1A1OA 4RWYH 4IM8A 5E5MB 5CEYB 5FO8B 4CVWA 2XTJB 3WIHH 2EE2A 2KZWA 5DRWB 5DF0A 2IPUG 4ZOAA 1F3DH 4R7DA 3ZYOA 2VXQL 1JGEB 1IGML 4NHUB 4JANB 1FDLH 4OT1H 3G5XA 3HMXL 1ONQB 1X5HA 5TF1L 4K3GA 3VW3H 1J0ZA 1JN6A 3GJEB 2M1KA 4XNMA 1QA9A 4JRYE 1WT5A 2BNRE 3TBSB 3CSPA 4P9HC 3QP3A 4DQOH 3FCTB 1Q38A 3E6FB 3O11A 4JR9L 3EFDH 4HK0B 2MFNA 4WFGD 1CQYA 2DQGH 5CMAB 1MVUA 4PRBA 1BLNA 4XI5C 3VFUB 3DVFA 5ADOL 4HW6A 4XVSL 5FHBH 3P0VL 4WU7B 3DGGB 2F74A 4CMMA 1Z0MA 1AD0A 2GW5A 3OV6A 4XPTH 2B4CC 3FO1B 2I25N 5IMOA 1VPOL 1KB5H 1NAMA 3MA7A 3QUXA 4XP5H 1UB5B 4DAGH 3VRIA 3JTSA 4P46A 4GKZB 4EQ2A 3VMOA 5GS2D 3FZUC 5LVEA 4XCFH 5IBLC 3BZ4A 5HHXL 2VISB 5D8JL 1J1XH 4GKNA 5CHNA 1AHWA 2I24N 3EO0B 4EI5D 2ED9A 4NWTH 4DGVH 4TN9A 4WRLA 1DL7H 4LSTL 5D1XC 2AJYL 4M4RA 3ZDXF 4N0YL 5E6ID 1FAIL 1ZHLB 4PTTB 3IFLH 3TZVB 1PG7X 1XF3A 3QWRA 4HWZB 4KDTC 3F5WB 1FNSL 4X4ZA 5CUSL 3BMVA 1KPRA 5FYKE 4JO2L 3FONA 3P4OA 3U4AA 1U8PB 3G6JF 4JZOA 3FJTA 3OKNB 1CXFA 2CGRL 2UWEF 1FP5A 4M7JH 1GGIL 1EVUA 5BVPL 4M03A 5IVOA 2H2SC 4G80A 2C4FT 4XGZB 3IETA 3VFTA 4TPRH 4QRRA 4TVSa 4HIHB 5MHSD 1S5IL 2XNAA 3LD8C 4RQQB 1CLCA 3UJIL 2IADB 3MRJB 3UBXA 4LSRL 1YN6B 2EE6A 4Y1AD 2NY5L 3I9GH 2QHLA 4RGNB 3RP1A 4JFED 3CUPB 2LAAA 1U8MB 4KJWD 1I7ZB 5TQ2L 1G9NL 2Z31C 1SY6L 5L8LB 1LO4L 1G7MB 4PJCE 3D39E 1BM3H 1CFVH 3O2VH 1JZ4A 3NA9L 4I9WD 1AGEB 1IM9D 3HE6B 4QRSA 4F9PC 5DD3H 1B2WH 3KHOA 4GMTL 4L9DA 3BXNA 4D0DA 3FB8B 3GJFK 3U0PB 3L3HA 5I8OH 5BW7A 5I1KH 5IT2H 2F53B 4F33B 5DZLA 5BXFB 4HIXH 3MRPA 1P53A 1T3FA 4ODHH 5E8EB 3X14B 3K4AA 1X5IA 5L8JB 1LP9E 3IS0X 4IIQB 1CD1B 1KCVH 1OOAA 4I18A 2F8OA 3B9KB 4LPCA 5HHQB 4M93C 5CCKL 4WEMB 3T0EA 1FV1A 1MHHB 4GFTB 1KENH 2R2BB 2R39A 1W72A 2C1OB 1CFSA 2OL3B 1B4JL 1NUGA 1VERA 3ZDYF 2ED8A 3BFOA 3NPSB 3VXRD 4ISVA 4ZD3H 1WCBB 4GAJL 2DJUA 1MCJA 1Q1JL 2AEQL 4IOFC 2OXHA 5E08L 1CGSH 4JFZL 3OPZH 5GGQL 3V5KA 2NR6D 2A77H 1AXTL 2DQUH 2X4UB 4R8WL 3NTCH 3MJGX 4ODWB 4ELMF 1WF5A 4IRJB 2YN5A 2W0FA 1MCWW 2OQJA 4WI5A 5EG6C 3UROR 3K2UH 4QHMA 3QCTL 1ETZB 3T3PF 2NY7L 4PJXB 5D7LB 1A6ZB 2MHAB 3WD5H 5J6HB 1MY5A 4PY7A 5HHNB 3MRKB 3IFOB 4JG1H 4UT6H 4YAQB 3R8BB 1S3KH 4JREB 