3MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 34
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg102
1NAKL 1NCAH 1I8KB 3TBTA 4DN3L 4HC1H 4ZSOE 1H8NA 3FQUA 1F90H 4FXLA 1FIGH 3GIZH 4JM2D 5LXGH 1IKNC 3CC5A 3BRGC 2EZ0C 4JG1L 4P4KA 5EO0A 4OT1H 3IJSA 2OTPA 3GHBL 1GCFA 2RR3A 3CVHH 1YEGL 4C55A 1CE6B 4ODBD 5IFHH 2CD0A 3G5VB 1N64L 3BH8A 3E1F1 4I4WB 3WO4C 3KDMA 1BFSA 2OR9H 4NUGH 3BP6A 5SWSD 2DM4A 5FF6A 5IUSA 1R5VB 5IFJA 4JKWA 3QIUB 2VKWA 5GS2D 3IETA 4HIHA 4Y5YC 2CUMA 5LGJB 2ZCLL 3U9PH 4FG6D 1NJ9B 1T89C 2R0WL 4QY8A 4PJBF 4OZIF 2V9TA 1FVCA 1D7FA 3WKMH 4OLWH 2F54E 3QQ9C 3VH8G 1P2CA 5BS0B 1K3ZA 1BX2B 3FO2A 3BIBX 4P46D 2HRPL 5E2UH 2P43B 2V5YA 1FFPA 2X4UA 5HHOB 3CLEL 4GKNB 2NW2A 3A6BH 4BQBA 1KTDB 4LSQL 4RGNB 4L1HA 4KRLB 4NQXB 3HNVH 2PO6D 2Q8BL 5D2LE 5C7XH 3IFPA 1A6AB 4GRLB 5SWZA 1DDHA 3NCFB 2KZWA 2WUBL 1CGTA 3QXUA 1OCWH 1T03H 1DFBH 4ZPTA 2C1PA 1U91A 5DFWH 4G6ML 3F12B 3QFDB 2BY1A 5FGSA 4I3RL 5TGBB 3HC3H 3IDNB 5B38B 1DLHB 5IFAH 1MJUH 3MRIB 3N50A 2JCCB 4HD9A 1YEKH 5DA4A 1IC5H 4M6NH 4URTB 1KJVA 3LSOA 3BYYA 2IJ0C 3V52L 4Z7OE 5EB9A 1OM3H 3VWJC 5LCVL 1UWXH 3VWKB 1WICA 2IFFH 5K93A 1AP2B 2W65A 3QUXC 4NC2B 4IRZH 3QIWD 2FZ3B 3VFVA 2VRAA 2AI0H 4G9FA 1ERNA 1TNMA 3KG5A 4DEPB 2DQTH 4R8WL 3M45A 3DGGA 5EORL 4RFOH 5T1KB 5TE6L 5IM7A 5IB1A 1JRHL 3TNMA 4BKLB 3C60C 5DEFA 3V0WH 4X7FC 3MV01 1A7RH 5KS9E 2WW8A 5ISZB 4XCNA 1E4WL 3FHAA 1BZ7A 1A7NL 1U8KA 5J12B 2FL5B 4LOUD 1S9WB 4ODTH 2FJFA 4HXBH 4QRUB 1CE1H 3EO9H 3OKLA 4PUBL 3D0VA 1XIWD 3U82B 2ARJA 1F3DJ 1AJ7H 5JTWA 1CK0H 1FN4B 2YEZB 1DQQB 1P1ZB 3TH3T 3JTTA 1S9XB 4PJDE 3PGDA 5CKGA 1UC6A 1UVQA 3SJVB 1X5LA 3PGFH 5DC0A 3LKNA 5DT1H 5JR1H 5EBLB 4KQ4L 5E8EB 1XGTB 5EBGA 4KH2A 2A9ML 4XMLL 2AABL 1PW3A 4K3JL 4PJXA 2BHUA 2BRRH 1RUMH 1AGFA 12E8H 4M1CD 2VXQH 1A6VH 2W91A 1U2HA 5HPMA 3A6OA 3VXNA 1T1YB 1XF4B 3H3BC 1TENA 3ECBB 1S5HA 3SKMB 2VISA 3G08A 4DK6A 5IBLD 4P2RA 1QLFA 3EYSL 4F7EA 1ZA3B 1KGCD 2XZAH 4KROC 1KIPB 1BAFH 1V7MH 3TIEA 3HZMA 1M7DA 2P8PA 2GEEA 1MSPA 5F21B 4AY0A 5H2BA 3KWWB 1FCCA 3ZDZF 4ZXBD 5D1QD 3C2AH 2DWDB 4PJ9A 4HF5L 1CFTA 3WFHA 3VMNA 2VLKE 2Q87A 3QZWA 3ZDXF 1R5IB 4PJAE 1CFNA 2ITDA 5ID0B 3HMXH 3K80A 1QHOA 1JI2A 2JJWA 4JM2F 3SO3B 1QNZH 3RY6A 1XF5A 5EUOA 4UOJA 1QEWB 4JANB 2F58H 3D5OF 2I07B 2N1KA 3QPQC 3NCYP 3I02A 3DX9B 2YXMA 1DE4A 5FO9A 1J0IA 1FNGA 2UVFA 3ARQA 4LPCA 2E7CA 5FOBA 2VLRA 3TN0B 5I0ZA 3NFSL 4OQ1A 4TOYL 3OR7B 2VDKH 2BSTA 4YBLC 2YPKA 3HC0A 4NRZB 3L5WB 2P46B 1HH9B 5F9JA 4F80A 1QUNA 4DUWA 4UDUA 1XMWA 3C9NB 4NWUL 4WFFE 5JHDD 2FH6A 3UYRL 4MDJB 4OZFG 2NLJA 1C1EH 4KTEL 1A64A 4WFFD 1F8TH 1LP9F 5I74B 3O45A 5J9PB 3T0EC 4DZ8B 1YNKH 4WDIA 1C16A 3X14A 1D9KC 2BVPB 3SE9H 2BSRB 15C8L 3QAZC 4H25A 3BPOB 2ZOLA 4KDTA 1BEYL 2F19L 1H3PL 4NOBA 1B0RA 1DLFL 2VR5A 3FRPA 5HY9A 3NZHH 4GG6A 3HB3C 3BKML 3QDGE 3SEPA 4W6YB 4UT7L 1T1WB 2X89D 3NABL 3FKUS 2GJJA 3EDEA 4JKMA 3LV3A 1QFHA 1AIFB 4HUMB 4PJIB 3HMWH 5F9WC 1X7QA 5IHZA 3SDXB 4S1RH 4D3CH 2XKNB 4KMTL 1UB5B 1G7JA 3UC0H 4G6FB 3UTSA 2H1PL 3ARRA 3Q6FB 3SDDA 3DVGB 3VD9A 3MGOA 1SY6A 1KCSL 1FO0A 4P3WA 4B41A 4NRYA 3FTGA 5D72L 3MGAA 1G1YA 1QZ1A 3SGJA 1N0LA 1S7SB 4JPKL 3B8SA 3BVNA 2XZQH 4GOSA 4RIRB 4WFHE 4ZPVA 4EI5D 3IS0X 4L4TB 2B7DT 4JN2B 2BNUB 2Y36H 2UVEA 1H5BC 2Y23A 2X1OA 5DO2D 2B0SL 5IR1B 1BM3L 3DNKA 3FAWA 3PG2A 4S1DC 5EN2B 3TVMD 1OD9A 2HFTA 4K7FB 5D1ZB 5KANG 3RUGB 1BD2B 3TCLA 1CLYL 1G9NH 2NR6D 3Q6GL 4NCDA 5C08B 5EIIB 3ARDC 3MFGB 5IVOA 1A3QA 2ZPKL 1NMBL 1CD9B 4U3HA 1I7RB 3ARZA 5I1DB 5CILL 1UJ3B 3WXWL 2VUOA 3RWDB 1GH7A 3TIDB 2IADA 2RAMA 3WBDA 2DBLH 5ESAB 1HKFA 3RWIB 2J8UE 5L2KA 4WW2A 3FB5A 3OF6A 2CXGA 2IH1B 3NA9L 4JRYE 4R90L 1RHHB 1QSEA 5HI3D 2VSDA 4ZS6C 5I19L 2XG4A 3MNVA 3DVNB 1NFDB 2MOVA 1UM5H 2YD8A 5IMLB 3MRHB 4YAQA 4JGJA 2ZSWA 2A0LC 3OKDA 5GXBB 5I75B 4GSDL 3QA3A 3CXHJ 5D6CB 3UP1A 4U1SA 2W59A 5FA3A 5GZNC 3U1SH 1INEH 3RDTA 3ZT7A 1NDMA 5E8DL 2HT4C 2XY2A 2DLHA 2Q76B 5MP6H 4LRIA 1TQCB 4MNHB 4HCRA 5F3HA 5KOVC 2Z92A 4HZLA 2MSPA 2YN3A 4FQ1H 1MREL 4PJ7A 4X98B 3HNSH 4YHOH 3VGDA 3AREA 3RVTC 3EFFB 1JNLL 3RWHB 5ACLA 3O2DL 4UT9H 5IGXH 1R3KA 2X44D 4WWKA 2DLFL 4P23B 4RMTA 1NCBH 3VXRB 2XTLA 4ODXB 2F5BH 3OR6A 3HPLA 3SDAC 5DD0L 1A6WH 1HINL 3U48A 4KAQH 4YHML 4XBPB 3B2VH 3QDJB 4S10A 3CFJB 3VH8A 1ZVSB 4F37K 4W81A 3QDMA 1JWMB 4J12A 2IPUG 3O2WL 2VDRH 3EYUL 1OAYH 3U9UA 4TVPH 1TQBB 4QHNB 3PNWA 3OJMB 4K94H 4XI5C 3TJHC 1XGUB 2Z91A 2EIZA 3HI6H 5EO1B 5JORA 2AS5M 4H8WC 4S11A 1CGSH 4NQUA 4GMSL 5IWLA 1F4WH 5KVEH 4S1SL 5DD5H 2MHAA 2R2HA 3TYFB 3DRTB 2GHWB 2P5EA 2BVOB 3PUCA 5ACZB 4Z7VB 3VD5A 1QR1B 1ADQA 4G6AC 2GJ6E 4IS6A 5SX5K 3MREB 3DUSA 4I18C 1RUAH 4P5KB 3RBSA 5IB2A 2GJ6D 1OSZB 1RUPL 5C0IA 5FYJL 3IXTB 4PRID 3O3BA 2EIBA 2ZSVA 2DQEH 4D2NA 2GIYA 2VYRE 1J1PH 4ALAH 2MWCA 1L7IL 3P11L 1X5AA 3PWJB 3L5XL 4B5EA 4QHLA 3KLHC 3KAAA 4DKFL 5HGHA 3O6FB 4Q6IA 3WFZA 1P4IH 3BAEL 5FHBH 1Q38A 3SGKA 2AQ3A 1YQ2A 2FHBA 2WBJD 1EGJL 4AQ1B 1FL5A 4K7PH 5F9OL 3F7VA 1UM4L 1T22A 4HFWA 1HXMB 1A6UH 3EO1B 3MRNA 1BQLL 3ARGC 1AC0A 4QHMB 4LDLB 1YA5A 3DV4B 4LVNB 5A3ID 5IOPB 3BDYH 4F33A 1EJ6A 