3MCKA

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DVMMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLEWYMQKPGQSPMLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAEDLGVFYCFQGSRVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C705 MONOCLONAL LIGHT CHAIN
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA01
2VC2L 4RWHA 1U41A 3ZE0F 3CXDL 1U8IA 5SX4H 1Y6MR 1HXMB 3QDJE 1UM4L 2BNUB 5I1KL 1CL7L 2EDEA 1SJEB 4JDZA 5CP7B 1MCWW 4XWGH 1ZGLA 4YXLH 2JCCF 3BHBB 4HG4K 4LLDB 1RZJC 4NNYB 1H15B 2XA8L 2XXMB 4KI5D 5JOPD 3T4AB 3WNLA 4O4YH 4GSDL 4IS6B 4BQBA 4Z7NF 4Y8AA 5GQBA 1SM3L 2CKBB 5C0AB 4EI6A 1ZLWH 5DUPH 1AE6H 2CXGA 5ECJE 2OZ4A 1RSFA 3X17A 5CEXA 3RWEA 1S7VA 2RBLA 3RI5K 1TQCB 3HPLB 1IRAY 2NY5C 4NT6B 4IMLB 3RZWA 3FQTB 1V7NL 2GFBA 1T20A 1WV7T 4L8CA 1P6FA 5DJ2A 4LLQB 4KK8D 2AJYL 1RZ7H 4M7JH 2HYMA 1YPZF 4Z7QF 1MH5A 1AR2A 1RUKL 4FQXA 2BCKB 2PTTA 4KKLC 5F9JA 5D1ZD 5D1XB 4BK4A 3HKFA 5AD0B 4MAYD 1A0QL 2QL1A 1ERNA 4LBEA 1MQ8A 3E8UL 2O93L 1DQTA 5IROC 4MD5A 3RWGB 2FH6A 5E4EB 4G6ML 1FPTL 5J13C 3LPFA 1QSED 2W60A 1AO7E 3GRWL 3P4OA 4PJ9C 1AGEB 1N7MH 3O6LL 1CVRA 5EBMA 3W2DL 4KGJA 4EI5C 1EFXB 1TJGL 4N0YL 4M8QB 3UYOD 2G2RB 4PJFA 3PQYA 4PJAF 3RX7A 3U82B 5GIRA 1JHLL 5FGRA 5JIIA 3QFJE 1T7XA 3UTTD 2VXSL 3QPXH 1D5IH 3WS3B 2MNUA 1OGTA 4GQ9L 1U42A 3UPCA 5DURD 3DIFA 4OFKA 3QAZB 3D3VE 2NXZD 2XPGA 1LWRA 5CIPA 3ZYZA 4PTTB 2R0LL 4U6TA 9CGTA 4D9RE 1ED3B 4C56E 4RA0C 4R6UA 3RX5A 5E94B 3HAEB 1QO3B 4GW5B 1P4LB 4YHMH 4B41A 3U9PH 2XOTA 4ELMA 4QY8A 1JUFB 4AEIH 5LQBL 1JNNL 1OSPL 5JHDE 1ZA6A 1MFBL 3H0TA 1I85C 4FXGA 1KEGH 1AGBB 2IJ0C 1A14L 5INDB 2BDNL 4ONGL 3MV01 1GGTA 5EUOF 3AU1A 1NC4A 1AGFB 5L2KE 4IDJH 5IVXB 1HHGB 4UINH 4YXHL 1IAMA 5DRWA 4J3TA 5FGBA 4EQ3A 4X5LA 3CSPA 3CFBA 3SE4A 1T03H 3B9KD 4JFQA 4HMDA 3X3FL 3CFEB 1ZHKB 3PL6C 1P7QD 4ZFZB 3ZT6A 1K9TA 4L3EE 5B8CB 4ENEC 3D39B 4KKBD 3AS3A 1RUML 3OX8B 4XPFH 2P48B 3ZKMD 4AL8H 1TIUA 4WHDA 5J56B 5BZDA 5HYJD 2P5WA 4PJGA 4KVNL 1IQWH 1K4DA 1ZEAH 2IANB 2W1NA 3CDGB 2COQA 4K7PY 2N4IA 1P4BL 3VRJA 2LVCA 1F58L 1QLEL 2AQ1A 4FFWD 1F11A 3EKCA 3JV4A 5D93B 5TDPA 5D5ME 1AI1H 5EO1B 3LS5L 3LQAC 4YUEL 5DJ6A 3NFSL 4ALAL 3L3IB 3ZHKA 1PLGL 2YHGA 3BESR 2VZTA 1BFOA 1OAUL 4JEGB 3O9WC 4WJ5A 4L3CA 4I0PD 4B7LA 4HD9A 1MIEL 2YD9A 1F8TH 4JLRB 1QSEB 1T0MB 5K59F 2IMMA 2X4PA 1QR1B 2R1WA 1HKLH 2LU7A 3RIAF 3UTSE 3S97C 4MQSB 5DR5H 3SPVA 1G1CA 2VDOL 1M71A 2XNAB 3NGBB 4OZHE 3TPUB 3I6LD 4M6OH 1MCOH 2NNAA 1EHNA 2Z31D 2MSPA 3CFIC 4WUUA 4K7PL 1T4KB 2X4TA 1FAIL 4GG8A 5A16B 3UTTB 4WVRA 3UZQA 1JHTB 4ZFGL 2DQHH 4HEPG 2PCPA 2ED7A 4X99B 1NFDE 4KQ3H 2D7PA 3QEQA 3IJSB 1LGVA 2NXZB 4KV5E 1RZKH 3WEXB 3VWKA 4CADB 4OQTH 1C08B 5KVFH 2N7AA 5T3XD 2CDEA 2R0WL 2M1KA 3DGGB 4U05A 5HHVH 7FABL 3PDOA 4W70A 3I3DA 1F3DJ 3D1MC 1DQQB 3JTTB 2FJHB 4Y4HB 3P11L 3V5HB 1M4KA 2X4RB 5EFIA 4JQIH 4C57C 2R2HB 4QRPD 4NO0D 1YC7A 4QXGL 3L5WA 1PYWA 3JV6B 3RNKA 4CUCA 4RFEA 4OLUL 2C3VB 4HUUB 3O6KH 1UG9A 3FFCB 4LKCA 5C08B 4QRUA 3AS2A 1LP9E 2CKBL 4U4BA 3MRLA 4J12A 4HKZA 4F7CA 1U8HA 4OZGE 4R97B 1ZLUK 3U7YH 5EZJB 1G7IA 2ADGB 3HPJA 5JOFB 1S5IH 4K8RL 5E7FA 4LCUA 3DRTB 4JPWL 3RTQA 4MCZB 1JTTA 3INUL 4TQEL 1FE8H 2QQKL 4RFNC 3VD9A 1L7TL 3NA9H 3B9KB 5EULV 3MXVL 5I1IH 1AY1L 3NABH 4D3CL 5MENB 3HB3C 5JO5A 1I9IL 4L29B 3U30C 2EDHA 1KENH 1X5KA 1G7MB 4LKXA 4U1GB 3GSVA 4QRQB 3R0MA 1RFDL 2FO4A 4TN9A 3HS0A 2YRPA 2BVOB 2QHLA 4JRYA 4GAYA 5C0DA 3MLYH 4EBQH 5I1EH 4L4TD 3QUMH 1DBKH 5IEKB 5IR1B 3QUZC 2EEBA 4OCMC 1JF1A 2FGWH 4WFFE 4K3JL 3MRJA 1VFMA 1LK3H 3ALWA 1KYOJ 4B53A 4N9OB 1CGSH 3G08A 4K71B 2HT4D 5GJTL 4XMPL 3CFKA 2YPVH 4P23B 1UB6A 2ICWB 3GMRA 3VFUA 3FO0L 4OI8A 1OY3B 2AV1A 4I2XA 4ZG1A 5F7NC 5FV2A 2FBJH 2ICEA 3OR6B 1WBXA 1J8HA 3SDCA 2B2XL 3DO7A 4LCYB 4MVBC 1JWUA 1FLRH 2RR3A 1MI5D 1CT8B 1KTLA 1OD7A 5CSBA 4WO4D 2NTFB 4WGWB 1IZJA 5C86A 4CGTA 6FABH 1DL7H 1H3TA 3WN5C 2Z31B 4X8JA 1UM6L 2PW2A 4M9PA 2ORBH 1J88A 2A9ML 2FX7H 3L1OL 3T08A 5BV7H 5FK9A 3BP6A 2QEJA 2W9LA 2YEZA 1UXSA 4MYWB 4HIEB 3MCKB 4M8VA 3QUYC 5IB4A 3WXVH 3ARGA 2NLJA 2VLLA 2F74A 2CUMA 3CK0L 3MYJB 4KTDH 2V5YA 3BEWB 3SJVD 1YEKL 2Y1VA 4Z76A 3S4SG 3BMVA 5GGSA 4K3DH 5FCSH 3DX9A 2XN9D 3EHBC 4D94A 1KEML 5F9WC 1E4XH 4S1DD 4QHKJ 4KHXH 2DBLH 3M07A 5SWZA 2P24B 1QA9A 1QLRB 3C5JA 3S37X 1LO2L 1EAJA 5H37H 2VIRB 3NBNA 5MP6H 3MBEC 2MPAL 1BBDH 5H35A 2Y36L 4WEUD 2DTML 4NHCH 4QRPB 1F6FB 3IT8D 1BOYA 2Q3AA 5I15H 1ZLUH 2GJ6E 4QHNA 2FCBA 1GVIA 2NMSA 5EO0B 1J1OL 1NDGB 1UKQA 2X89A 3P73B 1B3JA 1GGIH 5F44A 3VXRB 3GJFK 3VXSD 1PSKL 5ACMA 3O6FB 2AV7B 1FO0H 3C8KB 3MJ9H 3VRLE 1U3ZA 5J6HA 1IGFL 3L95A 3QWOA 1KACB 2BC4B 1GZQA 2ZCLL 2E6PA 1Y6KR 2AJUL 1MJ8H 3WFCL 4LLYB 3CCHB 1BFVL 2WUCL 2BXYA 3Q2CA 4ONFH 5DUBA 4F3FB 3TT1L 1NGYB 2Q86A 4BZ1H 4NZUH 4LCCA 4N1EA 5C0GA 2AKRA 1FNAA 3ESVF 3HI5H 2JELH 1ZT4A 4PP1D 5E9DB 5TDOB 1FVCB 4L4TB 1N6QH 3BPCA 2KKQA 1HI6B 4AYFA 4XP6H 3UC0L 2EYRA 1NEUA 4LLMB 4N1HB 4P5TC 3O4OC 3FO2A 3QXWA 4XXDB 3RGVD 1C5BL 1Z0NA 3GBML 3OHXB 2X2YA 2DQEL 2AEWA 3MA9H 5C09B 3C60B 3C6LA 4JQVA 4DVBB 1EMTL 1QFUH 3E3QC 4KMTL 3LV3B 4NHUA 4HT1H 3LQZA 1T83A 2AK4E 4LRIC 4XMKL 