3MCKA

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
219
structure length
219
Chain Sequence
DVMMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLEWYMQKPGQSPMLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISSVEAEDLGVFYCFQGSRVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C705 MONOCLONAL LIGHT CHAIN
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 48
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckA01
3WJLA 1W0YT 4NHCH 1D5ZA 5EZJA 1XGTA 1MCEA 4DK3A 3SEPA 4MJ2A 1MH5A 3D3VD 2V2WB 4XP5H 1S7UB 3BGFB 4LCCA 4RMQA 3O4OB 1NUFA 2BVEA 3GSOB 2FH8A 4JCLA 2OL3H 3SGEH 4H0GA 1P4IL 3VFPA 1WBZA 5IOPB 4OF0A 1KXTB 1A1MA 4ZQKA 2VE6B 3MODH 5IEHA 4MQXD 4LAJH 4PJFA 1GAFH 3RTQD 4BKLA 2YPVH 5BVJA 2XG4A 5L2KB 4JY6B 5GRZA 2DJUA 5EPMA 4MQ7A 2VXVH 4PV8A 2A74B 3DX9A 1Z0MA 3GO1H 1HEZB 1K6QL 1U8KA 3MLXH 3N85H 3V4VL 1I8IA 4WI8A 1JF5A 5HHOA 3FFCE 4TRPL 3QULB 1OSPH 2LTQB 1FNGB 3WN5B 4N8PA 5KS9A 4OD2A 3O6FB 5T3ZE 2PUQT 4L3CB 4GKOA 4LSQH 2Y06L 4LCWE 5CJQL 3IVKB 2AEPH 3H3PL 4ZXBA 2VJXA 4RDQF 1JRHL 1DFBH 4EI5C 4KU1A 1HCFX 1UYWL 4JFHE 3CZFB 2APXA 3X14A 4JHAL 5JR1L 3LKSB 4N0CC 3LN5B 4JFXA 4YHZH 3O9WC 4XNMA 4DKAA 2ICEB 2YHGA 5EUOB 1XF2A 4WEMB 3CVHB 4CN1A 3KPMA 5ISZD 2ARJB 2OJZL 3D0VA 3CJJA 4WI2A 3H2WA 1ITCA 6FABL 4D94A 5DVLA 3KJ4C 3ZT6A 1DCLA 1TVBB 3HZMB 3FHQA 3K4DA 1ES0A 3RZCC 3RVTD 1KJVA 1HKLH 4M7KL 3MLPA 5E5UB 4L4TA 5F97E 4L9LC 2RR3A 4AL8L 5GHWL 1SJEB 1U2HA 1CYGA 3LEYL 4LSUL 4HLJA 2CXGA 3KLDA 4RFEB 3I6KA 3S35X 5EN2A 3UBXA 3PDOA 4U1MA 2XICA 2VZVA 3MNWA 5T3XL 4L8SA 2NY5H 5C0AB 5D7LD 3EJJX 5DR5L 2H41A 5C0EA 2E9WA 1MFEH 2D2OA 4KJYA 4U49A 4LSRL 1YMHB 4D3CL 4MVBD 5KW9L 1GXEA 4XVSH 3BP6B 4ETYA 1A14L 3UBXI 1E6OH 5D5MB 3NZHH 4IRZH 2ZUVA 4KK5C 1Q9LB 5DRNA 1KBGL 3FQRB 3T0DA 1GZQA 4Y2DB 2P8PB 1GPOL 4PJ7B 3QEQB 1NBVL 1N4XH 2IEPA 4FG6C 2EDYA 5HDLA 5D2NB 2E5EA 4G42B 1YPZF 4R4FL 3KYMB 3QPXH 1WVZA 4P46D 1OARL 3UO1L 1FZKA 3WIFA 3JWDH 4MS8D 1A6UL 3GBNH 3SJVB 3D3VA 4KRNA 3DGGA 4HAFA 4MHHG 3ZTNL 2VIRB 1I8MA 4GRMB 5D7KE 5JXEC 3SDAC 3D87B 2IH1A 4HK3J 4LLYA 1ZTXH 5GS1C 3ZKXB 1PEWA 3R1GH 3AB0C 4G6JL 3AMKA 1E4WL 1AIFB 2KH2B 3RTQA 1QVOA 5I1DA 2BHUA 4F7PB 2MCG1 5C0NC 4LSSL 1T4KA 1ZE3C 2E7BA 4CN6A 3SOBH 2VC2H 4RGND 1KIRA 4Z0XB 3HUJA 1YY9D 2IBZY 2VXTL 1JNNH 4JKPL 1LEIA 3B2UC 1G7MB 1DE4A 1TJHH 5KSBB 3T3MF 2D0HA 3BDYH 3BIAX 3UTOA 4Z7QF 2YK1H 2VZOA 2A77H 5I73B 4FXGA 1S9YA 3WFEH 2XWTA 4MNQE 2FGWH 4GQ9L 3OXSA 1XZ0A 1KB5L 5JIKA 2NY0D 3KDMA 5L88L 1QO3B 3H7BB 3O3DA 5DF0A 1RZFH 2H3NB 4RNRA 3CGTA 3AS3A 1T7XA 2R2BA 5KBNC 4LL9A 3T0EB 5D7IE 5HYQB 1TZHA 5HTSA 4TULH 2YD6A 2OLDA 1PFCA 3VXQB 5B38B 4IRSC 5C0FA 4NYLA 5ISZA 3TO4C 1JNJA 1OTTD 1ZS8B 3NCBB 1UA6H 4X6FB 1UM5H 2ARWA 2HH0L 2J5LC 1RZKL 1J87A 1NCWH 4HGMA 1WIUA 3WUWG 1JHTB 1FGNL 5LXGL 4YDKL 4LSVL 5IMLA 2OK0H 3ARFB 2ITDB 3NFPA 4NBXB 1D6VH 4P5TC 3S35L 1H15B 3OX8B 4FQLL 4ODTH 1RZIA 2Z93B 5KVEH 4UTAH 3MNZB 4ISVB 1BBJA 4XNYH 4XCFL 3BH9B 5CZXD 4EUPB 4R9HA 2BJMH 3A0OA 4OZGE 4WVRA 1BLNB 4DN3L 2XFXB 3CC5A 2EXYD 3PHOB 4F3FB 5DA4A 4X6CB 3WIHH 1RJYA 1YZZA 5I1LA 2QR0A 2VUOA 3MZGB 1HQRA 5D7LA 5LAXA 1SBSL 3QO0B 3FN0H 2DKUA 5IBUG 1HXMA 2MWCA 3D9AH 4F15B 4YHPB 5E8PA 4LCIH 4RDQG 5H94A 4I77H 2HTKD 1ITBB 1KTDB 4DQOL 4Z76B 2JKXA 1OW0A 5I76B 1A6VL 1IM3A 2W59A 1YUHA 3QPQC 1YN6B 5C92A 4LAQL 2OS7A 4AIOA 5DDHA 3PABA 3ULVD 1R3IH 3ZZ1A 1VKXB 2K9UA 4X7SL 1QPXA 2PN5A 1TIUA 1T0NA 1LK2B 3L3IB 4P59L 2XTJD 1T21B 2FEEI 3S3PA 5JNYB 2IAND 5IHZA 4NRXB 4HT1L 3O6LL 1IFHH 1XCTB 4WWKC 3FQUB 4XCCL 4P46A 3MUGA 5EU3B 4B53A 2XWBA 2QSQA 3GGWB 4IS6A 2DI8A 2FR4B 2WBJB 4LASL 3ZO0A 4WU7B 2XZZA 4APQC 3QA3B 5C0DB 3O6KH 4KKNA 4EI5B 3FMGH 3AUVA 3IDJB 4UBDD 5DZLA 1A9EB 2HKFH 3HTLX 4TUKH 1AJ7L 1M71B 5CIPB 4TYUA 1H3TA 3MV7E 5GRXG 3KPRA 1QFOA 1I7RB 5DJ6A 3GSQB 5DMJB 3O6FD 2HA1A 3BKMH 2A6KB 4TSCH 1PAMA 4OZHA 2QSTA 5F9WC 3LH2H 5DWUH 2VMFA 3UAJC 3FO9B 2WUBL 4M3KB 3QXAA 4Q0XL 1ZANH 3O6MH 1RK1A 2Q20A 2BY2A 1JNHB 3KJ4B 1JYXA 2R39A 3P77B 2I9TB 3ZT5A 1MJ8H 2AEIT 3RZCB 3OR6A 4ZNEA 3BX7C 4L9LB 5EU4B 1E4XL 5EU5B 4JN1L 2HJLB 3X3GL 1GC1L 4OUUB 1N7ML 3DHJA 5IFJA 5F9AC 4POZD 1KN4L 1WAAE 4MZ3A 3P73A 4ESKA 2X44D 4QXTB 5I1GL 4Z18A 4EBQL 5J1TC 5LCVH 1CICB 3F7YB 3G04A 1MJ7H 3MRHA 3QISA 1Z9MA 3TBTA 4TUJA 2VH5H 1MCOL 1X4ZA 1NDMB 1A4KA 3DTXB 4GKZA 4PJFF 1AHWA 2GQHA 1HQ4A 5LGJA 4HZLA 3QEGL 1HIML 1G7LB 2SEBA 4PJIB 2VKWA 4JRYD 3H9HA 4JQVC 1C8PA 1ZHKB 4P2RE 1C5DB 1I75A 3QEUB 3I84A 5C0JA 3QHZH 3VXTB 4N0YL 4OAWA 5C0AD 3KAAA 2WK2A 1UG9A 1CCZA 3DI2B 1J1PH 1TQCC 1PYWB 4YHYC 3GMOB 3G6AA 1ZLSH 3ARTA 4YBLC 1AR1C 3AMLA 2XV6B 3WE6B 2UWEA 5KS9F 5F70A 2VL5A 4HWBH 1KB5B 2ZSVA 1JNLH 1BF2A 1JGUL 1NMAL 4MD5A 4QRUB 5B39A 1F8TH 1I8LC 1L4IA 2BY3A 3HNTL 3FTGB 3UTZB 1PJ9A 3PGCB 5E6IB 4OM1L 2N4IA 2ZSWA 5ID1B 1XGYH 3LS5L 4BZ1H 2NY4D 3MYZA 1ZV5A 4MAYC 4FXKA 4ODSH 2QQQA 4PJEE 2LFGA 1L9NA 