1V5JA 4XBEH 5HDQH 4P9HH 5E5UB 5C0GA 4M3JA 1QTYT 1HZHL 1MWAH 2YD5A 4JO2H 4ZOAA 1YMMA 4X9BA 2ADFL 2AQ1A 1ED3B 1B0WA 3GMOB 5EC1A 2X4OB 2DYPA 5EBMB 5J6HA 32C2A 4QTHB 1FGNL 1YEIL 1PKQE 5I1GL 3MV7E 4P9MH 2R69L 2A2QT 3MV7D 1I3UA 5DD3L 5GS1A 4KI5C 3ILPB 5GGRA 5IG7B 5K9QI 4P4KC 5BXFB 2XZCL 4F7PB 5CUSL 1JPFA 4IDJL 3S8WA 3L3DB 1P7QA 1VDGA 4MXVE 1MCSA 3PJSA 1FLTX 1L0XA 4QNPF 2EZ0D 4NZRL 3FONB 1G6RA 3HRPA 4LCUB 2VXVL 1S7XA 2EEDA 1TXKA 4G43A 1WAAF 1MY5A 4LAQH 5E6IB 4QRQA 3OGCA 1DQDH 1Q9KA 4HV8B 4Z0XA 4NNXB 1MIEL 4FQXB 1J1OL 3CDCA 3GMLA 1NMCC 4MZ2A 1OAKH 1HH6A 1Q8MA 3U7YL 5F7KC 3MACL 5ID1A 4KTDH 3MYJB 3CSGA 4JKPH 4JY6A 3KPSE 3KPSD 1IAOA 3M07A 1NEZB 5EU6D 1E4JA 3JVGC 5CMAA 5K9KB 1Z9SA 1WLHA 3PP4L 3CNKA 4HPOH 3NIDE 5SV4A 4C4KT 5GS2H 2H3NB 3TBWA 3ZSTA 3MLYH 2BJMH 1H3XA 2OK0L 4YBQC 4OD3H 3TT3H 4L9DA 3QQ9D 2HH0L 5KSUA 1B2WH 1S7VA 1FNLA 2HTKC 3GHEL 5ANMA 2P24B 3CFKA 2EDQA 1KB9K 1UGNA 2QSCL 5CJXA 4MVBC 1REIA 4O2CA 4X7DC 5BV7C 4YHZL 1N4XH 2W38A 4JRXB 4F3FA 1CICB 4OZFA 4W4OC 1KJ2L 1VFOA 1U8OA 4PGDA 1UXSA 1AQDA 1N6UA 3BUTA 4HGWB 5GGVH 4Z77A 2A77L 4CMMA 4FQQA 2IALA 2DQUH 3V6OA 4KUCD 3PWLA 2B5IC 3D18A 4LAJH 5AZ2H 3WIHA 3KYNA 2AV7B 5D7IF 4GW4A 1IARB 1T04B 4RCAA 3VWJD 1DBJL 2G9HA 4H8WL 5EOTA 4OV5A 4MJ6B 4X9FA 5KVDL 4GG8A 1AHWA 3QUXD 3DHMA 4QRRB 1MFNA 3EYFA 3LPFA 3O8XA 1TJGL 3EOAB 5CZXC 1Q94B 2QR0B 4LEOA 4LRNH 4YO0A 3FO0L 2Y06H 1BQHB 3C60D 4ZUSA 5M7QA 1I1CA 3ARBB 1I7TA 3D87B 5AAWA 1J86A 4EUPH 4TPRL 4HJ0C 3VGBA 5BZDA 2E9JA 4ZO6A 2FGWH 4P5MB 3T0WA 3AUVA 5GSVB 5CGYC 3RIAK 3SDYH 5EC2A 4Y4FB 5DR5L 5CWSB 2IC2A 4U1MA 4ZDHB 3E0GA 1UWEL 2NMSA 5D7LA 5CBEA 4WO4B 5E1AB 3H9SE 1FL6B 1T2QH 2YRPA 5IEHA 2AV1A 2HG5A 3VI4E 1ZTXH 5L9DL 4RDQF 3RIFF 3H6JA 1FZJA 1DP0A 4O9HH 4LSUL 4HUVA 1G7MB 1NGWB 2ICWB 4Y16A 4A6YA 1D6VL 3ZLQC 4H1LB 4LLWA 1QFPA 3GI8L 3L3IB 3CDGB 5I1HL 4OF6A 5F1NB 2Q86B 3GKWL 3VXUE 1CGXA 3AY4A 3EO0B 1X4ZA 3LKQB 3LMJH 4OSUL 4NPYB 3HHRB 1NCCH 1YY8A 5BRZB 3VXUD 4TNWF 2X2YA 1BBJB 35C8H 1A3LL 4M7ZC 3WUWB 3MLSH 4MQ7B 3M8OH 2CMRL 2DICA 3VFMB 3KLAB 3RY6C 2ZJSL 4PLKC 4DGYH 1ZS8A 1QVOA 2GITB 2Y9RT 4BYHA 1B0GB 5HI5C 3VG9B 2Z31A 3U36B 1F3JB 2F15A 1YEHH 4MXVF 4LIQL 4CW1B 3QCVL 3ESVF 3CX2A 1UH3A 3GZKA 3WS6A 3TESA 5KZCD 4J3TA 3QPQD 2NTFA 1AH1A 1NBYB 5BVPL 5GGQH 1LO0H 3LDBC 4BSJA 5B8CA 1YJDC 1N59A 4FQLH 5F1IB 1IEAB 5MEQA 3IDJB 2XA8L 3U83A 2XV6B 4RMQA 1VFUA 2JK5B 1BGXH 2H2PC 1AGEA 2B4CC 4KRMB 4CNIA 4ZO7A 1MCFA 3HG1A 4HKBA 3T8XA 2XWJA 1JPST 4P2QA 3V79C 1X9QA 4NKOA 1KEGH 1L9NA 4PJ8D 1ACYL 1LO2L 4G9DA 2CKBL 1KCUL 5C09E 4KDTC 3IDYC 2AJZA 3PIQA 4FXGA 5FYJE 3QUYA 5C0ND 4NYLA 2ATPB 4ODUB 4IHOB 2XFXB 3T0EE 4PGEA 1WBYA 5FYJD 5A1AA 4FZEH 5F7EH 3D3VD 4OIAA 3S35L 1D9KD 1A7QH 4ZS7L 4U6VL 2VXTH 1IGJB 4NN6B 1I3GL 3STLA 4RAVA 5JPNB 2ESVA 1JVKA 3OWEA 4HWNA 5ILTH 4OLVH 3MBXL 1UYWH 4X4ZA 5EZLA 3HB3D 5FUZH 3N1MC 4U6XB 2HTLC 3MO1B 2Y7QA 3OPZH 1TJIH 2I26N 4M6OH 1RZ7H 3S4SG 2OI9B 4MB4A 4PY7B 5BV7L 5MEOA 2YKLL 3VGGA 3SDDC 5HGDA 4BH7A 1BVKA 2AAVA 2EO1A 3D85D 2SEBB 4JDVB 4Y4HB 3K74B 3P4NA 1B4JH 4WFEE 3WD5H 3SGJC 4ACPA 4WFED 2EKJA 2NY2C 5FFLA 4KUCF 1MFEH 5C0AE 5I1IL 1UADC 4BFGA 5C0AD 3CVIL 5IV2A 3T2OA 5ITBH 1VHPA 3G5ZB 1D5ZB 1U3HB 1VFAB 4YLQT 1TMCB 1FFNA 1JN6B 4WI2A 4YUEL 3TFKC 5CJOH 1SYSA 4P2CG 1CTOA 5GGSY 2X4QA 4BZYA 1K4CB 4OIIL 3TA3A 4F7MA 2PYEB 3K3QA 4KU1A 1N6QL 1CIDA 4PJ5E 4QGYA 2Y07H 4BJLA 4PJ5D 2ERJC 2JELL 3GGWB 1LK3H 2Y1VA 2BOBA 4M1GH 4S1DD 2MNUA 1XR8B 1AXTH 1NAKH 3W0WB 1RZ8A 1T4KA 4C58B 4DN3H 3NZ8A 1A4KA 1CVRA 2QADB 3GO1H 4WW2C 5IVXA 1VKXB 5HD8C 5TDPB 3S5LB 3U0PA 2EH8L 3JBG7 2CDFB 1OAUL 1DVFC 4JG1H 2K7QA 5DMKA 4YJZL 1V05A 2E7HA 2AKRA 4E5XB 2HRLA 3GHBH 1MHEB 1U92B 5BZWB 1YEGH 3HE7B 3LD8B 1N64H 4M02A 1XGYL 3GJFK 4OI8A 2V7HB 4Y2DC 4ZS6D 1WC7B 3RDTC 2ZOKA 4DFHA 2XXCB 3OAUL 1MCDA 3EAKA 3VFSA 2A0LD 4JQVA 3VXSE 2BC4B 4JZJA 5D7IB 3VXQA 1DBKL 3VXSD 1T0NA 4JLRB 1FYTB 4RMVA 1RK1B 5GZND 2ZCLH 3D69B 3BQUB 3AREC 1WISA 2HT4D 4XVUD 4NO5B 4XWGL 4WWKC 4ELKA 1A1MA 4ZFZA 3IAQA 3OAZH 4NKMA 4XX1G 1K8DB 2EKSB 4JE4B 4CJ1A 1JE6A 3O2VL 4QKXB 5E4IA 1ZGLB 3VFUB 2IBBA 3FT3A 3RVTD 3GJFB 3IKKA 5B38G 4QT5B 3VGAC 4NZTL 3FQWB 1T6VN 1TTFA 2CSPA 3QFJD 5BO1L 2IANA 4OGAC 1VEMA 4IRJD 4Y19A 4LPYA 2HA1A 1UZ6F 2EE9A 5I1AA 2Q8BH 4LU5H 3T0XA 1BFTA 3MV8E 5DJDA 5EPMB 3BRDA 2UZIL 3ET9F 1U58A 2WUBH 4HIJA 4LCWB 5IMMA 4FHBD 5IWLC 4PJGB 1Q0YL 4G6MH 5I9QC 4PJEB 1YJDL 4I3RH 5C2BL 4XI5D 1KN2L 4WHYH 3TJHD 4C56E 1XGRA 2AK1H 2XXMB 5TDNB 1HOCB 3QPXL 4HKXA 4H0IA 5IW1B 3ZYIA 5DA0B 2GJZA 3VRLF 2B4CL 3IF1A 3UJJL 5LCVH 3B6SA 3M17A 3QNXA 1OGAE 2OBGA 3RL2B 5T1DL 2P48B 3QNZB 1M71A 4YPGB 5D1XB 2BFVL 4UDTB 4G6AD 4R8WH 2KL6A 3H0TB 3UPRB 5EORH 5TE6H 3I6GB 3N1GC 4Q6IC 1JRHH 3REVA 3BIKA 5B21A 4LNRB 3SGKC 1DN2A 5BQ7B 3VFOA 4LFHG 1A7NH 3V4PL 1IE5A 4L9LA 3KLHD 1MHPL 2VWEC 1OGTA 4PUBH 4LVEA 3UTPE 4EEEA 5E24E 4X7SH 3B9AA 4ZUTA 5FA4A 3CK0L 4Z7UE 3ARGD 1ZLUH 5BCAA 3O3EB 4KQ4H 5C0CA 5JOPD 2A9MH 3MBEA 1SY6L 4XMLH 1FO0L 2AABH 2NY3C 4K3JH 3DARA 1U6AL 4MAYA 4OZ4A 1MVFA 2CK0L 4N0UE 5I8CA 3GMRA 4YDLB 1NBZB 4HWEL 2D2OA 2P5WA 