3MCKA

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
b'DVMMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLEWYMQKPGQSPMLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAEDLGVFYCFQGSRVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C705 MONOCLONAL LIGHT CHAIN
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA01
4ZTPL 5I8EB 3MNZB 4HXAH 3VU2A 1R5WB 1NEUA 2VNCA 2A9NH 1RJCA 4P9MH 2QKIB 1QRKA 2E27H 4U7MA 4EUPA 3MV9A 5I1AA 2HMID 1H3PL 4B5EA 5IQ9A 2Q8AL 1CF8H 3S36L 3N0PB 4HV8B 3V7AG 1KPRB 4JFFE 3G08A 4QWWD 4QTHA 1DSFH 5T1LD 3VE0A 4PJBB 3MJ8B 2IBZX 4LQFH 1UYWL 2Z31D 4HZLB 5FOBA 2YD7A 4KY1L 1RK0A 3VFPA 3RZCD 3U1SH 3LH2L 1JUFA 5EU4B 2LQRA 2XI9A 3PABA 2GKIA 1TDQA 1CFNA 4OCLC 4EI5D 5JA8B 1JGLL 3VI3E 1QPPA 5GZND 4KROB 2VLMD 3GB7B 3UTQB 1NJ9B 4OLWH 5C0BE 3BT2H 1GGIL 5E8PB 3ZKMD 1Q38A 3H3PH 2AXFA 5EU3A 4M7LT 3EDJA 4RFNC 4HULB 3LZFH 3MRPB 1WFUA 2JB6A 4JHWH 3PWVB 1L0XA 1RUML 2R9HC 4TPRL 3C8DA 4JFEA 3GSWB 1U8JA 4ODVL 4K9EC 1MF2H 3HMXL 4C59B 3P40A 5I1KH 4F3FA 3EOAA 1M05B 4J4PA 5J11C 4KTDH 2VE6A 3CGTA 3U9PL 4A6YH 2YN5A 4MNGA 2C3HA 4IRZL 1AKJA 1KB5A 5L6YH 1S5IL 1ZK9A 4JY4A 3BW9A 4WUUE 1IAIH 3IDNB 1DE4B 4XCCL 5IV2A 2BOCB 5DRNA 3IFPB 5GPRA 1U8QB 5DRWA 1RUQH 3QULB 2HKHL 3ZYOA 3Q5YA 4MNHB 2Z4QB 2LU4A 3PHQA 3MLSL 2E9BA 4QGYA 5GS0C 5HHVL 3GSUB 4JR9H 3CUPB 2FO4B 5F7KC 3ARFB 5H35A 5FYLH 1YEJH 3TBWB 2PUQT 4NM8L 3IDXL 4YX2L 5J06A 2Q86B 4I13B 4NUJB 4H20L 4KPHH 4M43L 2Z35A 5F9JA 4QRUA 1DEEA 2APFA 4IDJH 5C0ND 4UTAL 4JGMA 3F7YB 3HI5H 2PXYB 5L8KB 4W4NA 1G7JB 1BPVA 1AO7B 4JFFD 4YXLL 3VFRB 1FC1A 2BZDA 4PJXF 4Z7UB 4U7KA 1YUHB 4XC1H 3VGDA 1JV5B 1RV6X 1BD2A 3I6GA 2VLRE 3PGFH 5TE6L 1H5BB 2Y07L 3VFOA 2XQYK 5E8EB 2FRGP 8CGTA 1QVOB 4MB3A 1YPZB 3C6LC 2R15A 4ZAKB 4EN3C 1BEYH 1BFOA 5GGRY 4JFPA 3LKRB 2UZXB 3DMMB 2R2HB 2JJTC 1CDUA 1T7WA 4WGVB 5E2TH 4JCMA 4LF3B 2GY7B 4HIXL 2G2RB 3H9HB 3T4AB 1ORSA 5C0BD 3GI9H 2C7UA 2XWTA 3LKPB 4V1DB 2AEWA 2CRIA 1QR1A 3MA9H 3VXSA 1MFNA 3UTZB 4AIZB 1MFAL 1KPVB 5D7JB 1XCQA 4YFLI 3NCEB 2P45B 1TQBB 4MJIE 4P2YA 1EEYA 4YDVB 4R9HA 2VXSL 4Y4HC 2IG2L 1Q0XL 3HE7C 3U7YL 4LCCA 3VI4E 3GHEL 1JZ3A 5I0DA 2ZCHH 1ZHLA 3UBXB 3GSNB 3RI5F 2QEJA 4U0RB 1P4IH 3KXFA 3TPKA 3ZKND 1LO4H 2KDGA 1R0AH 4OM1L 4HUMB 5IVXE 1PKQE 3WNMA 3IDMB 1KBGH 1ZAGA 1RI8A 4JLRA 1QG3A 1NMCC 4WW1B 4PJGE 1AD0B 4IS6B 4OLYH 5SX4I 5F1KC 2BSSA 4XPBH 1HDMA 3QQ9D 4W70A 1AH1A 4OF8A 4WUUD 3QPQC 1LWRA 3P3YA 4R4NC 2ZP0T 4HLJA 5GSRB 3WNPA 3TESA 1SQ2N 4AK1A 4K7FB 4MJ4A 3I02B 5IMMB 2V7NA 3Q5OA 1EO5A 3DO7A 4LSRH 3F65A 4KXZI 3HNSH 3VFNA 1VACA 3WUWA 2Q20A 3HZMA 1W0VA 3HZKB 4XPHH 1CGTA 2YPLE 4MD5A 4WIQA 3TIDB 3IS1X 4L8SA 1WAAF 4ZUTB 1J0ZA 5E8NB 3BUYA 4JO2L 1T1YB 2QHRL 1VKXA 5DC4B 2MKLC 3WFEH 4PRPA 3V8OA 4M3JA 4MAYA 4LCUB 5C0DA 2BNUB 1ZLUH 1HSAA 4I18C 2BVYA 1WT5A 1QSEA 2I60H 3SJVB 1GGCH 2X4QA 5DO2C 4OF6A 4XVSL 3KPNA 2VLRD 5DURD 5L88H 1CTNA 2VH5L 4Q9QH 2ZUQB 1FGVL 1MCOH 3HPJB 3JV6B 3KPLA 4J23A 3C5SB 4NPYB 1G7LB 3MUGB 4K9EL 3PWJB 5BOPA 5FECB 2RCSL 4P5TC 3BOVA 5MEPB 3F7QA 3ARTA 2DYPD 3L3KA 4C56A 4MMZC 5JHLL 2NYYC 4ELME 1JN6A 5DI8B 3OZ9L 3ROLA 2XQBL 4JHBA 1E27B 2IQAB 3E0GA 4L4VE 4U6TA 3ILQC 3TO4D 3LB6D 3PWNB 3KPMB 4P23D 4HUVB 3OAUL 5DSCB 5BQ7A 5F7NC 3RKDD 2R23B 4MJID 4LEOB 4MNQE 4G8IA 2W60A 2XWJA 4K3DH 4PYHA 2YD3A 4ELKA 4L3CA 3DV6A 1MHHA 2OTPA 3JUYA 2QHLA 4I48A 5LG1A 5B4MC 3O2DH 3QUXB 5GS0L 1KJ2L 4PJHE 4Z76B 3BP6B 1JMXA 2DTMH 3N85H 3D3VA 1KEGL 3QZWG 3ZYJA 2CXGA 2DDQH 2X6MA 3QUZD 4KKNA 4P59H 3ZE1E 1IM9D 4O51A 1LEKA 4U1SA 1LK3H 1A3RH 1N4XL 5CCKL 4IOSD 3UAJC 3SY0A 4MQTB 3KYOB 5DR5L 3NFNA 3TYGH 5DMJB 5CJOL 1ULVA 3G6JE 3MNWB 4WV1A 3LEVH 5HYEA 5ETUA 1NFDF 2QSCL 1FDLH 2DQUH 4RRPA 4P3DB 3UP1A 3D6GA 5I1CL 3L3JB 3VMOA 5EU6A 2HFFA 3RWIA 2YPLD 5EZLA 4Y4KC 5LXGL 4I5BB 4Y2DD 4NZUH 2HJKA 2AABL 2D0GA 3EGSA 4ORGB 5DT1L 5C8JB 4ZFGL 4G8GA 3D5OF 1U92B 4LVOB 4Q9RL 3BFOA 3BEVA 1TVHA 1B6DA 3BKMH 4KKBC 1EMTH 1H15B 3GHBL 3O9WA 3MTRA 2XKNA 3VWJD 5IQ7L 2V9TA 1R24B 4D9LL 4ZXBA 5KS9B 4K8RD 35C8H 5ESQB 4IOIB 1IM3A 4QOKE 4M62L 4WO4A 2WWKO 5CGYC 4CRPA 5FGBA 3IFLL 4PRIE 1G0XA 3IJSA 4QCIA 1IEBA 4AENB 1QPXA 2Q3ZA 2I26N 1OTUD 3G5ZA 2VTFA 2HKFL 1BGXH 3KPQA 4F7PA 3PHSA 1OM3L 4L4VD 6CGTA 3GJFA 2JCCE 1BVKA 4LPVA 4WU5B 4KMLB 3QQNA 1UQSB 2Z0BA 2DRUA 2PYEA 4M6NL 4MNQD 4JVUA 1I7RA 4XVJL 2ARWA 3U0WL 3DETC 5EN2B 4LMQE 4APQC 4XNZB 2HT3D 1DFBH 2F8OA 4OZHA 5JW5A 2GT9A 4LBEB 1JGVL 1FNHA 3EJJX 1OP3H 4DUWA 2Q6WA 4MZ2A 1CVSC 5DMKB 2C4FT 4I3SH 2QR0A 2W0FA 4LCWA 5IBUB 1AXIB 1UG9A 3KPRD 4NCC2 4NQCA 3V5DB 4F33B 4GFTB 4QRPE 5HYJB 4XI5C 3ZTNL 2I9TA 2FYYB 1WWCA 4BFEA 3VRJA 2VDLL 2W9EH 1V3JA 5IFHH 1BJMA 2OL3H 4XAWL 1E6JH 2R4SL 2Q76A 1JGDA 4P57A 5HHNB 5DXWA 3MBEB 5C7XL 5D5MA 1IGIL 1UC6A 4JDVA 5LBSH 7CGTA 4LLUA 4UINH 5IW1A 3B6SB 4CBPA 5DA4A 3MRQB 4ACPA 1FL5B 4DCQA 1KJMB 5JPNB 4Z7NF 3L5WA 4LKXB 3STZB 3LIZL 1KCLA 2BSTA 3H6JA 5MERB 2NY2C 1GH7A 1Q0YL 1Q9WA 2FL5A 3MJ9L 1WCBB 5HGDA 1G6RA 3TIEB 3C08L 1OLZA 3JWDC 4G42A 3MRFA 3S4SG 4DKEL 4KZEL 1N6VA 3BZ4A 2D9QB 3QG6B 2DWDA 1ZSDB 4N9GA 3SDCA 2EIZB 4LCYA 2HVJB 3VJ6A 3REVA 2GJZB 3BH9A 