4NQEE 4AZ8A 5L2JB 5F7HA 4X99A 3U7YH 4Z7WB 3F7VA 2C4FT 2X9YA 5IQ9A 3S98A 3PWJA 2ICES 4YXKL 5IBLD 2I25N 3T1FB 1FGVL 2B5IC 1WWWX 2AI0L 4BM7A 1MCBA 1UZ6E 1OGTA 2GK2A 3OAUH 2O5YL 3ROLA 4TVPH 4MLSA 3GSOA 5FDWB 2EC9U 2IANA 3TFKC 5BS0E 5DUPL 5HHME 2GFBB 5J9PA 5HPOA 5IOPA 3MRBB 4LLMB 2ZCHL 4J3SA 4LP4A 2VE6A 3N1FC 5L0QC 2E7LC 5T33H 1KJMA 2LU7A 1B90A 3IRZA 5DVMA 1MUJB 4JY6A 2XA8H 4XPGH 3RWCB 3OXRB 1J1OL 4M7LH 4HWUA 2A74A 4I9WE 2CGRH 3D85B 4PBVC 3CX5K 4NC1C 4DGVH 1JE6A 1BD2B 2UY6A 2HT2D 3QULA 5DJ2B 1MAMH 4DVBB 2VDRH 2R9HD 2XXCB 5TE7H 1NPUA 4IOSD 3WN5A 1QLRB 3VGEA 5J11C 4HXAH 3I02B 2RCSH 3O6FA 4FQXC 4PD4J 4IRSB 2GJ6B 3RNKB 2D31A 2WMPA 3TO4B 4L3CA 3HPJB 3C6SB 5MENB 4PJXE 2VLMD 3ECBB 3TJEL 3N9GL 4XP6L 2K3TA 3NGBB 4KZDL 3O4LB 1KTLA 5E1HB 4CVXB 1JTOA 2MHAB 4LEXH 5FM8A 3CZFA 3RWEB 4HUVB 4H0IA 1MF2H 3LKSA 1A3LH 1HH9B 1WV7T 3X13B 4GW1B 4ZS6D 4ELMB 2ICEA 3JTTB 4NO0D 3RAJL 4M6AA 3CVHA 5DMKB 1I9IL 4Z7OF 2ARJA 3TBSA 1FQ9C 3B4NA 3NA9H 4FQQB 4Y19D 3TH4T 2DQEL 4PYGA 4Z77A 3DX6A 3ZDXE 2HTLC 5DSCA 4MGXA 1TVBA 2OP4L 5E1AB 1G6RB 1TJGH 2X4PB 1I3GL 2XYCA 3PWNB 3Q5YA 4FFZL 5E2TL 5FA4B 4RISH 5TF1L 4KHXH 1T80A 3QQNA 4N5EC 1SJEA 1VEPA 3WBDA 3NFSL 4YHOL 4RFEA 4DK6A 5JW4N 4JRYA 9CGTA 3FQNB 3HUJF 1JHKH 5C0AA 3N1QC 4L9DA 1JZ8A 2AJYL 4I13B 5KVFL 3BN9D 3OJVC 1YMHA 2BC4B 5DUBB 1RIUL 1FH5L 2H45A 4APQB 5LVEA 2D7OA 4QHUB 1GGCL 3SGJA 5CGMA 5I71C 3VFTA 5D5MA 3J8F7 4LFHG 4UTBL 3UZVB 3UC0H 2AK1H 4KHTH 4JM4L 1Q9LA 2FX9L 1Z2KA 4HIXL 5T1DH 2WAHA 4DUVA 2XA3A 2P5WE 2P8PA 4PJ7A 1INEL 1BJ1H 2CH8A 5D2NA 3X17A 4DTGH 1FYTE 3HG1D 4N8VB 1XEDA 2IBBA 5F9WB 2Q8AL 2IMNA 5C71A 2OCFD 2QKIB 5DJYB 3LRSB 2DQTH 3SJVA 3RX7A 4ZD3H 4G80B 2Y5TB 5T3XD 5BW7C 1MHPH 3QDGB 4OGAD 5IP4A 4P23C 2VIRA 2AJVH 4Y5YB 1D9KC 4OBRA 5B4MC 2WBWB 1FNSL 2R69L 5F21B 1QBAA 1AIFA 2F58L 1X5LA 1C16A 3SBWC 2ZUQB 2ZUXA 3BT2L 4F7PA 3M8OH 2W9DL 4XBEH 4JVPA 1RIVL 1AGEA 3EYQD 3G5VB 3MA7B 5ESVA 4YHIB 4Z0XA 1QP1A 4NDMB 4QLRA 2DLFL 3FFDB 4WW2B 1JZ6A 5GRVL 1BQHA 4WU5A 4BQ6A 4AEHH 1G7MA 1BBDL 5DC9B 4OD3H 3KYKL 5KSBA 4XNQB 4BYHA 4HDIB 4NNPL 3MR9B 4JE4B 4RMWA 5HXMA 1A3RL 5D8JH 3BUTA 1J05B 5E4IA 4U3XA 3QG6B 4P99A 2EZ0C 4G7YH 2VDOH 3Q0HA 1CT8B 2X4OB 3D48R 1OAZL 2EYRA 4DZ8B 3P0GB 2ZUSA 3LIZH 1QO3A 3H7BA 4S1SH 3RBGA 4U6HA 2VXUH 4H88H 1JN6B 1YEGL 3WS6C 4PJGB 4Y1AB 3T0EA 2VLRD 2VOTA 2PO6D 5HYQA 2GTZB 1CGWA 1KPVB 1CICD 1TQCB 1ZVHA 3VG0L 5CEYB 4MX7B 4NO0A 4EIGB 4YBLB 1ORSA 1SYVB 4PJAE 4XPAH 5B38A 2VQUA 4GRLB 5B8CB 4FFYL 5IVXB 2X2YA 4X6FA 1JGLH 1KG0A 4Y19A 4D0DA 4FZ8H 3BGMB 1JHLL 3DARA 1JHTA 4PJBE 4NGHL 2ITDA 1WF5A 1G84A 7CGTA 2MPAL 4KTDH 5IB1B 1H15A 3OX8A 4UILH 4XH2B 5CEZH 1J7VR 1S78D 4MSWB 4OCLC 3MNZA 4EUPA 1W72B 2NY7L 2PYFA 7FABH 5I17B 1MHCA 2B5IB 4ODHL 1EAJA 4GXUM 5JQHC 3R06B 4TUOB 3T8XA 8FABB 3PHOA 3VE0B 1QA9B 4KKCC 3T2NH 1WGOA 1JGVL 3GHBL 3PHQA 1CD9B 1LP9E 1AH1A 3RVVC 5E6ID 1U6AH 3QO0A 1GHFL 4K8RL 5E8NB 4YHPA 3T3PE 1NANH 4XVTL 3VFOB 1KTDA 2J8OA 3D0LB 5I76A 3VXUD 3B8SA 1QR4A 1MVUB 1LEKA 1V7NL 1YN6A 1NAKH 5TPWL 2NTSP 5CZKA 1WBYB 4B41A 5C07E 2CUMA 5F89B 3IAPA 1EK3A 3DO7A 5DRZA 2FD6L 2E6QA 1LK2A 5JNYA 1T21A 1IC7L 3ULUE 5DQJB 4NRXA 5JOPE 3S34L 4NQTA 5EBGA 4X5WB 43C9A 1XCTA 2QQKL 2BNQB 3FQUA 2B1HH 4LQFL 5EU3A 3RX8A 4LHUD 2VQ1B 3GGWA 5CJOL 2R29H 5FFLA 4ZUUB 4PGBA 4WU7A 1VGKB 1TXKA 3QA3A 3WSQL 3MLYL 5HVFB 4XPBH 3HMXA 4YE4L 4IRJB 1DTUA 3KG5A 3SE4C 2XN9B 4LKCB 1BD2D 1DL7L 1M71A 3CLEH 1EAPB 2ED8A 4FP8L 3RWHB 4DN4L 4PJ5E 1I7RA 4QHKI 5EU6E 2CKBH 4OIIH 3CK0L 5E2UL 1DP0A 5HI3D 5MP6H 4NOFA 3PWUB 1CWVA 2A6KA 2P47B 3HI5L 5DHXB 3O2WL 4JHZA 5MEND 4FQJL 5LGKA 2UWEF 4KVNH 4TSBH 1BFSA 3EOAA 3UX9B 1Y18B 1A7PL 4KKLC 5CJ5A 3O4LD 4MXQD 4DKEL 3V79C 4NZJA 3P77A 5HPMA 3DBXB 4D0BB 2I9TA 5IROC 5GJTH 5FO7B 3U4AA 5C2BH 5DMGD 1KB9K 4RA3A 4LDOB 3O3EB 4MZ2A 2C3VA 5I15H 5EU5A 1A6TB 3PGFH 4Z7VB 1EMTL 2HJLA 5IB5B 1NCNA 2EKSB 3B9AA 1QOKA 4U3CA 2YKLH 3PWPB 5I18L 4JKKA 2YA1A 2XZQH 3MRMB 3ULVF 4XBPB 3LDBB 4QXTA 2VLRA 2DJ4A 2PO6A 4ODUB 1CICA 2DI7A 2F5BH 1T0PB 1CGYA 2VZUA 3RA7L 4N0RA 5ITFA 5ID0A 1RUPL 1GRWA 2FSEA 4NKDB 3JV0A 2M26A 2B4CL 3QIBC 2KZWA 4WHYG 5F71A 3ARGB 1G7LA 1HKFA 3T1WA 3BEVB 3VRIB 4LEOB 3LKOB 2XQBL 4U1KB 3B9KB 1CLOH 3QEUA 3W9EB 5SV3A 1IGCH 3VXTA 2VUYA 4M6MH 5IHBA 5E08H 4UV7H 3WE6A 3VFUA 1IAKB 2H2SC 3EYSL 4WHTA 1NSNH 1KB5A 1TFHA 3CVIL 3B5HA 4GMTL 4C56E 4LPUA 1U3HB 3OMZA 4K71C 5E6IA 4FABL 5F7LB 4P3WA 1NBYB 3S37L 4IJ3C 3BP4A 1A7RL 1J0KA 5L7XL 1FDLH 5I75C 1FNFA 2GAZB 2QSCH 4RWHA 1VEOA 4U1JB 5L2JA 2NZ9C 3VXUA 4Z7WA 1CGSH 3DX8B 1LK3H 4ODVH 5JLZA 2XPGB 3T1FA 4G8FA 2WNGA 1H3WM 5I9QB 3DMMC 5F7UA 5HI4C 5CJXA 3H9ZA 3WDHA 1Z3GL 3GK8L 3GSRB 4EN3B 1G7IA 1UCBH 1EO8L 1FC2D 4PTUA 2HT3C 5EBLB 5FDWA 1MPAH 3QDGD 3K2UL 2ZCKH 1AXIB 1P53A 1QFWL 3OBAA 1INDL 3QXTA 1RUAL 3MRBA 4LLMA 4OZ4A 2AXGA 2J8UB 4LHUA 2C3WA 1FZJB 2OSLB 1MUJA 3KR3L 4Y8DC 2FECI 3TT3L 4LPXA 