1KXVC 5IIEA 1EHLL 3DX8A 2JIXD 1URLA 5FCUL 1YY8A 3QQ3A 2FWOA 5ANMB 1BM3H 5KW9L 1MI5B 3WE6B 3QDAA 4ZUSB 4YBHA 4HWBH 3CH1B 1FFNB 4WI6A 5EC2B 4WU7A 3QEGL 5DJZA 5DXWA 1IC7H 5C92A 3RP1A 1FHGA 3A6CL 3GI8L 5ILTL 4CW1A 4QHLB 3IDMA 4LPUA 1FFRA 5T3ZH 3VU2A 3CMOL 2NYYD 2Z8RA 4QF1B 1KPVB 1RHHB 3O6ML 4Z7WF 5IBUB 1X6NA 4I8DA 3GSRB 1S9VB 2X1WL 3SJVB 2ZUVA 3E6HA 2P42B 4Y1AA 1RUAH 1E4JA 2XRAH 4O9HH 4ONOA 4GRLA 3TO4D 4RNRB 2E3VA 1IBGH 5DI8B 1W0VB 2XN9B 1JTOA 1TNNA 3RWDA 3B8YA 1A1MA 1S7TA 5LGKA 1A7QL 4PGDB 4X98A 1X5IA 3CPLA 1UA6L 2C26A 2YWYA 1NAKH 2WMPA 2XYCA 2ZUUA 3FT2A 5FKPB 4F33B 5TJWK 1NGXB 3TIDA 3GJFH 2AEPL 2YPLD 4HKXA 1J12A 3WNPA 5IQ7H 5FYKE 1A3RL 4KAQL 4YHYC 4AEFA 4UV4L 1S7QA 1TZGH 3ULUH 3MLXL 1FNGB 3VXSB 2ICCA 5IK3B 1UH2A 4F9LA 3MRQA 2EDRA 4UUJB 5DD0H 3C2SA 2AQ3A 4UAOC 5KZCB 3QQ9C 2AJSH 3LRGA 3H9ZA 3HRZA 1OD9A 4YGAB 2GY7B 4IMKA 4TSBL 4OI9A 5JIPA 2JJSA 3P9MB 1AXSB 4JM2F 1SQ2N 4NP4L 4ZSOE 2VDPH 5JNYA 1JPSL 4NCDA 5C0IB 3PWNB 3SE9L 5J4MA 2CO7B 1DBBH 3HE6B 4XC3L 5J57B 2H26B 2E5EA 3FL7A 1ZHBB 3MNZB 3T1FB 4FXKA 4PD4K 2CMRL 1TQBB 1BGXH 4FQ1H 4L9DA 3IJYA 4NBXB 5BVPL 3TVMA 4BZ2L 2Z92A 4K3EH 5ADOH 1EV2E 3KWWA 2JK5B 4HUNB 4GAFB 4K3GA 3FT4A 2R4RH 2CK0L 1IGYA 4OD1L 4M1DH 1WBYB 3OB8A 3WO3B 4PJ8A 3QZWB 1CXEA 3MRPA 1MCEA 5BO1L 2IALA 3Q6GH 2CIKA 4OLWL 1R3IL 2OP4L 3RGVB 5LKNA 1A7NH 4JPIB 1XGRB 2Y07L 4GKNB 5ID1B 3VD4A 5CILL 1UJ3C 2Q8AL 4HAFA 4PJEF 1PZ5B 3UBXI 2BVQB 4X4XB 3FTGA 4N90D 5KSVB 3KVQA 4HPOL 4XNZC 2CDFB 2D0FA 1R3JB 4LDLB 3D25A 3F5WB 1CU4H 4LPXA 1J05B 4Z7OF 2BOBA 5HI5D 3LIZH 1JZ2A 1KIQA 4ODXA 1ULVA 4CN4A 4GAJH 3RL2A 5DS8A 3SDDA 2AABH 2DQTL 3HN3A 5T1KB 4F7EA 3ULVE 2VN7A 4X9FA 5L8JB 3ARBD 1R3KB 3VFVA 2UZIL 3ZL4L 4H1LG 1MQKH 1WSST 3VFSB 2ICWJ 1XF2A 4DGYH 3K46A 2OXGA 3X3GL 3SKJL 2E7BA 3HZVA 1CR9L 1JNJA 2Q20A 5CGMA 1M7IB 5IV2A 3OG6B 4ZOCA 2VLKA 4GG6B 2EYTA 4A6YB 1GC1H 4P4KD 1OGAA 5IB5B 5HI3D 4LSTH 3T0BA 5DD5H 3PWJB 4R8WL 4WNQA 3SY0B 3UROR 4H0HB 2HKHH 5FECB 3ZE1F 2BVUA 4OGXL 3GHEH 1QEWB 4NSKA 3QI9A 4KK9D 4YC2C 1TZIA 4G7YH 4KRMB 1LEIA 1ZHLB 3QR2A 1T1XB 1YEEH 1U6AL 2ATKB 4TVSa 3IDXH 2PR4L 4N0UA 3MROA 5IQ9B 4KROC 3MGTA 5BMFH 4CNIA 1E4WH 5GRUH 1H8NA 4X7TA 4OFYA 5FGCE 4O2EA 3GUTB 4FFYL 3BH8B 4QXUL 4P9MH 2F53E 4UNUA 1RY7B 5L8KB 1CI5A 2VAAA 4OUOA 4D2NA 3VFOB 3ES6B 3OAUH 4Q97A 4NRZB 1AO7D 3T0DA 1KFAL 1WK0A 3MNVA 5SWQB 1KT2A 4LIQE 4TVPD 1AQDA 2XWBA 2ZUYA 4JHWL 1IEAA 2FR4A 4M7LT 4TSCL 1N4XL 5EC1A 2H2SD 4M1CC 4FQHA 1UZ6F 3QFJD 5F6IB 4JZJB 3BZDA 2BOCA 5LCVL 3IS1X 5GRWA 2WP3T 2JJVA 4LCWA 1PJ9A 1QYGH 4X6CE 4K8RC 4BSVA 3S98A 5BVJA 2E9JA 3D3VD 5D8JH 1TFHA 1I8LA 1TQCC 4X6DB 5DWUH 2ATPB 4G42A 5ESQA 3WIHH 3P4NB 5DTFA 3QCTH 4PRHA 5E8EB 1YQVL 4C56D 5FOBA 1XGTB 3RWFA 3PGCB 1NMAH 4XCCH 3E6FA 15C8H 3WJJA 4LPCA 4ZFFB 3SGDH 3MOBL 3MV8E 4NRXB 2YR3A 3SO5A 3DI2B 1F4YH 3G6DH 3U4BL 4DKEH 1FORH 4UTBH 5JHDD 5D1XC 1EJ6A 3AAZB 3RI5F 3OJDA 4OJFH 2G60H 3KS0J 4UV7H 3WFHB 1Q9LA 3TBWB 2Q7NA 3FB7A 1MFCH 1G7HB 1NLBL 1LDSA 3BW9B 5IB1A 5E4EC 1VDGA 5DRNB 2GSIA 5DC0A 2CLZB 2BNRE 2FEDC 4KUCD 1HXYB 5BXFA 5L2KD 4WW1B 3PV6A 1QRNE 4QTHB 3QYCA 4UNVA 4LOUC 3DBXB 1K6QL 3ILPB 2GT9B 4G80A 4H0IA 3VXTB 4P2RE 5FUZL 2W9EH 4P4KB 1MHCB 1IGJA 5E24E 3G9VA 3LD8B 4L3ED 3KJ6H 5C6WH 5F9OL 3QHTC 3RWJB 2LE9A 3EDFA 3KPLA 3CFDB 4L4VB 5DLML 4U6XA 3VW3H 3GGWB 5HGHA 3WLWC 2IPTH 1LVEA 5TQ0H 4UDUA 5ICXB 5DUMH 2A77H 3MCLH 4J3XA 12E8L 3T0ED 2V17H 2ADJB 1CFTB 3QAZC 1P9MA 2Y4SA 4WI3A 3CZFA 2BMKA 2VLJE 3DUUB 2GK2A 4Q9CA 2ILLA 4OF7A 1I3GH 3MLWH 3B9EA 4NC1C 4QOKB 4D9QE 3BRGC 5FDWA 2I60L 5HVHB 1CFSA 2VN4A 2EDOA 5IBTL 5FB8A 3BKJH 3QO1A 3TJEH 1ZT1B 1TETL 2ENSA 3KPMB 3QIUD 3HE7D 3LKQB 4PGEA 3KYNB 3BGMA 3ETBF 1ZANL 2GJ6A 5D6DC 2UWEF 5I1GL 5IFAH 3SBWA 3UTSD 1N59B 3PABB 2OMBA 2OTUB 3FB6A 3LHPH 1OF2A 1TJIL 2EO1A 4NZRL 3QXAB 2J6EL 5CJQH 3C5ZD 3HG1E 2HTLD 1ONQA 3H3PH 4LHQB 1Y0LB 5FHBH 2DQJH 1P1ZA 3EO1B 3V52H 4OF3A 3AGVA 2UZXB 1S5HA 3Q0HA 1KLFA 1S7RB 4KJWD 3QH3A 5LBSH 4QXTB 2EECA 1I1FB 1KV3A 3BZ4A 3SDAA 5D7JA 4G8IA 3U46A 1NFIA 3RNQA 5B8CC 5KJRH 5CHNA 5CD3B 2A6JA 2E7MA 3D3VB 3ZKXB 1JHKL 3WXWH 1CBVL 4U3XA 4WTZA 3W81A 1ITBB 5ESVA 3RVTD 5I1IL 5HHQA 3DX6A 1M1SA 1QSFE 3WUZA 5IB3A 1DVFB 4JGMA 2E6JA 2IAMD 3HCVA 4C56B 2B1HH 1N64L 3KYMB 4HS3B 4ZODA 1T5WB 1Z0MA 2Q7YA 2AJ3A 5B4MD 1T21A 5EA0H 5I17A 3IDGA 4NO3A 5JXED 3X11A 4YPGA 3WLBB 3S5LG 1HIMH 1TMCB 5D93C 1T04A 1SY6L 5JHDB 3KPSA 1C12B 1XF4A 5ACLA 2HVJB 1UQSB 4PR5A 3CXHJ 5E1AA 3MRCA 2WBJD 4P4RA 5ITBH 4A6YL 4XMLL 3OKOB 1Q94B 3N9GL 4FTVB 5I0DA 4HGKC 3PHOB 5BS0B 4MMZC 4KK6D 3LKRB 1W8NA 4PGCB 5ALBL 2YC1B 3N1QC 1XCQB 2YD3A 3DROA 3HNTH 1R5WB 4U1JB 2BHYA 1S7SA 3DUSA 4R26L 2JCCA 5T1DH 3K2UH 2OLDA 3C2AH 4BH8B 3NGBC 4APQD 4MXWH 3DECA 3CUPA 5FOJA 4PJDA 4QHMB 5FUCC 1N5AB 1KTDA 1B4JL 3VFRA 3DX7A 2DI8A 3NZ8A 4LVNB 4GG6F 3UTZB 5C2BL 1BQSA 4M5ZH 2QQQA 3EIFA 1D9KB 4IOSD 4G8FB 5IMMB 3QUKB 4DFHA 4I3SH 2AK1L 1RIUL 4LEOA 2RFXB 3FN0L 1UWEH 4LCIH 1GOHA 1MAKA 1DL7L 1G6RH 1MCIA 1OWWA 1WTGT 2AXJA 2WWKO 4XPGL 5DZNA 1FC1A 4RAUB 2BK8A 4WY7H 1LD9B 4FQLH 3T0EB 4GKZB 5HPMB 5FYJU 3LN4B 2NXZC 2BVPA 1NAMB 3HC0B 3T3MF 