4FFYH 5GS1C 3V6FB 3LN5A 4FRWA 4S2SA 4UU9B 4MB5A 3KXFD 4FMKA 3JV5A 2JF1A 1OT1A 3EYSH 2OTUB 1RIHL 3ZDYF 4JGUA 1CT8B 4K8RC 5DHXB 4KI5E 5FDWB 4KI5D 1LEGB 4PTTB 4P4KD 4X5WB 1NLBL 1YPZA 5J1AB 1UWXK 2VXSL 3DHJA 1HQRA 4P99A 4D8PA 5I73C 4HF5H 3X11B 3A6CL 1P5UA 1I7ZA 2C3GA 4MLSA 4PGCA 3UEZA 5IJKA 1LHZA 4F7CB 1JGLH 4LSTL 4XNZC 1S7RA 4P4RB 3CSYB 4L4VA 3MC0A 1E4XL 4NQEE 5GIRB 5ELIA 4U1HA 4E41A 1I1AB 2H9GA 4QRTA 4POUB 2NNAA 2PR4L 4Q9BA 1EAPA 3FRUA 3W39B 1P84K 4KWUA 4OZGE 4LL9A 2OL3A 3L5IA 3MSPA 3OKEA 4R4FL 3MRGA 1M1SA 1JTTA 5E95B 1JYVA 3VGEA 3ZHKA 3NFSH 4NUJA 3TJEL 4TOYH 1IAKA 1HQ4A 2CIIB 5D96C 3ZE1E 1N5YL 4X6DE 4P2OB 3ILQC 4N8PA 2FYYA 2Z35A 3BPLB 5E9DB 4EDWL 4PJHA 2P8MB 4HCRL 4LPWA 1I85A 1TIUA 2QKIA 4KJYA 4NWUH 4MX7A 2UYLB 5CJXC 3ABZA 1N5AB 3TBYA 4Y88A 4AG4L 1YN6A 4YBQD 2HVJA 4KTEH 3KJ4B 2FEEI 1ZLVH 3TWCH 3BE1L 4XAKE 3E6HB 5DJCB 3ELAT 2VLJB 5SWZE 5C2UB 1QA9B 4OCMC 4G42A 2Q7YB 4HUUB 15C8H 3BHBA 5SWZD 2HTKD 3IFOB 4HLJA 2FIKA 1H3PH 4QLRA 5DUML 4BELD 3QEQE 4DVRL 1DLFH 2VN4A 43C9A 3BZ4A 2FHFA 3QR2A 3QUKB 3V6OC 4MCZB 3BKMH 3VI3E 5BVJA 1NC4A 3B9VA 3P73A 5DEGB 4UT7H 4U1JB 5T1LA 4XPTL 1JWUB 2YD7A 3QXTA 1XR9A 3NABH 1QLRB 4XP6H 3FOLA 4AEEA 2APXA 1F4YL 3WE6B 5D6DA 5A2LH 4NBZB 1AHWC 4XNUH 4YGAB 1O7VA 4HW6A 4G9FD 4CN6A 4KMTH 3O8XC 2CH8A 4MXWL 5C0BE 1OTSD 4XCEB 5CGMA 2OQJB 3S4SA 1ADQL 3WHXA 1KCSH 4U6HB 4QXTB 5D72H 1JTPA 2N4IA 3PV6A 5EFIB 4Y0GA 5L0QC 4JPKH 5K33A 1ONQB 4YK4B 4WCYL 4WJ5A 5CZXD 4XHJC 3ULUC 1LEKB 3TV3L 1U8MB 2GK0A 1P7KA 1KIQB 3BSZL 1U95B 3CH8A 3VXME 3OHXB 4QXWA 5GJSL 3UJTH 4LQFL 4ZUWA 4MQTB 4HJ0D 2B0SH 1I8KA 4HKZB 1BM3H 2YD3A 5KSBF 3CMGA 1NBVL 3SCMB 1J11A 5F3BB 1YUHB 5D9SB 4DOHB 2YD9A 4OI7A 1CLYH 4FTVE 4PJXE 5D2NB 3LZFL 4R96B 1UB6B 4UQ3B 4OF8A 2BVEA 3DURB 1H3GA 1NMBH 2ZPKH 2YHGA 4PBXA 1YNLH 3DX6B 4NJAL 1CE6A 5CILH 3G5VA 2IBZX 1A8JH 4XB8A 1V7NL 2OR8A 4I4WA 3BD3A 2OSLB 3HRZA 3UTTA 5HHQB 4JFDE 1KB5B 3NA9H 1W0WA 4P2RD 4R90H 3AY4C 4CMHB 3R06B 1F2QA 1NPUA 5I19H 3ARUA 1I3RB 5JPMB 4HWBA 5F7UA 4MMZC 1ODAA 5KSVB 2NY5C 1B90A 4OUUA 5LGJA 3QXWA 1A4JB 3JTSB 1RURH 4H88L 1NJ9A 3WDIA 1A7BA 2OMNA 3BJLA 4PJ9D 5T33L 1WJ3A 5E8DH 5FKAB 1AKJA 3ZE0F 2Z31C 2PXYB 1QFUL 5BS0A 3K4DA 1G1CA 5EUOE 3Q48A 2GYSA 4HK3N 1EEYB 4PLKD 2NXYB 3EYVB 4GAYB 1O0VA 1MREH 3WS6C 5HHOA 3L3GB 1GAFL 1A0QL 3CZJA 3SKOB 3IDGA 3BGFC 5GZOC 1KTDA 1G6RL 2RFXB 5HI5D 1JNLH 1NL0L 4X6CF 3O2DH 5H37G 4UI2A 3G5YB 3QQ4B 4NQXA 2V5SA 2DLFH 5C9KA 1J8HB 1CGYA 4X9GA 3ARPA 5DD0H 1A6AA 4GRLA 5HVFB 2VLRD 5FYKU 5HYJA 1FL3B 3H9ZA 4U2YA 4HX1A 1UA6L 4YHMH 3BX7C 4RX4A 2NXZC 3QQ3B 4WTXA 3EDJA 3EJYD 3F12A 3QFDA 4YQXL 5TGBA 5B38A 1X4YA 4EIGB 1DLHA 3O4LB 3EYUH 3MJGX 3MRIA 1M05B 2JCCA 3G6JB 9CGTA 2W9EL 2H2PD 5CIPH 3NAAL 1I9JL 3QUYC 1BIIA 5DJYB 1IGML 1TZHA 4G8GB 2XWBB 2KUTA 5GRUL 1KXTB 3IXAB 3WLWC 4GMSH 3BPNC 3MV9A 4C83B 2FZ3A 4S1SH 4U1IA 1WSST 3CLFL 5F7DB 1IKFL 4KMQA 2R2EB 5T1KA 5KN5B 4TQEL 1U8JA 4GG6E 1CD1B 2CLRB 2F53E 1F3DH 5ISZA 3WFEH 1N3NB 1RUPH 2YSSB 5FYJH 1PQZB 1MFAL 2FL5A 1S9WA 3GMPB 4JY5L 4EN3C 5I0DA 1RD6A 5B4MD 3VFGL 1NGPL 4Z9KB 4L3EB 5L8LB 1W0VA 4JVPA 3UYPA 3BD4A 1L7IH 3P11H 3UTSE 2RQ8A 2HTLD 1FN4A 1DQQA 1P1ZA 3LEVL 3UTSD 3BAEH 4QCIB 2WP3T 4ZOBA 1EGJH 2J88L 1PZUB 2B2XL 5EBLA 5F9OH 3SDDD 5E8EA 1XGTA 3V8OA 1UM4H 1CDGA 1I9EA 4U7MA 4F58L 4MNQB 5FYLE 1TVHB 3HE6B 2JIXB 1MLBB 1BQLH 5JW4N 2NY2D 3GSRA 1JPSL 3WN5B 5C6TL 2BRQA 3TA3C 2AJSL 5DGRA 5I17A 1CYGA 1T1YA 1HZHH 5I2IB 3TO2B 1UEYA 3ECBA 4OGYL 4I77L 3TFKD 3KPQB 3SKMA 2ADFH 3H3KA 3W5MA 1G6VK 4HKJB 1KIPA 2EDJA 4FFVC 1FGNH 1VACB 1YEIH 5IIEA 4AEHL 2CRIA 5I1GH 4RWYL 3W2DL 3JWDC 3KWWA 2R69H 4NNPH 3ULUL 1E6JL 3DO3A 5DD3H 2DWDA 1A7OL 3TBSB 2XZCH 4NKIL 5JDSB 3JSSA 5CUSH 2R0ZL 1GOGA 3IDMB 4PRHB 1T0PB 1INDL 4IDJH 5F7NC 3VFTB 4YEFA 4MS8C 5ID0A 1PBYA 3G9VA 5L2KD 3OF6D 5HD8D 3S36X 4EZMA 2CRMA 1QSED 1U9KA 2J4WL 4WFGE 1QEWA 3F8UB 4NZRH 2I07A 5J6GB 2VXVH 1NEZG 4JQVC 1CN4A 4JZJC 3DX9A 4Z76B 1H8SA 1MIEH 4LGSB 3D2UB 1WZKA 1J1OH 3C5JA 4A6YL 3TN0A 5A2JH 3BUYA 4NO0A 5CJBA 3RDTD 3X12B 3U7YH 2Y25A 1VGKB 2J6EA 5CEXB 3T3ME 3MACH 3KS0H 4PJFA 1D6EB 4NRZA 3L5WA 2VO5A 1HH9A 4X8XA 1LO3L 4OFIA 2IGFL 1FV1B 2NY5L 3ARED 3O11B 3V5DB 1BOGB 5GS0C 4M7KL 3PP4H 2YN5A 3HLAB 5D5MB 4JO1L 5J9PA 4WWKD 3TT1L 5D70L 3MOAH 3NGBC 2OK0H 1R3HB 5SWQB 4OF5A 1MJ7L 1ITCA 1SJEA 2HH0H 2CO7B 4C59B 4LBEB 3QDME 5J06A 3C87A 4MHHI 3GHEH 5E08H 3QDMD 2H2SC 2H6PA 2QSCH 2R2BA 4OGAD 4NN7B 2BHYA 2CUIA 4JFFB 1W8NA 5H94B 3WEXB 4YHZH 3TZVC 3NCJL 1KJ2H 1V3LA 4ONGL 5TF0A 1A2YB 1AIFA 1IAIL 2N7AA 2DQJH 2P45B 1DEEB 5FO7B 2L7JA 3QG6B 4HPYL 2A77H 2B1AL 4LDEB 2XKNA 5CEYA 2P5EE 3L7FB 4GO6B 4AZ8A 4OI9A 5FCUL 1JPTH 3DETC 1G9ML 2P5ED 3Q6FA 3ULSA 4NP4H 5F7MC 8FABB 1IC4L 3OJDB 4YC2B 3DVGA 5F1OB 4PYHA 2NY6D 2YPVL 2DQFA 3IYLW 1FZMB 1S7SA 1DJSA 1DBJH 1ZVHA 4H8WH 5KVDH 5DI8B 1ACZA 4ORZC 2O5ZL 3DOSA 2XT1B 5F88B 1HCFX 3FZUC 4X7EC 3OAYH 4JN2A 4PJBA 5F6IC 4OZIA 1TJGH 3E6FB 4XCYB 1A5FH 1G7HB 4L9LC 3RA7L 3BOVA 3VD3A 3IJHB 2ED7A 3FO0H 5IR1A 2FECI 4KC3B 2JJTA 2DAVA 1RUQL 5D1ZA 4K7FA 1BD2A 3THML 1QBAA 5C08A 