4HX1B 4JPIA 4AT6B 3ZO0A 1CT8A 1TJIL 1CXKA 5FYJH 4YXKH 2JE8A 3D0LB 3X3GL 1RUPH 4EOWH 5ALBH 3G08B 4LDLB 2Y06H 3BZFA 3D69B 1YN7B 5CS7A 3QQ4A 2MCPH 4PJ8A 4AEHL 3NH7H 4MQ7A 4AQOA 1TZHB 5I15L 4Y5YC 1J0HA 2KKQA 3H9SE 4HPOH 4GRLD 3QG6B 5E4EC 1TVHA 1CD0A 3IU4H 5JO5A 2H9GB 2ZCLH 3O3DB 1YEIH 5IHBA 3MNZB 2V7NB 4RGMB 1NAMH 3KXFA 1CE1H 3I02A 5IJVB 3ARBA 4FP8L 5EULV 3RAJH 3QIUD 3ULUH 1U8OB 2BRQA 4P5KA 3MV9A 5C1MB 3A67H 1T04A 2VLKA 4M7ZB 4GBXB 1JWMB 3BP5B 3EKCA 5D7KD 2NZIA 1MSPA 3KPOA 3ULVD 3GSNA 2PYEA 4PG9A 5KVDL 5EU4A 3VRJA 4N8VB 4P0DA 4U1JA 1Z9MA 2NY2B 2H8PB 5D1QC 4YO0B 3PUCA 3ZE0E 4QRTA 4OF5A 1NGYB 2UUDK 4GQ9H 4JG0L 3MBED 2C4XA 4JRXD 5C0AD 2N7AA 3EOAB 3T8XB 1GVIA 5ID1B 3R1GH 3IS1X 1A21A 4IJ3B 3LHPL 1KB9K 1KBGL 2X4OB 4Z7UA 3ARGC 5EU6E 5DJ6A 3CXHK 3DNKA 3EYQD 2HFEA 1U92A 2IG2L 5BMFL 4KQ4L 4CU8A 1UEMA 3NFNB 4OUOA 4YFLF 4KZDL 1BBDL 4HS8L 2X7LB 4WHTA 2ZUUA 5DD6A 4U6XA 4HWEH 3WJJC 1C5BH 2D7OA 3BQUA 4P4KC 3C6LC 1DBML 2FGZA 3P9LA 3U0WL 3NACL 1RHHB 5MENE 3N9GH 3ZHLA 4FFVC 2P45B 4RWYL 1RJCA 4GLRH 3WIHL 1FORH 1L7IH 2IQAB 2HVKB 4YFEA 5C07D 2Y23A 1Q9OB 3OJDB 1T1WB 5ABDE 1OSZA 5AUMB 5DK2B 3D48R 3G9AB 1LE9B 1FDLL 4HUWA 4OT1L 2CMRH 3FQUB 4CW1A 4UNTA 5FO7A 3VW3L 5I8KH 4Y2OA 2VQUA 4KRPB 5LAXA 1MFNA 3B8YA 4NNXB 1KT2A 5D7JD 4DQOL 3EFDL 4OBRA 4Q6IC 4P3WA 2DQGL 3GM0A 3HTLX 4WU5A 1BQHA 1FIGH 3W11D 1NC2B 5FHBL 5HHOD 3RTQA 1W72H 4XPTL 5ID0A 1T1XA 2ZUYA 4PJGA 3KYKH 1KB5L 4RCAA 3SKUD 4XP5L 4DAGL 4TTDD 1XZ0B 3TH2T 4PGZA 4NN7C 5CD5D 1DEDA 1SEQH 2ZZUT 5EC1A 4M8QA 5INCB 4P9MH 3HZKB 2DIBA 3D2UA 1F6AA 4MA7H 4XCFL 1OGAE 3KR3H 3LKPB 2AV7A 5JIKA 2PO6C 4P2CG 2CK2A 3LRGA 2IQ9H 5FGBC 1J1XL 1DVFC 4RMRA 5KN5B 3WS6C 2BSRB 1YMHB 2DM4A 4NWTL 1EFXB 4DGVL 2DI7A 1XF4B 3B2VH 2WZPD 4N5UA 1DL7L 4NZDA 2MMXA 2GJZB 4S2SB 2P5WA 4YDIH 4DVRH 5I18H 2VZ3A 5I1CH 3IFLL 4PD4K 5FKPB 5IM7A 4P57B 1FVEA 2HTKD 2Y7QB 1WK0A 1SYSB 1T89A 2XG5A 5B39A 3NGBC 1BVLB 3O41A 5E99H 4HAGA 4M7JL 5E1AA 1LDPH 1FYTE 4PLOB 3SKMA 4Y4FA 3PG2A 2IALA 2A6DA 4M5YH 4TPRL 5CLWA 2BVOB 3KLAB 3BH9B 3RWCB 1OB1A 3MRGA 43CAA 1WBXA 4OZIE 1PX3A 1ZT1B 1CL7H 1INQB 1D5ZB 5M94B 3QXAA 1K5NA 