1KCRL 4WFFD 5DK2B 3L5HA 4DCQA 2IFFH 3I3EA 3VI3E 3D85B 3IDIB 1U3JA 1T1YB 3WKNA 1MRCL 4Y4HC 2HT3D 4YXKH 4N9GA 5E8DH 3Q6FA 3TWCH 4RMUA 1YPZA 4IRJD 4LP4A 1FZJB 4WWKA 1CS6A 3QIUB 2EIZA 2OK0L 1YUHA 4ZYKA 5GGUA 1U8QA 2Z93B 5DJDA 1KB5B 4ZD3H 1ZHNA 3MO1B 4URTB 4G8GE 3RVUC 4IIQB 3NPZB 4JN1L 2X4QA 1DUYA 2ITDB 3ARZA 2VDLL 1GH7A 4PG2A 4OZHB 3PGDB 4U3CA 4WW2B 3P0GB 4R97C 3C6SB 4UQ2B 2BX5A 3VG0L 3U6RB 1FYTB 4Z5RB 3R8BB 3EZ8A 1CXLA 4R4BB 5AYUL 1Z2KA 4OZIB 1A6WH 5H37G 4LVHB 3B9KC 3H3BC 1NEZG 1AGCA 1UZ8B 4F7MA 4Y16D 3VFTB 3QCUH 5F7KC 4HIXH 5DJYA 1NFDB 4U1GC 3DYMA 4ZNEE 3MRDA 4HX1A 1EX0A 2HLFC 4Y5YA 3ZDYE 1MCBA 2VKXA 3O45A 3ZKMC 4ERSH 4IHOA 5CZXC 3OTTA 3L6FB 4I3GA 2UYLA 1KG0B 5A2LH 4C59B 2CLRB 1VACA 5A40E 4NZUL 4KRPD 4NQSA 4Z95H 3W0WE 3MXWL 3H9SE 4FFWC 4LLWB 4EDXB 2DL2A 4K71C 4NO5B 1WT5C 4HUXB 2G9HA 5D7IE 2GTWB 4JFEA 1QLFA 5K9OA 1IM9A 3QNYB 4P23C 4BK5A 3QG7L 2OSLB 3OKMA 4HPYH 4ZTOH 3HZKA 4KY1L 5KSBA 2XICA 4I18B 3P30L 5EN2A 3WDIA 4GOSA 1FVEB 3HNVH 4KJPC 1BVLB 2EIBA 3IVKA 4NO2A 5GRJH 1X5YA 1MAJA 1S78C 3S88H 2L7JA 4APQB 5EUOA 5DJ0A 3R1GL 2BNQA 4HHAA 2VLRA 3Q1SL 1A47A 4Y4KA 5FIEA 3SDXE 4PPTA 1AC0A 2X7LB 5ISZB 4F80A 5JPNA 3VH8G 5BW7C 3S9DB 3DARA 2FD6H 3Q3GB 1MJUH 1GIGL 4ORGA 4YE4L 2JF1A 3S35L 5GS1A 3ZT5A 4LQFL 4LAQL 4PJHA 3BGAA 4U6HA 4D0DA 3RVVD 4E0RB 4RMQA 4AM0B 5CIPH 3I6GA 1SHMA 2DM4A 2VDML 1RUQH 3LDBB 4MQ7A 5I8EB 3BI9X 3QDMA 1RJCA 4N0RA 3GMNB 2A0LC 4KWUA 4GW1B 4TVPL 1EBAA 1B90A 4WGVB 3V0VB 4HZLB 5TE6H 1HCFX 4FNLH 4I77L 2AK4D 5CUSH 2ADFL 1D5MB 3D87B 5EBLB 3REWA 1AKJD 2HWZL 2XA3A 5CGTA 3U2SA 4XX1E 4DVRH 5L7XH 5IOPA 4QRRB 1FFPB 3G6JE 3O6FC 2XIDA 2Z4QA 1F3JB 4KXZH 4CMMA 4WI4A 1AFVH 3O11A 1HQRA 5AWNH 2VTFA 1A21A 5L0QB 4LHUB 5J0BA 1W0YT 2QSVA 3NCJH 3RY4A 3IFLH 4OZFH 4PJIF 3D9AH 4UOW1 5DJ8A 4Y16B 4AT6A 1INEL 4J8RB 1X7QA 4XPTL 3KYKL 3SE8L 5D96B 5I1LA 3MRHA 4UNTA 5JPMA 4POUB 5C0CA 5C0BE 1MHEA 5DSCB 4OTXL 4PRBB 1C7SA 4X4ZA 3NFNB 5I1HH 2Y7QB 1SJVA 4S2SA 4P2QA 5DHVA 3K4ZA 3O3EB 3ULUF 1HSAA 4RMVA 1KN2H 1J10A 2NZ9D 4HS6B 4NUGH 4YZFF 3U7AA 4NQUA 4JJHA 4U3HA 2A2QT 4KRPB 4MHHG 4WV1A 4ZOAA 2Y5TA 3OKKB 1VFBB 3EYOA 5DFTA 5FYKD 1H5BA 2DKMA 4XBEH 2HT4C 4U1IB 4ODHH 4KZDL 2C7UB 3VGFA 3FHQA 3RA7L 4BQ6A 4S1QH 1BOGA 2YUZA 3BWAA 2WWMC 5DT1L 3C60C 2ZUSA 4LASH 2EKSB 3WUWB 2R9HD 1MVUA 1ZSDA 2J88H 1CLZH 1H3PH 2LFGA 1K85A 4MNGA 2AS5M 5D2LF 1V5JA 3GIZL 1LO5A 5ESAB 4DW2L 2R8SL 1E6JH 1PBYA 2B4CL 4OIIH 5HVFB 1A5FH 2VABB 3BKCL 4H5SB 2VZVA 1K5NA 4HIJB 2C3XA 2DJSA 2GCYA 4O00A 32C2B 3LRSA 2JJTA 2MOVA 2DYPD 4K55A 5CCKH 1Z3GH 2PKDA 1ND0B 5KN5B 4PRAB 5B21A 1EH9A 4MXVF 1W2KT 1NAML 5DMIL 1RULH 1L4IA 3U36B 1ZS8A 5IGXL 1F4WH 2E7HA 4PGJA 1H8SA 5TPWH 3GMMB 5DD6A 3DV4B 3U1SL 2ZUQB 4WI7A 4I13B 3N85L 1BZQK 4MXQD 4YDKH 4GMSH 4MJIE 4H26A 3QUXA 3VWJB 3CVIH 1U8JB 4S1DC 1KB5L 3NH7L 4NJ9H 2HRPL 3GSXB 1DLHB 4MA7H 1ZKAA 5I0ZA 1BAFL 5FM4A 1GOGA 4DZBA 4FQJH 4LSRL 5JDSB 3ARRA 1HHIA 4FG6C 1KCVL 4F7PB 4GXVH 2X4UB 3WL9A 4PJ7E 1TPXB 2QHRH 5TGBB 1UWGH 2L7UA 1U91A 2GSGA 1BIIB 4NQEB 1AKJB 4KUZL 1G9ML 2XZAH 3IKCA 3VRIB 3UYRH 3MGOB 3BPOB 4OF6A 3L5JA 5K9JL 1UH3A 3VGHA 1E0OB 4HJGB 1TXKA 4OB5L 5EU6E 3CGTA 3KYOA 4OGYH 4P3CH 3T4YA 4NKMA 3LN5A 3RZCA 4WW2F 4JE4B 2HFGL 2QSCL 4FQIL 3ULVD 1U8KB 2X05A 3HE6C 3U7WL 3VI4E 5LG1A 2Y06H 1NCAL 1G6VK 1M6OA 4OZIF 1TQBC 25C8L 3GNMH 3QDGB 3HZYB 1FNEA 4HUMB 3IXTA 1VGEH 1BQHG 5GS0L 1KLGB 5FO9B 2A6DB 3DNKA 2GTZB 3L3KB 2V2TB 3PWVA 3Q5OA 3UJJH 3QBTB 4GAGL 2LQRA 2D31B 1XZ0B 4BFIA 3W9EB 3OXSA 2R56H 3BYTA 4LSVL 1SYVA 2IGFH 1FZOA 3I3BA 3F7YB 5EO9B 2JB6B 3NCBB 2MKLC 3CFJA 3S4SA 1WEJL 1CIDA 1FFQA 4UQ3B 3RGVC 1MRDH 1JF6A 3HR6A 1E6OL 3JWDH 2A83B 4G43A 4GS7B 2FBOJ 3VGGA 5C6PB 2VXVL 1U8IB 4HKJB 4M6ML 1F3RB 3TBYA 3TN0D 5F1IA 3TO2A 4DWHA 2W65A 3OF6D 4JDZB 2GUOB 3NCFB 4LMQI 5I66B 1KJMA 1RZ8A 2D7TL 1ZGLB 3CU7A 3ARSA 4QTIH 4UT9H 4XNQB 3EYQD 2CRIA 4M3JA 2F53D 5MEOB 3WFBL 5L88L 1CDIA 5E0QA 1NUNB 1YZZA 5CINH 1GGCH 3FQRA 4EI6B 4ZPVB 5KS9E 4Y5VA 3GK8L 1WITA 1JGEA 5F8RC 1PX3A 5FYLH 1CGVA 2I27N 5CEXB 1NUDA 1MRFH 3RWEB 1VHPA 5D1QD 1DBML 2NYYC 2F5AL 1V3KA 4LQ1A 1JZ6A 4FQ2H 1U8LB 5KANG 1MPAL 1TVHA 1CFVH 1IARB 2GJZA 3ZLQC 5EBWA 1T20B 5D7LE 4IEFB 4L8CB 5DJ2B 3KXFE 4PJXA 2APVA 1RURH 2CGRH 3BX7C 2A74A 3DXAA 3GIVB 5SX4I 2Z91A 4B0MM 1MH5B 2NY4D 4ETYA 4ZUTA 3HUJF 4LEXL 2ZJSH 2WW8A 5KTEH 2DLGA 3QNXA 4PRIA 1YEFH 1Q9OA 3W11C 2PXYD 1FP5A 1KNOB 3IFNH 1YNTA 5F7DA 3HAEG 1Q0XH 5C07E 3RDTD 4KK5D 1OVZA 4MD5B 3QQ4B 3ARVA 1SVZA 43CAA 1YMMA 1FYHB 3V7AG 2HN7A 3NIFF 2W60B 2J8HA 2FLRT 1FN4B 1ZWIA 1O7SA 3FO9B 3MV8D 4Z0XA 1NCUA 4RZCA 3K7UA 4GKOA 2XQBL 4Q0XH 4KPHL 4P46A 3VD5A 1BF8A 1JGUH 1NCWH 4HXAH 5DJXA 4NNPH 3LAFA 3LKNA 5GIRB 4Y4FD 1DQDH 3RKDD 1NMCB 1D6EB 3LEYL 4XWOC 5F7UA 3NACL 2BNRD 2WM0A 1XGQA 1OGTB 2YUWA 1J7VR 1MFDL 1QRND 3N1MC 4ONHA 3MTRA 1FNSH 5E08L 1BVZA 1QNZH 2XPGB 4K2UL 4P2RD 3MRMA 3IJHA 4Z7WA 3A6OA 4GBXA 4XI5D 4UTAH 5F7LB 5FKAA 1WAAE 2YA1A 4XP5L 5F6IC 2XY1A 1C5CH 4JZJC 4PJBE 3VDCA 1F4XL 4PLOB 1IGMH 4QY8B 4Y0GA 3V6BR 4D8PA 2E7LC 2J8UE 4JB9H 4LLAA 2DIBA 4XCNA 1ZA6B 5F7WC 5GGQL 3H0TB 3I9GL 4FXGB 3TN0B 2CQVA 