4JFPB 4JJ5B 2PW1B 4LLQB 4AEIH 4HCRL 3X12B 3C2AL 3QIWB 2VR4A 1BD2A 2X4RA 5DJ2A 3VFGL 1F13A 4DVBA 3SGDH 4PRPB 5I2IA 4ZUVA 3WFBL 3ZYZA 2I5YL 3I02A 4LVHB 5IIEB 3RNKA 5EU7E 4NKOB 5I1HL 3UJIH 4WO4C 2VDMH 3C6SA 5MENA 3QNYB 3ECBA 3I6GB 4GSDH 2LQRA 2NPLX 3IDXH 4A6YL 3DYPA 5IT2L 3O4LA 1IEBB 4PGJA 4WI7A 2Y36H 4NKIH 2D7PA 3AS1A 4XWOD 15C8H 1EXUA 1NH6A 4ZPTB 1HH9A 4J1UB 3UTPE 2IFFL 2NW3B 3X13A 2IBGA 4PJ7F 2FO4A 4GW1A 1KSRA 4XMPL 3PJSA 2LAGB 1RULH 3JTTA 4P3CH 5F44A 4MAUL 3SO3B 1RJLA 5DMKA 3N06B 4NWTH 3EGSB 1FIGL 4PLOB 3L1OH 4FQQA 2F54B 1A21A 3QUXD 1P4LA 3E3QE 5E1AA 4WV1C 1CLCA 5D2LB 2X4PA 1S5IL 3PWNA 1TCRB 3LS4L 1RUKH 1QR1B 4XP4L 3ULUH 5FA4A 3HC3L 4F7TB 5DD0H 2EDFA 4WTWA 2G9HB 2QADC 4Q9QH 2J4WH 5FCUL 1IM9D 2Y7QB 2P5ED 2EEAA 3STZB 4KQ3L 4KMTL 5EFIB 3FQNA 5D70L 3WFHA 4P3DB 2PXYB 3MLWL 4QRQA 3CFEB 4RFNC 4F7EB 1P7KB 5BVPL 2YUZA 4U6TA 5KSBF 3C9NB 4XCYB 1WQVT 1T3FB 1G7QB 3NZ8B 5DUBA 2V5YA 3VJ6B 3WDIA 4ZO7A 1P7HL 5FV2A 3PF2A 3MRNB 4K3DL 1XIWD 4D9RE 3UPCA 4JY4B 1K8IA 1CXIA 1RJCA 3FN9A 3BHBB 3RIFF 3VWKB 2YWYA 3SY0B 4BQ9A 4QTIH 1UACL 3IDYB 2X5PA 2FJGB 2BNQD 4N8VA 1YYLH 2VZ3A 2A6JB 3LHPH 4LARH 2V5MA 4HJJH 4XI5D 3IJYA 2QKIA 4XX1G 2BVQB 3LRSA 5J06A 3TT1L 4F33A 5HYSA 2Y5TA 5GS3A 5E00A 1PKQE 1WFNA 3QDGA 1CQYA 3JUZA 1JPFB 4Y5YA 2EDNA 4H8WL 4IRJD 3NH7H 3NIFE 2XN9D 3BRGC 3KS0H 5HBBA 1FVEB 2VAJA 1QSFB 1X5IA 3CSPA 4C4KT 1YEDB 3LQAH 1N59B 2ZKHL 1PD6A 4JRXB 5KJRH 5JMRA 1IGML 4WI9A 5CEXB 1TJIH 5EO1B 3AGVA 3RWIB 3G5VA 4YHIA 1G1YA 3DV4B 3QQ3B 3U0PB 3ZL4L 2BFVH 1OP3K 3FFDA 4HXBH 3REVB 1BZ7B 3NOIA 4YPGB 3F65A 4KUZH 4JCMA 1CF8L 4HDIA 5CZVH 5L9DH 1KXQE 2FL5B 1OTUD 5GGVH 5TE4H 2DDQL 1JGDA 1YPZE 2CRMA 1J05A 1V7MH 3QG6A 3BPCA 3KPPA 3GI8H 5D7IB 1MNUH 2FH6A 4WI3A 2X4OA 3DIFA 1A7QL 1BJMA 1DUYB 4Y5XC 5FYJU 4DZ8A 1F11A 1I9JL 4ZOBA 4JPIB 4HS3A 1L7TH 3PWPD 1YEHH 5E5MB 4ZFGL 4M7LT 2FCBA 1JN6A 1XF3B 1XF5B 3W9DA 1BP3B 4FQ2H 1KCVL 2W65B 3WL9B 5MEOB 2GTZA 1DR9A 1KPVA 1KTKE 5DS8B 4MX7A 1HHIB 5B8CA 4X9FA 1YEJL 4NRYA 2WWMC 4LVNC 3HB3C 2DQIL 3WXWH 4XZUB 3BGMA 3QUXA 4CMMB 4PRNB 3ARGD 5F9JB 4H25B 3T3ME 3B9KD 5I75B 1LD9B 1CGTA 3A67L 4XH2A 3T0AA 4Z7QE 5DTFB 4LOUD 4MJ6A 4UOJA 1NGQH 3QZWB 1FHGA 3V0AC 5IWLC 3MMEB 5I17A 1IM9A 1K3ZA 2A0LC 2P5EA 4A6YB 4RGOL 1AGFB 2DKSA 4TUOA 8FABA 1X5FA 2DQHL 5KVDH 3VE0A 4P4KC 5JW4M 2X4QB 2V5SA 5E9DB 1BM3H 4PP1C 4FRWA 4M7ZC 1Z5LA 1U3HD 2HT4C 4ZFOL 4K23H 1JUFB 1BZQK 1IAOB 3WS3B 5INCA 5TQ0L 3RFZC 2IBZX 2X7LB 4OUOA 4LIQH 4XBGA 2DM2A 3IDIB 3KHOA 4YR6B 5F6HJ 1UKTA 3S7GA 4XC3H 3QCVH 4F58H 3QI9C 5D7SL 1XIWA 1MVUA 5EWIH 2VR9A 4KH2A 5JO5B 1WBYA 4K7FB 4K9EL 1OF2B 4X83A 5F89A 1DBBL 1G9MH 3ARDD 4H1LH 4EN3D 3L9RA 1A7OL 5ACZA 4ZMAT 2C5DC 4YEEA 5DQJA 3FQXB 3KPLB 5IV2B 2BCKA 5IFHL 5BRZB 2G2RB 2BNQA 1NEUA 4CMHB 5CP7B 1YY8B 1Q8MA 2VQ1A 1N64L 3MV7B 1C5CL 1HN1A 5CGYC 4Y0GA 1LO3H 1VGKA 2AQ2A 1NCDL 1LVEA 5CILL 4GKNB 1BVKB 2NYYC 2AK4B 1VPOH 1SY6H 3BEWB 3D1MC 2C1PB 2NY2C 3WLWD 1V8HA 4IRJA 4K8RD 3BN3B 3QIWD 2XN9A 4WWID 1M05B 3MLRH 4LKCA 1OP5H 1I4FB 2J88L 4ALAH 1EAPA 1U95B 4P48A 2AEWA 4PRPD 3S36H 4Y5VB 4X4MA 5J3HD 1F42A 2DQJL 1N6UA 3H42L 4GBXC 4HEME 3PWUA 4LLVA 1NEZG 3THML 1HSAB 1HNFA 3G6DL 5EBMB 5FYJH 1BQHG 2W91A 5E2VH 3TA3D 1GGBH 1Y18A 1TLKA 2PF6A 3TBVB 1MQKH 5IB2B 3LZFH 1WZMA 4MJIE 1FO0L 3DBXA 5KZCB 4WV1B 4D0BA 2UVEA 4Z95H 5FO7A 5EIIB 4UOW1 4Y4FB 3EYVB 3JV4A 3O3EA 3JTSA 2W07A 1A6TA 2XKNB 4Z7VA 4Z7WF 3IFPA 2CJUH 4LRIC 2OTUB 2EKSA 4ZUSA 5IB5A 5A16B 4P2QD 3BO8B 3ZKMC 5DD1L 3X3FL 3CDGB 3PWPA 1BIIB 1C08A 1FG2B 1MCKA 2E9JA 4LLAA 3L5HA 3TJHC 2F54D 3RKDD 4D0CB 3UDWC 4XBPA 1AD9B 2KQMA 4ODUA 4M02A 4HPYL 1F4AA 4RFNB 4NQXA 2Y6SC 2BSRB 4IDJH 3PP4L 3E8UH 4P2RB 4LNRB 4NQSB 1UEYA 3SE8H 5GRJH 1YEKH 4J4PC 4NKDA 1QEWA 5DZOA 2OI9B 1H3VA 2V17L 3ARGA 1B2WH 5I74C 3BEVA 3VRIA 3MGTB 4LEOA 3B9KA 1FL3B 5CUSH 4JKMA 2PXYD 3B83A 1VA9A 1D5IL 1N2RB 3QCUH 5D6DC 4W81A 1JV5B 3WNOA 4NQUA 1YECL 4PJEB 2WWKT 2JJTC 4NQEB 3AAZB 3LQZB 1KLFA 1V3KA 4XHJD 1O7SA 1Z9OA 2CIKA 3K3QA 1R5WA 1U3HA 5LBSL 1KLGA 3WFCL 1NBYA 1A6WH 5IB4B 4N68A 4HBCH 4M62H 1KJ2B 5F3HB 4YFEA 5GISH 3VWKD 1IAII 4U1JA 3VGDA 1CFQB 4BFGA 1J1XL 3DX8A 2XPGA 3QUYB 1HINH 2WIMA 3O3UN 1F4HA 5HHMB 1ZLUK 3VXRB 4MWFA 3A6CH 5FCSH 2O5ZL 4PJFE 3D25B 2HJFA 3ARDA 4KVCH 1ZA6B 3GSRA 4EN3A 1FNEA 1HDMB 3I85A 1G7PA 4X4XB 2VB5A 5EBLA 3LPGA 4X9IA 5E8OB 5DFWH 4X80L 2C26A 1G9NH 1TNMA 5HHOE 4EDWL 2J8UA 2BDNL 1HWGB 1QSFD 4Z8FL 1QBLL 2ZJSL 1IC4L 1IZKA 3UZEA 1FZJA 4JRXD 4YHLH 1UWEL 5KS9E 2OSLA 2PCPB 3ULUC 1T1ZB 4I0PD 3MLTB 4BH7A 4YXLH 2BVPB 3GKWL 1II4E 3HI6L 4PJ8B 4XMKL 5AWNL 4F7CB 2ZUTA 3U9PL 4ZFOB 4JFPA 4JJ5A 2IG2H 1T1WB 2PW1A 4O2FB 3B8YA 1NAMH 3QIWA 2JLLA 3UZQA 3O8XC 1BAFH 4RBPK 2A6DB 4PRPA 1YMMD 4G6KH 4CKVX 3MXVL 2DRUA 4P9HC 5KSAC 1MRDH 3BP5A 4HQQH 4NKOA 3EO1B 1N8ZA 1ZLVK 4N9GB 3QNYA 1GGYA 4ZFZA 1WLHA 3NCJH 5IFAL 3ILQD 3K7UA 2NZIA 2WBKA 1IEBA 4XNZC 