4Z76A 4MVBC 3V6FB 3X13A 4N0UB 3I9GL 3S88H 3BE1H 1C5DA 5C7XH 3B2UC 3RGHA 2V6HA 3ELAT 1BX2B 3RWFB 3TO4B 1MHCB 2Y5TA 1BM3L 1CFVL 3OKYA 4HJ0D 1MJ7H 2NNAB 3O2VL 4LLUA 5I1IH 4Q74A 3RY5A 1E4XI 1IAIH 4I3RH 5DD3L 1AO7A 1RZ8B 5F7HA 1B2WL 2BJML 4MCZB 1R24B 5JOFB 2G2RA 1ZVSB 3AVEA 4L9LA 5IW3A 4GH7B 1N6QH 5I8OL 4QOKE 5I1KL 5IT2L 4H5SB 5CLTA 4HIIA 3CMGA 3G6JB 4P5TD 4HIXL 1EJOH 4ODHL 4YHIA 5GGUB 1AD9B 2UWEB 2DLFH 3JBG7 1KCVL 3VD4A 3QO0B 5IK3A 4UMGA 3VI3E 2IBZY 5E8NA 1D9KB 1S7TA 2XTLA 2I60H 5F1SA 4PJHA 5F7MC 4WFHE 3VI4F 3IJYA 3SDCB 1KENL 5C09A 4BZ2H 2VZUA 3HB3D 2Z0BA 2AJ3B 3VWJA 4AEIH 5EU3A 4Y5XB 3EJJX 4K3JH 4ZD3L 4IRSD 1UKSA 1CGSL 1J5OH 4HIEA 3OPZL 3TCXA 2A77L 5F9JA 2DQUL 1IMHC 1P4LB 4TUOB 3P30H 3NTCL 4LHUB 5B8CA 3HZVB 3SJVE 4F80A 3CDGB 1FNGB 3QWQB 3BDXA 3K2UL 4PJ7F 2DIJA 1LO5B 4HBQA 3IDXH 3QFDA 4OCXH 3S37H 3HNVH 3JV4A 3WD5L 5CBEA 5AD0A 3BPOB 3O6FA 4JG1L 4QRPE 4UT6L 4Y19D 3MNWB 1XCQA 1S3KL 3VGAC 4Z7QF 2ZCHH 1T66D 5DHVB 5DO2D 4DJMA 1XCTA 1UH3A 5C08D 1BQLH 3RVWC 3MQIA 4KRMB 4DN3H 3K8MA 4LRIC 5FYJL 4GW1A 1MF2H 4YXKL 1N6UA 1JK8B 2BP3A 4YDJA 4ZSOE 4HGKC 2VL4A 1RUPL 5CP7A 4EOWL 1H5BA 1S5HB 3HZMB 5ALBL 3JZ7A 5I2IB 1RZJC 2Y06L 4GXVH 3S96A 5I8CA 3PIQA 5F97E 3WL9A 1CBVH 2MCPL 4LF3A 5BRZE 3DRTB 1MCLA 1MFBH 3NH7L 5A40E 2NXZC 2VLJE 1TMCB 3VXSE 4AQ1B 4HPOL 4PJ5B 1JNLH 3GHEH 2ZCLL 1UH4A 2R1YA 5DLMH 1YEIL 3T2NH 2V5YA 4FQHA 1JCKA 1X5JA 1JPSH 1NAML 1KJ2A 5JDSB 1YUHB 3H7BB 1CE1L 3QG7H 1BD2D 4JZJA 1X4ZA 3RVTD 4HDIA 2P24A 5E00B 2EDOA 3C8KB 3ROLB 4LLDB 3RAJL 4PJ9C 5IIEA 3ULUL 5FB8B 1WUNT 2VH5H 3BIAX 1MAMH 5JHDA 1U36A 1PVHA 1FGVH 3A67L 2BOCA 3BDBA 4FTVE 5K9OA 3L95B 4KV5E 3UJJH 4HEPG 5KW9L 1HHIB 1RZKC 5C0CD 5HYSA 4M00A 1GSMA 3OXSA 4HV8B 3IJSA 4HLZG 2IPKB 3BHBB 2IMNA 3U30B 1LEKB 4ZO8A 3SGKA 4YJZL 2LFGA 2BY3A 1NEUA 2BNQE 2G75A 5KVMC 1ZGLA 4GQ9L 4D9QE 4WFFD 3R1GL 3GZKA 1WT5C 1T7YA 3VFRB 2ENYA 3VFPA 4PJIF 3ZSTA 1EZVX 4O2CB 1G6RH 4KDWA 4LDOB 2LVCA 3RVXC 4P2QD 4PRPB 2NXYB 3CC5A 4PY8J 4TQEH 1JTTA 2JJTC 1MCWM 3U2SB 3LN4B 3ZKMC 1IEAB 3FB6B 4HWEL 4BQBA 1C5BL 2CH8A 1U8IB 3TCLB 4HGWB 1BFVH 4YXLH 3MOBH 3STBA 3R0NA 1EV2E 1LO2H 1W0VA 