3U83A 2HP4A 2VLJD 3SKOA 1MJ7L 1CFNA 3K0WA 3ZE0E 1VA9A 3BN9C 5FXCH 2EDWA 3AU1B 3I2CH 1NC4B 3A67H 1FH5H 5DRWB 1EZVX 2F53B 1ZVHA 2VMFA 4BQ9A 2Z0BA 4ZTPH 3I02A 5HI5C 4JFYB 3S36L 3LVEA 5ACZA 4NFBA 4JM2A 3IU4L 3QEUA 1ADQA 2CDGA 2HVKA 1U58B 3O3AA 1UCBH 3EUUA 3PDGA 4M48H 4Z7NE 5EORH 1PG7X 3TZVD 3QCVL 1A64A 4MJ4A 4DKFH 4F58H 5GHWH 5E8PA 3HG1D 5F7EH 4JN2B 1OM3H 4UT7H 5CD5D 4XRCA 3X12B 1BECA 3S6CA 5BZDB 3RPIB 2KZ1B 3L3OB 4M5YH 2P5WB 1OAYH 4ETQA 3OKLA 5JA8B 4P4KC 1MF2L 3IGAA 3VRJB 1I75A 3LD8C 4UILL 2KDGA 1HYRC 1J1PL 1B2WH 2NY4B 5IBLD 3JV4B 5TDPB 5HJ3A 3V6FA 5AG8A 1T3FA 3DLQR 4XHJC 5AAMA 3KLAB 3VXMA 4AIXA 5SWSE 1UKTA 2PXYB 3NN8A 5DJ6B 2AGJL 1R0AL 3O2DA 1QSFD 4V2CB 3DO3A 1CFQB 1MLBA 4KK9C 4U1KA 3V4PL 1BFOB 4JFDA 4DOHE 2FATL 4L3CB 4FZ8L 4MGXA 3CU1A 3M8OH 2X4PB 2R1WB 5GPRA 1HYSD 1BQLL 4JRXA 4LK4A 4ZS7L 4JFZL 4D0BA 4MCYA 3U0WH 2ZOKB 3SPVB 4POYA 1G7QA 2PF6A 1M71B 5HVHC 2HMID 2PNDA 5GGRA 3NFPA 4X7CC 4ODUA 2NNAB 1P5UA 2EZ0C 4M7LL 5BJTB 1MCLA 1SJHB 5I1JL 4NCC1 4FFZL 4WUUB 3LEVH 2E27L 3M17A 1MIMH 1KCSL 2YSSA 3U4EA 2DQFA 1DE4A 2QQLH 3MV9A 5DQJB 4PJ9A 2PCPB 4PJAE 4QT5A 5F9DC 2F8VA 1QRNB 4Y19E 3E2HB 4WEMB 2ZCHL 3RUGA 1G7LB 3VXUE 4ELKA 4NWUL 2NY0B 4B7IA 1EEUA 4P2RB 3VWKB 1OAZH 2F54E 1G1YA 4H1LA 3VMOA 3PDOB 3WNKA 5T1LD 1JN6A 5JUEL 3TCLA 2V5TA 1AJ7L 3P77A 1VPOH 5TFSL 2V9RA 5EFIB 1A4JA 3DURB 1A1NB 3FB8B 4JJ5B 3RNKB 4RFEB 3HC4L 3ULUC 3ZKXC 5F96L 5KAQG 3T2NL 4QRUB 1SEBA 3FFDA 2CLVA 3LKPA 1O7VA 4XVTH 3BKMH 4JAMB 4I48A 1DVFC 1A3LL 2NX5E 2W0LA 4HKZB 4JO3H 1U8HB 1JZ5A 5EOQL 3HPJB 3PDDA 4L9LA 4AEHH 1FZMA 4OD2B 2OZ4L 2LAAA 3GFUA 4LCUB 3RTQB 1NL0H 3L7EA 3DWTA 4C4KT 3O3UN 1I85A 1IM3A 1ZAGA 3MJ7A 5JO5B 1CIUA 4WHTA 4G8GD 4LKXB 3ZHLA 1JPFB 1A7PH 4MNHB 2FYYB 1FRGL 4GRWE 3TZVB 4AG4L 4GO6B 1VFOA 4JRYB 5HHOE 3HG1B 4GAYB 4PRPA 5C0DB 4OCSH 3EYSH 4P5KA 5E00B 2B1AL 3O8XD 3BAEH 4D9LL 4M93B 3EOAB 3S34L 3MRJB 4WWID 4MS8C 2E9WA 1U8MB 4M9OA 2XKNA 1T2XA 4LVNC 2BSTA 2VDNH 4ZO9A 1ITCA 3DMMD 3LS4L 3GKWH 1D9KC 2B4CC 3VDAA 2OQJA 5ITFA 4OT1H 3NCEB 3VMPA 1UB6B 1LDPH 3GMRB 3VFUB 1EVTC 1S9WA 2ICEB 1U8NA 1WBXB 3T0EC 4MD0B 3OKEA 4BH7A 1A6ZA 5FYKU 3SDCB 5D71H 3DO7B 4BQ8A 4FZEL 3IFPB 3NIDF 3ULVL 3S37H 5I8CA 2FD6L 1N3NB 1A6AA 3W0WD 1KN4L 5HDQL 3H9SD 3HFMH 4NKIL 2P47B 5HGDA 2BXZA 1EDQA 2N56A 4QNPE 5F6HI 3MMEB 5K59E 3WS6C 4X8JB 1JK8A 2PW2B 4OFPA 1IFHH 3QIUC 1S8DB 4GW4A 4PJFF 5TF0A 4K07A 2YEZB 1UXSB 5CSGA 1RIHL 2X1XR 3JBG7 1CLOL 4AQ1B 2VUYA 5IB4B 1YY9D 3ARGB 5ETUA 1RJZA 2VLLB 4IIQC 1H3VA 3WHE1 1UADC 1ORSA 3DVNA 5LWYH 1RUPL 4WW2C 2UZYB 1CDCA 1TCRA 2PO6A 3V6OC 3DX9B 3VE0A 4OV5A 1HHHA 4IRSD 3ARFA 1AGDA 1G9MC 5SWZB 1QA9B 3C5JB 3QIBA 5E03A 4LVHC 4EN3A 4KJWC 2YA2A 1WCBA 4U6VH 1V7MH 2XZQL 4J6RL 3VD3A 2P43B 3HLAA 1AFVL 5KSAA 4JANB 2V2WB 4ELMF 2YD4A 4QHNB 5GJSL 1JWSA 2GYSA 3LMJL 3NCJL 3RVTC 1OT1A 2QBWA 4ZXBA 3ARDA 1Z9OA 5GGVY 1U92B 2VR5A 3WHXA 4YQXH 3VJ6A 1Z6JT 4G7VL 4KC3B 3C5SA 3AC0A 4O02H 5J6HB 3L95B 2XY2A 1NCDL 4AY0A 1YEHL 3QWOB 3OPZH 5GS0C 3IRPX 1GZQB 1RIVH 3ELAT 4S10A 3HMXH 1P7KA 4OZFG 3VCLA 1M05B 5E6ID 4TULH 3BIAX 2FX9L 1Q1JH 4MNQA 1EO8L 4G6AC 4TOYL 4EI5D 1OLLA 1R3HB 3KDMA 3BXNA 1XFPA 2Q86B 5TE4H 4I18C 1INQA 1E4XI 3MREA 4LCCB 5C0GB 2AKRB 4K23L 4ODHL 3EOTL 2GAZA 1F42A 5C0AE 5KG9A 1ZT4B 1FNFA 4JQXA 3IETA 1NH6A 5IFJA 1BVKA 3WFEL 3BPCB 5GGVL 4APQC 1UGNA 1WZ1H 2AEQH 4PJ8D 5A2JH 3AXLA 4U2YA 4Z0BH 2F5BL 4X5XB 4PJGF 4JY5H 5KVDH 3I50L 5JMRA 4OIIL 5C0BD 1I1AA 4XPHL 4NJAL 5D6CA 1MCDA 3MLVH 3U0PA 1YQ2A 4P2OD 4BFGA 4TUKL 5LXGH 4G6JL 3C6LB 1Q72L 1DUZA 4H25A 3FB5A 5F71A 1UJTA 3LQZB 5EBGA 3DX8B 3QUZA 5DC4B 4AZ8A 5TF1H 4ESKA 3GI9H 1DBAL 1EJOH 2O5ZH 3QQ3B 3MRKA 2FWOB 1OWRM 3VFMB 1DBJH 4NYLA 4XPAH 3SDYL 1KJ3L 4FQQA 2E9BA 5TPWL 3LDBC 5HSFA 5HGGS 5D7IB 4HGWB 2HT3C 3KPTA 2WINA 3GMOA 4WU7B 1EAPA 1AIFA 1NGQH 2DDQL 2OJZL 5DJZB 2QKIA 1MAML 5ELIA 4CW1B 1FGVH 3IDMB 5FDYA 1I3RB 5K9KA 4JFFE 4PB9L 3EO9H 4BJLA 3VFGL 3WJLA 3MOQA 3PL6D 4LSQL 3E6HB 4Q6IA 4FQJL 4Y1AB 4MZ3A 1DSFH 4ENED 2I5YH 2YPKA 4W4OC 3TBSB 4Z9KB 2B39A 4IRSB 5L0QC 3SDXB 4P59L 1A1MB 3MZTA 1S7TB 2DQGH 1CDBA 4X98B 5FYJL 2EH8L 4E42A 3KPRE 3CPLB 3BMWA 2Q6WA 5FGSA 3ARWA 5IFHL 4Y16C 1OT2A 1T2QH 4YFDB 5E2UH 5EU3A 5FO8B 3QNZA 5CZVH 3DV6A 5D96C 35C8H 5HGBA 5HVWA 4BSJA 1IC4H 3TT3H 3FMGH 4DTGL 5DRXA 3L5XL 1ACYL 4MJID 1JWMB 2VITA 4QLRA 3MRQB 4K7PX 5B3JF 3LRHA 4OD3L 3K3QA 3WNOA 1LO4L 3HRZB 4KRPC 5EPMA 1INDL 3BIBX 4UB0H 2R0ZL 4YIQA 3O9WD 3P0YL 1WAAA 4RFOL 2X70A 5E6IB 1C1EH 5C0RL 1K2DA 3ME0A 5HGAA 1T0NB 1KCUH 2W0FB 3FQNA 1EIBA 1VERA 4UU9B 4WDIA 4U2ZA 4FABL 4MJ5A 5IEHA 2VDKL 3IJYB 4WCYH 5IVXE 5TE7H 4CDHA 2H9GB 4HJJH 3TVMB 3UTPE 1J18A 2Z92B 4XP1H 1ZLVK 3KWWB 3GJEB 2FO1A 5EU6D 1NLDH 3GHBL 4ZOEA 3F58L 4Z78A 2PTUA 2P7TB 5F7FA 3FT4B 3OAZK 3D39E 1KJVB 4RX4A 4PJ8B 2EXWC 3MRPB 1PQZA 2EH7H 1OAKL 3GSWA 1A2YA 2IALB 2CIKB 4RIRA 3RAJH 2DIAA 3V79C 5EOTA 1IGCL 5KSUA 4P2OB 2P5EE 3AM8C 3Q48A 4U1MA 2VXUH 2OR7A 4LPWA 3G5VB 4ODWA 1NEZA 2IANE 4M62H 4HV8B 5A3IC 2C4XA 1KIUA 2VZ3A 4NM4H 1OP5K 1L9MA 4S1RL 4OCNC 3QJFB 2ZUQC 4HEME 3D25B 2WAHA 5L9DH 3NCCB 4PRHD 4P5TA 2Q76B 4RMWA 