1Q9KB 1KCKA 2NW2A 4XT1C 4X7EC 3OKLB 1NGXB 3RIAK 1U8PA 4J1UA 4GW4B 4XPTL 4KAQL 5DUMH 2Z8RA 2UZIL 4KJWC 2I24N 2O61A 2YA0A 2A2QT 3PG2A 2OXHA 4IIQA 3GHEH 5GGRY 4P2QA 4M1GL 4L4TE 5EZIH 3EGSA 4R26H 5TF0A 2CSPA 2F54A 4M7ZB 1HHHA 1KC5H 1S3KL 2GSGB 5AZEH 1CFVL 1EBPA 3C8DA 4FZEL 4NHUB 3C6LC 4LHQB 1OAYL 4OQ1A 2IWGA 3NA4A 2W9EL 3V5KB 5D2LA 12E8H 1TCRA 2LE9A 3E2HC 4HJGB 1SYSA 1QR1A 1NL0L 5HYJD 4YX2L 2NXZC 5I1EL 3MBEB 2XY1A 4UQ3B 5GGVY 5I8CB 4JANB 2G9HA 5ENWB 3VFVA 4OFVA 2Y7QA 4NM8H 4IOFC 5I1IL 4W6WB 3STZA 4V1DD 5EFIA 2BOCB 1FO0B 1IE5A 4HS8L 2FX7H 2O5XH 5E9DD 5EDXA 3BMWA 3GSNL 4M6NH 4P3DA 5IF0B 3V6OA 2PXYA 4QEGA 1JZ7A 3Q6GL 2V5RA 2AV1B 1P7KA 5FECB 4XCYA 2P5WB 2X4TB 3MRKB 1G7QA 1R3LB 3MJ7B 2EDTA 2GT9B 5EC2B 3ALPA 2RJMA 2JF1A 3VJ6A 4NHCL 3QDMB 5DD3H 3EDJA 2H2PC 2WIIB 4Z7OE 1X7QB 5SWSB 4XP5L 4JDZB 4L8DA 5GSRB 1N6VA 2XT1B 5DJ8B 2H9GB 2DI9A 4O51A 3D3VE 2DLHA 3EUUA 3BHBA 3VWKA 3U30C 3SY0A 4PJCB 4L5FL 2JIXB 1FL6B 3MODL 1CDUA 3OKDB 1GAFL 1NGWB 2YPVL 2FJGA 3HE6D 5BRZD 3S5LA 3W81A 4JREC 2A6JA 2VXVL 1TETL 1ZWIB 4G8IB 4OV6F 3FB7A 3MLXL 4PLKC 1RD6A 2AK4D 3I2CH 5DHVA 3UXFA 1OSPL 3FZUD 3O11B 3HUJE 1JPFA 4LHUG 1SVZA 3MRFB 1FVEA 4N5UA 1QSFA 1YEDA 5C3LD 4M7JH 4QKXB 4JRXA 4I0PA 1TITA 2FIRT 4F9LA 2AEPL 5HI5D 3RWIA 2X09A 5CJ8A 3V4PH 1DFBL 2PTTA 3U0PA 3PIQB 3REVA 1BZ7A 2VDNH 1YMMA 1YYMH 5TH2A 2C1OA 5H2BB 4YHZL 3G6JA 4XMLL 4LVOC 3MLSL 2Z31D 1E4KC 1U9KA 5DK0B 1M7IB 2AS5M 4TN9A 2R0ZL 1FPTH 3TYGH 4X4YA 3MYJB 3IETA 1DUYA 1T1XB 1U92A 2MQ3A 4PJAB 4JDVA 5EU7C 5ISZE 1OPGH 3HE7C 2YXMA 4HIEA 4JPIA 5HVHC 5IVNA 1MFAH 4AEEA 3OKNA 1WFTA 2P7TB 2EE6A 1XF5A 1G9MC 3HNSH 2A38A 3BXNB 5DK3A 4PJBB 3TV3H 1KPUB 3WL9A 2W65A 3ARPA 3T2OA 3EOTH 4KUCF 1HHIA 4CL7A 3KLSA 3ULSB 4K94H 2QTEA 4NN6B 4O5LH 5A3IC 1G7HB 1T89A 4HCRA 4OLVH 4M4PA 3RUGB 2CPCA 5BMFH 1HHGB 3P4OB 4NKMB 4CMMA 4PRNA 3I75B 2NY5L 5I8KH 2YXFA 1U8IA 3K80A 5D7LE 3IB4A 4AT6A 1ZKAA 4Q97A 3EDDA 5HYJA 5ESAB 3P11H 4XVSL 3R4DA 1MY5A 3AVEA 4PREB 4Q2ZB 3E3QC 3MMEA 2NR6C 4A6YA 1E6OL 1BREA 4U7KA 1AGFA 2IAMC 3NZHL 4V1DA 4IRZL 5JHLH 5D93C 2BSED 4G8GD 4PJ9C 4UIKH 3PV6B 5E9DA 5BOPA 3TWCH 1M7XA 1PQZA 1B6DA 3DX7B 1QNZH 3DNKA 1IAOA 1S9WB 1TTGA 4G5ZL 5LWYH 4R7NB 2RHEA 2X7LA 4LLDB 3K2MC 4LK4A 3L3DB 1OTSC 4YR6A 3QPXL 4I18C 2C9AA 5SX5K 3MUZ1 4PS4H 3JWDL 3UROR 3QUYD 2X1OA 2H32H 3FO2B 3VXRD 3GBNL 8CGTA 5JW5A 1KFAH 4Z7VF 5JO5A 4E0RB 4PGCA 5M95B 3MCKB 4GLRI 4HWEH 3EDKA 3B43A 1SBBA 1ZTXL 3R1GL 4WNQB 5DJCB 3FQXA 3KPLA 5IV2A 2Z8SA 1I85C 5KSAB 1F6AB 4YDVA 3HE6A 2IQAB 5BRZA 5BV7H 3NAAH 4F9PC 3KPRE 4JFDB 2VC2L 4PJ5B 3SOBL 5HYSG 3TN0C 3DURB 5EU6B 5IM7A 2DBLH 4GKNA 5T5NF 5CD3B 2AK4A 1JNNL 3GSNB 1YEEL 4OZHE 4RGNE 3HAEH 1XCQB 2M1KA 1TJHL 2C1PA 4C4KO 4ZODA 3BDYL 1K8DB 2VXQH 3VGAC 4PYHA 4L4VB 1EVTC 1U95A 2A77L 4Y5VA 3JWNC 4NPYB 3GI9H 3NFNB 3DI3B 3WFEL 4ZNEE 2AJ3A 4Y7MA 2FGWL 2E9IA 4WEBH 1HSAA 5EBMA 3BUYB 5ILTH 1K3IA 3WIIH 4WFHE 5CSZA 1RZFL 3RNQA 4QY8B 3TBVA 5IB2A 3UP1A 3VDAA 3QQ9C 4YO0A 1WTLA 2KKQA 2D9CA 4TULL 3HS0B 2Z31A 1IKNA 2V2TB 3K4AA 2F9BT 4Y4FA 3EYVA 2NXZB 4U0RB 4OLEA 2XKNA 1UA6L 5E24E 1UM5L 1F4YH 2JJSA 5JW4R 5JDSB 5A16A 1NCWL 1AE6H 3BO8A 1OOAA 4ZTOL 4U1LB 1BIIA 2LU4A 4U7SA 2OK0L 1FG2A 1EEZB 4Z0BH 3MROB 1D6VL 3SKOA 4LPVA 4ODTL 5HGAB 4ZAKB 5KVEL 4CVUA 4LF3B 1ZVYA 2ZWLT 4XNYL 1UEMA 5HGBB 4LNRA 1L9MA 5AYQA 2BNRD 2BJML 2DL2A 3S4SG 4NQSA 4J8RA 5F7DA 2J8UF 1A1NB 3MBED 2VO5A 3W2DL 3WIHL 3WKMH 3ME0A 2UWEE 5AD0B 4FG6D 5K9QI 3MO1A 1CGUA 1UT9A 3FN0L 3MGTA 2L7JA 4AH2B 1AP2B 3D9AL 1A1OA 1FL3A 4LCIL 3U30B 1U93A 4I77L 5LG1A 5C7XH 3LKRB 1N2RA 4CUCA 1TZGH 4URTB 2ZG3A 1JV5A 1CS6A 1P6FA 4X9BA 5IJKC 1RZJC 2GHWB 4MNGA 3AAZA 4JFZH 4G8GA 4NNYB 3QDMD 3QDJB 3NABH 5F7FA 4HLZH 5JXED 1R3IL 3QEHB 2Q8BH 2A1WH 3SDAD 2YD1A 2ARJQ 5SWSD 3TBWB 2XACC 1IJ9A 5DRXB 3ULVE 3V52H 3VH8A 1EEUA 2I27N 1KJ2A 2EDLA 5EA0H 1CFBA 1IFHL 1XF1A 4RMRA 5ALCH 4HX1B 3V4UL 1CFQA 2XTJE 2IANE 2JIXD 3QUYA 3VXRA 2OR8A 4JFQA 2VZTA 2CR3A 3O6KL 4JFEB 4ZOCA 3D25A 3FMGL 2YR3A 1WICA 1ZA6A 5AUMA 2ZNXA 3GKZA 4F37F 2HKFL 1EERB 1HDMA 5K9KB 2VDLH 1JWMB 4FFVD 4X4XA 1KCRH 1A64A 3HRPA 1KACB 1QSED 1INQB 4X9GA 1QTYT 3BKML 4G6MH 5D2LF 1A2YB 4TSCL 5F7KC 1J8HD 1N6QL 2PCPA 1T1ZA 3LH2L 3MLTA 4RX4D 5DWUL 2AV7B 2C7UA 3LV3A 35C8H 3B9DA 4F7CA 3HE7B 1ZANL 1E6JH 3K8LA 3O6ML 4ZFOA 4O2FA 4HKJA 5HVHB 2I07B 5JORB 1G0YR 3ZKNC 1MJ8L 1VADB 5E94A 1LHZA 4NZUH 2A6DA 1DQMH 1JK8A 4D9QE 2P8MA 5C08D 1MCWW 5JOEA 4IOIB 3EIFA 3EO1A 5HHXH 3DYMA 2EH8H 3QRGH 4N9GA 3RX5A 4HLZG 3WUWB 1EO7A 4GOSA 5FUOH 5KN5A 1QLEH 5DQ9B 1MAKA 2Y07H 5CLWA 1Q9KA 3VMOA 1IAIM 2BHZA 5LCVL 3OKLA 1Y6NR 1P4BH 1NGXA 5J13B 4NRZB 3QDHA 1KB9J 4GW4A 3T0WA 4NQCD 3QDAA 1MJ7L 2V2XB 3U9UA 3PXHA 3NN8A 5JW4Q 5FHBH 2YPKB 3G5YA 5F88B 4EKXA 2P8LA 2IAMB 2YSSA 5C3TA 3KGRA 3LB6C 3TBYB 1I1AC 1PY4A 2GSGA 5IBUB 1HSBB 1FLRH 3P0VH 2JK5A 4NFBA 3QHZL 4JRYE 1WZKA 3V5KA 5I1AA 1J1PL 