4FQJH 3MV8D 5CJXC 1OHQA 1CDJA 3ARVA 2VC2L 4U6YB 3U0TA 3FQRA 3NGBC 3WO3B 3WDJA 2XN9A 4QRSB 3O3DB 4QOKD 5D2NB 3QNXB 1ZS8B 3VXQB 4NSKA 4CNIB 3I9GH 5DMIH 1ZVYA 1NLBH 1A6VH 1IL1A 3HE6A 3ARGD 4M02A 4PBXA 4ODSL 2DMKA 1XGUA 1UM6H 5C9KA 3GDBA 1JNLH 2QQLH 3O3EA 5EA0L 5IGXL 5KSBB 1OCWL 2ZUVA 3BKYL 1CLOL 5FUZH 5SV4A 4EIZC 5ITBH 2R8SL 5FYKL 1T7XA 1K8DA 3FO1B 4TNVK 1GZPA 1FVDA 2DTSA 2CK0H 3LKOA 3F5WB 5IB4B 4U6VL 1TIUA 3FFDA 2CMRH 4H26B 5DYOB 1OSZA 3U9UB 4Z6AT 3DVNA 4XNXL 3QJHA 3BQUD 1OP5H 2J8UB 3E2HB 4KGLA 2O5ZL 2EIBA 3DX8B 1BOGA 1LO0H 1T1XA 5HYSA 3FZUD 4QYOB 4KTEL 4UTBL 1TTGA 3SO3B 4HX1A 4XNUL 4HFWB 5EIIA 4JREB 5FV1L 4OGYL 5TJWK 1NGYA 1JNNL 5GRVL 2NY4B 2XZCL 4QRPD 2RIKA 4YR6A 5C0AD 1CBVH 3B2VL 4LP4A 3NCYS 3VWKC 2H9GA 5J6GB 4ONHA 5J56B 4Y16A 3VDAA 4Z8FL 2BRRL 1DQMH 3GM8A 3GIVA 2ICWA 2BP3A 4GKSA 5E1AA 1NFKA 3VW3H 2HT4D 1WZMA 2HFEA 4P3WA 3VXTA 3D85D 1AFVH 1P7QD 3QUYC 3T2OA 3MJ7A 4XP9H 4TNVF 5KZCB 2F19H 3B9VA 3NABL 3ECBA 4OI7A 4GRWE 1S7TA 3QHTC 4GW1B 3BIBX 4ZD3H 4OFVA 3VXOA 4JFYA 3W2DL 3DI3B 4P46B 3OAYH 4Q9BA 4JM2D 5ACLA 2EDNA 4ZDHA 5A2FA 4M1CD 1FN4A 3LEXB 3RTQA 5I8EA 1KIPB 1SMOA 3MNZA 5E94B 1UZ8B 4B7LA 4G6JH 4DKDC 2CLVA 4Z5RB 5CBEA 2AKRB 4NQXB 4O9HH 4JJ5B 3ZE0F 4AEIL 2F58H 4QY8B 3D0VB 1DQDH 2YK1L 3HNTL 3LRSB 3QCUH 4OCXL 4WEUD 1CN4A 3VGHA 4LSQH 4HV8A 1OARH 1F8TH 3KYMA 1ZLWH 2ZOLB 3FRPG 1HWGB 3EYSH 1U36A 2ZG2A 4PJBA 4XRCB 5HI4D 3QIBB 2CUHA 3RGVB 5MENB 1L6ZA 4HWBH 3DO3A 1IZJA 1N6QL 5I19H 3WFCH 4WHDA 3KYKH 3V5KB 4RGMC 2GI7A 3V6OC 5H94B 3PG2A 5EU4A 1KCUH 2DLIA 4NYLB 4ZUWA 4RBPH 1DQTA 5J89A 1LE9A 1BQUA 5C2UB 2NX5D 4JB9L 1H8NA 3LN9A 3QHZL 1CICA 4V2CB 1S3KL 3GB7A 3UTQA 2C1PB 3QEQE 5E8PA 4M93C 3C8KB 4S2SA 4X5LA 1JI2A 5ANMB 1QBLL 1KN2H 5BO1L 2WQ8A 5IJKC 4YE4H 3T0EC 4JHWL 2I25N 3MRPA 5KTEH 3ZMRA 1MCRA 4X4MA 4ZPTA 3P4LA 5HDQL 1G1YA 3WIHA 4RDQF 3EW3B 3QIWD 4O2FB 1KJVB 5KSAD 3DSFH 1NCDH 4PJCB 1M05A 4WCYH 1OT2A 3S97C 3F12A 1IT9H 2VXVL 4MA7H 3FB7B 1MEXL 4JRWA 5L6YL 3JWDL 3QNYB 2O5XL 4KI1A 2DQIH 4KVCH 4X80H 3GMNA 1FLTX 1HNFA 2N7AA 4YGVA 2VZOA 3IXAA 4G8EB 1MCPL 1Q9KB 3IDNA 1DE4A 2BOCA 1KULA 1U8QA 1FYHB 3U0PB 1ZA6B 2BVPB 3L3DA 4ZUUB 1TVBB 5AG8A 1BM3L 3WCYA 1YQ2A 3QI9C 4OM0H 4YBLC 4PV8B 3BDXA 3GSUA 2CLRA 4YHKL 4NN7B 4YC2C 3MACH 2FO4A 3OSKA 4HMCA 5FYLL 1DQQB 3ARFA 3O8XB 3TBWA 4JQIL 2VOTA 3FT3B 4OQTH 4NHCL 1CU4H 4E0RB 1N5AB 1X7QB 2DJ4A 3FFCE 1E4KC 1WSST 4BFIB 2Q86A 3ET9F 4NUJA 5EWIH 1T5XA 5E56A 4HJ0D 3NA9L 1YN6A 3Q0HA 3F7YA 2PXYA 4BH8A 3V0WL 5DEFB 1G7JA 2JF1A 4OGXL 1FO0H 1YEHL 2FNBA 4GBXC 4OZ4B 3P9WB 4Z7UA 1YUHA 2CLZB 1UM4H 2ITCA 3HZYB 2DM4A 1WJ3A 2JTDA 4JGJA 5C2BL 1HWHB 1UXWB 1H5BA 2P5EB 2NY3D 2Y5EA 4Q0XL 1QVOA 5INCB 1YPZA 4TSBL 2R0WH 1BEYL 2X9XA 2HRLA 4G6FB 4ZAKA 5HHXH 3LKRA 2IBZY 2R29L 3DMMA 3SGDH 2R2HA 4BJLA 1LP9E 3V2AR 5JXAH 3NZ8B 1RUPL 3H9HA 3ZDZE 2DD8L 3QEQD 1NANH 5FF6B 3UYRL 4TSCL 1G84A 4AIZA 4R4FH 2QSVA 5D7JA 1P7KB 2FEDC 4WVRA 3NAAH 3WS6A 1I1AC 5BV7C 3KS0H 5E2WL 4RFNB 1AGDB 1AGCB 3IJYA 3I3EA 4AYFA 1NCTA 3UBXA 3BRFA 3GSNA 4HBCH 1DBAL 2VO5A 5F6IC 3S36X 3BN9C 1ZA3B 5FYJL 2AJVH 5J11B 4LLVA 3MLXH 5I6XC 1HHKA 4OLYL 2CR6A 3NPZB 1T3FB 4WW1A 4IS6A 4N0CC 3ULVH 4EVNA 1EPFA 4OZIB 3QO1B 5J57B 1TJIL 4NKIH 3BIAX 1P4LA 4DKAA 3B83A 4RX4A 1EV2E 5T5NF 1UB5B 3SCMD 3I02A 4S1DC 4TSAL 5IMMA 1HEZA 4ZO9A 3QIUB 4JO1H 4UUJA 4XWGH 3VXMD 4PJAB 1KJ2B 5EU5B 1S7VB 4JO4H 3GGWB 4G80A 3FFCD 1AQKH 2IBBA 3KS0J 5KVFH 3V52L 2R39A 1ORQB 3WKML 5C08E 5AD0B 5I18L 5IB3B 1NC4D 5GRWA 3SQOH 4ZUTA 2MKWA 3CFCH 4NUGH 1FG2B 1PX3A 1DBKH 2F54E 5EZIL 1PFCA 1F4YL 3LKSB 3WFDL 3FQUB 3MYJB 3TN0C 2LTQC 4LCUA 3TZVD 5E2VL 2QQKL 4HWEH 4RFOL 1A22B 1P53A 1MFEH 3QXVA 4GKZA 5I1IL 4G43B 1EO8L 3O45A 2P49B 2R69H 5DEZA 4NKOB 4PB9H 1MCOL 3GNMH 3JV6A 4GQ9H 4NPYA 3MUGA 3PWJA 3B8SA 3R1GL 5F7DB 5FGSA 4AL8H 2XTLA 4U3CA 5D7LE 1QA9B 2A83B 4LAJH 3C6LB 4EN3B 1DL7L 4M5YL 4N9OB 1HINL 1NAMH 1E27A 5D7KE 3GUTA 2AEQH 3KPTA 4CN1A 2WUBL 5HHOB 3AREA 4P0DA 2OP4L 5GGUB 1VFOA 5CAYB 3PWNA 3KGRA 1IAOA 4A2MA 4HUVA 5C07A 2H2SD 5DSCA 5CJBA 3MRMB 3L6FA 2I9LB 1XR9B 5F3BA 5ICZB 4JM4L 4LEOA 4K3DL 1EA9C 1QRNE 4NQDB 3VI3F 1F11B 2DQEL 1OAKH 3BPOC 2A6JA 3TVMC 3VXRA 1WWAX 2JELH 4KDTA 4DQOL 1IQWH 3KDMA 4Q97A 4Z76A 3BP6A 1RZJH 4YGAB 2V5RA 3MCLL 2P5WE 3MLZH 1U8NB 4JN1L 3C5ZC 1A6TB 3CCHB 4J3UA 4OFYD 3UEZA 5DFWH 1JWSA 1QHOA 3QP3A 4Y19B 3U6RB 2BNQB 1QHPA 3MODH 1FGNH 2FLBT 4UV7H 5IKCB 1NCBH 1NMCB 4JQXA 4POUB 4XAKE 4CMMB 1FFOA 3LEVL 3CVHH 4ISVB 5FK9A 4HPOL 1O5DT 4HKJA 4YHLL 2WV3A 1K85A 3EFFB 4URTB 2I07B 1OD7A 4P3DA 3BDYL 4G9FE 3DHMA 5SX5H 1DVFD 4GAJH 2ADJB 1RHFA 4R7NA 4BA8A 4Y4FA 5C08D 5IHUH 1YJDC 4ORGA 3DROB 5C8JA 1QD0A 2F54D 3RWGB 4ZSOB 5D93C 3U2SA 3V6FA 4PGEA 1URLA 4HQQH 3O3BA 2WBJA 2GW5A 2WP3O 1R24A 4XGZB 1ZHBB 3FHAA 5GGTL 3M8OH 3HC3L 5SV3A 3JTTA 4LRIC 5ESQA 3WMSA 3MOAH 4IOIA 1NGWB 2FZ3B 3EFDL 3VD7A 1JVKA 1MWAL 2C3GA 3LD8C 5B3JF 3BISA 4KKAD 1J9CT 3BKJH 3MXVH 4NZTH 3EJZC 4AENA 3WKNA 2VR5A 4P5TB 4EBQH 5D7KD 1SMAA 3SE3A 4JG1H 4NWUL 1U8IA 4FQ1H 1DQLL 1NDGB 3U46A 1BQHB 4LSSH 4PLKD 4I3GA 4DTGL 1MNUL 4FQXA 5CZXD 2GSGB 2R1WB 1YYLH 2YD5A 1UQSA 