2VWEE 2J5LC 5EIIA 3GSQB 3REWB 4NZUL 4XP1L 3P9LA 4YHPB 3RKDC 3MBEC 1I7RA 3W9DB 5ETUA 5I1DA 1OTUC 4H1LG 5DR5H 1IEBB 3FQNB 2Q7NA 3J8F7 1UJ3A 4MAYC 3RWDA 3TIDA 4ZSOB 2J12B 1YMME 5ESAA 3RWIA 2AEWA 3HZKA 1YMMD 2IH1A 3DX8B 3ZO0A 1RHHA 3MJ7B 1GSMA 1Q9LB 3CU1A 2DYPD 4H5SB 2BNRA 1NFDA 3WUWG 5IMLA 2NY3D 4D0DB 5L9DH 4ZAKB 3L6FA 1MRDL 4OFKA 4LEXL 4B7LA 1F11B 3VE0B 1NFIA 5D6CA 4PP2A 1MF2L 3D39E 3GI8H 3P77B 5I1HH 4MJID 1OTTC 2EYRB 3GKWH 4XBGA 5AAMA 4PBVC 4O2EB 3QJHA 4OSUH 1P7QD 1V8HA 4OF7A 4K8RD 1EIBA 2D4DA 1K9TA 4MNHA 2V7NB 5IJKC 3R8BB 1A3LH 5ALCL 4LVOB 4IOSD 2CR3A 2J1KA 4X98A 2CMRH 1QRNA 3V7AG 4KDVA 4NJ9L 2ZJSH 3EFFA 3IRZA 4W70A 5M94B 4BUGA 4JZNA 4X5XB 4XNMB 2X70A 1U41A 2BERA 4ZUVA 2F54B 3BGAA 1DUYA 1JMXA 4WW2F 3GBNL 4WU7B 4PB9L 1AGBB 4XBPA 5IK3B 2FH8A 3CJJA 4LIQH 5HXMA 3QCVH 3QDJA 3C6LA 4BK4A 4XMKH 1ZVSA 4BFIB 4LVHB 1JHTB 1QSZA 2DOCA 5CJ5A 5BVPH 4ZQKB 2QSTA 5CJ8A 4QHNA 5E2WL 2CIKB 5D2LB 3VXTB 4KV5F 1XGUA 3GSWA 4GJTB 1MHCB 5EO1A 1QD0A 4NM8L 1WWAX 4K3GA 4UAOC 3IB4A 4ZOCA 1IFHL 1RU9L 1KLUB 4PREB 3ILQD 5KVFL 3DRTA 4YR6B 5ANME 2HLFC 4TSCL 1ACYH 1LO2H 2BVOA 4I2XE 4ONOA 5ACZA 1KCUH 4PJ7F 4Z7VA 1QR1A 5BOPA 2A38A 3MREA 1TETL 4JZOB 4DVBB 5F1KC 1SVZA 3H9YA 1OSZA 5GS0L 4HQQL 3IXTA 3ROLA 5IVZB 3S35H 3MV11 2XICA 4EUPB 4J3WA 4U6VH 4ZS7H 2FO1A 1TDQA 2Z93B 5DXWA 1KENL 1P84J 5L88L 2YA1A 4RMUA 3NACL 1MJJB 4GBXA 2CR6A 3V6OE 3MBXH 1EA9C 3O6FA 1EDQA 5D6DC 3MRMB 5KS9B 1RFDH 4LHUB 2EDWA 4EXPX 3LIZL 5DFVC 3HPJB 5BV7H 2YKLH 1AC6A 3ZKQD 5TQ2L 1ZHKB 4QHMA 4QYOA 3MRRA 2CLZB 3ZL4L 3RRQA 5IOPA 2X09A 5DFTA 4PJDB 1KCRL 1MEXL 3O8XD 3F7PC 5I1IH 3EW3B 4HT1L 5I30L 1A7PL 1LE5B 4Z7QF 3CVIH 2IG2L 4IRSA 4UIMB 2X4OA 4YUEH 3U4EB 5LGKA 3ULUE 2PCPB 3MNWA 3S5LG 4V2CB 5E56A 4XHJD 3ULUD 1BFOB 1DL7L 1RJZB 4OIIH 1XF3B 1M7IB 3JV0A 2R1XB 5AEAA 1N6QH 2D7PA 3SDCB 1EO7A 3ILPA 2CJUH 4KVCL 5IG7A 1K2DB 4KPHL 2FR4B 4F7PA 5E94B 3RZCA 2JELH 1RI8A 2QQKL 3L3DA 4PV8B 5D7LD 2QQLL 1EZVX 2KQNA 1LVEA 3KYMB 2OCFD 1A9EA 6CGTA 4NFDA 3FONA 4PLNC 1R24B 2GY7B 5JDJA 2EH8H 1ZT4B 3WFBH 5E6IA 1OAUH 3CAFA 4HV8A 2VLKB 3F7RA 3CFEA 1HYRC 3PHOB 4NNXA 1BWMA 4FQXA 4PJAB 3FQXB 3ARVA 1OLZA 4Y16D 4ZFOB 3GBML 1XGYH 3H8NA 3EOTL 3I6LD 3L95B 3MYJA 2X4RB 1JRHI 4KTYA 3EZ8A 1IL1B 3OAUH 4BH8B 3ZE2F 3LKOB 1SBSL 1NEZA 1DBKH 5K9KA 5EBWB 5I8OL 1FNAA 4HS8L 1JNHB 5D7SL 2H3NA 4Q2ZB 3KJ6L 5JZ7C 5H35B 4RGNC 3OSKA 1LEIA 2Q6WB 2Z31D 4XWGH 4TUJB 4WW1A 1KBGL 1V3KA 1UG9A 1N6VA 2P24A 2VJXA 4N90D 3T4YB 5IW6B 3O2VH 5ESQB 2V2XB 5GZOD 2BVQB 1A22B 1BF8A 1IGIL 4NZTH 5FB8B 4JRXA 1CICA 3C8DA 5BO1H 4RDQG 1FH5L 3HG1D 4H20L 2NXZD 1T7XA 5ACMA 2OL3L 4QOKE 2IMNA 3QRGL 2UZIH 4KJWC 4P2QD 3QDGB 3DYOA 3VJ6B 1B9ZA 1KPVB 4HH9B 4HXAL 1ZT1B 4DEPC 2HKFL 2P1YA 1YJDH 2AV7A 1KN2H 3QUYD 1T04A 2YZ8A 4Y8AA 5C0RL 3QPXH 3V5HA 2VL4A 3UTQB 4MA1C 5GGTA 4RZCB 3WLWD 4MJ6A 3RAJL 1MCNA 2B4CH 2EH7L 3DX7B 1ULVA 4QRRA 4L8CA 5T1DH 3NIGF 3EOAA 2ESVD 1Q94A 4KHXL 2FX9L 2QR0A 2BFVH 5D93B 3ARBA 3B4NA 3RHWK 4P3DB 2XPGA 4P5MA 5D1QA 1D5MB 1OB1B 4JFEA 3P0VL 4FQ2L 2IQ9H 1RJLB 4MYWB 5HHMB 5ICYB 1FLRL 2FB4L 4Y4FA 3V4PH 5JMOC 3BP5B 1MHPH 2HVKB 5CWSA 1FVEB 2XTJC 4QRPD 1EX0A 4ZDHA 1A1NB 3OAZK 3KPTA 1Z2KA 1AXIB 3GB7B 4P0DA 3WLBA 5IBTL 3CK0H 3GRWA 3FB8B 1XFPA 4I1NB 3DTXB 2BCKB 1SY6H 1CLZL 1BQSA 1FO0H 1CI5A 3MXVH 1G7MA 3DBXB 1NGWA 2ICWA 1YY9C 4HGKC 2J8UB 4YZFF 4H1LA 2CK0H 1X44A 3E2HB 5MENB 3L3IA 5J0BA 3CDGA 2AJVL 2GTZB 3P4MB 4JRYB 5F1NA 1U93A 3P9MB 4HWEH 2Q86A 5DJ6B 1NAMB 3EO0A 3RBGA 1GZQB 4G5ZL 3LKQA 4GXUN 4NPYA 5IBUG 5BRZA 2EXYC 4FFVD 3BP4B 1BBJA 1OARL 4ELME 2FBJL 3WUWA 5CHNB 4MQ7A 3T08A 5DJ0B 3VFMA 3SO3C 3IFNL 1HEZB 2GITA 1WBZB 4Z18A 5GJTL 4OQTA 3MZGB 4NQCB 3KPNA 2VXSH 4XH2A 1G0DA 4MS8D 3U36A 3VXOB 1DANU 5E7BA 3A6CH 1MCJA 1F3JA 1KLGB 3AAZB 5INCA 4CW1A 1YYLL 2I24N 3TN0C 5EZJA 1CXIA 4HULB 1E4XH 1NBYA 4I13B 4F9LA 5K9OB 1UQSB 5T3ZL 1FAKT 2VZOA 4MGXA 2JB5L 2PR4H 2VDLL 3RNQB 5F1IA 4R7NB 1IEAA 4HUWB 3ULVC 3AU1B 1U36A 4HWBL 4PB0L 4KGJA 2JK5A 1JPGB 4X0KB 1L0QA 3P4LA 4JHBA 4CADB 3RL1A 2Q8AH 2VDOL 3G6DL 3AB0C 2DIJA 2VMFA 3FN9A 3TJEH 4L3AA 4TULL 4X4YB 1RIVL 5CP7B 1ZT7A 3BPOC 4JFXB 4EDWH 2ATPA 4HCRH 4ODUA 2XFXA 1ZLUK 5GS0D 1CD0A 3EGSB 4J8RA 4EI5A 4RFEB 4M5YL 4Y19E 3DV6A 2IAND 1U42A 4AG4H 5T1MB 4OZHF 3GSVB 1IGJA 4Y19D 1OWRM 1YEDB 3BE1H 5AYUL 4NQDA 4NWTL 5JPNA 1HHHA 1PLGL 2GJ6B 4OAWB 1OLLA 1S7QB 2H2SD 3RNKB 5DUMH 4OCSL 4DVRH 5CSGA 4U6XA 5I71B 4KK9C 4PY7A 5JLZB 4DGIL 1G7LA 3HUJF 1AFVL 5IP4A 1NUFA 4JDVA 2SEBA 4XPTH 3LN4B 4Y4HA 5TQ0L 2R39A 4DUVA 5BJTA 3UYOD 1QRKA 3U46B 1FFQA 3FQTB 3MUGB 3NTCH 1F4YH 3Q5TA 3DMMB 3DETD 1EEZB 4KK5C 2DL2A 1MHHB 3OL2A 1NGXB 3G5ZA 4MXWH 1D5ZA 1U3HA 1VFAA 1JN6A 1JGEA 1DQML 1ADQH 2JJTC 1RUKL 3NIFF 4Y4KB 5D1ZC 4WCYH 3V6ZB 1S7TB 4P3CL 5IMOB 3QHTC 1UCTA 3TV3H 3GGWA 4XRCB 3ZT6A 3BSZH 3DROB 5GJSH 2V2TB 4R6UA 3KPLB 1XR8A 1PKQB 1UJ3C 5EU5A 4LQFH 3MV7B 4BQCA 4R26L 2VITB 3AMLA 1FPTL 5BW7A 1VKXA 3H42L 1NBVH 1QR4A 1QFWM 3S5LA 3RKDD 5C0CD 3MBED 2EC9U 5DUPL 3LZFH 1OTUD 4KKCC 4MAYD 2X1WL 2XWTB 4E5XA 4QRSA 2XQYK 1ZLVK 1MHEA 5E1HB 5I75C 4JJHA 2P5WE 5BZWA 