3QPQD 2BNRA 5FYLH 5J4MA 5KVGL 4HJGA 4PB9H 1FBIL 5ACMA 1ZLSL 5C0AE 3HR5B 1JPSH 4HWBL 3MBEA 1DEEB 4HUKB 1FVCB 1JNLL 2G5BB 5ENWA 1OLZA 5L8JB 4JJHA 3MV11 1ZHLA 3KWWB 3OF6A 4KK9D 4C59B 4HUXA 4N9OB 3DSFL 2BOCA 1XGYL 1FO0A 1DBMH 3IU3B 4BZ1L 4F80A 4P57B 2NY1C 5D5ME 5IF0A 4ODSL 2VN7A 4MLIA 4K3EL 4JPVH 2WWKO 5D72H 3U7YL 3DETD 2AV1A 3SE3A 4PJDB 2VXSH 5FECA 5BJTA 2X4TA 3MRKA 4PJ7E 5HHQB 2GT9A 3G6JF 3G9AB 5D2NE 1U8OB 1PG7X 3QDMA 5JXEA 1EEQA 3F8UB 4I3GA 2NXYB 3C2SA 2WIIA 3DUSA 1X7QA 4Z7UA 5SWSA 3OAUL 4PGDB 3NIGF 2CK2A 5CP3A 4JDZA 4TVPL 4U2ZA 5DJ8A 4MMXC 3VDBA 1LO0H 3SJVE 1ERNA 5TJWK 3VGAB 3WJLC 1V3LA 3GB7B 4PJCA 4UT6L 2JIXA 1FL6A 3OKDA 2BRQA 5T33L 5HYIA 1KELH 1NGPH 1CZ8H 4XPGL 4DOHE 1SM3H 1H9VA 3OJDA 4LCCC 4M7LL 5CBEA 4JFDD 1ZWIA 4G8IA 2CGRL 3GSXB 4DGVL 3VGHA 4NNXB 1WEJH 1MAML 3MV9B 2VDRL 5FYKL 3O11A 5TE7L 3HC4H 1QSEA 1S7QB 2V7HB 4HXAL 3MRFA 3EYUH 2RCSL 3IDGB 3E6FB 4L4VD 5KSBE 1J8HA 1I9RH 4FS0A 4XPHH 2DIJA 3RU8H 4UDUB 4O02H 4NOBA 1EJ6A 1X5KA 5F1NB 3B9VA 1C5BH 2ATKB 4NIKB 1YPZB 1AQKL 4LSPH 3CFCH 1WIPA 4JGUA 1RU9H 1AKJB 5I1JH 1MF2L 1A3LL 2APVA 5H2BA 1CDCA 4OLXH 5ICYB 4JQXA 1XR9B 2M2DA 4IBLT 1NKOA 5C08A 1RJZB 4ZXBC 1D7FA 5DK0A 3T0EE 5IG7A 1M7IA 4MNHB 2QSVA 1X5AA 3NA9L 5GGSB 1T66D 2NLJA 5F7EH 3DSNA 3DVGB 3C5JA 1XGUB 4LBEA 3S96B 5MERB 4X5LA 4IM8A 4Y19E 2P7TA 3K74B 1HHKB 1R3HA 3PL6B 4NQCA 3ULVH 4ZAKD 4RISL 2IADB 3KPSD 4BH8B 1BQLH 4OGYH 2WANA 3ULSA 3ARQA 5GQBA 2CLRA 1G7HA 4MAYD 3RUGA 2HFTA 2GJJA 3JZ7A 3P4OA 3B2VH 2GK0A 4CU6A 5F7WC 2DQGH 3LPWA 1JHKL 4PR5B 3AREB 4Y4HB 4WTZA 5GGUB 5F3BB 2X4UB 1FNLA 5ESAA 4L4JA 1RV6X 4PREA 4Q2ZA 4XVJH 1NUDA 1U8HB 2WUCH 4L8SC 4HWNA 3UC0L 2AK1L 4C58B 3PV6A 3QDJD 4O2CB 3TP4A 4DAGL 5T1DL 4F8TA 3MXWL 3DX7A 3MGOB 4RQQB 1QRKA 5F96H 3G5XB 4HK0A 4R7NA 4LLDA 5CINL 1FFQA 1MQ8A 1XH3B 4U6VH 3L3DA 1A8JH 5D96B 1MRCH 3BKCH 4PY7B 2AJUH 3BJ91 2J8HA 4YDLC 2DQTL 3GMQA 3FRUB 4DWHA 2GJZB 4JFED 4WTXA 4I8DA 1MHPL 3WDJA 2XIDA 2AJVL 3V95A 3HCVB 4KROD 3CVHH 3RJQB 3P0YH 5T3XE 2EIZB 4WNQA 5DJCA 3S5LG 5ETUB 4ONHB 3CPLB 4OD1L 3WEXB 3HPLA 4P5KB 2LAAA 5H37H 3M8OL 4XBEL 1WC7A 4UT9L 5DJZB 2BMKB 1QFWM 4JFDA 3CUPB 4M48H 3DURA 3HKFA 1OAUH 1U3JA 1EJOH 4FFWC 5CD3A 4FQ1H 3GSNA 4AEHL 1XCQA 4MQXC 4OD3L 3RTQC 3D2UB 3HHRB 3A6BH 4UUJB 1K8DA 4UINH 4EXPX 2OZ4H 2R0LL 4WFGD 4L4VA 2B1AH 1HOCB 2XTLA 3MREB 1RURH 5D8JL 2FZ3B 4YGVB 4X6DB 4NPYA 4G7YL 2VDOL 3DUHA 3PQYB 4KJQC 3TEUA 2UYLA 2R1WA 1Q9OB 3BUYA 4KPHL 1P5VA 5DGQA 2ADIA 1S7TB 3O3BB 4S1SL 2X4NB 2VXUL 4QY8A 4H88L 2RQ8A 4I5BB 4KDTA 5JPNA 1SEQL 1ZVSA 3L7FB 3QQ4B 1CR9L 1DQJB 3HS0A 4PJHA 2JTDA 2VLRE 4XPAL 3FB5A 4K7PH 1QRND 3L3OB 1VACB 4YEFA 1JGLL 4R0LB 3FOLB 3U0TB 1UENA 4FZ8L 3P3YA 5HJ3A 4P2OB 5IMOB 4OI9A 2XOTA 2CDFB 4LGPB 4U1LA 4YDIH 3WNMA 4NBZB 4LDEB 2D7MA 4D8PA 2HFEA 1EEZA 3GZKA 3MROA 4XCNB 4KTDL 1EUUA 1RZ8A 4UILL 5CEZL 1S9VA 4ZAKA 3KPSA 3QUMB 5A40E 1M7DB 1LDPH 5I8OH 3CMOH 4QNPF 4X6BB 3UTSD 7FABL 2EE9A 3ZYOA 4UAOB 2OR9H 4GRWB 4JM2D 4ODWB 43CAA 1RI8A 2ZNWA 5FB8B 1FC1A 5F8RC 5SWQA 3ZE1F 4K3JH 3RVTC 3TNMB 1U6AL 4AH2A 5DVNA 3F12B 4RMUA 1XGQB 1MIEH 4K07A 1D5ZB 5FAAA 5GS0H 2I60H 3H0TB 1U91A 1A4JB 3RI5F 2RFXB 3SQOH 3GBML 3FCTB 1CXHA 1MH5B 3ES6A 5EIVA 1BOYA 1YJDL 1I1YA 4LCCB 1GIGH 3VXUE 4Z7WE 1NAKL 4P23D 2DYPB 1MCCA 3QDJA 1UXWA 2GIYA 2MCPH 3VFPB 1D9KD 1WBZB 5FM5O 2NXYD 4TOYH 1A1MB 1S7WB 4ZQKB 5J6GA 3TBWA 5IEHB 5DRXA 4PJFB 3V6BR 1CDBA 4R90H 1OW0C 2XNAA 4G43A 4NQVA 5EPMB 2B1HL 4HX1A 4MQ7B 4PV8B 1UH4A 3VWJD 2R29L 1FAKT 1P4IH 3MACH 4KZEH 4PG2A 5HHOB 1P84K 4MHHI 2FJFB 5ANMB 4JFEA 3VG9C 4N8CH 4XPBL 4MA8H 4FNLL 5KS9B 1CDYA 4OD2B 5K9KA 1JWMA 4MMZC 3U4BH 5E2JA 1CG9A 4P46C 3CLEL 2EZ0D 2PR4L 1K6QH 3V4VH 1YNKH 2CKBL 2Y23A 4MS8C 4OIIL 1BD2E 4ZXBB 4J3XA 4ODXB 2EYTB 4OIBA 5MP6L 1A2YA 1A47A 3TZVB 1MCIA 4KVNL 4TSBL 4R4NC 2H26A 3L3HB 4M43H 2K1MA 5MENE 2C3XA 2I07A 1FJ1B 2J12B 4QHNB 4XNMB 3NCCB 3SDDD 3UMTA 5JORA 3H3PH 4GG8A 1VADA 5GJTL 3O4LE 4ENED 5C2BL 4DZBA 1T5WB 4RGNC 1XT5A 3V0VB 1YY9C 2XZCL 3LN9A 3EHBD 1K85A 3R8BB 2CUIA 4ORGB 3V7AG 1EEYB 2YKLL 3WUWA 4ZSOB 2BVTA 1TNNA 1JYNA 2VDPH 1MCRA 5DQ9A 1AI1H 5GZND 3BFOA 4Z7UF 4KK6C 4B0MM 1LO5A 3KPTA 1KCSH 2JJUA 2F5BL 5E8DH 1FNAA 4NRZA 1QRNA 3PL6D 2QQLH 5EN2B 2NY0C 1H8OA 2FB4H 3PDOB 3M1BB 4F8QA 4PJCF 3ZT7A 2VSDA 5F88A 4O58H 1VFOA 1XF4B 4U6XB 3TBYA 3UCRA 4AL8H 5GHWH 1ZT1A 5C0EB 1NDGB 1CD0A 4CW1B 1MRFH 3BE1H 3T0VA 3NTCH 4H20H 2ZOKB 3Q1SH 3MFFB 5E4EC 4PP2B 3WHXA 2MJWA 4KQ4H 1QPPA 2D0FA 3RWGB 1IL1B 3RIFK 1UB5B 3ARED 1OSZB 5T3XH 4QHMA 4Y4HD 3UTSA 2HVJB 4W6YB 1AHWC 1EGJA 3HMXH 5E08L 1Q38A 4UV7L 3HR5A 5DHYA 1NSNL 1DEEA 4JM2A 1FVCA 5D1XD 2G5BA 1EHLH 1A6AB 5CIPH 1TVHB 2HWZH 3UYRH 1CLYH 4F7MB 1A14H 1JBJA 3F7PC 1NLBH 4YC2C 3IU3A 4JQIH 5CZXC 4YJZL 5JMOC 2IPUG 4P57A 3I3BA 3CMGA 5C0IA 4WHCA 1FDLL 5I19L 1CDIA 3WIFB 4GUPB 4GO6B 3GUTA 2EXYC 1CGSL 4ODVL 1LK3L 4QCIA 1JPTH 4PJDA 5ITBH 