5FGRA 3D25A 5IHZB 2YSSB 4R26L 3GMOB 1QRND 5F1SA 3BH8B 2MSPA 1AXTL 2OXGA 4WEBL 4NZJA 4R4BA 3RL1A 1IKNC 1IFHH 1D5ZA 1ZMYA 3SDDB 2VXTH 2R0KH 3LV3B 1BVZA 2AK4E 3VFTB 4YHZH 2P5WD 4XC3H 4Y88A 4LBEA 3D9AH 5E2UH 4PGBB 5GGVL 1CD1A 3B2UD 3KJ4C 1PZUB 1KCKA 4DKFH 1CLZH 1JRHL 2H2PD 1YQVH 1TITA 3X11B 2HVKB 3RWCA 3V5DA 4F33A 4AY0A 4MS8C 3OF6D 4L4TB 1GPOH 3VI4F 5FDWA 4L3EE 4PRDA 1S8DB 1R3JB 4XAKD 1UVQB 2IPTH 3WFHB 3B9KA 2J2ZA 4WWID 5IVXF 3I50L 4AEHL 2CXKA 5HHNA 4M03A 3A67H 1C1EH 4UB0L 5F9WB 4JFHD 4Q2ZA 3PL6D 3ARDA 4G9FD 4YHPB 1X3DA 5IMOB 1X5XA 4BSWA 1Z9LA 1KJMA 3P0VH 5JPNA 2UV3A 4LKXA 4LVNC 3STZA 1JPSL 4P4KD 3GJEB 3KPPB 1AGBB 5T1MB 1U3HD 4KAQL 4Y4KB 1WCBA 2VDNL 4JPVH 5L2JA 5MI0B 2VDQH 3BI9X 2EXYD 3S3PA 3IAQA 4NC1C 4OBSA 3TIEA 1JK8A 1RJYB 1KLUB 3WJJA 3IDGB 3QG6A 2ZG3A 1FNFA 3I6LE 1ZSDA 2EIZA 3P9MA 2HVJA 2GJZA 1B2WH 2N56A 1BJ1H 1G7MB 2VL5A 4YHYC 2IPKB 1C08B 1W0WB 2WWMD 3L95A 5C09B 1B0GB 1TQCC 4U6YA 4Z95L 2EDXA 4XVTL 3HFML 4QRSA 4KRMB 3O3DA 4TVPL 5D2NA 4GXVL 3QDHA 5DLMH 3QNXA 2X44D 4Z7WE 1RSFA 5EPMB 1KNOB 3MRRB 4O58H 1WFOA 1QBMH 3H9SB 4JRYE 1UM6L 5J9PA 4NHUB 1JPFA 4NO0D 1F3RB 1QFHA 5DD3H 1FNGB 4X6DE 3LKNA 5KSBA 1HQ4B 4G7VH 1N7ML 1BQLL 4Y0GA 3HLAA 3QA3B 5IB4A 3LVEA 2IGFH 4O2CA 5JHDE 3IETB 1YMMB 4H26A 5DYOA 5JR1L 3U9UA 2HMIC 4ELMF 2OSLB 1ND0A 3MRKB 4W4OC 2VJXA 4XBGB 2AK4D 4QWWC 4AZ8A 4APQB 1IZKA 4XPFL 4NJ9L 4HMDA 2X09A 1BJ1J 1RIHH 2EDFA 4MHHG 2I5YL 3INUH 4Y89A 2Z31C 3O6LL 3T3ME 5FO8A 3RZCC 2EYRA 4XCNA 1CT8B 2ESVB 4LOUD 4L3ED 4UDUA 5CJQH 1KCRH 4LL9A 1YJDL 1TXKA 3FN0H 1CK0H 2HLFC 5J6GA 2Y06H 2C3XA 1I9RH 4LASH 3QDGE 5JXEA 2BOBA 2VMFA 3BXNA 2BHZA 4QT5B 2XTJB 4GG8B 1D9KA 3ZE1F 2A9MH 4FABH 1U0QA 3ZKMC 4FFVD 3RPIB 1EJOH 5DD0L 1TETL 1SJXA 1K8IA 3HC4H 4F7EB 5HHQB 4GW1A 1MCQA 2HJLB 2IAMC 3G6JF 4NGHL 1MCLA 4P46A 3MRLB 2AEPH 2NY2B 1NL0H 1ETZA 4NNYB 2RFXB 1CDBA 1KT2B 3DOSA 4R6UA 3LEXA 1KIPA 3K8MA 3MV9E 1QFWM 3H9ZA 5E94A 4WUKL 4KKCD 5E9DB 3I6LD 4Z5RA 1BZQK 2AKRA 4J12A 4NQXA 1FP5A 4BM7A 1INDH 1IC7H 1ZLVK 4EI6A 5FCUH 2VIRB 4K3JL 5HHME 3DRQB 4O2EB 3LRSA 3LN4B 2NY6C 1F4HA 1LO5B 2FH6A 2J4WH 3H3KA 2GCYA 4FMKA 3NGBB 4P2QD 5MP6L 1P2CB 2MPAH 3QFJB 4HIJA 4U1KB 3QIBA 3F62A 4K23L 3THML 5MENA 3EOBB 1QSFB 1JE6A 4H8WC 3V5KA 4Z7VB 4CJ0A 1LNUA 4UT6L 1UACH 4DEPC 5BS0E 4YHIA 4U1NA 3OKKA 4DUXA 5H94A 3O6FD 2VLKE 4NYLA 3QG7L 1N26A 4OKVB 5JHDD 4JHZA 1ADQH 4L29B 4PJXB 2FD6H 1FZJB 3CC5B 4HT1L 1WC7A 5DWUL 2EE9A 3AMKA 4MJ5B 3CXDL 3HRZB 3R0MA 1J12A 5EU7E 3BESR 3MRIB 4YE4L 1H9VA 2FECL 1T21B 2VZSA 3U4BH 4OZFG 3HAEH 2NY7L 4HF5L 5GHWH 3BD3A 1Q72H 3OKNB 4QRRB 4ONOA 5JW4N 4MNGE 2VAAB 4POZD 4CVUA 1D5BB 1KFAL 3L5IA 3QJFB 2RR3A 1OB1B 2BC4B 4WHCA 3QDGD 5E6ZA 1EGJH 2FX7H 1J1PL 2DQIL 3QNYA 5KVEH 1BJ8A 5IEKB 4LPYA 2EZ0D 4LNRA 1UT9A 1Q9KA 1GHFL 1OVZA 2CJUL 2VQ1B 3HMWL 2YUVA 3U0PA 2HTKD 1ZA6A 3QUYB 4ZUUA 5I1EL 4LHJB 5JPMA 2E6PA 4CADB 3EIFA 1IBGL 3CAFA 2UUDH 3QXAB 3SKJH 2X89D 3PV6B 4X8JB 1EK3A 4ZUSA 2EDOA 3S37H 3FT3A 4E0RA 1N5AA 4WDIB 3MV9D 1X7QA 4MZ3A 2ADFL 2HG5B 4BFIA 2UZIH 1NBZB 4IRJA 2FECI 2H3NB 3K2MC 1UM5H 1RHHA 3LDBB 1PKOA 5DQDH 4GXUN 2BY0A 3CVIH 4OD3L 1QO3B 5EUKA 3NCJL 3H42L 2DBJA 1BD2E 2GK2A 3C9NA 2O61A 3TEUA 1F4XH 3EDDA 4N8CH 4JRXB 4U6XA 4MA8L 5D72H 3IT8D 5CEYB 2EDBA 5F8QC 1G9EA 1UXWA 5L7XH 2P5EA 1EHLH 4FQ2L 2C4FU 4RMWA 4Y5VC 4UAOC 4RSVA 1RZKC 2PTTB 4Z0XB 3O3UN 4RGMB 3MRHB 4JZOB 3TT3H 2DQGH 2LABA 1EBPA 3QB7C 4NP4H 3NZ8A 1HH6B 1YNLL 3GKWH 2Y72A 5FF6A 5EOQH 4UOJA 5JLZB 1EVUA 1RU9H 1MREL 4LARL 3RVWC 4JFDB 3GJFH 4LGRB 1QFOA 2IANE 4OZGA 1FORH 2VXQH 4J4PD 5F9AC 3RFZC 2B5IB 1Z0NA 3IXTB 3KXFE 5KAQF 4HAGA 2Q3AA 1G6VK 1Z3GL 4DAGH 5EOCH 5ILTH 2KZWA 1CS6A 4UILH 2F74B 4X6CE 2QL1A 3MZGB 1S9KC 4HS8L 4E5XA 1JYNA 8FABB 2ICEB 2X1XR 4OZIA 2F53B 3QO1A 4HK0B 1PZ5A 3NH7L 2G9HB 3NFSL 2W38A 1A0QL 3PWLB 4MXWL 3RKDC 1UB5A 1J1XL 3DTXB 2O26U 2VL4A 5CGMA 1RAMA 2FX9H 3QIUA 3X13B 2CGRH 2X4PB 4HCRL 4P5KA 1TNMA 5EU5A 3I3DA 4YC2B 4CU7A 1S7VA 1AQKL 1QBBA 5EC1B 4H8WL 1X4YA 2BXZA 1ORQA 3QUZC 3MRDB 3RIAK 3BKCL 4OCWL 4PRPE 4KRNA 5AD0A 3O2VH 2FJGB 1T6WA 5FXCH 5IB3A 1J5OH 5EOCJ 5CD3A 5DFVD 3RWJB 1QSEE 3LKSA 3MYJA 3RZWA 3TO2B 3N1FC 1G6RH 1BD2D 2OI9C 3BMVA 4G6AD 5AWNH 3X3FL 2V9QA 4JFXA 4GBXB 2NY5C 4JG0L 5F8RC 3IDJB 2PF6A 2A6DB 3GMQB 1ZOXA 4QHKJ 3WSQH 3DARA 2BNRA 2UZYB 4XNMA 4NKOA 5E8DH 1FE8L 1UXSA 4LHUA 1MJ7L 3BP7B 5GRJL 4C56E 5BMFL 4YDKL 4JDTH 4R2GC 3DBXB 4Y2DC 1ZANL 1UWXH 4XP1H 1LE5B 3C6LA 4ZMAT 1JCKA 1RZGB 3VXSD 5JUEL 2DJUA 4HUWA 4LSTH 4GG6E 3RNQA 3V0VB 1NCCH 5F7YC 2E6JA 2A1WH 5T5FH 4EUPG 5HHOA 1S9WB 3GMPA 4YFEA 3TA3C 4XWOD 4JCLA 3RIAF 3VWJC 3FRUA 5IR1B 1C5CH 5MEQB 3MRMA 3MQIA 3WXVH 3SDAC 2I9LA 1XR9A 2IH3B 1IRAY 4RMRA 4HK3J 4NQDA 1MCWW 4K8RC 1F11A 3KXFD 1I1AB 5SWSB 1MHPH 5I2IB 2B4CH 5EOTB 1MWAB 2ZCKH 3AC0A 4YDIH 5FCSH 4P2RA 5I1JL 2H26B 1YNTA 5JOFB 1F6AA 2FO1A 1MLBB 5C0RH 1WIPA 5F6IB 1OTUC 3GM0A 5LQBL 1CYGA 2BFVH 1G7QA 2BNQA 3EOYG 4NNPH 1NCBL 5I6XB 3H2WA 5IKCA 5D70L 4H0GA 3TP4A 3BSZL 4CMMA 3TPUA 4H1LA 1D5IL 4LVHB 3TH3T 1MUJB 4RNRB 4ISVA 2P8LB 5EU6E 4NJAH 1G9NL 3WIFB 4QO1A 1FC2D 3REWB 3S35L 3EFFA 2E7LC 2I07A 