4NJAH 3HE7A 2A73B 2P5WD 2QTEA 1V7NH 2V7HA 1IM3B 2R15A 4ISVB 2EYTB 3L9RA 4NZJA 1MCWW 3Q2CA 1ZOXA 4YFEA 2HJLB 1PKOA 2BC4A 1ZSDB 1K4DB 5D7IA 4PIRF 2DKUA 2FD6L 4JLRA 1FYTA 2OJEB 1RMFL 3C09C 1RK1A 3D69A 1LMKA 3RWFB 3WIFB 4H88H 4JEGB 1OTTD 4NDMB 1T5XA 4NO5A 4Y5YB 5T33H 1OSPL 2PW1B 4LASL 3P30L 5IVXF 4HWZB 2BOCB 4L4VD 5DS8A 1QFUH 3SGEH 3GEWB 4E41E 3J7HA 4K8RH 1ZGLA 4YPJA 4XXDB 3C6LC 3VFUA 4E41D 5L8JB 4S1QH 4WI8A 5DJAB 4AM0B 1P9MC 4QT5A 3V6BR 3MOQA 4IOIA 3FQWA 1GAFH 1A0QH 4Z7NE 3BMVA 3MZTA 4WI6A 3I3BA 5DD1L 1G6RH 1NL0H 2HJKB 1EO5A 5A43C 1EK3A 2DKSA 1I8MB 3DO7B 4KY1L 1UA6H 4HIXL 2IEPA 4LCWA 1LE9B 2J6EL 4PJGA 1Y6MR 3IAPA 5TE4L 1Z9MA 3H3PL 3DRQA 4PJEA 4YQXH 2KQMA 4MXQD 2EDFA 1AGDB 4GQ9L 4XPGH 5TDNA 5CZVL 2C26A 2W9EH 1U8IA 5IW1A 2DB8A 3NAAH 1I9JH 5DJXB 2BSED 1IGMH 1LNUB 4MD4B 5GRUH 3RL2A 1J9CT 1KFAL 5MHSE 2HLFD 1KTLB 4YPGA 4U6YA 3VWJB 5MHSD 3CLFH 2A6KA 2R2CA 1PYWA 3KPMB 4BFEA 3I6GA 3QUXB 4GBXC 4PV9B 3O6FC 2X1XR 1TCMA 2EECA 4XP9L 4D9LL 3QULA 1NC4D 3QUMB 4NNYB 4OCRL 3EJJX 1MFAH 3NBNA 4OZFH 4JY5H 4XAWL 2YD2A 3P2TA 3VFGH 1MAML 5KW9L 1FDLL 2J3SA 4NFBA 2HFEB 1BJ8A 2IQAA 3ROOA 1W2KT 5DFVD 2MKWA 3D9AL 1T21A 2VAAB 2J88H 1GXEA 2B2XH 4K55A 2CGRL 3O3EA 4IRSC 1RPQA 1EUTA 4F58H 5IHLB 3WIHH 1SQ2N 5CD5C 3K2UL 1NDGB 1YC8A 2OMBA 3PWUA 3RTQA 4TRPL 1OP5H 4FG6C 3PP3H 1JPSH 3CH1A 5C6TH 2AJSH 5JHLL 1FNHA 5TDOA 1NBZA 3JWOC 3V6FA 5LJYH 1R3IL 3H9SB 3N85L 1JF6A 4OGYH 4I77H 3RZCC 3BZFB 3GM8A 4P46C 1DBAL 1CT8A 1MLCB 3HS0B 2VH5L 3LKSB 4AEHH 5FDWA 4PRBB 1LEGA 4RWYH 3SKNB 3W2DH 4PTTA 3ULUH 4KROB 4X5WA 1E6JH 3VXUB 4OZHB 5J1AA 3QCTL 1A7OH 1DQLL 4O2FB 4GRWF 2DD8L 3DSNA 1C5DB 1SEQL 2R0ZH 1ZA6B 2FLRT 3UTTE 1INDH 4F7CA 4RNRB 4P4RA 3CSYA 5DVLA 3UTTD 4AT6B 1AD0B 5GIRA 5T3ZD 1ZVYA 1E6OL 1F00I 4N8CL 2FWOB 5T3XL 3QIUD 3W39A 4PJCE 4R2GC 1F4AA 4GAFB 2VDNH 1NGQL 1IGTB 1ZGLM 3GMNB 1NC2A 4NRXB 4XTRC 4A6YH 1F3RB 4ZTOL 2QHLA 5CIPB 3G9AB 4DZBA 4ODWB 1IGYB 4HDIB 5JNYB 1MUJB 4P2OA 3UMTA 2FJHB 2YUVA 5BS0D 3VG0L 2FBOJ 4LSDA 5F7LB 5E9DA 2ADJB 2ICES 2RHEA 2P8MA 3V8CA 4EQ2A 1JI1A 3T77B 1YPZF 5HHOD 2GSIB 2IGFH 2NY5H 1FVDB 4U6TA 5ERWB 1N5AA 5JZ7D 1ETZB 4RGND 4M7KH 3WFDL 5INDB 4JO1H 1A6TB 1CICC 3TT1H 3E6HA 5D70H 4XNYL 5HYJE 3QBTB 2Q7YA 4ZNEA 4M1DL 1Y0LB 3FJTA 5C09B 4HUUA 4GRLD 5FYKL 5HYJD 5K59F 1MJ7H 1JK8A 1HSBB 4RX4D 3T0EB 1GPOL 3HAEB 1U8HB 1I9RL 1DBBL 2MQ3A 4Z7WF 2VAJA 3GFUA 2ZUUA 3MCLL 3U4BL 5C6WH 1JWUA 4CVUA 3PDOA 2HN7A 3NCJH 2PW2A 1QLRA 2AJXL 3JXAA 4RQQB 1IAIH 2AK4E 4KJWD 3MV9E 4YHKL 4CVZB 3WE6A 3L3HB 3MV9D 4HPYH 2B1AH 1QSFB 1BF2A 1J7VR 4PJHF 1TTGA 3LH2L 1P4BL 5DJZB 5T1KD 1G9MH 2OQJA 1IC4H 3BIAX 2X05A 1DQJA 4W6WB 2YPVH 4QXTA 2FX8H 5ISZD 5EFIA 1Q9OA 5C0AB 1T66C 4I0CC 1ONQA 2V17L 1FFOA 3UBXB 4F57L 5D1QC 1LEKA 1BVLA 1U8MA 2O5ZH 3QIBB 2QSVA 1KIQA 5FK9B 4Y4FC 3UTOA 2KKQA 1RZGA 4G6KL 4CDHA 4HKZA 3MUY1 1DANT 3PL6A 3LKRB 4XCFL 1H5BB 5JW5B 1RUQH 4IMLB 2R56L 1ZHBB 1YUHA 5D9SA 3SCMA 3DXAE 3LKPA 4M8QA 2BXYA 3THMH 2RIKA 1U8LB 5D2NA 4R96A 2AJ3A 2XTJE 4X80H 4NZUH 4LFHD 3S3PA 1YQVL 1QPXA 4UQ3A 4U1NA 1RSFA 4LLYB 5DRWB 3KPPB 3DURA 4PGJA 5HHXH 3DX6A 3MTRA 3KYOB 5GSRA 3ARDB 1AE6L 1F45A 2DDQL 4ZYKB 2DTSA 1LO4L 5HHPB 4YDVB 5CSZA 5GHWL 2E9IA 3G6AB 5E00B 1KB5A 5HHQA 3DYMA 4BUHA 3R06A 4LLVB 2G5BB 1I3RA 4HGMA 5JPMA 2MFNA 5B3JF 1AO7E 2IPTL 1YY9D 2W0FA 4HBCL 2DM3A 4EQ3A 1FNSL 4N5EC 5JQ6L 1MRDH 5KSVA 1MCLA 4LEXH 2ITCB 4LLUB 3JTSA 5IJVB 3JWOL 3WS3B 3GSXB 2NX5B 4KRNA 4PD4K 1MF2H 3VRJA 4X99B 2EXYD 4W6XB 2HLAA 3VXSB 3VG9C 1KT2B 3G5XA 2AQ2A 5JW4M 3I9GL 4O5LL 4KVNL 3RWCB 4WHTB 2ADGB 3RGHA 4JPWL 1EEYA 1K5NB 5ALCH 2NY4B 1UKTA 3EYVA 4GAYA 1QQDB 3SKOA 3JWDH 1KPRB 3BN9C 2RFXA 4NJ9H 5IQ7L 1QP1A 5E5MB 5DDHA 1J8HA 3GSNB 3INUL 2XZZA 2H32B 1YZZA 1Q9WB 3OAYK 5AWNH 3TN0D 1FL3A 3GBNH 3R0NA 4NO0D 4NT6B 4PJFE 4XNXL 3S3JA 1KJ2B 3BEVB 3QQ3A 3SDAB 3STZB 4X4XB 3ULVE 5D7KD 1CU4L 2WM0A 1S7WB 3QXVA 3O4LA 3KHOA 1M05A 5HDBE 5B39B 2ZUQB 2N56A 4HEME 5E2WH 5GGSB 4JPVL 3MV8B 5EU7C 1C12B 5DJYA 4G8GA 1JF1A 3IXAA 5DK2B 2ENSA 4EI5C 4NM8H 1W0YT 2X4PA 3TP4A 1YMHA 1IFHH 1RU9H 5F7DA 4C56B 4DJMA 5KVFH 3I6KA 3CXHK 2R2EA 5KN5A 4TSCH 3KPRE 1CD1A 3R1GL 4LHUG 4X9IA 2CLRA 3N06B 3SE3A 4G7YL 1R3JB 1TETH 1BFVL 1OGAB 4L29A 1J0JA 1N3NA 2DI8A 4L8SC 4MAUH 3TO4A 5GS0H 2YSSA 1F6FB 1FE8H 4HQQH 1HHGB 2YRLA 2JJSA 1U3YA 3ARWA 4O51A 2EC9T 4Y4HC 1KENH 5LBSL 5L88H 4UNUA 1WWWX 3NACH 2IH3B 4R7DA 1EJOL 5FO8A 2YR3A 1FG2B 1QBLL 2OXGA 5L2JB 4KK9D 4G6FD 3ALXA 4QCIA 1UXWB 2JCCF 4WTWA 4G6JL 5HJ3B 3S36L 4K7PY 1U3HC 3LIZH 1GGTA 1XT5A 1MH5B 3MQIA 1MLBA 1C08A 5TQ2H 1IC7L 3ZL4H 5HHVL 5CS7A 5GGTL 4PJBE 1PG7X 3F65A 4OZIE 2W60B 2ICEB 1S8DB 3AS2A 1KCRH 1KG0B 1MEXH 3EOYG 5I2IA 5I30H 4HT1H 4Z7UB 3TO2A 3MJ9A 1A7PH 3KPQA 4UBDC 4OLZL 4Z0BL 4R9HA 2IG2H 4D0CA 4PRDB 5IT2L 4Q6YA 3QSKB 2CUHA 5D1ZD 1BD2D 4N0UB 3DSFL 5C08D 5DYOB 4L1DA 5DVNA 3LS4L 5BW7C 1DL7H 2V9RA 5IEKB 2H8PA 1X3DA 5KG9B 3TBTB 3T4AB 3TBSA 2WK2A 4KVCH 4J3VA 4KPHH 2CXKA 2QQKH 4PRHA 1IAMA 3ARYA 1FRGL 4HK3J 3WNPA 3CC5B 5DWUL 3HE7C 2QQLH 3NN8B 5EO0B 2Q1EA 1CG9A 2BNRE 1GHFL 5T3XD 3NCMA 2BNRD 