1NEZG 3N9GL 5HGAB 5DJZB 3WSQH 1MLCA 5C0BE 1F4HA 2CIIA 1EO7A 2AV1A 4G9FE 4XBGB 1AXSA 1FORL 3Q5TA 4GW4B 3ZL4H 1L7IL 3BI9X 3QDME 1C16A 4MB3A 3VXUE 1BEYH 3DX6B 3TT1H 2XWBB 4RMQA 4UDUA 4N8PA 4ZO7A 5EORH 1AHWC 2CMRL 1M7DB 4YEEA 1K8DB 3MLXH 5I8KL 5GS1B 4XX1E 4JFFD 1QBMH 4O2EB 3IDNA 5T3ZD 1WWWX 5KSBA 1WISA 4OLVH 3S7GA 3WIIH 3I6LD 1HE7A 1U91B 3NZ8A 2OX5A 4D3CH 1OAKH 1FIGL 1PLGH 5DFVC 1ZLVH 3W9DB 2NY6B 4K7PY 1OPGH 1W72L 3CSGA 3MRIA 3RHWF 1B6DA 4LK4A 3B9AA 3KYKL 4KI5E 4LSVH 1TENA 4D9RD 4JCMA 1CFNB 4EDXA 4MNGA 5E5MA 5FO8A 5CEYA 1SEQL 2B20A 4P9ML 2R1XB 1VB9A 3HE7D 4MA7L 4EDWH 3KR3L 5DRWA 1DSFH 4K3EH 1D5BB 3AMKA 1A4KB 1T80A 5MP6H 2IQ9L 1UZ6F 1U2CA 1JGEA 3T65B 3MZTA 1LO0H 4NHUA 4JANA 1PDKA 2DQIH 5FYLH 5IVXE 3ARQA 1Q9KA 3JV0A 4EN3C 1ONQA 1T1YB 3B2VL 5CGYD 5JLZB 1JZ5A 3GJEA 1UXSB 2XOTA 4NQCB 1IGYB 4YDIL 4DVRL 1A6AB 4FFWD 3TBSA 5I18L 4CN1A 5J56B 5I1CL 4JGUA 3FCTA 3E6FA 3SPVB 1ORQB 4WY7H 4HK0A 4TVPD 2EH7H 3RWEB 5A1AA 5CMAA 3OAZK 3SO5A 3VFUA 3LKOB 5BW7C 3DURB 5E99L 4GS7B 1LDPL 2UV3A 4WU7A 3DGGA 4H88H 4KRNA 4ZAKD 4L3EE 1CTOA 2X9YA 3FO1A 4M5YL 3V6OC 1J9CT 3KHQA 1UB5A 1U2HA 1H3PH 3MMEB 5GISH 1QG3A 3T0EC 4BH8B 4WEUD 3AREC 1CL7L 4GKZA 2AK4E 5CINH 2Z9TA 3QI9B 2LU4A 2VB5A 2VISA 3S88L 2IH1A 2HRLA 3BE1L 5C7XL 1MHPH 4WI2A 1ORSB 3EO0A 1CXHA 4XWOD 1DE4B 1KJ2H 5HTSA 3ZHDA 5HI3C 2EIZB 2WBJC 5FOJA 5I71C 1MJ7L 4FXGB 3BZEB 1MPAH 5I1IL 5L88H 1IAIL 1ZHLA 4PTTA 1FL3B 4I3RL 2XWJA 3TZVA 4HWZA 1GJIA 2QKIB 3F5WA 4JFDD 2B1AH 2Z8SA 4YBHA 1N6QL 1BECA 1IGFH 1U8PA 3OKNA 4Y2DB 5FYJE 1EJOL 4NN6B 3LY6A 1FLRH 2DLFL 2PETA 2NY4C 4XGZA 5DEFB 5E24E 3RL2B 3BKMH 4F7TB 3NCMA 4HIHA 2I60L 5F1NB 2XZAH 2EDBA 2HLFC 3KAAA 4RQQA 3EYFB 5IEKB 1S7VB 5D1ZC 2WBKA 3L7EB 4F15B 4FG6C 4BZ2L 2IADA 3MRJA 3NZHH 1NH6A 1YN6A 1IBGH 4MDIB 5BS0D 4WIQA 1ITBB 3OF6A 4AEIL 4Y4KD 3C5ZC 5JR1H 4K3JL 4YPGB 1UJ3B 1I1AD 3CUPA 1OARH 3AY4C 4JLRB 1U8MA 4G9DB 1J5OL 4Q97A 1WAAA 2OYPA 1G7MA 4P59H 3WN5C 3MV7D 2DF3A 2PXYC 1VFAB 5D6DC 1C08B 3P30L 2BY2A 1FN4B 1AGEA 3ULUE 3HE6A 3L3OB 2V7HB 1SVCP 3T3ME 4G6FD 1A47A 3JWOH 3FB8A 3IDXL 3U0PA 5KANG 4OCXL 3S37L 3HNVL 2F53A 4F33A 5BXFA 