2VDPL 2ED9A 1TLKA 3SDXA 4U1GC 4MLSA 4HG4J 4X6BA 2AJ3A 1A6UL 2ADJA 1K3ZA 5C6WH 3P0YL 5E1HB 3PDDA 5EBLB 3P30H 2AJSL 3WIIH 5INDB 5GRUH 4PRPD 5IESH 2YXFA 2ICCA 4HMEA 2DQHL 4MXQD 3DROA 5ERWB 2F15A 4KWUA 4ZSOA 1QSED 4ZUVB 3KLHD 4DVBB 1J0KA 2DLFH 3BRDA 1J8KA 3ABZA 4OAWB 3TN0B 2LTQB 4LLMB 4XGZA 4K3EH 5T3XH 1M6OB 1CGSL 3T2PA 4FZEH 4PY7B 4HWUA 2WUCL 2B2XL 4XPTH 4C56D 5ITFA 3Q1SH 2FZ3A 3SE4C 3CFBB 4H0IA 3LRHA 4XH2B 1AC6A 4Z7QE 4YPGA 3WJLA 5F96L 1FG9C 1NUGA 2OJEA 5HVGB 2ED7A 4DFIA 1I4FB 3O4OC 3QXDB 3EYVB 1BQHA 1TJGL 3OR7B 3Q2CA 2YN3A 1GXEA 3G5XA 1U8HB 3O0RH 1FBIL 4ZS6D 3ULUH 4N1HB 5GS1A 2YSSA 5IHZA 3GMOA 1LP9F 3KJ6H 4OZHE 2XNAB 4LAQH 5K33A 4P9HH 3SDDA 1N6UA 3VFTA 1XZ0B 4LCWE 5E2UL 3TVMB 3RWDA 4NQCE 3ARGC 1F6FB 3MGAA 5IB1A 1Q9OB 1IILE 4PGBA 4YO0B 3QDJB 5J8OA 4IHOB 2NLJB 4XBEH 3C5ZB 1ZLWK 4HLZH 1Y18B 1A6AB 2HVKA 2R4RL 4N0YH 4YXKL 3RGHA 3RUGA 2X4UB 2A77L 4NQEA 1T22A 3MREB 4FTVE 3L7FB 2RQ8A 1R3JA 4AMKH 3VXPA 2LE9A 1UVQA 4XNYL 1T6VN 1DLFH 5EU6D 3F58L 1M7IA 1C1EL 3BQUC 1R3KB 3WLBB 3B9DA 3LS5L 1BECA 4G6KH 1JWMB 1Y6KR 4YHPA 2NY5L 1CGXA 2HH0L 5D7SL 4G8GD 1XF3B 2V5SA 2LAGB 2V7HA 5T1MA 3T08A 1MCDA 1J0IA 1HILB 5F1NB 1I9IL 3O9WD 5IB5B 5T3ZE 3QEGH 4EDWL 1MRCH 1RJYA 4ZXBD 5JORA 1NCUA 1MIML 1VDGA 2B39A 1A5FL 3IDGA 5D93B 4DGIL 2HT4C 3RKPA 3SHSA 1DN0B 4WO4D 4F15B 2IPKA 1C08A 1W0WA 1OGAB 4XZUB 1B0GA 5I1DB 4U1IB 1A64A 5DLML 4J3SA 2MFNA 4K8RL 4WEMB 2X40A 3BAEL 5SWZB 1KGCE 1KNOA 5DF0A 3WUWG 1I9JH 1QBML 2GY5A 3DYPA 4ETYA 3LD8B 5C0EB 4NHUA 2H8PB 1G9MH 4JM2C 1A4JA 4G5ZL 4YDJB 4XCEB 1FNGA 2FBJL 4E42B 4OGZA 1OAUH 1HQ4A 1MLCA 1H0DB 2B0SL 4PV9B 1ACYL 3MRNB 2XA8H 2DWEB 1PYWB 1HOCA 2KPNA 4M8VA 4ZNEE 1AHWA 3QA3A 2NXYB 4TULL 3AUVA 1WWWX 3NFPA 4M1DL 1YMMA 4HDIB 1YY8B 1TMCB 5DJXB 2OSLA 3N1MC 2HWZH 4C4KO 3MRKA 4QTIH 5CLTA 5E8OA 2EXWC 3CZFB 2FGWL 4XBGA 4LCWD 2Z91B 4NQCD 3KPSE 5IFJB 1UKQA 5HI4C 1A7RL 4O00A 2I27N 3GKZA 5JQ6H 4YLQT 1EAPB 3U36A 1A3LH 3KJ4B 1EX0A 4OCYH 4B7IA 2OX5A 1CT8A 3UTPD 2OS7A 5DUMH 1A21A 2FIKA 4FTVD 2N4IA 4NN6C 1X5KA 2EDLA 3B9AA 5BCAA 4TUKH 5HVHC 3GSNH 3S34L 1R3IH 1VB9A 1S7SB 4FQLH 4MA3B 3AB0C 1XEDA 3EYUL 3HAEG 5GJTH 3AXLA 4P2CG 4ODHH 1EJOL 1V3LA 3RPIA 2GEEA 4ZOAA 4JY6B 1FVEA 1RFDL 1RULL 4F7EA 5E70A 4D8PB 2HJLA 3BO8B 5D8JL 2VISA 3BPCB 1S9XA 4LVNB 3QIWC 5KSAC 2IFFL 3MRLA 1YEGH 4NNYA 1NFIA 2RFXA 3SDCD 5E00B 1KT2A 4PRNA 5HSFA 4ZYKB 4YEFA 1J1OH 1NSNL 1XIWD 1IC7L 1RD6A 4R0LB 3V6ZB 3O11B 3DLQR 1HCVA 1CFVL 3DRQA 3HE6D 3UJTH 5I15H 3LN4A 4YHYB 1KUMA 1SEQL 1RJZA 2DQTL 1TQCB 4RRPG 1KGCD 4GMTL 5FA4B 2MPAL 1P2CA 3IRZA 1OQOA 2NZ9D 5B38B 5L9DH 4OI8A 3QFJA 5LAXB 5D1QA 1EO7A 1U3YA 3PQYA 5IFAH 2YMXH 1MOEA 1UACL 4KQ4H 1MFBH 4NQUA 2YEZB 1T0MA 4PJFB 4OLVH 1GGTA 3GI8L 4OFDA 2D7QA 3ESVF 4L29A 3OJVC 1KENH 3IKCB 4HJ0C 4X4ME 4OTXH 5I1HH 1UEMA 1T21A 3MV7B 2YD1A 4FZ8H 1Q94A 1G0YR 3WO4C 1JF1A 4H0HB 1CIUA 4F2MB 5GHWL 4JFZH 4PJ5B 5D6DC 4FQIL 2NY3C 4BZ2L 1RUAH 2YPKA 1UCBH 2Z31B 3OKNA 4QRRA 5F9DC 5C6TH 2VAAA 4JO3H 3RZCB 5I16B 1PG7H 2XXMB 1FNSH 1OB1A 3L9RB 3OKMB 2PW1A 5KVEL 5M7QA 1YEFH 1RUKL 1QNZL 2P42B 1I8MB 3MRCB 1M7DA 2VQ1A 3QFDB 3QUYA 3L3IB 4XCYB 1KTRL 4CADA 5C0CE 2CO6B 5LWYH 4BFBD 1H3XA 5DHYA 5E99L 3L3OA 5K93A 1YN7B 1OAQL 4J6RL 4E41B 3RTQD 4O5LL 3QXAA 4GT7A 4Q6IC 2IAMB 1SBSL 2AV1B 2AK1H 3QYCA 4NZRH 4Q58C 5EG6C 2OYPA 2HG5A 1MI5E 3D18B 1HHJA 4YXHL 5BZWB 3A6BL 3K4DA 3LHPH 1H3UA 1NGPH 3CLFH 2BMKA 4D2NA 1WZKA 5TQ2L 3HHRB 2L0DA 3AY4C 1F4XL 3UJJL 2VDKH 2NY6B 3SCMC 4JHAL 3O6MH 4JRXA 3GIZH 1D6EB 3FL7A 3M17B 1KXQE 3RVTD 2XZQH 1CI5A 5CEYA 3ULUD 4PJ9A 1WAAA 5B8CC 3L7EA 4WHTB 15C8H 1O7VA 2DM7A 4Z0XA 1KC5L 3IFNH 3VH8A 4NFCA 1CICD 2B1AH 1N0XH 4Z7WF 4DEPB 1QP1A 3V6OA 2DQGL 2BSRB 5JW4R 4JZOA 3JZ7A 5KS9F 5FEBA 1CFTA 4UV4H 3TWCL 2OR9L 1X5GA 1OQXA 2XKUA 4RISH 3TZVC 1MFCL 2OXHA 1IC4H 1PDKA 1QFUL 3WEXB 3UPCA 4JFDA 4KHTH 4JFFB 3GBNH 3K46A 4NOBA 5IJKA 3QZWB 5TE4L 2IFGA 3TJHD 3HR5B 5E24E 4OUUA 5FHBL 1TJHH 3QUMH 1X5YA 1R3HA 2JKXA 2F74A 3TBVB 3ES6A 3ZLQC 4UBDD 1L9NA 3VG0H 2G5RA 4JVWA 2EYTB 5F1IB 3RU8H 2DQJH 1MRDH 2KKQA 2BY1A 2OM5A 1G1CA 5DZLA 3FQWB 2F53A 2BHUA 2ADIA 5C0BB 1I7ZB 5DJDA 2G9HA 4PR5B 2X2YA 1A1MB 5F44A 5C0CD 2HYMA 3QWQB 3MZTA 3U83A 3SDYL 3ARFD 1U6AH 5HYSG 3DTXA 2D7TH 5TDOA 5JO5A 4ZOCA 1RURL 3O2DA 2Y6SD 3SPVB 5LCVH 3AMLA 5DQ9B 2AJYH 2VUYA 3PJSB 1MFDL 3HI1B 1BX2B 5EC1A 1DJSA 5ELIA 4YBHA 1MI5D 2IQ9H 3MRDA 3O2VL 1CE1H 1N2RB 3OPZL 2PXYD 2FJGA 1DBJH 1LEIB 3PP4H 4Q7DA 3SE8H 1N5YH 1NFDA 4KUZH 1PD6A 5E5RB 3RWJA 5C0GB 2A6IA 3DYOA 3TCXA 4IOFC 3TO2A 4WUUB 3TT1L 5E4IA 1MCCA 3IU4L 4PTUA 5DEGB 2E7MA 1T5WB 3EO9H 4LSVL 2VZUA 4MJ6B 1U93B 4GBXA 3IDJA 2A6DA 4L9DA 1L7TH 1GRWA 4F7MB 4ZAKD 3QCVL 2EDEA 5F7EH 1DVFC 3BP7A 4QHKI 3DMMD 3R8BB 1HKFA 4K3GA 5TPWH 1FNEB 4KI5E 5J4MA 1U8OA 3QDMA 5A43C 3DBXA 5EBMA 2CDEA 4Y5VB 3S8WA 2GJ6A 4UAOB 1RIUH 2XFXA 4NFDA 2LVCA 1RZGA 5EORL 3SE9L 4HKZA 3FB8A 5D7JD 1MRFH 4OCRH 4WWKC 3V0VA 3FB6B 5C07E 1F02I 3CK0H 4TRPL 1IGFH 1S9WA 1ES0B 4ZTPH 1N59B 1VPOL 4CAGA 3IF1B 3VXRE 2VZ3A 3N9GL 2YZ8A 4KUCF 5SWSA 2EEBA 5I2IA 4JKWA 5DD1L 1H3PH 3MRGB 2VLRB 1HCFX 2Q8AH 5DURB 4ODWB 3S36H 