2BP3A 1CXKA 1GPOH 5MI0B 3D3VB 4YHMH 1UXSB 5BW7A 4P23A 3WO4C 1U8OA 4M6OH 1F97A 4LLYB 1C1EH 3VH8G 1OARH 4PGDA 1UCBL 4MA7H 3RTQB 5K33A 1MPAL 2W0KA 3T4AB 2ZCKL 5JW3H 5GZOD 4L3AA 4U1IB 3CX2A 3GB7A 4KC3B 3VWJA 3QDGE 1IMHC 3R8QA 1KIRB 3ULVC 3WIHA 4EDXB 5CMAA 2AKRB 3BGFC 3LVEA 3O4OC 2W0FB 1LILA 3TPKA 2XTJC 3GSXA 3WNKA 4AEIL 3PGDB 2J6EH 1HK6A 2BNUB 2GYSA 4NNXA 1JPGB 4FXGB 5EIQA 3RUGF 5M94B 3MV9A 5AYUH 4HUNB 1S7QA 2Z91A 4JKPH 3KLHD 5CBAB 4PRHB 5FOBB 3UJIL 5GS2H 3KDMB 4UBDC 1LGVA 4UDUA 4GSDL 1LDSA 5F1NA 3IDXL 4RNRB 2ATKA 2R2BB 4HC1A 3SDDA 3WN5C 2Y36L 4NKIL 4TVPD 4YQXH 3ZDYF 15C8L 1AKJA 3O6FC 1KB5H 3V0WH 4I2XA 4NYLB 3R0MA 4G8EB 5ICYA 1XR9A 4MDJB 4HHAA 2B39A 3QIBD 1RJZA 1RULL 4WI5A 4JFOB 1NFDB 4P3CL 1GYAA 3GRWH 4MNHA 4NWTL 1FZOB 2X42A 1FZMA 3L1OL 1NCCH 5GGSA 3DVGA 4P2OD 1XGUA 3C5SA 3S96A 2Z35B 2EDHA 1BOGB 5FYKD 1F90L 1RZKH 4OCYH 4LCYA 3BD5A 3PL6A 4JO4H 2H2SD 1RUKL 3CC5B 3JWOC 3QNXA 2IADA 1T03H 2NNAB 4POZC 5I1LB 4RMVA 2QR0B 4Q9QL 2J4WL 1BZ9A 1RUMH 1HQRB 2DM4A 3BOVA 4J3VA 5D7LB 3QRFM 1MCDA 1HXMB 4MQSB 2DM7A 4HGWB 5E8PB 2P5EE 2R23A 1QZ1A 2CDEB 1UZ8A 3BKJH 1VGEH 3P9MA 4RMSA 1MCQA 1IKFH 2ZG1A 1IM3B 3OAZK 4P5MB 3AREA 4Y4HA 3MOQA 1GVIA 2HN7A 1UADC 2C3GA 2ADJA 2X4UA 4WCYH 4DFIA 5D1XA 5DDHB 4LNVA 4O9HH 3OG4B 1D6EA 4RZCA 4K7PY 1K4CA 3VG9B 2Q6WA 2DYPD 5E2WH 4YAQB 3AROA 3TCXA 1R5VA 1NCBH 4IS6B 3MRIB 4UB0H 3G5XA 3K0WA 3DV6B 3HFML 4QTIL 1GSMA 1XH3A 1K9TA 2HLFD 3M17A 3SGJC 5MEQA 1YYLL 3IDMA 2CDGB 3LHPL 5F6IB 4LARL 4PJHF 4BSWB 4HJJL 1NKRA 3ZSSA 3DO3A 4WUUD 2BNQE 4XCCH 1QFUH 4Y2DC 4KWUA 1EFXB 2WV3A 1MCJA 4LASH 5D2NC 1WSST 5DJ6B 3HCVA 4C54A 3BYTA 1CVRA 1S7SB 5IBLC 4YGAB 1H0DA 1RSFA 3NH7L 1HXYA 4RGNB 3LQAL 5ETUA 3LKQB 4HWBA 3WEXA 5KJRL 3MQIA 2XN9E 2HRPH 1TJIL 5DJZA 1BIHA 2BMKA 3TZVD 3CUPA 4X4ME 4LPYA 3RP1A 1G6RH 1WCBB 1WITA 2BFVL 4HXBL 1SJHB 3SE9L 1G1CA 4KUZL 5CZVL 4UUJA 5L9DL 2X1XR 5GGVL 1HOCA 3MREA 5K9JH 1CFNA 1V7ML 2FZ3A 4YGVA 2YWZA 4X6DA 3GI8L 4IDLA 3TNNB 3PQYA 1KT2A 3LQMA 2HT2C 3CCHA 2R9HC 5T1KB 4JB9H 4JN1H 4Z7VE 1L7TL 3MOBH 1S7TA 3D69B 3O3BA 1YEHL 3EO0A 3QJHA 2X4NA 3G04B 3WLBA 3T04D 5JPMA 3PWPE 3TBTB 5DO2D 4FQ2L 2IALB 4QF1B 2DD8H 3QIBA 1A4KB 1DQJA 4GKZB 3MA9H 1HQ4B 1NJ9B 4HZLB 2ZUUA 4OCMC 4R7DB 1EX0A 3WXWL 3WYRA 4R0LA 4O2EA 4BQ8A 1OGAB 3W11D 4P2OA 1ED3A 5IMOA 5IMKB 1XGRA 4YC2B 3T0EC 2DIAA 5FEBA 4X8JB 4OB5H 3MLZH 3V6ZA 4HF5H 4ZS6C 4XCNA 2ZG2A 1JI2A 1N3NB 2R1XA 3N1MC 4PGZA 4P4RA 4Z78B 2XKSA 4CVWA 4J3UA 4ZOEA 1M7DA 1NGQL 4MD5B 5D4QA 5B39B 1I3RB 2Y4SA 2FHBA 2ZSWB 4JLRA 1A22B 4ODWA 3OV6A 5KVDL 5FB8A 1BM3L 3TNMA 4K23L 4X99B 5DJDB 4WTZG 3F7VB 4U4BA 4B7IA 2AJZA 5TDOB 3WD5H 1XGQA 5KOMC 4G9FD 4LIQL 1ZGLB 1YNLH 1VHPA 3QCVL 3H0TA 1A4JA 4F58L 2RFXA 1OGTB 2JJWA 3FCTA 3GJEB 3RBSA 5EWIL 3ROLB 1R3KB 2ITCA 2XTJB 2YD9A 2IANB 2DYPA 1HYRC 5J9PB 1G9ML 4KI1A 4F15C 1U8JB 1BX2B 1S7WA 3BN9C 2AI0H 2AJXH 4UIMA 3VD5A 1KJMB 4JAMA 4M3JA 5CEZD 3QH3A 3ALXA 3VGGA 3EYOB 2CXKA 1CXFA 3OB0H 4XAKD 2YPLD 1IEHA 5GRYA 4WUUA 4HK3N 3BPLB 2J8UE 2FJFA 5ANMA 4F2MA 3ARVA 1VPOL 4MA1B 1KN2H 1OAQH 2H1PH 2D31B 3MLRL 4YBQD 1F4WH 3S36L 1U3ZA 1D5MB 2WBJC 3QCTH 4JG1H 4ODXA 2EYTA 1KTLB 3LN4B 5DFVD 4PRPE 1AGDA 4PRHD 3TZVA 4OGAC 4Z5RA 5FYJL 4W6XB 5E2VL 4X7TA 1JF1B 3BJLA 1NUGA 4JM2F 5JZ7D 1GGBL 3L3HA 1RPQA 5HHNA 1MQKL 1EA9C 1FJ1A 3LZFL 1W72H 4QHNA 3TJEH 4Z95L 4LKXB 4Y4KD 3EYQC 1I3UA 1T20A 4DKFH 4JZJA 1T5WA 3HB3D 3TBSB 1KCLA 3V0VA 4YFDB 2R2HB 1M4KA 1FAIH 4Z77B 4PJDF 4ORGA 4JHWH 2V9QA 2ATPB 3DX6B 1EEYA 4YUEH 4ZSOA 2E3VA 5DSCB 5EOCJ 3RAJH 1H3UA 4BSVB 1I9IH 2ENYA 4HKBB 3O45A 3V8CA 5GGRB 2F54E 4IDJL 4GXUN 2VLLB 1T04A 3E8UL 3CD4A 4AG4H 1B3JA 2BRRH 2HFGH 3SE8L 5GRJL 4JRYB 2WSKA 2OP4H 1JFQH 3M1BA 5D2LE 2CUHA 1VFMA 5KSVA 2LV4A 2HT4D 2R0KL 1XF4A 1CL7L 3HMWH 3MGAA 5K59F 4U6XA 2PO6C 3RIAF 1YEFH 1B2WL 1NDGA 1CICC 5CHNB 4CW1A 4HIIB 2ZOKA 3MFFA 4PP2A 5JDJA 1NLDL 5CUSL 4ONFH 4JKLA 1OAKH 3RWGA 1IL1A 3QCUL 1MELA 3S8WA 1UB5A 3SPVB 1OSZA 3V6OE 2HVJA 3ESVF 3VFTB 3N1GC 3VD9A 2NY4B 2DS4A 1BJ1J 1A6AA 1TVHA 3H7LA 1RIUH 3ZKSD 4F7MA 2F19H 1S78C 4DGYH 3G9VA 1CQKA 4HBCL 1GGCH 4M62L 5E03A 2Q76A 4TTDC 4G9FA 5GISL 3EW3B 1F58H 4GUPA 5EORH 1FCGA 1FSKB 1HINL 2X89D 1INEH 1CGVA 3A6CL 1UXSA 1AFVL 5E6IC 2DWEA 4FQHA 3U1SH 4X7FC 4DOHB 1EFXD 1OQOA 1C16B 4RA0C 3WNNA 3T4AA 2E7MA 3OGCA 4U1IA 2QJDA 1YN7A 1G9NL 1E28B 1AGEB 2YPLA 4QXUL 2JE8A 5ESVB 1RZKC 1T7ZA 4LHJB 4NN7B 5CJXC 4I1NB 4S0SD 4YXLL 1BQHB 2R69H 4WU5B 1QSFE 1N5YH 4EDXA 4NC2B 2AKRA 4JRXE 5J0BA 2EE2A 2W0FA 3F7RA 4XC1H 3BT2H 2IG2L 5D1QB 3PGDA 3K1DA 1NAML 1QYGH 1M6OB 2BNUA 1JPGA 1BAFL 3ORJA 3MRPB 1NGZA 2UUDK 2VR5A 2EYRB 5CBAA 5GJSL 1YMME 4PRHA 5FOBA 4N1CA 1AD0A 3G6JE 1F4XH 4LMQE 4U6HB 1KYOJ 4FN0A 3NCJL 4G3YH 3BKYH 3BW9B 4QYOA 2D3VA 5T1KD 1TCMA 3C8KA 1F6FB 3NIGE 1IAIH 1J9CT 4NO0B 1ORSB 5HI3C 4Y4KA 1BVLB 1VERA 4G8EA 5DUML 2F5AH 2GUOA 1KG0B 4L3ED 3BAEL 4MDJA 4Y19B 