3X14A 3VWJC 3MLUL 2BOBB 3MRRA 1FO0A 3MJ9A 3QISA 5E8OB 4XP9L 2W0PA 3U79A 1V3MA 4ODXB 3RL2B 1CXIA 4WEBH 4NQCA 4LRIA 1H9VA 5K9QG 4HQQH 1TPXC 4HFWA 5IHZB 4JDTL 1IC5L 3O0RL 5CGYC 4G9FA 5FYKH 1WZKA 2ADIA 1XF2B 5LGJA 2VQTA 1IZKA 4OLXL 3HB3D 4HXBH 5FUCE 1IGTB 3BPOC 3HZVB 5EOCH 1YYLH 1E27A 3BP5B 5DMJB 5IV2B 3MFFA 1CGXA 1Q0XL 2VLKB 2EYTB 3STBA 4BA8A 5CLTA 1OGAB 1QR4A 4D0CA 4WUKL 2OXHA 2XXCB 1CGYA 2CK2A 4LAJH 2FHBA 3HC3L 2ESVE 3HTLX 1QG3A 4JPVL 3SQOH 3BWUC 2W59A 4YBLB 4Z77A 1OCWH 3PG2A 1YN6A 5HHXH 3FT3B 1NGZA 4HBQA 1L0YA 1JNHA 1LNUA 1HH9A 1YJDL 5D7LD 2R69H 4MJIB 1AXTL 4MDIA 3KXFD 5CZKA 4Z8FL 4N0UB 5I1DA 3QRGH 3MROB 1NMBL 3JWOL 1UACH 3D2UD 2NZ9C 4CNIB 2EDNA 1JCKA 5HHMB 4RGOL 3BT2L 4X7TB 3O2VH 3MRBA 3FFCE 1XR8A 4MVBD 4OCLC 2D03H 4YEEA 3ECBA 5C08E 5E5UB 4KKCC 1ZLVH 4GS7C 4PLJD 4HWBA 5C07D 1UM5H 4KDVA 4PTUA 5B39G 3OAZH 1DN0B 5D70L 3MNVB 5E4IA 1KT2B 3CAFA 4CU6A 3C9NA 1WBZA 3I75A 5E2TL 1AQDB 4ZO7A 1OB1A 1L7IL 2XWBB 3W9DA 2LABA 1JGLH 3PIQA 5JXAL 1RVFH 5IHLB 2IH1A 1UENA 5MENE 3NVQA 1OW0C 3QUYD 5EC1B 2VL5A 2ZUXA 3A0OA 3WHE0 4MX7A 1FL3A 3REVA 3VGBA 4GJTB 1OP5H 3MV7A 3GSUB 5J7CC 3EYUL 4PJIA 1KJ2A 5B22A 3O4LA 4BSVB 5B38B 1ZGLP 1IAOB 4Z7UA 4KJYA 5DJCA 1YN7A 3GJFA 5IMLA 1UVQA 5DD1L 3MBED 4G42B 2IG2L 1A7RL 5IMOA 4DQOL 4RISH 4W6YB 5ESQB 4PRHB 1I7RB 4PJEE 3CLFL 3OWEA 3A6BH 3E6FB 4ZAKA 5EWIH 5F70A 2IQ9H 4G8EA 3LEXA 3MUGA 3SGKA 5IP4A 2QJDA 1BBJB 5I18H 1UJ3A 1KIRB 1PY4A 2R1YA 5I16B 3UBXB 3OJDB 4WI8A 4I9WE 3B3IA 5CEYB 3RY6C 3FB7B 4R90H 5M94B 4X7SH 3DVIA 1ZLSH 5IB1B 2ZKHL 5IWLA 2AJXL 5HYQA 5IM7A 2GSIB 4JG1L 2ARJQ 1HH6A 4MA1B 5BXFB 2Y72A 2O5XL 4WENB 1CD9B 1FIGL 4QGTA 4NWTH 4ZQKA 5IUSA 4PUBH 5D2LA 4G80B 4X4MA 2DS4A 5GISL 1UKSA 1FGNL 3SKMA 1IGJB 4J4PA 3IDJA 3LH2H 3TESA 3ULVC 1I9EA 1BD2A 1NMCC 4U6XB 5HGHB 5KANI 4J3UA 5DD3H 5A2IH 2VR9A 3MACH 4UDUB 1IQDB 1HQ4A 2AI0H 2DD8H 4C83A 2VUOA 1CG9A 1NCCL 3SGDI 2IADA 2YZ1A 3BE1L 5D7LB 4ZUWA 1QFWH 1N0XL 3CZFB 3KXFB 2BMKB 3OKDA 4LIQH 3C8HA 3ZE1E 5DHVH 4G6KL 3D2UB 1BPVA 2YS4A 2W07A 4QRPE 5FDWB 1CFSB 5IESL 3UPRA 4XAWH 1G7PA 1KELH 4RAVA 1ZA3B 5CBEA 5FB8B 5SWSD 2YWZA 3QO1B 5FM5M 3P9WB 4GKSA 1CLCA 5C07B 2ZCKL 3IYLW 3VXRE 5GGTL 4M43H 2K1MA 5SV4A 5I2IA 4MAUH 3TN0C 3BGMB 2B0SH 1IT9L 2JB5L 1XGYL 4OZ4A 4PGBA 3HNSL 4LARL 4I5BA 1OF2B 2VH5H 4EKXA 4KZEH 1BF2A 4OCYL 4RGNE 1SVCP 3VFNA 5J9PA 3O41B 3RWHA 3EYQC 5FGBC 1OARL 1MELA 1RZFL 3MLRH 3SE4C 2VISB 1LO3H 3T04D 2ED9A 2RHEA 1DZBA 4XNUL 3BZ4B 5EZIL 2R2EB 5D7JB 1DEEA 4G8IB 3SDAB 3U46B 1NFIB 4WRLA 3RNQB 2V9TA 1G9NL 4RRPG 4Y19D 1SEQH 3VXUD 3LSOA 2L0DA 1UZ6E 5E9DE 5CHNB 4HAGA 2A6JB 4LLDA 3BKYH 3K8LA 4NNYA 4KHTH 4AK1A 1XEDA 2F54D 1CZ8H 2BFVL 3MFGB 4J3WA 5J12B 5L6YL 3PGFL 5IB3B 5BRZA 2DQCH 3NZHL 3CFCL 4IS6A 3F65A 3HCVB 4H88L 2R1XA 4TNWK 2CKBA 5ALCH 1BQHA 1A7PL 4PJBB 4X9GA 2AJ3B 3C08H 4EXPX 1T21B 4O5LH 5I17B 3IDGB 1CQKA 4NPYA 4NO3B 4TSAL 5C09E 4NOFA 1MCHA 1FZKB 2MWCA 3X11B 2NY4C 4DGIL 1KBGL 1X5JA 3KPSB 1WWCA 4R4FH 4JFED 5JZ7C 4ODTL 1TZHB 2PXYC 4OBRA 4PR5B 3WFDH 5JQ6H 5E1AB 1P4IL 4Q9QL 4PB0L 3MRCB 5ANME 1MI5E 1TTFA 5D5MF 2NX5D 3OKNB 2YD2A 5MEPB 1B9ZA 4LLQA 3UTQB 4NQVA 3B4NA 5C70A 3DROB 2XWJA 3DUSB 2JCCB 4HS8H 5LGHL 3EBAA 1JZ4A 3WSQH 3QHFH 4DN4H 1KTDB 1TNMA 3VFRB 2WIIB 3DX7B 5D71L 3NZ8B 3T8XB 1A7OH 3RKDC 5DC9B 1YNKL 3SJVE 1TJHH 4LEOB 5HHOD 4RBPK 1IJ9A 1DFBH 1MHHB 2V2XA 1NBVL 1TVDA 4CL7A 5I19H 1X5ZA 1MEXL 2DQUL 2XN9E 3E2HC 4HWEL 4V1DA 3GSOB 3EDDA 2NY0C 3MRFA 1UEMA 2J4WH 5C8JB 4JFXA 2BVPB 3VWKC 4J1UB 4EOWL 2G2RA 1QPXA 2CRYA 2O5YL 3MODL 2AXHA 4HBCH 4R7NA 4DCQB 4XI5C 3TNMA 8CGTA 5JHLH 3AROA 1F13A 4YWGL 4KV5F 3TNNB 4Y2DD 1F4HA 5SWSB 4N9GB 4AIZA 1YPZB 4DJMA 2EIZB 1YNLL 2PYEE 1YUHB 3VXSE 4ZYKB 4DOHB 1U8QB 1GAFL 1TLKA 4DAGH 4YGVA 1NGPH 2X4QB 2F58H 1D6VL 1HZHL 5DQDL 3VGEA 4MJ6B 5E94A 3HAEA 5HHPB 1QO3A 4GW5A 2GJJA 4NGHH 3SCMA 1AHWA 1I7TA 2UWEE 2R2BA 2V5RA 4O58H 1JUFA 5DMGC 3RTQC 2UUDK 1T22B 4B50A 1MY7A 2CSPA 4JO1L 3QDHA 4OZGF 4XC1H 2HTKC 1OPGH 2YMXH 1AGCB 4F7MB 1FJ1B 1NDMA 4KTEH 5I8KL 2H32B 1AGBA 5HI4C 4PJAB 5F1SA 2VDRH 5DJYB 1XGPA 2NY1B 1CF8H 1CGUA 2GITA 1ZTXH 4HX1B 3TZVC 1PAMA 1S7WA 2CD0A 3O45B 4IHOB 5IVXA 4P57A 1Q1JL 5E6YA 2UYLB 3BSZH 4TPRL 5FUOH 4PLNC 3HHRB 4RCAA 1VACB 2HJFB 4M93C 5GSVA 3CFEA 4HULB 3TF7C 4NQSB 3W39A 1OAQL 1L0QA 4XCFH 5IBLC 5L2JA 1MCWM 3RWCA 2A6IB 2BRRL 1S9XA 2G9HB 4KROD 4JFEB 5K9OB 1AD9A 2V6HA 5I1CH 5CEZD 4BKLB 4EEEA 4JPKL 3HZKB 1BREA 5KSBB 1UWXK 2NX5B 4IOIA 3TA3D 5FHAL 4M7KH 3CDFA 3TH4T 3SDCC 5DK0A 4O2FB 3CDGA 4JGUA 4LFHD 3UJTH 5CJBA 3MRNA 3CC5A 3IVKB 3RVXD 2HMIC 5D1ZA 4PS4H 2L4OA 5EUOB 3H42H 4RBPH 3L3HA 4MAYA 2BNQB 1N5YH 4HHAB 2VLRB 5BCAA 4Y4KB 1SYSB 4NQDA 1F6LL 3L3IA 5J6GA 1K8DA 4HUVB 5JPNB 3TV3H 3FCTB 5IW1A 2X4OB 5E1HB 1QSEA 2A1WL 3OSKA 2F8OA 4ORGB 5C0AD 1NGWB 3ARGC 1O5DT 4GG6E 3L3JA 5GS1B 4PJHB 4P9HL 4FA8A 1MNUL 2XNAA 4U6HB 4FQPA 3GBNL 3L3GB 4NRYA 3TPUA 1Q9KB 4D0DB 5E6ZA 3WD5L 1T7ZA 4OLVL 3BQUD 4K8RD 3I6GB 3ALPA 3ZSTA 5KVEL 1YMHB 1XIWD 5AUMA 1J11A 4MQ7B 4X6FA 1S3KL 3UTTA 3QDMB 4LGPB 3ZDZF 4Y2DB 5IVZA 5TQ2L 3T3ME 1U8PB 2WNGA 3VA2C 2VXQL 1RJYA 5JR1H 3IU3A 4X99A 