4KKAC 1XF2B 3ARXA 2H26A 4MLIA 5JOFA 2H1PL 4RMSA 1DP0A 1ZGLP 3H0TB 3LPFA 2BFVL 2V5MA 2C1OB 2GITB 4K7PL 1F6LL 2DYPB 3AAZB 1EEQA 3DXAB 4PLKC 1FIGL 4AEEA 4KY1H 4OCSH 1I8LA 5IK3A 5CZXC 1L7IL 5FOJA 4J7RA 1OLLA 1Z0MA 4HS6B 4DOHE 4N0RA 1MUJA 3I85A 5IF0B 2P8LA 1A1NB 3WIFA 1XCTB 4PBVC 4MJIB 5I30L 3REWA 1KV3A 4G7YL 3MOQA 2Y9RT 1GGIH 1F97A 4ENED 2F8VA 1TCMA 2W0LA 3BX7C 3NN8A 4KJQC 3B2UC 2PCPA 2NZIA 4GKNA 5INDA 4GSDL 5IVXB 5LGHL 2FR4A 1P5UA 1RUMH 4TPRH 3QUZB 4PJGB 4ODVH 5ERWA 4H88H 3HMXH 3K4ZA 1IM9B 5D71L 4ALAL 2DLFL 4DVBA 1Q8MA 3T77B 4HSQA 1N8ZB 1I7TB 1WISA 3NCMA 3U9PH 1XFPA 3CSYA 4OAWA 4XXCC 5JDSA 3EYOB 1ROWA 5T3XL 1FYTA 1S9VA 4FZEL 4IRZH 3PL6C 1S5IH 1U58B 4RFEB 4OFIA 2CDFA 3EZJB 3QH3B 3FAXA 4R96B 4LPUA 3I3BA 2XPGB 4PP1C 4NO5A 5CD5D 3CFBA 4P4KC 2X1PA 4XH2A 2HKHH 3FMGL 4QGTA 2YPLB 3O4LA 4R2GB 5JZ7C 3ARED 4Y2DB 3MLSH 4ZQKB 3NIDE 5HHVH 4PGCB 2EXYC 3I84A 3OHXB 5C07D 1M71B 1K5NB 1JTPA 2IADA 2XZZA 2DMCA 2UWEA 1PQZB 4NM8H 3OR7A 4PB0L 2D4DA 3MLPA 3IDXH 2IEPA 4YX2H 2HRPL 4F80A 3VXRD 1P6AB 2AW2A 5JMOC 3TA3B 1U8KA 4H20H 2EE2A 2WWMC 3VWJB 4L4JA 2XNAA 4M43H 3SDAB 4UTAH 1CDYA 1QQDB 1CDHA 2X10A 1HIML 2OJZH 1NBQA 4M4PA 3TVMA 3SGEH 4YO0A 5K9KB 4QXWA 3W9EB 3DUSB 4IHOA 4PLJD 4YXLH 5SX4H 1Y18A 1A6AA 2X4NB 2APXA 2D0HA 4ELMB 3MREA 1M1SA 1HHGA 5TE6H 3L7FA 5CFHA 5DJ8B 3WHE1 3SEPA 3BD4A 4M7JL 3RQ3A 3M1BA 4X6CF 4NO3B 1ZT7B 4R3SA 1JWUB 4ODXB 5I8CB 1R3KA 4MNQB 4HIXH 3S3JA 4N8VB 4Y4FD 2D3VA 1OSPL 4PJHB 3ALPA 4X6FB 1MAKA 1MFAH 4Y5YA 4YK4B 3UBXG 1XF3A 4U1GB 5F70A 1L6XA 1KELL 1MIEL 2VXSH 3U7YH 2IG2H 1Q0XH 4HJJL 4LOUC 3F8UB 3OJDA 3GHEH 2WBJD 3SGKA 2BVEA 4FFWC 4CUCA 4RZCB 1LMKA 3PNWA 4KRPB 1KN4H 4OM1H 4XNQB 1QFPA 4S0TD 4Z18A 3G6JB 1SY6L 3KPOB 4XZUA 2YA1A 3OMZA 2ZUWA 4X7CC 1OF2A 2P24B 4U1IA 4CKVX 4MB4A 3ALWA 2C9AA 2VDOL 5ICYB 5DK2B 4RIRB 4LRIA 5J1SC 2ARJB 1DZBA 1AXSA 1UJTA 2X4OB 5HY9B 1ZGLM 3B4NA 4FQXD 3VFUB 4LPWA 4XCEA 1A7OH 3R0NA 4E42A 2OR8A 3S35X 4PV9A 1MHEB 2HAZA 4NO2B 2AXGB 3MRNA 3BP4A 1REIA 2DWEA 1PYWA 4KKCC 2AQ1A 3O4OB 1RY7B 1GAFL 2LFGA 2MWCA 4HDIA 1YY8A 2HWZL 5DJXA 4CW1A 4GG6F 1JPGA 2QSTA 2JLLA 2EEDA 2ED8A 4D0BA 4JO2H 2QHRH 2VDRH 4PJDE 2Z91A 3FT2B 3WLWD 1IKNA 4QOKB 5EFIA 4Y5XC 5JQ6L 1JGEA 2JJUA 5E0QA 3K74B 4PRIB 3ARGB 2NQCA 3OKDB 1CGUA 2GSIB 4HS3B 1KTLB 4OCYL 4XVSH 3K81A 3B9KD 3QEHB 5M94B 2J6EL 3O6FC 2VH5H 5DMGD 3RY4A 3O41B 2MCPL 1FGVH 4QKXB 3R06B 1FZOB 4N90E 3TCLA 3BGMA 4K9EH 4PGJA 3ARDD 3EOTL 2RCSH 3MFFB 4FQCL 1JNHB 1S7SA 4YNYB 4MA3A 1IAIM 5JHLH 3AROA 3OZ9H 2XQBH 1H3GA 4OV6F 3V9FA 4XBPB 1HK6A 3BQUB 5D2LE 1MH5B 1J18A 1OWWA 4XTRD 3VFGL 2R1YB 2VABA 2P48B 4U1JB 1WFTA 4D8PA 3OAUH 4RMQA 3F7VB 3BO8A 2DBLL 5IOPA 1ITCA 3GJFK 3TBSB 4POZC 4QRPB 2CKNA 5CKAA 5GS0H 1KJ2H 1AGFA 1OW0C 3CMOL 3KNBB 2QQNL 4ZYKA 4ZPVB 1KEGH 2OQJB 4NC2B 4R0LA 3V6ZA 4PJAF 2AQ2A 2EZ0C 4QNPE 1DBBL 1A14L 4DVRL 3D85B 2HTKC 1N4XH 3V7AE 3WE6B 5FM5O 5DR5H 3NBNA 5B38A 3T1FA 5CJOH 4P5MB 5DDHA 4F7CA 4LLYB 1BZ9B 2WSKA 4LIQE 3GMRB 4OSUL 4JM2B 2YEZA 5I1CH 3D1MC 4Z7QF 5LXGH 4ZODA 2GHWB 4DWHA 1E6OL 2AABH 3RVVD 5HPMB 5DT1H 1EEUA 4HH9B 4F37F 1JZ2A 1B0WA 4Q9RH 3ARSA 5HHPB 5FKPA 3B3IB 5DJ6A 3SKMB 1G7HA 3MLRL 3MV7A 2NY4D 3MSPA 3GHBH 4F57L 1YDPB 4OGAC 5M95B 4PJ5A 5IQ7H 1BQSA 4D9LH 4HBQA 1DQJB 3BWAB 5JXED 3B5GA 3QUKA 1XGQA 3QISA 3T65A 1D9KD 5F7WC 2IALB 5JW4M 5FHAL 1H3TA 4N90D 3C6SB 3OKMA 5DRXA 3HG1A 4NN6B 1LEGB 5HVHB 3Q3GB 1KTDB 1JZ7A 3JV4B 4NBYB 5K9QG 1UWXK 5J1AB 3U7WL 4HEPG 3OXRB 1J8HA 2HP4A 2O5YL 4WFFE 5EU7C 2HKFH 3AB0B 4TOYL 1OM3H 3MRCA 3L3IA 2V2XB 4XCYA 4P46D 3CDFA 3QO0B 1KPUA 3G9AB 3LCYA 1YN7A 4E41A 3UDWA 2IAMA 2X4RA 4NZRL 4XVJH 3U0WH 1WGOA 3QIWB 5D4QA 2ZNXA 4M6OL 4Z78B 1HYSD 2ZWLT 3ARYA 1JGVH 4MA1C 3D18A 4OCMC 5GS2D 2ZPKL 5F97E 1XGTB 3C09C 3CX5J 2AQ3A 4IRSA 4CVWA 2YC1A 3ZTNH 4GXUM 4XAWH 4B53A 1CGWA 1KYOK 5HD8D 1OGTB 2R4SH 1KB9J 1C12A 4J3VA 4GRWB 1D6EA 5GGVY 1ONQB 1WCQA 4FFYL 2XXCB 1HH9B 1UWEL 5C7XH 4Z7OE 5CEXB 1IGIH 3CU7A 4JPIA 4DJMA 2WANA 3IFNL 1VEPA 4FXKA 2AJZA 3C60A 1U42A 2H41A 1KCVL 3IYLW 2DOCA 4X7FC 3MRJA 4PD4J 3LIZH 4HKBB 4I1NB 1Q0YH 4RISL 5DFVC 3MJ9H 3PP3H 3IJHB 4KKLD 1IC4L 3ME0A 4OZGE 1NBVL 2E9JA 5JIKA 4G6AC 2C5DC 3C08H 1CFSB 2YUXA 1F5WA 4ZFOB 4XP5L 4KZEH 5FO9B 4JFFA 2MNUA 1MJ8H 4KZDL 4YHOL 4BUHA 1W72L 5IWLA 3HR5A 2PO6D 3CDGA 1WBXB 1C5DA 2VC2H 1VFBB 2CIKB 3QUML 1HSBB 1DBML 4JPWL 2RBLA 43C9B 2CIIB 1CXFA 5IMLB 3D0LB 1LDPL 3VG0L 5GGQL 2HA1A 4NRZB 4MAUL 2A74A 4ODSH 4OFPA 5F1IA 1HI6B 4K94C 4WFFD 5IGXH 5EA0H 1CVRA 3GO1L 1T20B 2NW3B 1CLOH 2VKWA 3BKYH 3DVFA 2R8SH 3QEQB 3QSKB 1AD9B 1FRGL 1CZ8H 1I7ZA 4I0KA 4XWOC 5CUSH 5FYKH 4FS0A 4WI4A 4XT1C 1FPTL 2CUIA 3UC0L 5CILL 3JV0A 4PJEE 4U6VH 5E4EC 4DGVL 2DLGA 5DVOA 1CQYA 2NTFB 2ENYA 4XNXH 1ZVSA 5DQ9A 3S96B 4IRJD 3PJSA 4Q6IB 4X9GA 2O5ZH 4MVBD 1CD0A 2KUTA 1G7IB 3G6DL 2L7JA 4U1LB 1BBJA 1UKSA 4KTEH 4HKXB 5DJCB 4UTBH 3HKFA 1SJEB 4XNUH 2E7HA 2EC9T 1R3LB 4D0DB 1N2RA 4PREB 2LAAA 4OGYH 3SE8L 1FNAA 1I1RA 4KVNL 3ARUA 1JNNH 1D5XB 2XZCH 1V7NL 5C0GA 3OKLB 1FLRL 2F5AL 1D5MB 3B2VH 4EOWL 3S5LB 3D39A 1A2YB 2BNRE 4Z8FH 3GSRB 5DEGA 1NMAL 4CMHC 1T5WA 4ZO6A 5IJVB 2BRRH 