2QSTA 2Y9RT 5E8EA 5F96H 3X14A 3WLWD 2C7UB 5MERB 1UKQA 4IIQA 1CD1A 4QRQB 3KVQA 4B0MM 5E2UH 5IP4A 2ZCHL 3B9KA 3B6SB 1GH7A 1QD0A 5HHQA 3UTQB 1BQLL 4YGAB 5D7IB 5GS0H 3QWOB 4PIRF 4DN3L 1MHHA 1MF2L 1UZ8B 2HFGH 3RDTB 2Q76B 2R2BA 2C1OA 4OGAD 2OL3A 2R4SH 2DICA 4XT1C 4MAYC 3QDAA 4FQ2H 1JYNA 2FEEI 3AUVA 4FQJH 4GXVL 4KK6C 1JPTH 4R97C 5ENWB 1WCBA 1CBVL 1R3IH 4QRRE 4HBCH 2EXWC 1MFBL 2B2XH 2OBGA 5IFAH 1BGXH 1JNLL 3CSYB 1N2RB 2X4UA 4PG2A 3GHEL 4PJCF 4QO1A 4ODWA 5JW3H 4DFHA 3ARZA 4IRJA 3EW3B 5DLML 5J13C 3T2NL 3MJ7B 3LZFH 1JPSL 5E5RB 5BV7H 1ETZA 3QG7L 4OCSH 4YBLC 4PJXA 5D7LA 3IFPB 1A6ZA 2MHAA 1KIPB 5J6HA 2XG4A 5HHNA 5D7SH 3MRKA 3IFOA 3QXVA 1XMWA 4ESKA 2VH5L 1MAML 1FGVL 4YAQA 1LP9F 4HX1A 1HXYB 3UJJL 4AT6A 3V0WH 2VRAA 4JFPB 4RMWA 2IH3B 4LCYB 4RWHA 4HEME 4KROC 4NKIH 4HMEA 3QUMB 1F2QA 3D0LA 5DVKA 1ZAGA 3CH1B 1PQZB 4C59B 4GXUM 3F12B 4XVUD 2I9TB 1G9MC 1RJLB 2GITB 3SDDB 3G08A 3MV8E 1FZKB 4PGBB 3D69A 1YN7A 3U4BH 5B4MD 2YD2A 1OAXH 3QQ3B 1TZHA 5DJ2B 5DTFB 4WW1A 3S37X 1AP2B 3QG6A 3AS2A 2NY0D 1G6RL 1TTGA 1T0NB 2H9GA 3H42H 5C6WH 3O3DA 3RX5A 4AEFA 3MNZA 2V7NA 3W81A 3WFEH 2E5EA 1AR1C 4YIQB 4TQEL 1URLA 1U42A 1K9TA 5IJVA 5D71H 4OLWH 1P5VA 2WIIB 3UZEA 4L4VB 2VZOA 1XIWD 4NKQB 3RTQC 2V2WB 3QUZC 1BFVL 3BH8B 4YXLL 3MOBL 1LO2L 5GGVH 5BOZG 4GBXA 3UBXG 1JWMA 3RQ3A 3BP5A 2ZG3A 3WSQL 5KVEH 2VXTH 3L5HA 1JRHI 2W9DH 4YK4C 2QADB 4JGMA 3ZL4L 3GSRB 4OZ4B 3KPMB 1BEYL 3TT1L 4N8VA 3FQNA 2H8PA 5EORL 4YO0A 4AIOA 1OAYH 4M6NH 1QYGH 3MLXL 1NGYA 1QBML 3T8XA 3EOAA 3DJ9A 12E8H 2KL6A 5D2NE 5ID1A 1JHLH 4MLIA 3QJHB 4HPYH 4LCWB 2X4OA 4PJIB 1LWRA 4OLVL 1QEWB 3WIIL 3DMMC 4YGVB 4P99A 3NFNA 3U7AA 4D3CL 1G84A 1J11A 4I5BB 1OAKL 1PLGL 4JM2D 2X7LA 3STLB 1HXMB 3A6BH 3DI3B 1OPGL 3QXWA 4U3CA 3P11H 1ADQA 1ROWA 1ND0B 1INDH 1BFTA 4Y4FC 3Q0HA 3EAKA 1RHHA 2CKBB 4LSVL 1A0QH 4ZUVB 3WJLA 4Z77B 1SQ2N 1D5MB 1MIEH 3X17A 1A4JB 1SJHB 1M05B 3ZE1E 2FHCA 3KXFE 1FNHA 3MRDB 1O5DT 4EDWL 5C0FB 2IQAA 2HVKA 1JMZA 2BSSB 2ZUQC 1DSFL 4N5EC 3VDCA 1Q9OA 4K3EL 4NZJA 3OJDA 4FN0A 4MMXC 5ITFB 5B21A 1T1WA 5MP6L 5AUMA 2CKNA 5DK2A 1TQBB 3SCMD 5AZ2H 1LO0L 4QF1B 1LE9A 4UAOC 2VLKE 1I9JH 2DQIL 