4D0DB 3CH1A 3GHEL 3NGBC 4JFOA 1NFDA 2AABH 4MXQC 4PRBB 1FZOA 5EZIL 4R26L 3VG0H 1MFDH 3GMPA 4ZTPH 4JVWA 1BEYH 1KC5L 1OGAD 5B3JF 5DMGC 5AZEL 4DKDC 2X1WL 5EOQL 2Z35A 4PTTB 3LEVL 1KCUH 3QAZB 1BOGA 4YWGH 4M03A 2PYFB 4NZRH 1MHCB 2CKBA 1MFBH 12E8L 3IS1X 4JKWA 1UC6A 3QUZD 4Z9KB 3T8XB 5E99H 2NNAA 3PHQB 4HW6A 1ZHBB 3VRJA 2F74A 2PW2A 3AC0A 4NM8L 5HYJE 2N1KA 4UNUA 3RPIA 2CLZB 2DLGA 4HGWA 3LSOB 4JFFB 2O5XL 4Y16B 2CDEA 4M6NL 4V1DE 3VFSA 5JHDB 2WP3T 4GS7C 5E9DE 4P5MA 4MB3A 3KXFB 5T3ZH 1A9BA 1LEKB 4DUWA 5SX4I 2D7QA 2PNDA 4S2SA 1KJ3H 3OL2A 5DD3L 3DO7B 4C83B 4X6DF 4OF3A 3VMPA 5DRZB 3KPNA 5JUEH 1EDQA 3HG1B 4RRPA 2XQYG 5DC0A 5C07D 43C9B 4YAQA 1V7NH 5DMIH 5TPWH 3MRIA 4U33A 5GRVK 2GITB 3DV6A 4PGBB 4QHLB 3ZHDA 4OLZH 2CO7B 5DYOA 1PZUB 5JOPD 2X89A 2BX5A 1S5HB 4OZFH 3WFDL 2ED9A 2CDGA 4BSWA 4KRPD 2Z0BA 5BRZE 2QQKH 3QIUD 1B4JL 4IEFB 4M61A 1EFXA 1YDPB 3I2CL 1O7VA 4YK4B 1I3VA 4DW2H 3TESA 1FIEA 1S7SA 1IARB 2AK4E 2VNCA 3S3JA 3MLYH 3QNZA 1TQBB 2APWA 4YE4H 4M7JL 5CD5D 3LKQA 2FBJH 1I7UB 3RHWF 1ZEAH 2X70A 4R96A 3EOAB 3DYOA 1QUNA 5IKCA 3V4PL 5HPMB 5FF6A 1CE6B 4Y5YC 4QT5A 1WCBA 4GAGH 4GRWF 3K4ZA 2DWDB 1SJHA 1LNUA 5EULV 2LU3A 2VDNL 4S0TD 3VCLA 1JF6A 4CU7A 2C3VB 3T08A 3O2WH 2VLKD 1CDJA 2ZUQC 4UOW0 3MPCA 1LE9B 1NMBL 3FT2A 4CVZA 1SJXA 4N0UB 3MJ6A 3TNNA 3TYGL 3BZFB 4WW2C 4W4OC 3RVXD 2VLRB 3MLUH 3MJ9H 2PO6B 4S10A 2EH7H 5T1KA 2E7CA 3D69A 5EO0B 2WZPD 1UVQB 3HNSL 4KKAD 5ITFB 4EQ3A 3TV3L 5BOZG 5ID0B 1PDKA 2IALA 4L3EA 2FSEB 2RGSA 4QF1A 3EOTL 4IMKA 4OZFG 1AXTH 1NJ9A 4UNTA 4U7MA 1QD0A 3T2PA 4K94L 4R7DA 3HI1A 1QBBA 4XWOC 1AY1H 1OGAA 5BMFL 5IMKA 3Q5TA 4S1QH 2WM0A 2DIBA 4X8JA 4JY5H 4XAWH 5I8KL 3FT4A 1IGIH 1T2QL 1OP9A 1N3NA 2O26U 3QUZA 4M8QB 3VFUB 3TM6A 3WUZA 4GRLC 5B8CC 4WHTB 4Z78A 1S7VA 3GSUA 1UQSB 4YNYB 3P11L 2R2CA 1I3RA 3WKNA 5IMMB 3QUXC 3X11A 3BPOB 1K2DA 5TGBA 5JHLL 3BP4B 3RQ3A 4UIKL 3VXSD 3L3GB 4DJMA 4MNGE 5DJDA 3VXUB 4G8GE 4BUGA 4GMTH 4F37K 5JLZB 5TDOA 5LWYL 4TSAH 4G8FB 3MCG1 2BOBA 1KEML 1ZGLA 3O81A 4PBXA 1AO7D 4FQIH 1RFDH 3MNVA 4NJ9H 2FHFA 1H5BB 4PS4L 4RWYH 3GJEA 1SMAA 4PLKD 1G7IB 4TQEL 3EFFA 4PTUB 1R3KA 1KFAL 5I0ZA 3VXRE 4H26A 1U8JA 4HWEL 1BX2A 4OZ4B 2BVOB 2AXGB 1CFTB 3FKUS 4LHUB 2F8XC 2CO6B 4MXVF 3U0WH 1X5ZA 1UWGH 4XGZB 5I1CH 2DKMA 3EYOA 4WGWB 4KKBD 2JELH 4FXLA 1ACYH 4CN4A 1XIWC 5BV7L 2E8YA 5ICXA 4LSTH 4QNPE 3K2UH 4M5YH 3QYCA 3QIUA 5BZWA 3GJFK 1GOFA 1UJ3A 2DBLL 2X4RB 3TCLB 5GGQH 3ZE1E 5I2IB 4ZUVB 4OFKA 1VFUA 4OCRH 5D1QD 1DBAH 3QXDA 2IGFL 3QJFB 2UV3A 2VXQL 4MJ4A 1IQWH 4HCRH 4XI5C 1D5MA 3GI9L 3U7AA 1X5GA 3LN4A 4WEBL 4E41B 1JF1A 1EXUB 2ZUWA 5ILTL 4IRJC 3WIIL 1K4DB 5J56B 2VLKA 2FO4B 3HZYA 4HUWB 5A2IH 3PJSB 2ED7A 1MWAH 4LKXA 5GSVA 1RJLB 5SWZB 3QSKB 4I48B 3SDCD 2R2HA 5AEAA 1BPVA 5J1AB 5FA3A 1FFNB 1F4YL 3EO9H 4GLRH 3BQUB 1P4LB 3G5ZB 1AE6L 2ATPA 3WCYA 4XMPH 2E8ZA 1OTUC 3OG6B 4Z0BL 3ISWA 2EXWD 4GS7B 4BSVA 3LCYA 3OB8A 3Q2CA 2D03H 4HKBA 4EIZC 4EOWL 5GGRA 4YHKH 4U1HB 4Y88A 2VLLA 4UT7L 4BZYA 1FVDA 3IGAB 3DOSA 4HS6B 2Z9TA 5FYJD 2NTFA 2BNRE 2NY6D 3WFHB 2FIKB 3L5JA 4XP4H 3WKML 4QRQB 3LDBC 3ARXA 1SEBB 1RK0A 1ZHNA 5CHNA 1PSKL 4HIIA 5FCUH 2Y5EA 4JFFD 1OTSD 4Y16D 2OJEB 1LQSR 3GNML 5JHDD 1IGFH 1X5JA 4G6AD 1TZGL 3SPVA 3KXFD 4YFLF 2YOCA 3U4EB 5DT1H 3UTTD 4JFZL 1K8IB 3ARGC 2NQCA 2HJKB 1JP5A 3VXSA 3NABL 1PG7H 1CD1B 3B9KC 2A1WL 4NP4H 3QZWG 4Q9RL 4A2LA 4LOUC 3QDME 1ORQA 3CIQA 3F6LA 3MJGX 1EO5A 4R8WH 4Z7UE 5SWSE 3FHAA 5ALCL 3ILPB 2DTSA 1AO7A 3IJYB 3TN0D 4NZTH 2B0SL 3SN6N 4F33B 3QG7H 3BH8B 2ICCA 1P7QD 5HYSB 1U3HC 5E00B 4PJCE 4F57H 2QHRH 1URLA 5I6XB 2Q3AA 4WENB 3KS0J 1NFDF 1FFPB 5FGCB 2VDLL 1SHMA 1P5UA 4LU5H 1KCRL 2DJSA 2ORBH 1KIQB 3S97C 1E28A 3MZTA 3EFDH 3CFJA 3LY6A 4G6ML 5I9QC 1QSEE 3MOAH 1NEZA 3ARDC 4H8WH 4EN3C 1P84J 1U36A 35C8L 3SKMB 1J8HE 3ARRA 3QQ9D 4WFFD 1T83A 5D1QA 3W5MA 1M6OA 1JGDB 4K3HA 4NZUL 2P45B 3AM8A 1VDGA 3BPCB 3KPPB 3MRPA 1BJ8A 3ZL4H 3ZHLA 3DIFB 4S1RH 4WJ5B 4FQPA 1JYVA 5HHXL 4ERSH 3P4NA 1F11B 2EH8L 3QRGL 4HS3B 3LMJL 4X6EA 3WLWC 5C08E 4K8RC 3QIWC 3W9DB 2FEEL 1KEGH 4H1LA 5FUOL 1QLEL 3BW9A 4J23A 2Y07L 2YS4A 5IHUH 5EZLB 5J3HC 1A7QH 4LVHC 1BVLA 1P4BL 4NRYB 5BV7B 3SDCA 1MCWM 1ZSDA 4UDTB 5LKNA 3S4SB 4PFEA 3V7MA 3V8OA 4P9MH 2AAVA 4M00A 4I3SH 3QUXB 4HAGA 4NQCE 3VW3H 2YUXA 1KJ2H 3PHSA 4PRBA 2CD0A 3L7EB 1YEJH 3C5ZB 1FLRL 1XGPA 4EVNA 2QQNH 4QTHB 2EDEA 4MJ6B 1YQVH 4PTTA 32C2B 3VXMB 3IF1A 3RUGE 1TVDA 1IM9B 2P5EB 4IIQC 4RFOH 5FYLL 1GL4B 3SO3C 25C8H 4O4YH 4B5EA 3JUYA 1JPSL 3WJJA 3RKDC 1Z5LB 1ZHBA 5TDNB 2DQCL 3SKJH 5INDA 5M7QA 4GAJH 5INCB 2CLZA 3LSOA 1DBML 4JFFA 4Y16A 1ZA3B 4XBGB 3C60B 1FG9C 3BD3A 5JHDA 3ZDYE 3F7QA 2DQHH 1JRHI 4XXCA 5D72L 2WINB 4JPWL 1OCWL 1XIWB 3KXFA 2VXSL 5B22A 3VXPB 4TNVK 1MHHB 5DI8A 5KANG 3UTTA 4UI2A 5D7JB 5GIRA 4BFBD 1DN2A 2VAAB 3VA2C 4FOMA 4C83A 1RQ5A 3O2DH 3L9RB 5C6TH 4J6RL 5DD6B 3OSKA 4KDVA 3V6OC 2PXYC 4OCWH 4GXVL 5ACZB 5IGXH 3ZE0F 5HGHA 