3PP4L 4HFUH 2YRLA 4YDJA 4TNVF 3UJIH 2C5DC 3L7FA 1C08A 1JFQL 1IILE 3REWB 4KVCH 3DGGA 2UUDH 3UMTA 3U2SB 4FQCL 5D1XD 5IOPB 3JTTA 1CE1H 3JV0A 2OR9L 1Y18B 4HMCA 4V2BA 3G5ZB 4YHZH 3V5HA 3WUWG 4CMMB 4QHUB 3O11B 2XI9A 3MSPA 1CLYL 3DOSA 3Q5YA 1YJDC 2EDLA 2FEDD 4JZNA 4LOUD 2XTJB 5JW3L 3JWOC 4JFFD 4W6XB 3BP4A 1LO0L 1EFXD 1X7QB 5I1LB 3MRHB 5JPMB 1ADQH 5C0CB 2I9TB 1MHEB 2CJUH 3D18B 4YDIH 4K94L 5KVMC 2AP2A 4LCCC 4KQ4L 2YKLH 4DZ8B 1QBLH 3VA6A 1RZJH 4NZJA 1I8IB 4R0LB 4S2SB 5DHVB 1JGVH 1G6RA 2E9IA 1HSAB 2P44B 1J1XL 4DN3L 4O51B 3KPRD 3PXJA 5CJOL 1P7QA 1RZIA 4I1NB 2N7BA 4OF0A 1EBPA 4F57H 2Y5TB 1G7MA 1UWXH 1JIBA 3EYOB 4QRQA 1JNLH 4JDVA 3MBXL 3STLB 1Q8MA 4OLYL 3TBTA 1BOGB 4KXZI 3THMH 2NY5H 3C6LC 5LVEA 4NUJA 1F90H 4JQVC 1ZSDB 5K33A 3TA3B 1A4KA 3K8MA 5HYJA 5M95B 2PUQT 3IAQA 1T83C 4MNGB 3H3KA 4TTGA 5HDBE 5IR1A 3IDNA 5A2KH 3SOBH 1LO5B 1CD1A 2D4FA 2DM2A 3QJHB 2DRUA 2H1PL 3LRSB 4ODSH 5HDLA 2R29H 3EYVA 2DQIH 4FP8L 4PJDF 3G04A 3GMQB 4I0PA 4EZMA 1NBYA 1ZS8B 3UTPD 4H20H 1NSNL 1YY9C 2VNCA 2EIEA 4KDTA 5MEQB 4JY6B 4YR6A 1FCCA 5DD6B 1CT8A 4HIHA 4NQXA 4LSSH 2NTFA 2DLFL 4OM1H 1HINH 2NR6D 2Z31A 3D39D 4GQPH 2W9DL 3BQUB 4L4VE 5E2VL 3CLEH 3QUXB 4IRSC 1J86A 1XIWB 5HDOA 4H1LH 2VYRE 4HIEA 4CRPA 2R4SL 2I25N 5EOCL 1IAIH 2P5ED 3IF1B 5D72L 2F9BT 4PJ5E 1NCBL 4DZBB 2FNBA 4JM4L 1I7ZA 2VB5A 5AG9A 2IAND 3MYJA 2AVGA 3BEWA 1FAKT 3ZTNL 1MWAB 4QOKE 1FSKB 1YYMH 3IKCB 5D7SH 4NZDA 4F9LC 2J12B 4JG0L 4OCXH 3EYFB 1J0ZA 4QKXB 4CKVX 3FHAA 1CD8A 3PWPE 2WSKA 5E2WH 2NW3A 3LZFH 5FA3B 5H2BA 3KYOB 5T3ZE 3OZ9L 2JJSC 3LN5B 4QRPA 3RZCB 1RU9H 1MLCA 4NO0A 3QXVA 3ZYJA 1B0GB 5E6IC 2YK1L 4LL9A 1MFAL 4TVPE 1IC1A 4JFFB 4KTYA 2D7QA 2MFNA 4NQTA 2Y5EA 1M6OB 4U1HA 1FNEB 4JR9H 3IXTB 3HI6H 3C8KA 1FBIL 1VENA 3TYFB 3QHZH 5DMYA 3TVMC 1VFUA 3H9HA 4KMQA 3T77A 3NTCL 4BFIB 1GZPA 4LLYA 3ZYOA 3KPRB 3OXSB 2MCPH 3OL2A 1SYVB 2DICA 4IRZH 1FZOB 2HH0H 4PG9B 3V4UL 4Q9RH 2HJKB 4PJ8C 5DGRA 1EGJL 5DHYA 1OSZB 2RCSH 2ESVD 3RBSA 3CFJB 4RWYL 3ULUE 4OCRH 1JV5A 3NAAL 3E1F1 5D2NA 4OKVA 5IT2H 3MGAA 4YZFE 3BD4A 1GL4B 3F12A 4G43B 1S7XA 2FSEA 4X80H 1KULA 4P2OC 3TBYB 4XVJL 4Y4HD 1FVCA 1KTRL 4L4TA 4HJ0D 4F9PA 2W65B 1IL1A 4JRWA 3KNBB 2KPNA 2OMNA 5JIHA 1RZ8B 4LHJB 4CVXA 1P5VA 1OAXL 2R0KL 1G9NC 3QULA 5KSBF 4OM0H 1W72B 1BJ1H 3FFCD 1XF5B 2FB4L 5C08D 3RVUD 4NKOA 1UYWL 8FABA 5HHNA 4EIGB 3KR3L 3VXQB 2V9QA 2A9NH 1BEYL 3FQRB 1D5XB 3LQAH 4JM2D 4DVBA 4FTVE 2QV2A 4CVUA 4Y5VB 5BS0E 1JGEB 3CDYA 2OJEA 4M03A 5ICYB 4OZFA 4HC1H 2WV3A 3EOBA 4I4WB 1MI5A 3WE6A 4MXVE 4WO4A 4N8CL 5MEND 2IBZY 4ODVL 2XG4A 1TVHB 1FFNA 3MLSH 1SBSH 4JHAH 2GJZB 4MA8H 5EBWB 4PJHF 2BSED 4XVSL 1VADA 1OHQA 3PV7A 2HLFD 1I1CA 3O2WH 1GGBL 2A74B 2ARWA 2Z91B 5C6TH 4AMKL 5CZXD 1XAUA 1YEGL 2XWTA 4ZUTB 1QSVA 4QRTA 2P5EB 3T0EE 3QNXB 3WKML 1IGIL 3GMPB 4QF1A 4MB3A 1Q9OB 3GSRA 5I6XB 5HBBA 4L8BA 4YBLC 1KIPA 4YHIB 1LEGB 1A9BA 5F7DB 4EDWH 1YECH 4JKWA 4RNRA 43CAB 2XN9A 1YMMB 1U3HD 2H45A 2HN7B 5IHUL 4K9EL 4GUPA 1ZWIB 4XPBH 1CK0H 4P23D 1GHFH 3MOAL 1S9YB 4P5MB 1RMFL 2VZOA 3WIIH 5JA9A 1RK1B 3R06B 4L8SB 5FKPA 5K9QI 4I9WD 4MSWB 4NM8H 3S35X 2I07A 3LKNB 4KJPD 1UB5A 1I4FA 3UO1H 5KVGH 1S78D 2F19L 1T7VA 1FNGA 5IK3A 3B5GA 1FYTE 4UUJA 3V6OE 3LCYA 4Z7VA 4ONHB 2HFEB 3BH9A 1TVBA 2FZ3B 4OZIE 3BDYL 3ZMRA 5GRXG 1X5FA 3MRMB 5C7XL 3IJHB 4Z7WB 2QQNH 4R9HA 3V0WL 2ZPKH 4F8TA 5IJVB 3V4VH 2DBJA 4GBXB 1I1RA 4NZTL 5FKAB 2FIKA 5CEZL 3OGCA 2H26A 4XP4H 1ZHBA 1NCTA 2ESVB 1WFUA 4BFBD 1PG7H 4I0KA 5C0ND 1FDLL 2D7NA 4G5ZH 4MB4A 4LSPL 4OSUH 3G5YA 4HWNA 4XCNB 3OG4B 2JK5A 5GRVL 5T33H 2A0LD 2NY7L 3SKOB 3SHSA 1WBYA 2X4NB 1CFNB 4EUPH 2VOTA 4NDMA 1LE9A 3LKOB 3RGVA 2OL3A 2P8LA 3WJJC 1IMHC 2EDJA 4PRDA 4U6YA 2XZCH 3I02B 2X09A 2NY6D 3VXRD 4HCRH 5ACZB 5F89A 3S96A 3O6FD 5GS2D 1YEJH 4JM2B 1H3XA 1PZ5A 3CVHH 3KYAA 3DSFH 4X4XA 3ET9F 3QEUB 5IMKA 2EE3A 2RAMA 1PVHA 2CDGB 4QCIA 2LV4A 5DO2D 3O3AB 3B5TA 2DF3A 4HZAA 1CTOA 2JIXA 4XBGA 3S3JA 1NKRA 3GMLA 4ZUVA 3TBVB 1KB9J 4MA1C 1J05A 1IKFH 5E8PB 4RGND 4MA3A 1QKZL 4XGZB 1CDJA 1YDPA 3HMWH 4XRCB 1T7WA 4TRPL 4G3YH 5E99H 3VD7A 1TCMA 5ISZE 3EFDL 4Y5XB 5T5FL 4LPVA 5CSZB 4ETQB 3OKLB 5DVOA 2WZPD 1RV6X 2VDQH 3IGAB 2PETA 5I74B 1MWAL 1XR9B 3V6FB 5E9DD 3VXNB 1ORQB 3FRPG 4XXCA 3MUZ1 2ITCA 1I9RH 2QR0A 4KDWA 1MLBB 1D3CA 1SBBA 2UV3A 3HUJE 3MLZL 3TO4A 1HILA 4JFDB 3D6GA 1QTYT 1DLFH 1U3HB 5D9SA 4PJEB 4A6YA 1A7OL 2VXTL 5I71B 2Y23A 4JRXB 4UT6L 4UOJA 5J1TC 5C09D 2WWMD 1G0XA 3TYGH 4D0BB 3C60D 3SY0A 5GGRB 3NFPB 4NCC2 4P9HC 2YPLA 4ODUB 3NIFE 3GO1L 3B5HA 1MHPL 1OP9A 1SJXA 4RMSA 1QEWA 4LPYA 3AY4A 3MQIA 4PLJC 1CXFA 2YSSB 3UTOA 2XFXA 4PJCA 1HDMB 2DQFB 4QRRE 3U4EB 4YHKH 1ZHLA 5MERB 1T1XA 2EEAA 2Y6SC 3MV9B 3RU8H 1OTUC 4QT5B 4ISVA 1JP5A 3T0WA 3RUGB 4ELKB 1MCPH 3SBWC 4U0QB 4GMTL 4AENA 1KTKE 3KLSA 1GPOL 1I9JL 5JORA 5F7MC 5AEAA 1R6VA 1JN6B 3T3PF 2VQ1A 3L3DB 4YX2L 3HI1B 1PKQA 3P77B 4M6NL 4JVPA 4XNYH 4HK3N 1KC5H 3VFOA 3ES6A 1CICD 3QEHB 3SDAC 5D7JC 3IFOA 1A1OA 3QB7C 1A4JB 1DQLL 1YEIH 4H8WH 4JKPH 4YH6A 1W72L 2FHFA 3FFDB 1QBAA 2CLVB 5J12C 2VC2H 1X5HA 3CXDH 2FLBT 4YDVA 1JRHI 4FG6D 4MD4B 5C9JA 1UM4H 5I1KH 1CL7H 2P8PB 4YO0B 4L9LB 3PP3K 