4S0SD 3FQUA 5FYLL 2HT4C 1GZPB 4YHZH 3PL6B 3ZE0F 3BWUC 1C7TA 2JB5H 4OGZA 4NNXA 2PYEE 1R5VB 5J3HC 2HFFB 5JUEH 5E5UB 4WY7L 2FR4B 2EH7L 5IJKA 3KYAA 4X9FA 2IBZX 4L9LC 3MO1B 2AEPH 5CAYB 4QGTA 4U7SA 1F45A 3GMOB 4HUUB 5SX5H 2WQRA 1RZIB 5SX4I 4U6TA 2YKLH 1QFWI 4H88L 3MCLH 2OL3H 4K94H 5CZXC 1G7PB 4GAYB 3O8XD 4Z7UE 1TNMA 2V9RA 1H3PL 1XZ0A 4UIKH 5GISL 1J8HA 2X4RB 3IAGC 5INCA 3HPJB 3HZKA 5CINL 5FA3B 3LKPA 5A2FA 1N4XH 2QTEA 3VWJC 4ZDHB 3SQOH 3NCEB 5KN5A 3VFWB 1MHPL 2BSRA 1YMHA 5SWSE 4MNQD 1A1NB 3EBAA 4DWHA 1KJ2L 4FZEH 1EFXA 1XF4A 1TQCB 5BZWB 3TF7C 3GMRB 2GJZA 1MPAL 4S2SA 2Z35B 5C9JB 5L88L 5B8CC 2YBRB 4XI5D 5FKPA 2EDRA 1CDUA 2B1AL 2Y7QA 3DUHA 2IAMC 1IGFL 3VCLB 1SYSA 4RBPK 4OF6A 3HR6A 5ERWB 1BVLA 1QVOB 2ZNXA 3EJZC 1FLRL 5ITBH 3T2OA 2JLLA 1JVKA 1K8IB 4WTXA 3BKML 2BVOA 2HT2C 3BH9A 3PP3K 4LARH 3VXMD 2WP3O 3FZUD 3RWCA 1A02N 2XZAL 2L0DA 5IBLD 3CX5K 1ZT1A 4OLZH 1INQA 1NGWB 1D5ZA 3ARYA 3NZHL 2IBGA 1G9EA 1IBGL 3V6FA 3N1FC 4N0UA 1H5BC 2VLLB 5JR1L 2ESVE 3MRQB 4S10A 3CAFA 1OARL 5D1XD 2HJFB 3RWFA 3TO4A 4QYOB 1MHCA 4P59L 4OZFB 4MB4A 3SKNB 2ICWB 2NNAA 1TVBB 1VEMA 4MLSA 4NCDA 1HWHB 3AS1A 1RZ8A 1ZA3B 4PJBF 2E7BA 3TV3H 1GCFA 4MCZA 1R24A 5JOFA 1Q72H 2JJUA 2BNRB 1ZVSA 1U3ZA 4EBQH 3JWOL 1YMMB 2KBGA 2VLRD 2H2SD 1CG9B 4H5SA 1YEFH 3ULVF 2EYTB 3G6JA 5GGUA 4EXPX 4AH2A 5F96L 1AD9A 1LHZA 2UWEA 4LVOC 1AY1H 3QO0A 4P4RB 1E27B 3BPNC 5E2UL 1D9KA 2E7MA 1EUUA 4P5MB 4OKVB 2ICCA 5GS0L 3WXVH 2F8XC 3MFFB 3SDCA 1OTUC 2HFGL 4X9BA 1Z0NA 4OZIF 2YD7A 2R4SL 1PSKH 4AJ0A 1PX4A 2AJ3A 4I1NB 3OKEB 4XMPH 5K9KB 1YJDC 2Z31D 4FQ2L 4Y5XA 4FQJL 3SGKC 1JPTL 2O5XH 1H3XA 5JW4Q 4TSAH 3TVMB 3D85B 1R3IL 2ZG1A 4U1KB 3X11B 4HBCL 4DZ8B 2B2XL 1JZ3A 4KTYA 5IFAL 1BGXL 4G6KH 4X6CB 2CJUH 2C3WA 1P4LA 1PD6A 4TUOA 5DUPH 3NBNA 1BQHG 2X10A 4LHUA 3DARA 5JW3L 3HZVA 3KPRD 3LZFL 3CDGA 1FNGA 1KNOB 5BV7L 1LO5A 4OCSL 1WBYB 4M7KH 5D7SL 1D5XB 1FSKB 4AG4H 4JFXB 3MNWA 4QXUH 5KS9E 2D0FA 2R8SH 1N64H 5DHVA 3VI3F 3V0WL 3ARDB 4BZYA 3LDBB 2NW3B 4QKXB 1R0AH 3MYZA 4NKIL 3PXJA 5JIHA 3P9MB 1JK8A 3S8WA 2XN9D 3ALPA 1W8NA 2A38A 1JGLH 4L29B 4IOFD 1S5HA 3HZMA 3L1OH 4DZBB 5I2IA 2VSDA 3U4BL 3AC0A 