1BBDL 3MRDB 4IRJA 5J6GA 1MCPL 4KKCD 3GRWL 3OKMA 5E6ZA 1WBXB 2I60L 5HYIA 4DKAA 4Q97A 2FIRT 4S0SD 4U33A 4Z76A 3DI2B 4NKDB 1PDKA 3D2UA 3ARSA 5EO9B 4Z8FL 3HKFA 3SHSA 2LAAA 2C7UB 4PPTA 4PRPE 1ORQB 4NQEB 2BP3A 3PQYE 2GI7A 2K9UA 4XMPL 3X12A 4XP4L 5IFJB 1VGKA 5CEXA 1QFWL 3V7MA 3EOTH 2D7MA 3CXDL 1D6EA 4HIHB 4MLIA 1KCKA 5DJ8B 5LVEA 4OZGB 4X6FB 1QRNE 1SBSH 4QY8B 2E6PA 4I0PA 1QPPA 2Z8SA 1QRND 4L8BA 4JREC 4UNTA 3NOIA 3O11A 4OTXL 3V5DA 1BOGA 5I8OH 4HS8H 3HLAA 5D5MA 1P69B 1CWVA 3QXAB 5D7SH 5FYKE 5J4MA 3KJ6H 4X6DB 2VL5B 4OQTL 4Q9QL 5SWQA 5FYKD 1U8NB 2O5YL 3DUUA 2YBRB 3MLXL 4QHUB 4NCC2 4BSWB 3MRQB 4LBEA 1VB9A 1IC1A 4CN1A 3QDJD 3SKJL 1KBGH 3U0TB 2WBJC 5KSBA 1TVDA 3IFPB 4U49A 4JFFA 1IGIH 5H94A 5SWZB 1DDHB 4NSKB 3GI9L 2APWA 4G3YL 5JA9A 1NEUA 2CQVA 4D0BA 1FH5H 3QEQB 4DKEL 1G7PA 1HYSC 1RULL 4H20H 2OL3H 4JFPB 1KIRB 2AP2A 1UJTA 3QRGH 3L7FA 2NPLX 1PX4A 3WV0A 4PRAB 8FABA 3T1WA 4M5ZL 4HXAH 4DUXA 1GOHA 3QHZL 2HKFH 2WBKA 5C8JA 1WGOA 3BT2L 5CP3A 5L6YH 2HYMA 1QKZL 3ZDZE 4GAGL 4KKAC 2B5IB 5C0RH 1CL7I 1FZMA 3QO0B 3FFCE 1GGCL 2L7UA 4UOW1 3RAJH 3DGGB 4JFHE 1ITBB 4YE4L 5KBNC 3Q1SL 2CDEB 5C0BB 5JOFB 5IM7B 3TNMB 3ZDXE 1HHJB 2FX9H 1G7HA 3N9GL 5J1SC 4GBXD 4CU8A 1E4XI 3IJHA 3O6FD 4R0LB 4XCNB 2I27N 2ZCHL 1U8KB 4OM1L 1FORL 3WNKA 4I8DA 2P8LB 4WEMB 2ATKB 2FJFB 4WY7L 2NY1B 1R5WA 3KHQA 4WNQB 3REWA 3U0WL 3KGRA 4BSVA 4PJIF 3P0VH 4FQ2H 3VXMB 1H0DA 4X6CA 3NFPB 1FLRH 2FB4H 3KLSA 1JZ4A 2EDLA 3PGDB 3SDXF 3ZKXC 3RTQC 3P4OA 1IEBA 1MNUL 1ZWIB 4ZSOA 3O6ML 5SWSE 4Q74A 4TTGA 4YDLC 1L6ZA 3FCTB 3OKYA 3GUTB 3P0YL 3DX8A 4FTVB 4LGRB 4IRSD 1UKSA 1Q9LA 4R4NC 4H5SA 5CD5D 5IBTH 4MDIB 4D0DA 5HPMB 1T0MB 4YNYA 4WV1B 4ZAKA 1CLZH 2LTQC 1LP9E 4NC1C 1F11A 4UTBL 3VE0A 5JIPA 4UMGA 2V5TA 4XZUA 1RK0A 1MCOL 2VISB 3ZKNC 4NO3A 4BZ1L 2W0KA 4JFDB 2CKBA 2AJVH 2WIIB 4MNGB 2JTDA 3TIEB 3HZMB 4JJ5B 5KAQG 3RZCD 2EYRA 2P8PB 1BWWA 4G5ZH 3BYTA 4O2EA 3RUGF 3U6RA 5E70A 3U7AA 4MJ5A 4YHYB 1YECL 4O58L 2V7NA 5A2FA 1HILB 1OARH 4LCCC 6FABL 2FBJH 4AEFA 4N0CC 5K9JL 3MLRL 1CFTB 4IIQB 3O9WB 3IFNH 5E6ID 4M7ZB 5AG9A 5GJTH 4KK6C 4JRWA 4FQXD 2F54A 4LPUA 2HAZA 5EUOB 1CD8A 2VUYA 4WU7A 2APTA 5ADOL 1PVHA 3GNML 3GDBA 3SY0B 2GK2A 4G8EB 3I02B 1I8LA 2A6JB 1YYLH 2F8XC 5CJQL 1NFDF 1JHTA 4FFZL 3IS1X 1DE4B 4R2GD 1EFXB 1CDHA 1N7MH 3DGCR 4ZQKA 4P2OC 2XA3A 5T3ZH 3IVKB 4BFIA 1UKQA 5A2IH 5FOBB 2VDLH 3TYGL 2CIKA 5D2LA 5HI4C 2BY3A 3VXTA 2OLDA 4ZUUA 1ZANL 1B6UA 1HK6A 5DRXB 5I8KL 3DPBA 4HWBH 1E27A 4PB0H 3AXLB 2GFBB 4XTRD 3K8MA 3WHE1 4OIBA 1IJ9A 2NYYC 4XNQB 5J89A 1U0QA 5F9JB 1KELL 2MMXA 3G6DH 1T7ZA 4PREA 4ERSH 4YR6A 4TULH 3P0GB 1RIVH 3HZVA 3FOMB 3UJIL 3KYAA 3MLZL 3QQNA 4JZOA 4WDIB 1KF9B 1C16B 4B0MM 3X14B 4JRXE 4K3DL 4H25B 5AZEL 1IM9A 4XGZB 4JRXD 1KCLA 1CICD 4M5YH 2BNQB 1NANH 4LMQI 5IVZA 4OF0A 4LSVH 2BXZA 5AUMA 2Z93A 4NWTH 4R97B 4GG6B 2VXUL 1PLGH 1MJJA 4DGVL 2F53B 3S96B 4N0RA 2X10A 5KS9A 4HAGA 4LHUA 4OCSH 2WBWB 2FX7L 3HPJA 4DGIH 3C6SB 5IHZB 1AFVH 1ZHKA 3F6LA 1UH4A 5D4QA 4S0TD 2CLZA 2A9NL 5TQ0H 5F8RC 2EDOA 4QRRD 4M9OA 4PJDA 4F9PA 3SDDB 4YK4C 3ZZ1A 1KGCE 4OB5L 1RQ5A 4NRYB 4Z7VF 3U4AA 3SGEI 1KXQE 1OAXL 2APBA 4N0FB 4NCC1 4UIMA 1P4LB 1CGUA 3ARBD 3U4EA 1T66D 2PCPA 3EYOA 1DQMH 3PL6C 4JFEE 1RUKH 1AY1L 2DWEB 1RJZA 1M7IA 1G84A 4JFED 2R1XA 5LAXB 1NCAL 3MA7B 4P3CH 3T0DA 5D2NC 1K2DA 4Y4FD 2FR4A 2ZNWA 5E94A 3TCLB 5EH1A 3FFDA 4OLXL 3LCYA 3K4AA 4PV8A 4OLUL 1C7TA 3KYMA 2ERJB 4R26H 3CMOH 1FPTH 3MROB 4MA3B 3H42H 4BZ2H 1R24A 2EDRA 4NGHH 3BWAB 4CMHC 3FMGL 5DUPH 4C4KO 2VLKA 2COQA 3PHOA 2BY0A 3FB5B 1CDJA 4J3SA 4PJAA 3FQXA 3BH9A 4QXGL 2EO9A 4GS7C 1DVFB 3MNVB 4JN1L 4ODVL 3B2UC 3MODL 3OXSA 4YAQB 3FQRB 3L95A 4PJ8C 4RFNC 2X4RA 4OCXL 3SQBA 5JHDE 4CU7A 5BRZD 5IROA 3MUZ1 3IDIB 4BH8A 4U1SB 1WFNA 4G80B 3LKOA 5C0NC 1HDMB 4LSPL 4N5ED 4Y2DB 2AEIT 3KS0J 1NDMB 5I1KL 3GMMA 2X41A 1K3IA 2FD6H 1RMFH 3VFNB 4Q2ZA 3IDXL 5H35A 1XCQA 4B53A 2Z92B 2Q6WA 5E2UL 4HZLB 1X5YA 4ORGB 5HVGB 4TUJA 1F4XL 3B83A 3G04B 1WWCA 1IMHC 2HMID 4LASH 4JKKA 5IW6A 3T4YA 2O61A 2QBWA 3LQZB 5ESQA 4XPBL 3V7AE 2V2XA 2BVQA 2WZPD 4Q9CA 3BN9D 3OR6B 5C7XL 2YS4A 5FB8A 2QHRL 5DD1H 2NY7L 4GXUM 2V5RA 5DSCB 1VEOA 2VC2L 4FQHA 4XPFL 5B22A 1ZKAA 2V6HA 4QXUH 1A6ZB 2DI9A 4KY1H 5E8PA 3PNWB 3QDGA 4HIXH 2XN9B 4CGTA 4PD4J 3CX5K 3VJ6A 4H26B 1FG9C 2Z91B 4HH9A 5TE4H 3H3PH 3QO1B 1ZT1A 1G7IB 4BFBD 1ORSA 2WQRA 1QFOA 3ULVH 1AD9B 5E4EC 5CZVH 5C0DB 2MHAB 3SE3C 5I1LB 2R2HB 4RZCA 1S9KC 4AIXA 5HVHC 2W9DL 5FUCC 4NQDE 2Z8RA 2P5EB 3DX7A 5F7YC 3TO4C 2VDQH 3V5KB 4QWWC 2VZ1A 1KFAH 4NQDD 1CS6A 1Z3GL 2OP4L 4A2LA 2XKSA 3O3BB 5ICZB 4QNPE 2VE6A 5KANI 1Q0XH 4XP9H 4D9LH 3EO9L 1WAAE 3O3DA 1S7UB 1OB1A 4QHLB 5JA8B 1CK0L 1GGBL 4OCRH 5ICYA 4Y4HD 5EDXA 4TN9A 3L1OL 4XAWH 1ZLWH 2HVKA 1FL5B 1FVEA 5I18L 1WIOA 1MAMH 4JG0L 3GMQB 5KW9H 1T22B 3B5HA 3MRNB 1Y18B 1ZV5A 5KJRH 4X6EA 1U3HD 3D9AH 3DYPA 3GB7A 4HIIB 5C07A 3TPUB 3FB8A 2CGRH 4YDKL 3DTXA 2BCKA 5AYQA 5J3HC 3K2UH 1GOFA 2WWMC 4HLZG 5J1TC 3QISA 2PYED 4Y89A 3DBXA 4TRPH 2J8UA 5F7HA 5MENA 1PFCA 2GTZA 3P4MA 4JRYA 5E8OB 5J6HB 4XVUC 5JHLH 2DJSA 3P40A 3P9MA 1R3IH 1CVSC 4UBDD 3N85H 3BXNB 