4NDMA 5ADPH 1U93A 3ILPB 1KLGB 5C0IB 4Q6YA 2PYFB 3W9DA 5HGHA 1J0HA 4F7MA 2FEEL 4G6FD 5JOEA 2E9WA 1SEBA 5TPWL 2EDWA 4G6ML 3UTSB 1MJJB 5A2KH 4PGDB 1FNEA 3QCTH 4R7DB 5B8CB 5DMYA 4TVSa 3NABH 4Y5VA 3JTSB 5HVFB 4NKMB 4MXQC 4YH6A 4Z9KB 3W2DH 4RGNB 1WT5C 5FKAA 3FB6A 3KLHC 3S37X 3GMLB 1ES0A 2L7UA 1DR9A 3TZVB 4U1MA 3IF1A 4XP4L 2LU7A 4UMGA 4GAFB 1NC2B 4HFUL 1PSKL 1A6PA 4N0UA 2UY7A 1BBDL 4M7LH 4P2RE 3LQAC 4JZJB 4OV5B 4AEIH 5I75B 3IGAB 2CQVA 1WFNA 3C2AH 3MRGA 2YK1H 2VLRA 2W65B 3HNTH 1YECL 4OCXH 4OCNC 5D6CB 4ODWA 2BNQE 4OLXL 2AV7B 1KB5L 3KG5A 4IEFB 4PJ7A 4DUVA 1JGUL 2WQRA 2OTUA 5BZDA 3AAZA 3NIFF 1LP9B 4IMKC 4OCSL 3DXAA 1N6QH 1FNLA 4G9DB 5L0QC 3MUY1 4LU5L 2FEEI 3QIUD 2A6KB 4ZS6C 3CLEH 5GS0D 1I7UB 5AUMB 3WNNA 4OLUL 1RZ7L 5IF0A 1A1NA 3SDXE 4LFHD 4MX7A 4MJIA 4JB9H 4D3CL 3QHZH 4GQPH 2E6QA 1S3KH 4G3YL 2C3VB 4M5ZL 4N0FB 4LHQB 4ZS7L 3N1PC 3RY6A 3OQ3B 5KSVA 5B39A 1QBLH 5BO1H 5CWSA 5SWQB 4PJIA 3K4AA 1BFTA 2R0LH 4F7TA 4L9LC 5HDQH 4H88L 4WV1C 1FQ9C 1S78D 3EYFB 3HZVA 5FUOL 3E6HB 3SQBA 2BNRD 3ZTJH 4GRMA 3OR6B 2VXVH 1ZTXL 2R2BB 4LHUD 4B50A 1MEXH 2XOTA 3JWDH 1V8HA 2O5XH 4OIIL 4PBWD 4RFEA 1JI1A 3QH3A 4KV5E 4BQ8A 1MCPH 3C6LD 4ETQB 3LS4L 1DVFB 3ZT5A 1BM3H 4PRAB 1CR9L 1U95A 5L2KA 3V0AC 3DX6B 4EIGB 1ZT1B 2MJWA 5C08B 1SM3L 3O9WC 4YHKH 3OHXA 1K5NA 4U2ZA 3U4AA 1F45A 1S7XA 3DI2B 4ZXBC 1PQZA 3BIKB 2F54B 4JQIH 1YNKH 4WWKB 2ARJQ 4NQDD 4NHCH 1GCFA 2K3TA 4K94L 4ZG1A 1XH3B 2WWKT 3TA3A 2IH1A 4P2RD 2EEAA 4Z7VF 3SDAA 3T04D 1QQDA 4AJ0A 2OJZL 3NA9H 1FZMB 3K80A 5DJZA 2BNQD 3RUGE 3V0WH 2V9RA 4OGXH 5K9KA 1YEHH 3P77B 4YFDB 4NQEE 5GISL 2F5BL 3O2WH 5KJRL 2MOVA 5D7LB 1PVHA 3RP1A 5C2BH 3OB0H 2G75B 2X05A 4Q0XH 1GJIA 2FJFA 3VGAC 5HYQB 1AGEB 3JXAA 4TSBH 1QSVA 2EDQA 5EC2B 4WTWA 4ONGL 5GSVB 1F3DH 2R29H 2WM0A 1JWUA 4ODXA 5E5UB 1EDQA 4UIKH 5I8CA 1I3VA 1RUPH 3ARRA 4N8VA 2X9WA 5TDNB 2DD8H 1JTTA 1L4IA 3SGJA 5J0BA 3X14A 4JANB 1K4DA 3UYRH 4TSCH 5F7FA 3L5JA 5CSZA 4HW6A 2FX8L 3IRPX 3T0BA 1QR4A 1JFQL 5E2WH 4M8QB 1BWMA 4BSJA 5ISZA 1Z5LB 2BDNL 5IIEB 2V5YA 5FM8A 3BZEA 1KN4L 1DBAH 2HN7B 2YBRA 5F9OL 5FYJH 3SGEI 4XNQA 3H7BB 3CPLB 1WLHA 3WBDA 2ZOKA 3FQNB 4GAYB 5FV2A 3KPOA 4GRLD 1CE6B 1INEL 2P24A 2DIJA 5F71A 4OLEA 1XGRB 3PL6B 4R97C 4G9FB 2M26A 3LQAL 2EDRA 5DK2A 1F2QA 1TJIH 4RIRA 1F3DJ 1IMHC 2ATKA 3E6FA 4BQBA 5J7CC 3FCTB 3SE4A 2X4OA 4KGJA 4JZNB 4LFHG 5ENWB 4P4KB 5HY9A 5BVJB 4TSAH 1A7OL 2X70A 5I74C 5GGRB 3SDCC 3M45A 3ILQD 4LRNL 3T2QA 3L1OL 4WHYG 2PETA 1MHEA 2ZZUT 4NO2A 2YR3A 2AXGA 5H2BA 3B9EA 4ZNCD 5FO7B 3SKOB 3D2UB 4KI5F 4KK9D 1PLGL 1XIWC 5EB9A 4M7ZC 5CINL 3V52H 3OJ2C 3SDDD 3MBXH 5TF1L 3WKMH 4LLQA 1A02N 1B90A 3BGFC 5TGBB 2HFTA 1EFQA 1XF4A 4I9WE 3HE6C 5I18H 4OZFB 4IIQA 3BZFB 5IG7B 2IMMA 3C5JA 5C9JB 1ERNA 4ERSL 2VDRL 4QHUB 1INQB 5EZIH 1F4YH 1HHIB 1VEMA 5E95B 3WFDH 3PV7A 3FT2A 3FTGA 3IVKB 3QRGL 2NZ9C 4ORZC 4QRTA 5E2VH 3AU1B 4LHUG 1MCEA 2QQKH 4NQED 3RA7H 4RFOH 3WHXB 4PRIA 3KLAA 1LO3L 3ARGA 3OKDA 2GSIA 4HS3A 4LLAA 1KTLA 5BOZG 2OR7A 5I1IH 1I8KB 2NY0C 3QEHA 1EO8H 3OG6B 1B9ZA 2B4CC 1JTOA 3WNLA 2XTJE 2FATL 3EHBD 1FZOA 1ADQA 3QPXL 3GSQA 3R1GH 4HIHB 3MFFA 9CGTA 1AQDA 4YNYA 3I6KA 3HS0B 1DL7H 1NEZB 4JFOB 4M5YH 1HINH 1A3QA 4UOW1 1YMHB 2L4OA 1P84K 2WUBH 1MH5A 5F88A 2OP4H 3BE1H 3V4UL 2J12B 3HNVL 3HAEA 2AK4B 4U1JA 1OTSC 3IDIB 2NNAA 3F7VA 4WNQB 2Y5TB 1JYWA 1MY5A 1NCWL 4JM4H 4OT1H 1LILA 2DQEH 2Y36L 5D1XB 3RVUD 1IJ9A 1HZHH 4HWZB 4KRLB 2YZ1A 2G5BA 1GVIA 5KN5B 4C55A 3LQZB 3FOMB 2SEBB 4DQOH 1EGJA 4L3EB 3FO2A 2JK5B 4DN3L 3MCLH 4ZPVA 4JN1H 3HR6A 2OQJA 4HIEB 4JPKL 1V5JA 3KPRE 4H1LG 4F9PA 4UU9A 4XPAL 5CP3A 3MYZA 3DGGB 4JFQA 2XG5A 3VRIB 3PQYE 5FYLE 3P4NB 3RWEA 3NVQA 3WE6A 1X9QA 4ZO8A 4JN2A 4XMPL 5FGCB 4QLRA 3RTQC 3K7UA 1WQVT 3MROB 5IT2L 1DLHB 4HPOH 5I0ZA 3W5MA 3ZDXE 4LLYA 1BZ9A 2XWBB 4GW5B 4LGSB 4YHLH 3GMRA 3MO1B 3LY6A 5CSBA 1YMMD 4U1HA 3BDYH 3VXUB 4EQ2A 5DJ2A 3TBTA 2X9YA 5IB2B 2DI8A 2YS4A 4MDJB 2DB8A 3G6AA 1MCJA 1GC1C 3NIDF 2OZ4L 2Q1EA 2YHGA 4I9WD 4TN9A 5HPMA 1NGQL 1S7QA 4HH9A 4HHAA 2AERT 1NGXA 2VLLB 3T3PF 4DW2H 1AIFB 5CZKA 5HHPA 3B3IA 2DKMA 4Y2OA 1H8OA 2H32B 5DD6A 3SKMA 3RIFK 4PRHA 3ARBA 4Z7WB 4QRRE 3RVTC 1YDPA 3ZHDA 4H5SB 4Y5XB 3MV8E 4JRYB 4XI5D 5KBNC 5GGTH 3CFDA 3BWAA 2EO9A 1QLEL 3HC3H 2GTWA 5BV7H 4X6DB 5E6IC 1CICC 4PLNC 2XTJD 2ADGA 2IALA 3V6BR 2A0LC 3EFDH 4LLWB 1MWAH 5J6HB 3O6FB 4HIIA 1BQHG 3L3HA 3V5HA 3VFVA 1BOYA 1OAYL 1KTDA 5JHDB 4JKMA 1N64L 5DUPH 1H3VA 5KVDL 1T0NA 3W11D 3W5NA 3UTTA 3SKNB 4RMUA 4Y1AA 2FDBP 3RDTA 3KR3L 4NWUH 4X99B 4WY7L 5C71A 1DQLH 3DVIA 4D9QE 2V2XA 4X0KB 4DTGH 1MNUH 3QO0A 4L8CA 5GGSA 2NY2D 4X7TB 4RAHA 4QHMA 3TJHC 3W81A 1W72B 3O81A 1BHGA 4R26H 5DUBB 3QUMB 1AXTH 4WEBH 3SBWA 2P4AB 5KW9L 4Z78A 3GSOA 1BVLB 1RZIA 1L0YA 1TFHA 4UBDC 5T3ZL 1MHCB 2XIDA 1HQRB 1NCNA 2BRQA 3EO1B 4HGWB 1R5IB 4PFEA 4FXGA 1EUTA 1T2QL 2QJDA 1IGJB 3QDGB 5GGVH 4PJ8B 2DN7A 1JRHH 1XGTA 5C0AE 1FIEA 1FJ1A 2EYSB 4JRXE 2YRZA 3QFJD 1VADA 5D1QD 2V2TB 3PQYD 5FYLD 2OCFD 1ED3B 3RL2B 1OGTA 2JB5L 5DVMA 3HUJA 3VD5A 3I50H 2Y6SC 4AEHH 3NOIA 4X4ZA 3IFOB 1HH9A 3NPSC 5CEXA 3ZL4L 4UB0H 5DK0A 1WZ1L 4TTGA 1J87A 3ZE2E 1NBYA 4EUPB 4AIOA 4PTTB 