1IFHH 1OAXL 3DRTA 1I1FB 3CZFB 4PJHE 3TBTB 4MX7B 4PJ5A 3X12B 5C09E 5B39G 3H42L 1LMKA 4PJCB 2Y4SA 3D39B 3WHE0 3WFEL 1WVZA 3DXAB 5JDSA 1YUHA 3H7BA 1ACYH 3B8SA 5D71L 4OLWL 2DWEB 2GQHA 4OD2B 5E00A 3C8KA 3ROLA 4LLDA 3CDYA 5EBLB 2FJFB 5FB8A 3R4DA 3V8CA 3UTTD 5GGVL 5J06A 3C08H 3L95A 1ZA6B 5KVEL 5GS3A 1XFPA 1HHIA 2VXTL 3LOWA 5FYLE 2W9DL 2VQ1B 5ACMA 2DL2A 5ISZD 3VGFA 4HV8A 1S9WB 4P48A 2IPKA 3BHBA 2CXGA 5AZEH 1U6AH 2FHFA 4R2GC 1NANH 1LEKA 1RJYB 1REIA 4TOYH 4DCQB 4WI3A 8FABB 4BFGA 1OAYL 1XGTB 4M6NL 1NCBH 1QYGL 4GG8B 4ODXB 2UZXB 3GMNB 5IROA 12E8L 4WUUE 1JHLL 3VFRA 2X41A 4HPYL 3BEWB 2AEWA 4O2CA 3TJEH 4M48H 4HMDA 4X4YB 4PRPA 1T2QH 4PJDB 1EHNA 2VABB 3HA0A 3KYMB 3U2SA 3LN4A 1IEAA 1M4KA 3FB6A 3A6BL 4Z7NE 3UZQA 5CJ8A 4UZGA 2FRGP 3P11L 4M3KB 4OIBA 1U8IA 4XXCA 2X05A 3TCLA 4HGWA 1KIQB 2I5YH 1INDL 3K0WA 2GY7B 4KHXH 1A0QL 1ZGLP 4KK8C 5HGAA 5DJZA 4J3WA 1MIEL 4J8RB 3MODH 4KV5F 4LBEB 4XBGA 2EDKA 5HDQH 4GW4A 3AM8A 3OB0K 3C09B 5D1QD 4X7EC 3DX6A 3BOVA 2XIDA 2XWBA 3U7WH 2BERA 2YSSB 4KUZH 3PWJB 5AZ2L 2CUMA 5JHDE 3FB5B 5E6IB 1I9JL 1M7DA 1K8DA 1NDMB 4YHZL 3HPLB 5GS1A 3ARGD 5GRVL 4O2EA 4DGIH 3AXLB 1OVZA 2JB5L 4LNRB 2FECL 5FHAH 5GGTA 2MQ0A 5FIEA 5JUEL 3TZVC 1OSPH 4PRDB 2YPLE 2ARJB 2RR3A 1U91A 5F7KC 2AEPL 4P4KD 3C6LD 4I13B 3W9DA 4LVNB 2YKLL 1VENA 3MCLL 1J7VR 1KCSH 2OL3L 1CFQB 4RIRB 5EOTB 4K94L 4FFVD 3BX7C 2NY1B 4ODUB 5ESAB 4TNWK 4UIKL 4Y1AB 1CFNA 1T2JA 4ALAH 3CFCH 4JFEB 3UAJC 1A2YB 2R1XA 5DVLA 3CIQA 5JW4N 1N4XL 3C8HA 5SWZD 1T7XA 1D5BA 1A4KA 3SQOL 3T65A 5JIPA 4RAVB 4CMHC 3LKNB 4FZEL 5JLZA 1T1YA 4Y4HC 2P5ED 5K9QI 1MJ8H 5E9DD 1UXSA 1LNUB 4NQCA 1IGYA 4M6AA 5A3IC 4NCC1 4W81A 4NP4H 3SPVA 1ORQA 3NCYS 2X6MA 4EKXA 3Q1SH 4JVUA 3IKCB 3RWEA 5DHVH 3UPAA 5EU6B 4MQTB 3LKOA 1JPFB 3VH8B 5EO1B 3DURA 5FEBA 2E9JA 2Y07H 5ITBL 1P7KB 5T1MB 1XR8B 4IIQC 1UCBH 2B0SH 5FF6B 3IGAB 5I1JH 4HZLB 5KSBE 4LARL 4J3XA 4UQ2B 1KYOJ 1VGKB 3MMEA 3VXRB 4QHKJ 3SKOB 4M02A 5H94B 4BH8A 2PO6D 4OLZL 6FABH 5MENB 3JWNC 4ZNCD 1DVFD 3KLHC 5BCAA 3ZHKA 1NGPH 2IAND 3QI9A 1IKNA 3RPIB 1ORSA 1DE4A 3PWLB 4NKDB 3QR2A 1AGBB 2EIZA 4NQVB 5HGDB 4MNGE 5IVXF 3L3DB 1MNUH 2WBWB 