1NAMA 3RWJB 1GZQA 4U3XA 3BP4A 3W0WD 3B43A 4LKXB 5GS1B 1DBAH 2R23B 5DJ0A 1GRWA 2VH5H 3D39B 1JPFB 1HEZA 4N9GA 1IAII 4X9HA 4IRJC 4WI4A 2D9QB 3PJSB 4NQCA 4MA8L 3QCTH 5I6XC 3PWNA 3PGCA 3VXOA 3LPGA 2DD8H 3HE7D 3AAZA 2YWYA 4U0RB 1ES0B 2D7NA 4OCWH 1C7SA 4QRQB 1ZLSL 3WNMA 3RI5K 4B50A 3EKCA 5CBAB 5I73B 4U7SA 4Z0XB 5GPRA 1KB5L 5K9OA 1UQSA 1E6OH 5D7IE 3ES6B 1HHKB 2E7BA 4M7LT 4N8CH 2VQ1B 4R7NA 2OX5A 4HUWA 3WO3B 3AU1A 2LE9A 3WKNA 2YRZA 2AXGB 4HSQA 1FYTD 5FDYA 4X0KA 4I0PC 4YX2L 5F7FA 4OFYA 3BQUD 1T83A 3RIAF 3O6KL 1IAOB 4X8JB 2ZNXA 1IGCL 4XB7A 3W9EB 1U8PB 3N0PB 4X4YA 5CMAB 1CFVL 1X4XA 5CP7A 4PRIE 1WT5A 3HAEG 4Y1AA 3VG0H 3LAFA 3D25B 1F6LL 3L7EB 2C3VB 5D96B 2JKXA 4WUKL 1VFBA 1X5GA 3EGSA 2NY0C 4NN7C 5T1MA 2GT9B 1OP5K 3GSVA 5JIIA 4XHQA 3WFDH 3PP3K 1YEDA 5ANMB 3TNNB 2VABB 2PNDA 4I2XB 5ADPL 4M1DH 4GQPH 3A67L 2WINB 3W82A 5FYKH 3RNKA 4F3FB 4LCWD 5FCSH 1I9RH 1P53A 1DBBH 3O6LL 1QHPA 4UB0L 1AR2A 1MCKA 5JLZA 3MCLH 2G75B 3LRGA 3RKPA 5GRYA 5FAAA 2ZUTA 2CKNA 1HYSD 2C4FU 3LN4A 2IALB 4U31A 3PWLB 3ZMRA 5H37H 2AJXH 3D18B 3U46A 3FQTA 4YHKH 3MUGA 5EG6C 4DQOL 4XPHL 3DMMA 1QLEL 4PP1C 3RY4A 3NFNB 1W72A 4KQ3L 3LH2H 1P4BH 4OV5B 1AHWB 1WFOA 4KKAD 5C1MB 1IGFL 3EYFB 3U79A 1B88A 1FJ1B 4OCYL 4Y4KA 4LEOB 1A9BB 4MJIA 2V17H 1S7TA 3OG4B 3HNTL 4F57H 1FIEA 4XRCA 4PGZA 1U3ZA 3DIFB 1YEEL 4PBWD 1NCNA 2V2TA 3KPLA 1PKQA 4G6KH 1YEJL 5EC2B 3VRIA 3GSUA 5I1CH 4XCFH 4EVNB 2R56H 2ZG3A 1JCKA 2DBLL 4OLYL 4FOMA 4Z5RA 1YQVH 1DR9A 3MRJA 4HFUL 3RTQD 2E7MA 4ZAKC 4YEEA 1C8PA 4OD1L 1AE6H 1UM5L 2DDQH 5IEHB 2HG5B 1HWGB 2C3HA 1LO4H 4ISVA 4R4ND 5GHWH 1UWGL 3MJ9L 3OZ9L 5EU6E 3CD4A 4HUVB 4NC1E 2HJLA 1ZSDA 1K4DA 3QI9A 1LWRA 2MCG1 3KYKH 4N0YH 2IPTH 3ZKND 4HBCH 2OJEA 1F02I 1FNSH 4NHUA 3RWFA 3WIFA 3T3PF 3JWOH 4KKLC 4I48B 4NDMA 3AM8A 5FXCH 2PW1A 2NTSP 4IM8A 2ZUVA 1QVOB 4HWZA 4N0CD 4O5LH 4KVNH 3SKUD 2VKXA 1X5IA 4DW2L 1I8LC 1LK2B 4JPWH 4AM0A 5DJAA 1A6WL 2IPUK 4LVHC 3EIFA 2Z31B 5DRNB 4KK6D 4O00A 5B39G 1OAQL 3IJYB 3B2VL 1UZ8B 4PG9B 3RPIB 4XPAL 2WV3A 2Z4QA 5EOQL 3INUH 1I8MA 2BDNL 1NC2D 3S37H 3DO7A 4YBHA 2G60L 4M3KB 1N59B 3MLWH 4FN0A 4G8FB 4XNXH 1OTSC 4N9OB 5MEQB 1LE9A 1ZE3C 5E9DE 4P2OD 2J8OA 5JO5A 5J11C 1F6AA 5HI4D 1CU4H 1AGEB 1CGSL 5E9DD 3TBVA 1AGDA 1KSRA 1V3MA 1CLCA 4XVTL 4WEBL 4QOKB 4JPVH 2NYYD 5DJXA 4CVXA 1LNUA 4HUNB 4ZNEE 1P7HL 4XC1L 1FZOB 1I7UB 2AJZB 3PIQB 1KTLA 1X5JA 3IGAB 4A2MA 1JGDB 3DWTA 3MRLA 1INQA 3L3JB 2OTWB 3STLB 1J1PL 4G7YH 4LHQB 1BFVH 1DUZB 3EZJB 3QUMA 2WUCH 4NNYA 1T1ZB 1P4IL 4OBSA 3FN0L 5DQJB 4PJGF 5LBSH 5FM8A 4YHIB 1U8QA 1EJOH 2HFEA 4HMCA 4PJEF 4EN3B 1QBLH 4F9PC 2EDYA 1D5IL 2V5MA 2VAAA 4DCQB 3BDYL 1C5BL 3S36H 3RP1A 5HDQL 4GXVH 1XGPA 4JQIL 1NGYA 1NDGA 2EDNA 1CF8L 1XCTB 1IC7H 5HHVH 1FFNB 5GGTH 3IRPX 3UZVB 4PJ9C 3SQOL 3H9SA 2I9TA 1RHFA 4M6MH 1MVUA 1UACH 2Y72A 2F5AL 3PHQA 1ZMYA 3TA3B 4F7MB 3BZFA 4JY4B 4OLZH 4Z0BH 4E42B 5C3LD 5IT2H 3PL6D 3WNOA 1MLCA 5LG1A 3SCMD 1FAIL 3QXDB 3LKSA 5AD0A 3DSFH 2BOBB 3ZTJG 4ODSL 3LS4H 1T7YA 4N1HB 4NQSA 3CCHA 4YFLF 1UZ6E 1S9VB 3ISWA 4OZHA 4M4RA 1IRAY 2E8YA 2YUWA 3GK8L 1QBML 3Q5OA 4RBPH 4ELMB 1ZA6A 4G8IB 1FRGH 3IKCA 4RNRA 5DMKB 5DWUH 5TF1L 4AT6A 3EJYC 1AD0A 2YK1L 2YXFA 3L3KB 1WEJL 4KKBC 1F97A 1M6OB 3BISA 1GHFH 1BBDH 1MCPH 1HXYB 5IROC 3GRWH 3HUJA 3VRLE 2I60H 2YC1A 3SN6N 1LO5A 3GJEB 3S88H 4Z8FH 1JHLL 3B2UD 3NPSB 4NRXA 1RIUL 3QWOB 1GIGL 4H1LH 4XP4H 1IGYA 4HDIA 3T1FB 1QFWH 1MUJA 5DEZA 3CXDH 2FJHA 3D3VE 2GW5A 2ADJA 2ZCKL 2RB8A 3LQAC 4OD3L 3T77A 3TT3L 1J0HA 1QOKA 2CPCA 5ERWA 4ZFZB 2E8ZA 2R1WA 4P49A 1ETZA 4OTXH 5INDA 5IKCB 5B4MC 1RJCA 4UZGA 1TITA 1J8HD 4OQTH 5C3TA 4Q9QH 1A1OB 5C09A 3FT3B 2IAMB 2O5YH 3MLXH 2EDTA 1N4XL 3T0EA 2X9WA 2PYFA 4DAGL 1WCBB 3NGBB 3SKJH 3HAEA 3QCUL 1U8HA 4Y19B 5I16A 4EDXB 5DHYB 5JQHC 3FO1B 5EUKB 1PD6A 3O4LD 2O5XL 3QJFA 4YWGL 3RJQB 5L8KB 4YXHL 4G8GE 4HHAB 5ESVB 1HN1A 1OF2B 1VSCA 3GI9H 1QYGL 4G3YH 5IMMB 4QRPA 2ZUSA 5D71L 4G8GD 2D3VA 4RQQA 1KTRL 4P5TA 1NSNL 4DKEH 4KDWA 4CVZA 3NCBB 1RULH 3L5JA 2WAHA 3L3HA 2R4SH 3TZVB 4AJ0A 1QSFA 2BK8A 2DQGL 2ED8A 4HKXB 4RMWA 5DJZA 2GJZB 5KSAB 2K7PA 3VFWB 3ZDYE 4M5ZH 3B6SB 5FUCE 3QHZH 5D93C 1JGVL 1K8IB 4MMXC 1M71B 4GAGH 4RAUA 3TO4D 4QWWD 3UTZB 1GGCH 1WZ1L 5GISL 2X4SB 4YE4H 3Q1SH 2R29L 1N26A 3QIBA 1F2XK 3REVB 2QJDA 2I5YL 2VLMD 1RZJC 1WQVT 1DN0A 1XF1A 1SYVB 2ZCHH 4OM1H 1FORH 3SDYL 1KPUA 2MCPL 1H5BA 1WIPA 3B5GA 5JW5A 1UT9A 4IMLA 1ZHBA 4WY7H 1OGTB 3CX5J 2E9BA 4JO4L 1U8LA 1HHIA 2JIXD 1EXUB 4K3EL 3O4OB 1L9MA 4U1LA 5DRWA 3KPPA 4XWOD 5DHVA 1NCTA 2H26A 2J5LB 5FUOL 2DJUA 3HFML 1MNUH 3ARDA 2RGSA 4WUUB 5EZOL 5FM5M 4G7VL 4Q9RL 3IU3A 3LS5L 1SMOA 5HHPA 4YDVA 3G6AA 5E00A 1N8ZB 4LRIC 4JR9L 1DBML 5J3HD 2G5BA 5I8CB 3GMRB 2WWMD 1NANI 3K8LA 3MRFB 2P5WB 4JO3L 3B9KA 5I66B 4S2SB 4GFTB 3CFBB 2R0WH 4UTBH 2UWEF 1MCOH 1KNOA 2A6DB 3WS3A 3GSXA 2NX5A 4BZ1H 1VERA 1HIML 1KC5L 4PRHE 4V1DB 1IAIM 2A74B 4X99A 1SMAA 3BGMB 5J57B 1FNEB 3D0LA 4N1CA 4PRHD 4DKDC 1C5CL 1KT2A 4POYA 2HRPH 3QFJE 4AENB 1YECH 3U30C 1RZKC 2ADGA 3CLEH 1JNNL 4LSQH 1EVUA 1QQDA 5K9JH 3MLRH 1KPRA 4LARL 5D7JA 2AW2A 2Q3ZA 3BO8B 5E5MA 5F89B 