1FZMB 5E70A 1S7UA 1JZ8A 4K94C 2V7NB 3GSQA 4I3RL 1J9CT 2PYED 2NY6B 2ZWLT 5AZ2L 2XA8H 3CSBA 4E41E 5E5MA 5HYEA 5KZCD 4GSDH 4X6DA 1D5BA 4QEGA 1SM3H 1FVDA 4NFCA 1K4CA 4TNWF 3WCYA 1AQKL 1XGTA 4LU5L 1WLHA 3P2TA 3HE6D 4RGNB 3UP1A 3G6AB 1LMKA 1QACA 4P5KB 1PY9A 5B39A 2Z8SA 3N1PC 1N2RA 4EQ2A 4LRNL 4UIKL 2CRMA 1GSMA 1V7NH 3QDJA 4YHLL 3WFHA 1DJSA 3ARBA 2BSTB 2UY7A 1MFEL 4PJXF 3VXPB 5ITFB 2AJYH 2OQJB 2CLZA 3VGAB 5BQ7A 1HXYA 1RUKH 2FJGA 2FL5B 4WW1A 4QTHA 1S9WB 1Q0YL 1U8NB 1FQ9C 1A0QH 3ILPA 2GT9A 3VXTA 4BH7B 1A6ZB 4S1SL 4M1GL 3E8UH 4P4KA 1MHCA 5AZEL 2P8MA 5I8CB 2J1KA 3RIAK 4LSUH 4G6MH 1FPTH 2GEEA 3RWJA 5HGDB 3GRWH 3GGWA 3O6LH 1M7DB 2WLYA 3TIEB 5ADPL 4OF8A 5JW5A 2ZSVB 4NQEE 3WBDA 2DM3A 3W2DH 1TJGH 4N0YH 2G5BA 3QXDA 4GW4B 1WWBX 1CFTA 1LE5B 1JHLH 5ETUB 1RJZB 1A9EA 2AEIT 2VXSH 4OGAC 1LK2A 1ORSB 2WUBL 1X5AA 3QG6B 2P45B 1JI1A 4PG2C 5T1KD 3MUJA 3R0NA 4GQ9H 5B3NA 4XNXL 4OIBA 1BMGA 1TCRB 2EDYA 1HSBA 2BY1A 2PO6B 3VE0B 1ZT1A 2BY2A 3ARFB 4X0KB 1A6UL 1P2CB 3QDGE 3QIBB 4EN3B 2R0LH 1BHGA 4HW6A 2FDBP 1CICB 1AO7A 2DI7A 3CX5J 2GHWB 4OLZL 3HLAB 1I7UA 1N59A 2NY1C 4JO2L 1LHZA 5KSAB 1BP3B 1QVOB 2OTUA 1ETZB 3PP3H 1X4XA 1KJ2H 2Q8BL 3QXAA 1FIEA 3FQXA 1WIPA 5LQBH 1JNNH 1OSPH 4ZXBB 4J2XA 4E5XA 3ARDB 1Y0LA 1MFBH 4GRWH 4J23A 3WHXB 3QQNA 5DVKA 3MCG1 4JY4B 3QFJA 3C5SB 3W11D 5C0JA 1S7RA 3B2VL 1A14H 3ZDYF 2B5IB 4ZFOA 1FG9C 1NANH 2GY5A 2BDNH 4ONGH 1UXWA 2PYEB 3QIWD 3NCMA 3BFOA 3VCLB 2Q3ZA 2C9AA 1KYOK 3ALXA 1UCTA 3D3VA 4YXHH 4U7SA 5GZNC 1FV1B 4MNQB 5GGRY 3KDMB 3QFDA 3X3FH 4C56A 4HS3A 1INQB 3MREB 4OQ1A 1RUMH 2GAZB 5D7KE 5KG9B 3V5KA 2UWEB 3IETB 2BVTA 4XWOD 3K4AA 4DGVL 5IFJB 5DFWH 4JO4L 2BJML 5JHDA 3ARPA 1C12A 4EVNA 2ZNWA 1BJ8A 3O2DL 4RX4D 1A6VL 1X5LA 4Y4KC 1QBML 4KVNH 1EEZA 3P4MA 1TTGA 2OCFD 1P4BH 1I1AB 1F58H 4OUUA 1QLEH 3TJHC 5L2KA 3PHOA 5E7BA 1YEDA 3LKRA 4PGCA 1DUZB 1XCQA 3FB5B 1R5WA 5GS1C 3P40A 4XWGL 4YXLL 3B83A 1N6UA 3LS5H 4YUEH 1F3DH 4FXLA 5GSRA 3MJGX 3S36X 4RRPA 4ALAH 1PLGH 4QHMA 4X5WA 1N5AA 4L3EA 5DEFA 4O4YL 1OAUH 3EGSA 4FQQB 1MIEH 3ARYA 4F2MA 4BSWA 4Y2DC 2WINB 3GMOB 5I75B 3QWRD 4MDJB 5DUPL 4QXWA 1AE6L 2VDOH 1U3YA 3BN9D 2QKIB 5HPMA 4NQCD 5T5NG 3DVGA 3LN4A 3HC0A 5K9KB 4K7PH 3TH3T 1FAIH 5GS3A 1HNGA 3IDIA 4XCEA 3J7HA 4ZFGH 1WF5A 1T1YA 4PJFE 5D5MA 4Q6IB 4ZO6A 5CJXC 1FFOA 1WUNT 4XX1G 2YPKB 3RUGF 3RX8A 1RZ7L 4M7JL 4HKBB 5F88B 1B0RA 4PYHA 4Q7DA 3QIUA 2CIIA 3F8UB 3HE7A 3G6JF 4E42B 3RQ3A 4K9EC 2Z93A 1R5IA 3QUMB 2R0WH 3PXHA 7FABH 2XTJC 3MO1A 5EU3B 4IIQA 3QNZB 2AQ2A 3UTSA 1EA9C 3DV6B 4K3HA 4UBDC 3SO3B 5HGBB 4IDLA 4OZHA 3C5ZA 3U6RA 5F1KC 1N7ML 4QXGH 5DRXB 5C9KA 1AXIB 4L4VD 4R0LC 4XHJD 2EC9U 1U2CA 4EXKA 4OLUH 4ELME 1VKXB 1HN1A 2C1PA 1UZ8A 2CKBH 3IB4A 5EPMB 3PJSA 4PJ5D 1NFDA 3QIWB 3BUTA 1P84J 2X70B 3QPXL 1K2DB 3QA3A 4LLVB 5HGAB 4K8RH 1D5IL 3FQNB 4JPWH 4QOKD 4TQEH 3INUH 4WDIB 2QQKH 5IG7A 4IRZL 1L7TH 1F97A 3L6FA 3MXVH 4MJ5B 1AY1H 1FL5A 2IAMA 2EZ0D 5BV7B 4D3CH 5IEHB 3TA3C 3GB7A 2CLRA 3PWPD 3FO1A 4NN7B 1RFDH 2X1QA 5T3ZD 3BVNB 5JXEA 4LLWA 3RVXC 2IFGA 4DUXA 5LAXB 4YHML 3U9PL 2VERN 2JJTC 3QNYA 1B6DA 2X1OA 1LP9A 1A2YB 1HEZB 4AEIL 2HA1A 2WBJA 4CN1A 4K3JH 1XF3B 4OZGA 3TCXA 4J3VA 1KEGL 2BSSB 4U1MB 4C58B 1BVLA 4F15B 2P5WE 1G7JA 4PJGE 4ODWB 5GJTH 4N5ED 4APQA 4LGSB 3P4LA 3FO0H 3K1KC 4IDJL 5I8OH 3CSYB 4UINL 3BQUC 1T5XA 2X7LA 3QUXC 3X14B 3ULUD 2B2XH 5F3BA 1XIWC 4W6WB 1T03L 5J1AA 3MRRB 4LF3B 1FO0B 4AH2B 3Q3GA 1DVFD 2XG5A 3FRUA 3B43A 4KJQD 3HMXA 4GXUM 4NQCB 1UM6H 4XPFL 1PZUB 3KPQB 2A9MH 3L1OH 5DQ9A 4AL8L 1MVFA 4AM0A 4G9FB 1FSKC 2Z8WC 2ADIB 5LGJB 4AJ0A 3ARED 5I8EA 3F6IA 2D7OA 1OTSC 1IQWL 1ZEAL 4PJ7F 4WUUE 5BOZG 4HG4J 3MFFB 4GW1A 3ZT7A 1EZVY 3CK0H 3HAEH 4IRJA 1YEKH 3RZCC 3V0VA 5FFLA 4FTVD 4J4PD 3RFZC 1FCGA 5IHBA 1AI1L 5BS0D 4D0CB 2BSRA 1J87A 4O2CB 3QEQE 1KEMH 4OAWA 2ZG2A 5DEGA 5GZOC 1X5XA 5K93A 1LO2H 1RJLA 4Z77B 1FFPA 1YN6B 4OCWH 4MS8D 2MPAH 2WWKT 1F3JA 1CDGA 1F8TL 1L0XA 1NGZB 2Y36H 1QFOA 2DTMH 2IH3B 1JNHB 1LNUB 5EIIB 1HKLL 1D9KD 4BFEA 5DR5L 1EXUB 5I1DB 2QSQA 5B38G 4K7FA 2OS7A 4M6OL 2DJUA 1MCOL 1J1OH 3T2PA 1NBZB 4Y16A 4ACPA 3DTXA 1PSKH 3SQBA 1RZGB 4PJ5B 3UX9B 5FYJE 1Q9WB 3MRBB 4Y8DC 3R8QA 1IGFH 1XR8B 3BIKB 2FEEI 5B3JE 2EICA 5DSCA 2ZCLH 1KPUB 2DQHL 3D85D 4RDQG 2AJUH 4CN6A 2Y7QA 5CMAB 3WFCH 4KQ3L 2ZZUT 2WUCH 2RIKA 4PTUB 4XTRC 1ES0A 1RZKL 3TT1H 3C9NB 3UBXG 5KVFL 4OQTL 1WBZB 3PWPB 3W9DB 4GH7B 4PP2A 2VZSA 3QPQD 2WBKA 5HHVL 3BUYA 3ROOA 1VFBA 2IH1B 4J7RA 4U1IA 2C7UA 2AERT 3N0PB 4JQIL 2EKSA 3WUWA 3M1BA 1H3GA 4JRYE 4Y5VC 1FYTD 3KPNA 4PJIB 1KJ2B 3O6KL 3O4LB 3EO0A 1C5DA 1C5BH 4KJYB 3GBMH 5DJCB 1YN7B 3GJFB 5IMLB 1RK0A 2DQEH 4IM8A 2VABA 4BYHA 4H5SA 5KS9F 5HYSB 32C2A 1RQ5A 5IMOB 3U7YL 3DRQA 1JPGA 1EMTH 2HFFA 2NR6C 3MR9A 3ZDXE 4EUPG 4KMTH 1S5IL 2WK2A 2WLZA 1ND0A 5KN5A 4M4PA 4ZAKB 1J5OH 1WICA 4NNXA 3UPAA 1EHLH 1FE8L 3NA9L 2GW5A 3LEXB 3MUGB 1CGWA 3BRFA 3NABL 5FCUH 5ERWA 4I2XE 1K8IA 5KW9H 1E28A 3AM8A 3IAPA 1KENL 2XKSA 2EC8A 4QYOA 5I6XC 2KQNA 5GS0D 1F2XK 5DK3A 1BZ9A 5JIKA 1DTUA 3QEGH 3STZB 4HK0B 3MLYL 2R39A 5IM7B 5HYQB 3A6CH 3GI8H 5ILTH 4EBQL 1G0DA 5SX5K 5I1EL 3AREB 3H8NA 3QUML 2OTWA 1DBKL 3CMOH 