3ARWA 5I1AB 1JPSH 5JDJA 1SYVA 1B4RA 5I73B 4JFDE 4KAQH 2VDNH 4NRYB 2YD4A 5HHMB 1WBYB 1CFSA 4U7SA 3L5XL 2BCKA 4QRRD 1MJ8L 3QAZC 1EFXA 4JAMB 4TTDD 3MLVL 1GGYA 2WINA 3DX7A 3DRTB 3BGAA 5HGGS 2GAZB 2CIKA 3PABB 1X44A 4Z95H 4XVTH 3HFMH 3P9LB 4TVPH 4GXVH 4PJDF 1F2XK 5BS0B 2CIIA 5I71C 5IMLA 3D0LA 3HC0B 2BX5A 2VLKB 2G60L 4NRZA 3CH1A 3MLWL 5D7JC 1KCSL 3WS6C 1U91A 1HI6A 3QUYD 4I4WB 3P2TA 4PG2A 5EUOA 4BZ1L 1CZ8L 1T20A 5CUSL 2NW3A 1AD9A 2JB6B 1N7MH 3PGCA 1KG0B 4D9QD 3CSGA 1BQLH 1E4XL 1U8JB 2NX5E 4K3HA 3RRQA 1S7RB 3IAPA 2ZUUA 5I1GL 1DUYB 5AYQA 5FYJD 4F3FB 1JHKL 4OB5L 2RB8A 5JR1H 1ZXQA 2VE6B 3OKYA 4PUBH 3S96A 5D2LF 1G7IA 4U1LA 5C6PB 4MNGB 1FL6B 4HKXA 5DJCA 1KB5B 1NFDE 3VA2C 4XPFH 2GQHA 4NJ9H 4O02L 1R3LA 4WFGD 4D0DA 2ZUTA 3QRFM 2I5YH 4PREA 1DDHB 3TV3L 3IDUA 3AM8A 4MA1B 3O6LH 2WZPD 5DRNB 2M8XA 5DRWB 1D5XA 1IGCH 4JRXD 4P4RB 5ABDE 3CD4A 1T03L 3C09B 4XXDA 1GC1L 1S7WB 3K1DA 1PG7X 3S5LA 1YJDH 1QSZA 4PJ9D 1VGEL 4NC0B 5ADPL 3GSRA 5IJVA 3AY4A 3ZT6A 4KJWC 5BXFA 4MYWB 5C0IA 3WXWL 3QDME 4QNPF 2VLJA 3RBSA 2R56L 3MMEB 3M07A 4NKQB 2GJ6E 2GFBA 3OGCA 4UT7L 2WIIA 4ENEC 3QCTL 3UTSA 1MJJA 4P2OB 1QFWL 3UO1L 4PGDA 5DD0H 4OJFL 1TETH 2Z35B 3K2UL 1DEEB 3WFBL 4NKMA 3ZTJG 4YFLF 4ONFL 1UWGL 2NXZD 5EO0B 1E4XI 2P46B 2YPVL 4NGHH 1A7QL 4X98A 4JFDD 3W82A 3DUHA 4DZ8A 4XVUD 3GMLA 4R8WL 1R5WA 4BYHA 1JZ6A 5FA3B 4X4YB 5E08L 3TZVA 4WUKH 3I6GB 1MSPA 1NC2A 4M7LL 2QKIA 3WIHL 3VFOB 1FCGA 4JZJA 1J7VR 4BQCA 4WU7B 3IGAA 3C2AL 3G9VA 2FHCA 4OD2B 1IKFL 4K3JH 2W65A 4KI5C 5CD5C 1BFOB 1KPRA 2EDJA 1CXEA 3AREC 5MP6H 3MJ8A 1LGVA 2F53D 3JV5A 1ORSB 2XWTB 1QR1B 4HZLA 4ODUB 4K23H 3THMH 2R0ZH 3NMEA 1NUDA 4G9DA 1LVEA 3QDAA 1XCQB 4UT6H 3CLEL 4U0QB 4DGYL 2A6KA 1EJ6A 3GRWL 4KDTC 3QG7H 1BIIB 5EZOL 1TPXC 2IANB 1J0YA 1ZHLB 4KQ3L 1EAJA 1NJ9A 5E4EB 1HYRC 3KXFB 4HT1H 5DWUH 2B20A 3CXDH 5J13C 5C92A 4MCZB 1J86A 1VGKB 1HN1A 3HPLB 3O6KL 4RAUB 3QXTA 4JQXC 2R0LL 5GIRB 3PWVA 4X6CB 1HDMB 3GSWA 1WF5A 5CKGA 1P9MA 2NY7H 1KIQB 4HF5H 3RVXD 4Z7NE 4GJTB 3EYFA 6FABH 3OTTA 4GBXD 1FYTE 4I0PB 4U31A 5IW3A 1KFAH 3B8YA 5BJTB 4X5WB 2EKSB 1FAIL 3MJGX 3OR6A 3UJIL 2W0KA 4P3CL 5BVPH 3VFNB 3WUWB 1J1PH 3DPBA 2VSDA 1UH3A 3HZMB 3QDMD 4CMHB 3LMJL 2BVOB 2GJ6D 4CL7A 4Y4FC 3O4LE 4O4YH 2AI0L 3IFPA 1GHFH 3QULA 2CJUH 3HMWH 4LVOC 2VB5A 2Z4QA 1HKLL 4MNHA 5I1EH 2UWEE 4PRAA 1GOGA 2D03L 3U48A 3BUYB 2VXUL 3CUPA 1IBGH 1VKXB 1ZT1A 2FCBA 2YA0A 3VXME 1J88A 5C08A 1IGTB 2WP3T 2WBJC 3EYQD 5C0DB 4HC1L 1YNKL 1HSAB 3NACL 2DS4A 3ZYIA 4WWKA 2FEDD 1KIRB 1QSEB 3CDCA 5SWSD 1PY9A 2ADFH 4KMTL 1XH3A 1AY1L 2ZSVB 5HI3D 4CDHA 4KHXL 2R2EB 3KPLB 4QRQB 4X7SL 2VYRE 2IPUG 3UYOD 1FZMA 3MLTB 4OZGF 4PJFF 4OD3H 3S98A 3LAFA 2YWZA 2QADC 1OT1A 3H42H 1AO7A 3NCJH 3SE3C 1I85A 4LSUL 5CLWA 5EZJB 3O2WL 5A16B 5EULV 3ROLB 3VFRA 3GBLA 4FQXC 3VH8G 1JV5A 4MA8H 5D7LA 2JIXB 4GG6B 1FH5L 5E8EA 4FQ2H 3RY5A 1I1YB 5HYQA 1AGEA 5CJ8A 5L0QB 2W60B 2XWJB 5EC2A 1I3UA 1T1ZB 4OI9A 4ELKB 4L3CB 5ALCH 4UIKL 4LF3A 5TE7H 2M2DA 2G2RA 2UVEA 3EKCA 1JMZA 3T4AA 1JHLL 1I3GL 1YNLH 3LKPA 4V1DA 3ARZA 5TDNA 1XT5A 3OAZK 3WLWC 4GLRI 3UTZA 3ZZ1A 1Z9SA 3DURB 1KPVA 1MPAH 2GK0B 1IE5A 4RAVB 1MREH 4LARH 4PY8J 4FOMA 1OD9A 4PJEF 2RGSA 1LEKB 4YDVA 4U1SB 1RZ8B 4M8QA 3B9KC 1FFPB 3SY0B 2J6EA 4L9LB 3LPGA 3MC0A 3UYPA 5IIEA 4GMSL 3VMNA 3OF6A 1Z3GH 1FYTD 3T4YB 3JVGC 5AZEL 1CGYA 3VCLB 2HN7A 5KANI 3TJEL 4HUXB 3ARDC 5I76B 1D6VL 3IDMA 4N1CA 3UZEA 2GIYA 2FB4L 3H7BA 5GGSY 4B0MM 4GAYA 1AD0A 5F72S 2K7PA 4XXCA 1MCIA 5EU6B 4HS8H 3O4LD 4BUGA 4X4XB 1XGRA 5EZLB 1MCWM 5GSRA 2ILLA 3NH7H 3EGSB 3NFSH 1A0QH 2VR9A 4K7FA 3V4VL 4MXWH 3FCTA 4YZFF 4JZNA 5ENWA 1J1XH 3WJJC 4YQXL 1TVHB 5E5MB 1YEKL 4HCRH 3HZKA 5FO7A 2AGJL 3EJYC 3D2UA 4ZXBB 2VUOA 4H8WH 3MBXL 3TIDA 2EH8L 5IVNA 3BKCH 4OCWH 4DZBB 2EKJA 3EDFA 5D9SB 3TVMD 1IM3B 1UKTA 5E8NA 2Z92B 3BZFA 5IG7A 1T1YA 5C9JA 4Z0BL 1JBJA 3MXWH 1HHIA 2XZAL 5DK3A 2E8ZA 5I1LB 1I9EA 2BNUA 3IVKA 2APBA 1AC0A 3RA7L 3BRGC 3G5ZB 3SJVA 3WHXA 3X3FH 2C3WA 2XA3A 4JG0H 1I8KA 4M9OA 4CVXB 2EC9U 3U82B 1FE8H 3HPJA 2X42A 1MJ7H 5GRJH 3C5SA 5BMFH 4YDKH 1G7LA 1F4WH 2YRPA 2X1WL 5FECA 4EDXB 4FN0A 4HIHA 1ZANH 3VGAB 5MEPA 4FQHB 3HS0A 5DI8A 4OF7A 5JUEH 2IQAA 1GGBL 3P11L 1NEZA 4JFOA 4AM0B 4OZHB 5JW5B 5GQBA 4OD1L 3QWRA 3TF7C 3BE1L 3I75B 4WI2A 3KPMA 5I8OL 2QR0B 1ZEAL 4LCWB 4XCFL 2R23A 2Y5TA 4HUKB 4OT1L 3VXNB 1BF8A 3VRJB 2W9DL 2XYCA 2XRAL 2VN4A 1HZHL 3DIFB 4Y4HB 1QEWB 1QACA 5D1XA 3HE7B 3QUXA 1D9KC 5KN5A 2Q76B 3MOBL 2SEBA 1JGDB 1UJ3C 4FTVB 2JK5A 3Q6FB 4L3EA 4P57B 1RK1B 4NIKB 2OK0L 4XX1E 5I1JH 5FM4A 5CHNB 5A3ID 2QLVB 1C5BL 4XPGL 2ORBL 3JUZA 1WVZA 5IW1B 4HIEA 4BK4A 4GO6B 5LQBH 1KJ3L 4LLDB 4ODTL 5D70H 4HEME 1E4WL 3VRIA 4KK5D 3BSZH 3KYOA 3P4NA 5BW7A 2HTLD 2JJSA 4R97B 1D5IH 3MNWA 5HGDB 1P6FA 1EH9A 1G9NH 4G42B 4JFHE 2XWBA 4GW5A 2NXYD 4NN5C 3MO1A 3S35H 1MQKL 4V2BA 2VDPH 3L3JA 1MJUL 4KV5F 3VXUA 1HYSC 2DWDB 4N9GB 3FO0L 4FHBD 4LCYB 5IB2A 3BH9B 1A6UH 4I5BA 4MDJA 3P0YH 2AJSH 4XP6L 2WNGA 1RZKH 4POYA 1XIWB 2DQHH 4M7ZB 3ZHLA 1C8PA 1U92A 3BVNB 4LGPB 3BGFB 4DW2L 3HE6B 4PJ5E 1BAFL 5HD8C 4UT9L 1A7NL 2H32A 1H15A 3DX9B 5IBTL 1XGUB 2E9IA 4Z7WA 3PWPE 25C8L 4I18B 