4I9WE 5DRZB 4WGWB 2VQUA 3D2UD 3GSNA 1A14L 2DLGA 5FECB 2H32A 4I9WD 1LO0L 4N1EA 4ZFOL 2C4FT 4EBQL 5ADOH 1MCBA 3FRUB 1T83C 3BEVA 1JZ7A 3SDAA 3STZA 3MLPA 5CJQH 2XRAL 1BIHA 4NN5B 2ARWA 4FFZH 2EXWD 1T2XA 1S7WA 3C5ZB 3OKKB 4ETQA 3BZEB 2NY6C 1UFUA 3PWVA 3X17A 5B39A 3HI5L 3V52H 1WT5C 2EEBA 4I0PD 3JV6A 3TYGH 5GGSA 2D31B 3MV8A 1ZANH 2NZIA 4TNVK 5I8KH 1MI5B 5DK0B 5DK2A 1CBVL 3BN3B 2FYYB 4LSRL 1E4KA 2Z35B 1PG7L 1G9EA 4C56A 1EBAA 1E0OB 4JHWL 4MX7B 2CRZA 5HYQB 2WP3O 3I84A 4FQPA 3MA9L 5KSBE 3V9FA 4UAOB 2HVJB 4FQCL 3LQAL 3UJIH 4JFFE 1R3JA 1E4WH 2NY0D 5J13B 1OGAA 43CAB 3PWPA 3MJ6A 2GSGB 4JFFD 4K3DH 3BHBB 5AZEH 5CFHA 3RGVB 2DI7A 1PEWA 5FUZL 3EYQC 2FGZA 3BZ4B 1TPXB 2VXUH 3H7BB 1YDPB 2IH3A 4DGVH 4M43L 3CVHB 4FXKA 5L2JA 4X7CC 5JOPE 5T1LB 1UXWA 4M7LL 3BEWB 3DMMC 3G6JF 4UIKL 3WD5L 5HJ3A 2WMPA 5HGAB 3FOLB 5TH2B 2FX7H 1J05B 4XVSL 3WSQL 1MH5A 4AMKL 4D9RE 3GBLA 2A9NH 4GUPB 2D7OA 3QEHA 4Y4KC 3MFFB 3KXFE 4D9RD 2W60A 1S8DA 3S4SB 4PP1D 1NUDA 1T3FA 4OB5H 1JWSB 3ZE0E 3B9DA 2BVTA 4LCYB 4RSVA 5AG8A 1OAXH 4Y5XB 1L6XA 4PRDA 1IBGL 4JFYB 3PXJA 1T7VA 5IF0B 4N0UA 1P7KB 4HJJL 5DYOA 1CL7L 1AY1H 3WIIL 5C0FB 2WSKA 4X6CE 4LIQE 5IEKA 5KG9A 3T4AA 3PDDA 4YHNB 3SPVA 5C0EA 4E0RB 1QO3A 3GO1L 1RZJL 2FATL 4OLXH 1EPFA 3T0BA 4OLUH 3NN8A 5SX4H 3OTTA 4JGMA 2EDHA 2HKHL 4Z7WA 3MRDA 1BREA 1OQXA 1R0AL 2RJMA 4UINL 5HSFA 1WBXA 4ZAKD 2PTUA 1TJHL 3MNZA 3FMGH 3QI9C 4ODHL 3HRZB 4NKDA 3UTTB 5EO9A 1W0WB 2C7UA 1OD7A 4QXGH 4NFCA 1ORQA 5I1JL 4NQEA 4JN1H 4ODVH 1MCRA 3MODH 3HR6A 1KTKE 3AM8C 3K2MC 1NAML 4PJCB 4OCXH 5DJ8A 4OUUB 4OZGA 4X6FA 4APQA 3UYRH 2NW3B 3MYZA 3OKNB 4GKZB 4LSPH 3WJLA 5DMIL 5I1KH 2EIEA 4KKLD 1AKJB 1T6WA 3QXAA 1O5DT 2E27L 4X6DA 2VL5A 1WZLA 3IDXH 5T5FL 2F54D 2OXHA 1Q1JL 3JVGA 1BEYH 2F19H 2WQ8A 1U8NA 2YBRA 1F4XH 4QHUA 3X13B 3OX8A 3IDGB 1NCDL 2YUZA 3MRQA 4BSWA 1RZKL 4Y2OA 3U0TA 5DVKA 4XPBH 2PTVA 1XH3B 4LU5L 3F58L 4EXKA 1EMTL 5HYJB 2QHRH 1TZGL 4HX1B 4NSKA 4X6BB 5FKPA 5MEPA 5MI0C 2NY7H 3TC9A 1ND0A 2DMKA 4G9FE 2G5RA 3ARFA 3QEQA 4GRMB 4LP4A 1X5FA 5C0JB 2VC2H 4XPFH 4JFPA 4W4OA 2AK1L 1KIRA 2GUOB 2H1PH 4MSWA 4M61B 1EUUA 3MUJA 1RZIA 1BIIB 4PRAA 3AFLA 4MD0A 3OMZA 1UH2A 1TZHB 3CUPA 5D5MF 2AK4B 3V0AC 3MV9B 8CGTA 2YPLA 4U1IB 1IM9D 3QO0A 2W9DH 3MMEB 2CDEA 1FYHB 3HZYB 1U8JB 2UWEB 3AMKA 4PRNB 5C0BA 5JOFA 1TZIB 4AENA 5F44A 4MA1B 1HHJA 1MRFL 4KK8C 3ALWA 4R0LA 1Z3GH 2OP4H 4UTAL 3QRFM 4LF3B 2P8LA 4LHUD 3WXVL 2D03L 2ATKA 3Q6GH 3QT2A 4X5LA 1W0VB 2OZ4A 4M03A 4WNQA 1JZ8A 4PTUB 5A40E 4I5BB 3EUUA 3VXMA 1GGBH 3NFPA 3BKYL 4X7SL 3WXWH 4Y16C 2G2RB 2W0PA 3L1OH 3LRSB 1PJ9A 1J0YA 4P2RE 4F7TB 5I18H 1SEBB 3TEUA 1ZWIA 3CFCL 4JG0H 3NCEB 4JM4L 1T80A 3DXAB 3FCTA 3GUTA 3QB7C 4FTVA 1R5VA 2XTJB 3QIUA 1W72L 3GSRB 4ETYA 2A6IB 4MDIA 5I17B 4GSDH 1T0MA 2WWKT 4FFYL 5ITFB 4WV1A 1F13A 4YDKH 3ZYJA 3RVVD 1N2RB 4JAMB 1JZ5A 1OW0A 2XIDA 4RGOL 4KZEL 3SDCD 3KVQA 1KJ3L 4JFDA 2WIIA 4MNGA 3WCYA 4JJ5A 4WU5B 5IIEB 1KYOJ 1BX2A 1H3TA 1JV5B 5LWYL 25C8L 4LLAA 1AO7B 3OKOB 4L3CB 1YEFL 1HILA 1S3KL 2C9AA 4GKNA 2OM5A 5B8CC 3P3YA 4IIQA 3O9WA 2VLRE 1JGLL 4GT7A 2VLKD 2YD1A 1HINH 4C57C 4MA8H 3VU2A 3KPOB 4F2MB 1S5IL 4BQ8A 3SY0A 4G8EA 4L5FL 1G9MC 4KKBD 2A6JA 3TLRA 5BMFL 3O2WH 3IDNA 1ZLSH 4UUJB 1KB5H 2NCMA 1EFXA 3IVKA 3C5JB 4XCCL 3BUYB 4NO0B 3VWKA 3DI3B 2R1YB 1BECA 5DRXA 1AP2A 4PJFB 3AXLA 2GFBA 4YX2H 2DMCA 1WZMA 2B39A 4XNQA 1ZLWK 2APVA 3VA2C 1LGVA 3O6KH 2XY1A 3KR3L 4JHZA 1IGCH 1PZ5B 1CFQB 4FFWD 2DN7A 2LQRA 4HS6B 1CFVH 4OFPA 4BKLA 3FOMA 3TWCL 4AEIL 4DFIA 3AB0B 3BI9X 1PY4A 4WUKH 2AEQL 3R4DA 4KGLA 4QRUA 4XGZA 4Z95L 1SJEB 5JW4Q 2BNQA 3FAXA 4LGPB 3L5XH 2H6PB 4DKFH 3KPRB 5DJ2B 2YEZA 2R2BB 5ADPH 3A67H 1S9XA 2F53A 3S96A 4P5TC 3BD5A 4YDJB 4NZDA 4I3GA 3SJVA 3QDGD 4OFVA 4WI3A 5DUBB 4YIQB 3RX5A 5DQDL 4XP6L 5D2LF 5HVWA 1AXSB 1FBIL 3RWEB 3VD4A 3O6LH 1VCAA 4UB0H 4XNUL 3C6SA 2V2WB 5EOCL 5CEYB 2AJYL 5DD6B 1XF4A 3ULSB 2AXJA 3SOBL 3PABB 2VIRB 4JCLA 4DQOH 4XPHH 3QYCA 1CQYA 2DQFB 1QLEH 1ZA3A 3QIBC 4Z7OF 4N0FA 4KQ3H 2ZKHL 5IQ9B 1P4LA 3E3QC 4K2UL 4OKVB 1IGFH 4MD5B 4AYFA 4PJBB 4WFHD 4OZIB 3LEXB 2DWEA 5HHME 3S3SA 1CCZA 2FNBA 3UJTL 4OCYH 4NBXB 3QUML 5LAXA 5HHMD 3V0VB 3MA7A 4ONFL 4LCIL 4NO2B 5L2KE 3HNTH 1EAJA 1R5IA 2LU4A 3CU7A 5F7WC 5KS9F 1I8IB 1QSEE 2JE8A 4POZC 3MR9B 5GS3A 1YEEH 1KN4L 3MGTB 4CUCA 1FSKB 3P9LB 4JANA 1YEJH 5C07E 3QUZB 3HA0A 1YNLL 3MROA 4MA3A 3VGHA 5ETUB 5C07D 1NMAL 3BWAA 4KV5E 4KHTL 3MRKB 4U1GB 3W5NA 4OLYH 1LDPL 4OCLC 4PJDF 4HFUH 2CK2A 3HZKB 5MENE 3O3UN 3B9KC 3OG6B 3ARTA 1I4FB 5MEND 3OR7A 1DVFA 4JRYD 5JXAL 4J3XA 4OD1H 2BNRB 4CDGC 3FQRA 3L6FB 4PJ7E 2FJGB 1UWGH 3MJ9H 3OZ9H 1NFIB 3C9NA 1RURL 3IDIA 4EOWL 3E8UL 4G80A 2BVYA 4PP2B 1HDMA 3MUHL 2XG5A 3LEYL 4Y2DA 4MDJA 1J0KA 1N0XL 1GGYA 3VXPB 4PRPB 2FHCA 5E8NB 4DZ8A 2NY4C 3PQYB 4XBGB 4NQCE 2BVPA 3QJHB 3VFNA 2BSRA 2ORBL 4NQCD 5D7JC 2MPAL 4LLDB 3O81A 3JV4B 2D7TL 2XYCA 3S97C 4ORGA 1XZ0B 3C09B 5GGRY 3G04A 5DC4B 1FZKB 1QRNB 2XKUA 2EYSB 3WDJA 1WV7T 4JZNB 3LQZA 2X70B 4ZUVB 4DW2H 1T1WA 1ZHLB 1DUYB 1H8OA 4PJAF 1OAQH 4PJIA 5CEZL 2HJFB 3C6LB 2PF6A 4XPAH 2ZUQC 4X83A 5DSCA 3C8KB 1IQWL 5EOQH