4G6AD 4G9DA 3KPPA 2FGWL 3O6MH 5D2LB 5FYLE 2J5LB 1XF1A 2HLAB 3NOIA 1B88A 1LK3L 3Q5TA 3ZKQD 4L8SC 1DQJB 1CGSL 3SKMB 4LDEB 3IDJB 3O3DA 4F7PA 2AK4A 1HWHB 1D5ZA 3IRZA 2YPVL 5TGBA 1BD2B 1AKJA 1A7QH 1XGUB 1T1ZB 5C3TA 2FBJL 3S3SA 1UA6H 4FFVC 1HQ4B 1R5VA 2A38A 4C83B 4V1DD 4YK4B 2AEPH 2IADB 3ZHDA 5ISZD 1A3RH 5SWZE 1FLRL 1HHJA 4KAQH 4ZUWB 4PIRF 2OX5A 4UV4H 6FABL 4LLUA 5CBAB 4GBXC 2DN7A 4JREB 3HZMB 3MLXH 5I73B 2M26A 1G7PB 2ORBL 4RAVB 2FX7L 5BV7L 5CBEB 5DGQA 4F7TB 3MX0A 3OR7A 2GTZA 1WAAF 4NP4H 2ZG3A 3WXVL 1JPSH 5I2IB 3SE9H 4HLJA 4XC3H 4OKDA 4KTDL 5EZLA 2DLTA 4HJ0C 4OZ4B 2D9CA 2EDBA 2CMRH 2J8UF 4I5BB 4K3DL 5EO9A 1KPRA 1E4XL 3VFNB 5INCA 5BVPH 5J9PB 1OTTC 2DBLL 4KHXL 3RWHB 4BZ2H 1WJ3A 4H0GA 4HUWA 3UXFA 2FHCA 1F6AB 5MP6L 5AYQA 5CS7A 1BBDL 4QRRD 1N26A 5C0EA 4QWWC 4NHCL 1KGCE 4HKJA 2CK0H 4JM2C 4OD1H 5I15L 1BWWA 1QFWI 1DEEB 2JTDA 3S3PA 5EIVA 2GUOA 4LHUD 3LSOB 5I66A 5BO1H 1VGKA 4OLWH 1R3IH 2OP4H 2BERA 3ZTJG 1GGIL 5I1AA 4ZSOA 2Y07H 1JBJA 1OW0A 1FO0L 3MJ9L 3SGEH 4XNQA 3VDBA 5CILH 2Q8AH 5BRZB 5MEOA 5CP3H 2DYPA 1D7FA 2R1XB 4PY8J 4Y5XC 1O0VA 3FOMB 5FEBA 1BQHB 4PFEA 4HPOH 1MJ8L 4ZPVA 2JJWA 4NPYB 2BHZA 5I74C 2QADD 4ONFL 3G5XA 5E8NA 5SX5H 3V95A 3W5MA 3F7VA 4YLQT 4BZ1L 1U8LA 5F93C 3ZKNC 4WFHE 4MLSA 3FONA 3HI5L 3ROLA 2DQTH 2JELL 2D2OA 1U3HC 3CDCA 5T3XH 3T09A 5JTWA 5I71C 1PGRB 2UZIH 3GIVA 4NQVB 1N6QL 2V7HA 5HY9A 3ZL4H 3ARQA 4XP6L 1BLNA 2A73A 2XWJB 4N8PA 5KBNC 2ZUTA 4X6EB 4E41D 3X3GH 3SKJH 1CR9H 5DFVC 1QFWM 3JVGA 5GXBB 1KNOA 3RY6A 4NQDD 5JW4M 1CWVA 3MA9L 3X13B 3QQ4A 4LSUL 2YOCA 4Y1AE 1H3WM 1QFUL 3JZ7A 4N0FA 5F7YC 2V2XB 4HT1L 4R8WH 1FN4A 2EXWD 4V1DB 3FO9A 2H8PB 4WI9A 2DMBA 5GS2H 3MRFB 4WI5A 3S7GA 4JFXB 1BM3L 4OGXH 3EFFA 4HWBL 4R7NB 5D4QA 4JFOA 2ZOLB 3TNMB 1U6AH 1HWGB 5I9QB 5A3ID 2PR4H 1D6EA 4HDIA 1LEKB 1IC7L 1U36A 4AIZB 5E2JA 5C0NC 5DYOB 1W0WB 2IQAB 5BZWB 2JKXA 3L9RB 3MRGA 5T3ZL 2EDQA 3HUJB 3VWJD 4FFYH 1GJIA 4OBSA 4QXUH 1I8KB 4YGVB 2VJXA 1RUAL 4RQQA 2XRAL 2D3VA 4O9HL 2EYSB 1UT9A 5DDHA 1IBGL 1PD6A 3NPSB 1KFAH 4X6BB 2PYFA 4DK3A 3SCMB 1AHWB 4L9LC 3SE3A 1I7TB 2R2BB 1KJ2L 4NQED 5CGYD 3KS0H 1C16A 4NKDA 3UAJC 4JHWH 2NY6C 1NAKL 2QTEA 4TSCH 1N4XH 2X10A 5IQ7L 1J0YA 2V5SA 3TN0A 1NDMB 5F7HA 5DO2C 1WC7A 3OF6A 3V5DA 1XGPB 2GITB 5LCVH 1TZGL 2PN5A 3CXHK 3ULUL 1S7WB 1Z5LA 3RVWC 5FF6A 3PNWB 4RGNC 4P57B 3ARXA 5DD0L 1N8ZA 1MUJA 2AJSL 2F53A 1I8MA 4Z7UF 2DQDH 4JFYA 2AXGA 4GRWF 3SKNA 3QDGD 3EJZD 5GSVB 5F9AC 2VDPL 2APTA 2X4SA 2CR6A 3W39B 5DA0B 2QADB 1YQVH 1U58A 1DBBL 5F3HB 3ZSSA 5L2JB 3RWCB 3MUHL 1S9XB 5D1QA 3NCYP 3EJYC 3BO8A 1BGXL 3MOBH 4FQ1L 3IDYB 3VGAC 1AD9B 1DDHA 4JN2A 3U4BH 3X12A 2HKFH 4K3EL 3RPIA 5ADOL 4IOIB 2FJFA 3G9AB 3L3OA 1FLTX 2ARJB 4XB8A 5DK0B 4KKCD 4HK3J 2NY2D 1NLBH 2R4RL 3JSSA 3CC5B 3MRNB 4HH9A 4M1DL 1QPPA 3V6ZA 1CVSC 4X6CA 5D1ZB 4E41B 5ICZA 3I6KA 3KLAA 1ACZA 3L3HB 4MAYB 3Q6GL 3RPKA 4YEFA 1VFAA 2PXYA 1MREH 1K6QH 4FOMA 5J6GB 1A7NL 4NQDB 2ZUWA 3B6SA 1K8DB 3IXAA 3RDTA 1CFQA 5FUZH 5IW1B 4NN5B 3HA0A 1BFTA 1UH4A 3LKSB 4QNPF 1HKFA 5T1MA 5F9OH 5D7KD 2VLKE 5DLMH 3L3JB 2HAZA 3MV8A 2ZOKA 1BX2A 1OGAE 2X9YA 4NRYB 4DUVA 2R15A 3MNWA 4X8XA 1CU4L 4RMRA 2NQCA 3CJJA 1XH3A 12E8H 5BJTA 1VESA 1SJHA 2PO6C 4PREA 4JFPA 4Y4FA 3ARFC 3LIZL 5AUMB 1CYGA 4X6FB 3QIBC 5IVZB 4EN3C 1JPTH 3T65A 4GAJL 2BNRA 1OLZA 2AABL 1CICC 5DQJA 1C8PA 1RJYB 2I60H 4N8VG 3IU3B 1QRNA 4DK6A 1G7LA 2MHAA 5DURB 3GDBA 3LB6D 1ZVSA 4N0UE 4YDJB 5IBTH 3EJJX 5KSAC 1MQKL 1UC6A 4P2RA 3L7FB 4DGYL 3BP7B 1TETH 1T0PB 4FQXD 5HHME 4ZXBC 2YN3A 3ARDC 3D0LB 3FRPA 4HIIA 1ZANH 1GC1L 3D0VB 3EDEA 3OXRB 5I1GH 2B5IC 4M6AA 4LSTL 5DD5L 2YBRA 1TJIH 4KRLB 4LPTA 2OL3H 4NZRH 2J6EH 4LFHG 3DURA 1J0IA 1A1NA 2EEDA 3FB8A 2HKHL 4JJ5A 2F8XC 5DJAA 4JZNB 1DCLA 3SGJA 3BPLB 2VLJA 3TH2T 3MC0A 1CXHA 3BP4B 3GHEL 4N0CC 4JAMA 1VB9A 4JCMA 3GKZA 3U9UA 3OV6A 4G7YL 1YEEL 4GFTB 3PQYD 3IDXL 2NPLX 2EIDA 1AR1D 2K9UA 4OD2A 5ID0A 4JQXC 1G6RB 5BMFL 1E4WL 5GRUL 4Y88A 1JHKH 1CBVH 4LCWE 1WFOA 1P7QB 4HLZG 1RZIB 1RZKC 1OQOA 4I0CC 1I1YA 4F37K 4P9ML 1N64H 5TDNA 3ZZ1A 1JPFA 4MNHA 4JDVB 2FYYA 3TZVA 2IPUK 3TBTB 1I1AC 4M4RA 1H0DB 3QWQB 3HG1A 3GM8A 3OAUL 4QGYA 2EKJA 4PRHE 4IJ3B 1SY6H 4NUJB 5E00A 1A4KB 5HYJB 3FN9A 3KPOA 4DKAA 3MUY1 2NY2B 3EOAA 3IDNB 5J89A 1BJMA 4UDTA 1CD1B 1U8MA 3CSGA 4A6YH 4XMLH 4HWZA 4X7EC 3N9GH 5JLZA 4TYUA 5ALBH 5I75C 3FOLA 4R26H 3EYVB 3JUYA 1QSFA 1QYGL 5I8OL 1FG2A 1NC4D 4Y2OA 4MD0A 3G04B 4I0PB 2LTQB 1B4JH 1NBYB 5D8JL 4PD4J 5DWUL 4WHYG 3ISWA 5C2BH 3IFPA 3HR5A 1EEQA 1SMOA 4YR6B 1N3NA 2KUTA 1F4AA 3WJLC 3WIHL 1JF5A 2AK1H 4HIHB 1RIUH 3QCTL 4NQXB 4X9HA 3FN0H 4MWFA 4Q6IC 2K7PA 2IBBA 4XPGH 1NMAL 3BJLA 4FMKA 4XCCL 3DHJA 3MMEA 1HOCA 15C8L 1QOKA 4IOFD 1T89A 1S7VB 5FV1L 1RI8A 1F4YL 3G6DL 1S8DA 4DKEL 1FORL 1KCRH 4UTBL 4OJFL 5IB2A 1Z9LA 1NCNA 2G60L 4UV7L 2GFBB 1MFCL 2P5WD 1MRCH 1I7ZB 4JZOA 3QSKB 3SO3C 4N68A 3ZDZE 4P2YA 4ORZC 2ERJB 4FQXB 2PTTB 2OK0H 5C1MB 5F9JB 5T1LA 3JUZA 4Q2ZA 5JZ7D 3RL1A 4LBEB 1XCTA 2NW3B 2W9EL 5IW6A 4JN1H 1IKNA 4OCWL 5H2BB 5F72S 3KJ6L 2VDLH 4NO0B 1MLCB 3QIWC 4JANA 2V2WA 3VG0H 3P4OB 3VW3L 1I3UA 2IPTL 4DKDC 1MCCA 5TQ0L 4U0RB 5EBMB 5AYUH 2APBA <