4MQXD 1P7HL 4JRYA 4CVZB 2EH7L 2EE3A 5KS9A 3JBG7 5FAAA 1CGSH 7FABL 1FVDB 3HG1E 5BV7L 2DQFB 5JNYB 2WUCH 5JOPD 2B2XH 3FFDB 2NY0B 3RUGF 1OTTD 1J8HE 2FJHB 4K2UH 3DVNB 3QJHB 5DUPL 5JHDA 5F96H 1XF5B 3BEWB 4KKLC 1T1XB 1YYML 3SKNA 1CDCA 1AR2A 4HX1B 5K9OB 5EIIB 4E41E 4TQEL 4X0KA 1TJGH 4WU5A 4TUOB 3S3SA 2GJJA 4X7TA 5LGKA 1FBIH 5H37H 3KPSB 3WS3B 1W72A 4OLZL 2DKUA 2PO6C 1TENA 3QUMA 2H9GB 4ONHB 5EN2A 3ULVE 3DWTA 3AS1A 3CH8A 3GIVB 2ICWB 5A1AA 1B88A 1BVLA 5E1AB 1Q1JL 1MHCA 3R8QA 5DMKA 1HQRA 4C57C 4HGWA 1OW0A 1R5IA 3VXTB 3T2NL 1IGJA 3F7RA 2V17L 4PJ8A 3U79A 2ZJSH 2AJXL 2R4RH 5HYJA 4YXKH 2FYYA 5KOMC 4ZTOH 2A77H 1YC7A 1OP9A 2V2TA 3BWUC 1X5AA 2B1HL 3U4EB 3VXOB 4JFYB 1ED3A 3RL2A 2IJ0C 4XNYH 3MBEA 3MUZ1 4M7KL 4PJGF 3SOBL 3F58H 3IFOA 1YA5A 2FWOB 1FN4B 3RTQB 4IRJC 3NCYP 1OAZL 2X89A 3LS5H 4MVBC 2NY1D 3B6SA 2CLVB 2H6PB 3MRQA 1K2DB 2NY5H 1FL5A 2HH0H 2WAHA 5TFSL 1EXUB 5CBEB 5HJ3B 2ENSA 4MQSB 5I8KL 5HBBA 5D7SH 3OGOE 4PTTA 1FFRA 5MERA 4PPTA 2GUOB 4YHNB 2IC2A 3MV7D 2YKLL 3BP5B 3KYMB 4NRYA 1OAXL 1I9IH 2NW2B 1V7ML 1WBYA 3NZHL 4GOSA 4PJ5D 4EDWH 5I66B 1MIMH 4UNVA 2YWYA 1A5FH 1YEDB 3PWPD 4DGIH 4JAMA 4QXUL 4YIQB 3DRTA 1JRHI 3HG1D 4JQVA 2GAZA 4ZUWB 1GOFA 2HLFD 1LE9B 1ZS8A 3P9LA 3VXQA 4CNIA 5BS0A 4K8RH 5GZOD 4P2QE 3HC0A 3BAEH 1J8HD 5E6IB 1CICB 2VLKA 2XV6B 1DTUA 3J8F7 2CRMA 2EC8A 5EDXA 3MLYL 4I4WA 2EIDA 4S2SB 5ICXB 4G5ZH 4M6ML 2FBJH 1K6QL 3MLUH 3FO1A 2B0SH 4E41D 1ACYH 1KG0A 3E8UL 3JWOC 4PS4L 4ZPTB 3F5WA 2IAMD 1FAKT 4TULH 1S7RA 1QUNA 2BVQB 1DUYA 3DSNA 4M1DH 4BQ6A 2Y23A 1AJ7L 4PUBL 4RGOL 2J8UA 5JIIA 3ULVD 3F12B 3DX8A 4JJHA 1NMBL 4QYOA 1CL7L 2FGWH 1FL6A 3ISWA 4FMFA 4HFWA 2Q8BL 3GMNB 4IRSD 1F42A 4YGVB 1A7RH 3I2CH 3IXAB 1DDHA 5AZ2L 4M1GL 3D39E 1IGCL 2NY6D 5GRYA 3L3DB 4P4RA 2YA2A 3QIUC 4PJHF 1S7WA 3TC9A 4C54A 5D7IE 4RDQG 2CLRB 3OB0K 4EI5C 3S34H 5C0CB 5GZNC 2DQCL 3C60D 3MMEA 3EYUH 3GK8L 4WI6A 4A2LA 3NPSB 4P2OA 1JL8A 4LIQL 43CAB 1JNJA 1U8MB 1T5XB 1MCNA 1RFDH 1RULH 4QEGA 3OL2A 1MI5B 5EO0A 1YN6B 3HMXA 1QKZL 5D8JH 5D1ZD 4WI9A 1S78C 4BH8B 3RI5K 1IC5L 3ZDXF 2IFFH 5B3JE 3QXWA 4XB7A 1J11A 4N0UE 2HLAB 1T83A 4XX1G 3CDYA 5FA3A 4X4YA 1UZ8A 2ITCB 1CL7I 1F3JB 1NSNH 4JJ5A 2KQNA 4QY8A 4WU7A 3D0VA 2AJUL 5TQ0L 3QAZB 5B38G 5CEZL 4OD2A 4JVPA 1GIGL 1UA6L 1CFVH 4PJ7E 1SEQH 3HA0A 2ZOLA 1B4JL 4I3RL 5A2IH 2DQTH 4GMTH 3DXAE 4XRCA 4YDLC 5I71B 3RGVA 2Z93B 4HJGB 2R0ZL 4ODUA 5GJSL 5GS3A 3MNVB 2W59A 4QXGL 2IPUK 4MDIB 1NQBA 3IJYB 3GI8H 4B41A 1R5VB 1BIIA 5C0NC 2IANA 1TZHB 2ZUXA 1F90L 5HXMA 2C1PA 4KU1A 4PJIE 2EDDA 4MD4B 4Q74A 1ZLVH 3C8KA 4HGMA 5CZVH 2JCCF 4MCZA 2A73B 5ANMA 1VGKA 4JFEE 4LLVB 1HHKB 3HPLA 5AAMA 1NLDL 4RAUA 3CXHJ 2DL9A 5GIRA 4X6CA 4EVNB 1ZLUK 1KEMH 1OPGL 5I9QC 1KIQA 4HXBL 3D39D 4O2FA 1P4LB 1KJVA 4FQIH 4BZ2H 6FABL 3MRBB 4PJCA 2D7OA 2ZUSA 1BFVL 4I0PA 5BJTA 1HEZB 4X5WA 3FB7A 2EKSA 4U05A 4UUJB 3VWKB 5BVPL 1TZGL 2PTUA 4UQ2B 4RA3A 1DUZB 2BVOA 5KG9B 1RUKH 4KK6D 4O4YL 4G8EA 4G80B 1G0DA 2E8YA 1QNZH 5L2KE 1LO2L 5CP3H 5FUCE 2BVPA 1EERB 1TVBA 3BUTA 1FL3B 2VDML 4PV8A 5E99H 2J7LA 5IROA 1WV7T 4J6RH 1OAQH 1IGTA 4O5LH 1DQQA 5T5NG 3O8XA 1NPUA 1SBSH 2PR4L 3ZKNC 3RVWD 5CJ5A 5E7FA 4L1HA 1KIRA 3ZE2F 3S6CA 4GKZB 2ZSVA 4F58L 1QBAA 1IQDB 4FP8L 3O45B 5ECJE 3GZKA 1EIBA 4GRLC 3JWOL 3ZSTA 4YXHH 3QQ9C 3A6BH 1MAML 2R2EA 4QRQA 3WJLC 4JM2F 1BREA 3MLTA 3QEUB 5TQ2H 5DEFA 4F8TA 1Y6MR 4N8PA 4OZ4A 4WGWB 5EZJA 4OIAA 3D87B 3UJJH 5A16A 2P44B 3DXAD 4JHAH 2CO7B 12E8L 2CLZA 4WW2F 3HZYA 3GUTB 4CN6A 3STLB 1X5ZA 1TCRB 1JPTL 1IEHA 3AREB 5BRZB 2JIXA 4OQ1A 1X6NA 1IAOB 4LQ1A 4GG6A 3NTCL 3PHOB 5GS1C 5INCA 5C07B 1I1YA 4IMKA 1EZVX 3L6FB 4KK9C 5F3BB 1KC5H 4OF5A 1T1ZA 3SDDC 5ALCL 3VMPA 5TE7L 1PAMA 2A6JB 3VXSE 4N5ED 3VXRB 1NGZB 1XGPB 1RZFL 2HFGL 3KDMB 3TWCH 4OFKA 2OR9H 3DYMA 1A7PL 1TPXB 4XHJD 5DVLA 1MPAL 1RIVL 2CKBL 2OLDA 1MFCH 3N06B 1JWSB 2GK0A 3DURA 4JFED 1QFUH 4RAVA 5ISZE 1P7KA 4M93B 5KOVC 5J13B 2VZVA 2DL2A 1AGDA 1AGCA 1RZ8A 3T0EB 2ZSWB 1FFPA 4PY8I 5TE4H 4L9LA 1FFOB 5FHBH 3EHBC 3T4YA 1AKJD 1ZA3A 5F9WC 4FNLL 3VCLA 5FK9B 4HUXA 5I76A 4HKJB 3CFIC 1L9MA 5K9JL 1Y0LB 4DOHB 1P4BL 1T3FA 3Q6GL 4KH2A 3TO4C 3LB6C 4L5FL 4X4XA 4R2GD 5L2KD 3WDHA 4R7NB 4P23C 5MI0C 4BKLB 4Y4FB 4YWGL 3V4PL 3SDYH 3O3AB 4NM4L 2ZCLH 4PJAA 3QI9B 1RURH 4GRWH 4YBLB 3RVUC 1T80A 1KJ2A 3U2SB 2W0PA 5E5MA 3V6FB 4PGEB 2BJML 3MCG1 3O3BB 5DD5L 3GGWA 3TA3D 2WBJB 3CSBA 2EDHA 1MFDH 3SDAD 3A0OA 2AP2A 1HE7A 1HHHB 4GRWF 4IJ3C 3MGOB 5IP4A 5EBWB 3GSVB 4DZBA 3GMMB 2NR6D 3JTTB 5AYUL 3OPZH 5D9SA 1OP3K 1FG2A 2Z92A 3MXWL 2R1XB 4U33A 2VQUA 4GW4B 3FQUA 5I1LA 3TFKD 3Q5TA 2YXMA 3TT1H 3KYNB 2QADB 3IU4H 4LSVH 1U8IB 1ZV5A 2COQA 1AHWC 4G43A 3U46B 3BZDA 4FQXB 4CVXA 1JZ4A 3BJLA 3QCVH 1YEEL 4I2XB 4MD0B 4WTZA 1F4WL 3RAJL 3U7AA 4C4KT 5CGTA 3D25B 5F7DA 4EDXA 4H25B 4I77H 3CFKB 3WD5L 5D96C 1QA9A 2A83A 2OZ4A 4R4BB 4FQHA 1PY4A 3RL1B 4EN3A 5EORH 1D5ZB 2GYSA 3SE9H 4AM0A 1SHMA 2JJTA 5GGUA 4TRPH 1KIUA 1CD8A 3I75A 1VCAA 1CD1B 1X5LA 5ISZD 1VPOH 3RWCB 5ICZA 1A1OB 4YUEL 3VXNA 5FDWB 4PRDB 3N9GH 3D3VE 5BV7B 3DIFA 4Y4HA 1QEWA 2DQDL 4KRPD 3HE7A 2FLRT 2XTJC 3B9KB 4Z77B 5DD1H 4OIBA 4FTVA 3Q6FA 1U8NA 1RK1A 1A6TA 1R