4FXGA 3BZEA 1KGCE 1P84J 2XTJE 3ILQC 2X5PA 5F7FA 1V7NH 2NZ9C 3QUYB 3DVGB 1FL3A 4CU7A 2EDEA 2G5BB 2QKIA 3TV3L 1Q72L 4WWID 1C12B 4CU6A 1YEJH 1MQKH 2GJ6D 3P0GB 4B5EA 4EBQL 3Q5OA 4U05A 4ZOBA 3HFMH 4MCYB 4P2RD 1YEFL 2OJZH 4Y2DA 5F7EH 3OJVC 2APFA 1AY1L 2E6JA 3MRFB 3MNVB 2ADFH 5DEFA 3OKDB 3RL2A 4Q2ZB 4F7TA 4JREC 3IFNH 1GHFH 4U6HB 2Z91B 5F1NA 3VWKA 3WXVL 1IM3B 4MVBD 1CI5A 2B5IC 3EYFA 5IEKA 5HYQB 1S7VA 2UYLB 3L7EA 3B2UD 5FCSH 2Q20A 1PSKL 4MDIA 1TVDA 5C2UB 4XMPL 2O5XL 4YPGA 4TSAL 4N90E 3ZZ1A 1UJ3A 1OGAB 4JLRA 4WHYH 2OR7A 4YX2H 4G9DA 2HP4A 2VDQH 4G6KL 4H26B 3I50H 2CJUL 5DUPL 1VFAA 1C08A 1FN4A 1Y18B 1YYMH 3L3OA 2V7HA 3QISA 1AGDB 3SGDI 4RGMC 4PJBB 4QRUB 3PNWB 5E7BA 4ODBD 4O02H 4G7YH 4M7KL 3MCKB 3QDJD 2C7UA 4ZFZB 4Z7WB 2MSPA 4N1EA 5MERA 4AG4L 4A6YB 1U3HB 4QXUL 4M7ZC 2MCG1 1N64L 1RZFH 3B6SA 3CFDB 1QSED 1DCLA 3UTQA 4S1DC 5D7IA 3QWOA 1WITA 2EDNA 1R0AL 4ZXBC 4WGVB 2PW1B 5EOCH 1E4XH 1UZ8A 2F9BT 4YR6B 3RDTA 2Q76A 4APQC 4AL8H 1D5IH 3MBEB 4LSSH 1JGLL 4JRXB 5GGTH 5C0AB 4OZIB 5C0NC 2EE3A 2GFBB 3L1OL 4QNPE 2W38A 3MUGB 3QDGD 5ENWA 2CLZB 3FQTB 4HAFA 1IFHL 4U1IB 3VGDA 4MJID 2Q3ZA 3P4LA 2ZG2A 3ILPB 5IR1B 4ZFFB 3CSYA 3DUUB 4NBYB 5FGRA 1UFUA 1NSNH 1QUNA 3HUJB 3FFCD 3MJ7A 4U1HB 3ULUF 4ETQB 4RGNE 4FMFA 1ACYL 4AYFA 3T3MF 1QBBA 3IFPA 1KIPA 2UUDH 1PGRB 3HNTH 3RVWD 3BO8B 1A3LH 3C08L 3QQ9C 1HXYA 4ZFOB 3WJLC 3A6CH 1IQDB 1QHPA 1NMCB 4JFPA 2ZOLB 2IH3A 4LCYA 3QUMA 5GJTH 1DBBH 5AZEL 1U6AL 3CH1A 4IBLT 3NVQA 1PQZA 4TOYL 3F12A 3RIAF 2I9TA 3PQYD 3OAUL 1RJLA 2GITA 4P23C 3SDDA 5IV2B 1YNLH 1FZKA 2NXZD 1OD9A 4PGBA 5EFIB 1NCBL 4XB8A 3BSZH 4MNHB 3DOSA 3QQ3A 5DJ2A 5DTFA 1AP2A 4RFOH 1DANT 4S0TD 3TJEL 4GKOA 4M48L 2APVA 2XKNB 3TYFB 1T2QL 1TJHH 4YIQA 4RMVA 5DMGC 4PJ9D 3MLRH 4LFHD 3RVUC 2AQ3A 2WIIA 4L4VA 5JORB 4XCCH 1B0RB 2V2WA 3BGFC 3BH8A 2I5YL 2FBJH 1OAZH 4IDJH 3ALXA 4KHXL 2NW2B 4F37F 4WFED 3F7YB 1FNLA 4QRPB 1OTSC 5GHWH 4YDLC 2GEEA 1F3JB 3MODL 5HDQL 1ES0B 4R4BB 4PJXE 3EDJA 3GSRA 1NLBH 1X6LA 5D7LE 4YHYB 4OZ4A 3KPMA 2IC2A 2R56H 2BRRH 3U7WL 3H6JA 4KUZL 5IHUH 4BQCA 2IPUK 3I6GB 3FRUB 4ZSOB 1Z9LA 3BWAB 4WI9A 5EBMB 3ES6A 2LAGB 1IRAY 2R0LH 2DLHA