1AGBB 2X1PA 3HG1A 2BCKB 4HV8A 5A2FA 2MQ0A 2GITA 3MFGB 1TZIA 4QHLA 4XHJC 3NCYS 1OD9A 2ADFH 1P7QA 2E27L 1S5HA 1MCLA 4L29A 1NGPL 1CZ8L 4NUGL 5E6YA 2F53D 2ZCLL 3W82A 2IPUK 1T2JA 3K46A 1S9KC 1WBXA 4HSQA 2PETA 1FFOB 5AZ2H 2R15A 5BO1H 1N64H 3ARBB 3VWKC 1CVSC 1YDPA 4JFDE 1WEJL 4HPOH 1WT5A 4OCXL 1NCDH 3HC4L 3IDYC 3SCMD 2YBRB 3EYUL 4LLVB 2B4CC 1KLUA 1X9QA 4KXZI 1I9RL 1E0OB 1CL7I 1I7UA 4XPHL 4XPFL 3RU8L 2HLAB 4O02L 1JZ4A 2EIEA 5HHVH 4L4VE 1C5BL 2EDXA 3IFLL 5LQBL 4KRMB 4C55A 1X3DA 4LSPL 1CE6A 1TPXB 4E41D 2Z8VC 1EV2E 2YN5A 1RU9L 2DWDA 2HKHH 4CJ1A 2A9MH 1J5OH 3JV4B 3NPSC 1EIBA 3JTSB 1RZGA 3RRQA 3IFPB 3BWUC 1BWWA 4ZUSB 1QSVA 4F9LC 1LE9A 5SWZD 1C08B 4N0UA 3MRGB 4M1DL 5JA8B 3RY6A 5HY9B 3BZFA 4PJHE 5F7EL 3BQUD 2DB8A 4NQXB 5EO0A 4K7PX 1YEIH 3MV01 1IBGH 3N0PB 1UVQA 3S9DB 1DQDL 2R0WH 5F72S 4MXWH 5HVGB 1QEWB 3TVMB 4Y2OA 5JQ6H 3ILQC 1BQLL 5CP3H 3T4YB 1P6AB 1OM3H 3KVQA 3RI5K 1EPFA 2FJHA 4X9HA 3KPSE 3I9GH 3ETBF 3B6SA 4CNIB 1NAMA 4JDTH 3L95B 3GIZH 3B2VL 4B50A 3MSPA 2DQGL 3KLAB 1MI5D 1OB1B 5EG6C 1UB6B 4NFDA 5MHSD 4M8QA 4DEPB 1UQSA 4YNYA 3CFKB 2J2ZA 2CIKB 4MA3A 1T89C 4HD9A 1R5WB 1BFOA 4XVJL 5IMMA 5I30H 1LMKA 1KLGB 1NMCB 2EC8A 2DMBA 2WP3O 3WXVH 3L3GA 2R4RH 1N26A 1I1FA 5F96L 3QDJE 4YDJB 4NZDA 2UY7A 4MWFB 4U6VL 5LBSH 2COQA 2HJFB 3RZWA 3VRLF 1MRCL 3ARDB 3BKCL 5E6ZA 2AJUL 1H5BA 2YD4A 5F1IB 1FNEB 4WFED 4N0FA 1G7PB 4RRPG 4KMQA 1FRGH 2D0GA 1RIHL 4YXHH 1KIPB 3TYFB 2BVOA 1CFTA 2Z4QB 3CVHL 3HR6A 5IR1B 2ID5A 4JFEE 3P0YL 2Y72A 1GGUA 4XGZA 4I3RH 1MJJB 4BH7B 4JO1H 2AVGA 1AQDA 2F53A 1CE1H 5D71H 2EDQA 4X80H 1N5AA 4M48L 1Y0LA 1GH7A 3TCLA 2FRGP 1EJOL 2HP4A 4AM0A 4Z8FH 1IC4H 4FQ1L 1R0AH 1ADQH 5E8EB 3SCMA 1JZ2A 3EDFA 5GRUH 3QJFA 3OKEA 1P1ZB 4UINL 3BP5B 2OZ4L 3ARZA 4PY8I 4CMHC 2B1AL 1N8ZB 4V2BA 3M45A 3RY5A 1RURL 4ZFZB 3TA3B 1CBVH 3BD4A 3NCFB 4WFGE 3L3JB 1QBMH 5EH1A 2NW2B 3FZUC 4E41A 5L6YH 3Q3GA 1U8PB 1A0QH 3Q6FB 1K4DA 4XNUH 3EJZD 3O2VH 4HUWA 4Y5VC 2O61B 3BESR 1MREL 4IIQB 2ICWA 4P2QB 1MCFA 3D39B 5HI5C 5SWZA 1JMZA 3HLAB 3IYLW 4I48A 4K7PL 5T1MB 1A02N 5J1AA 1FFNA 1HHHB 3LD8B 1QRNE 3BQUA 3G5ZA 4XP1L 1OP3H 4PGEA 4YDIL 3BGAA 3VA6A 1ZGLM 4DGIH 3H9SD 4PY8J 1SYSB 3C5ZD 3U7WH 4Y4FC 4Z7NF 5FHAH 1Q1JH 3TPUB 4KI5D 3VXMD 1DSFH 5DXWA 5EB9A 4U1HA 1S3KH 3VFVB 2JJSC 5I8OL 3CMOL 4KFZC 4U6YB 3CFIC 1X44A 2YZ8A 1ZLWH 3IGAA 2YC1B 3QBTB 4HS6A 2W9EH 2PTUA 4X4ZA 3UTSE 1T7YA 2FIKA 4H8WC 4JRWA 1NL0H 4P9HH 1SEBA 5LGHH 3KNBB 2X6MA 1WCQA 1MI5A 5E70A 1V5JA 3GJFB 3KPQB 4J2XA 3QUKB 3MUY1 1MIEL 3C60D 2OJEA 1WFUA 5HGGS 3ZE2F 4HULB 5GS0L 2I60L 5IJVB 5GPRA 3SQOL 2EKJA 2CR6A 5EUKA 2OI9C 3U4EA 4M1CD 4L8DB 1GIGL 5D7JD 2HJKA 4PJDE 1E4XI 4O51B 2MCPL 5ICZB 5EZOL 1CD1A 3EOYG 4TOYL 1W8OA 2ICWJ 4HH9B 3BSZH 1M1SA 1Z6JT 4R90L 1TTFA 3S5LB 3NPZB 3IAGC 3ILPA 3FB8A 1W0WB 3MACL 3B5GA 1GOHA 1F02I 1YNTB 3BH8A 4WI6A 3FB7B 5K93A 3S6CA 4E5XB 4KZEL 4FFWD 4QWWD 5DHVB 4L5FH 4OCSH 5HVWA 1N0XH 2X9XA 4N8CL 1B0RA 5K59E 2KUTA 4MA8L 3ARYA 1FFPA 3NPSB 3ARBD 3U4BL 5IVOA 1TETH 3E6HB 4R97C 4I0PB 1KIQA 5ADOL 1HILB 3QUYC 4WUKH 4KJQD 1YNKL 2WLYA 3I6LD 4HGKC 4DCQB 1HI6A 1KXVC 3MV9E 4QRRB 2PTTB 1YA5A 4OLWH 2DQUH 4AYFA 3NACH 1MVFA 3SKMA 2DLEA 3T77A 1YMMB 5AAWA 5TH2B 2C1OB 4M43L 2ESVB 3RKPA 1S8DA 3G6JB 3O0RH 3DXAB 3ZTJH 2VITB 3FN3A 4EI6B 3PWVA 4HMDA 4XWGH 1DQTA 5DRWB 4EEEA 1X5YA 4PG9B 3OPZH 4LPTA 3NBNA 2V7NA 4X4YB 1A7NH 4JVUA 3IETB 4WJ5A 1U92B 2IF7A 4KK8D 4PJ8C 4AMKH 2H32A 4I2XE 4JDVB 1BHGA 3BRFA 4IMLA 4HIEB 4PRAB 4XMLH 3MLSH 3OKNB 2MQCA 3ZKQD 2VDPL 4YPJA 1AI1L 4PRID 2IMMA 2R0ZH 5EZLA 5DJXA 4RMTA 1KCSL 5F6HI 5E8DL 3MX0A 1O5DT 1RVFH 4UDTA 2QQLL 2D9QB 3S4SA 3OKOB 2FB4L 4K9EC 3TVMD 1G7JB 4G7VL 1RHHA 2VDKH 4O58L 2EIDA 3U6RA 3HAEA 1TTUA 3L7EA 3H9SA 1MRFL 1U8IB 3BE1L 1F45A 3KYOA 3C5ZA 4OQTH 3NTCL 4H20L 5HD8D 3Q1SL 4AT6B 4QTHA 5HYJB 3SGKC 4KQ4L 32C2A 3VXMA 5DZNA 3WFZA 1QLFA 4PV9A 1AGCA 4GMSH 3C8HA 3K81A 1MJUH 3HMXL 4V1DB 3AU1A 3RDTB 5JIHA 4OTXH 3NIFF 3U2SB 5DC4B 1EHLL 1PQZB 2HWZL 5TDNA 3UYRL 3CDCA 1CLYL 5C70A 3ZTJG 3OB0K 2YD2A 1NLBL 1PBYA 4JQIL 2DTMH 1ZA3A 3C60A 4GG6A 2WINA 5DK2B 2E7HA 3MBEC 4HMEA 1JPTL 1DVFD 3VXPA 5ITBL 5JW5B 1MHHA 1T0MB 4YHML 4PGCB 5D7JA 4G5ZH 5I1KH 5D6CB 5FGBA 2VAAA 4M6OL 5CSGA 2XRAH 4Q6IA 5DD6A 1C1EL 5C6PB 1EBAA 1J11A 5CS7A 1ETZB 1AGBA 4MA7L 5B3JE 4NJAH 1UWXH 2DOCA 4YDVB 2CKNA 3HE6B 3OHXB 3SE3C 5JW3L 4OSUH 4RGMC 1WWCA 5FYLD 4YHNA 2IPTH 1F3DH 5IM7B 2D7TH 2EICA 4R4ND 5ABDE 1R5IA 4QOKD 3N1PC 1IZJA 5ECJE 1OWRM 1Y6MR 3KPRD 4OCNC 1ZMYA 1FFOA 2J6EL 4LRNH 3ARBA 5IBTH 3EBAA 1CIDA 4NQDB 1B0WA 2Q7YA 2UZYB 5AYUL 1MFCH 2AJ3B 2YBRA 1DUZB 1YEEH 1HHJB 3L6FB 2Y1VA 1ZLUH 4L1DA 2ERJB 5D1ZD 5C09D 1MLCA 2R2EA 2HLAA 4PIRF 5CSZB 1T22B 3RNQB 3PE9A 4FFVC 5CCKH 4M4RA 5CGTA 4X6DE 4YO0B 4KK6D 5FUZH 3QFJB 3PQYE 2IPKB 1EGJH 2Z31B 4MJ5B 4YQXL 3RGVB 4WFHD 3MCLH 3V0WL 4L8BA 4TVPE 3DRTB 5C0BD 1JZ5A 1PGRB 3D39D 1CU4H 3EZ8A 4JGMA 4OI7A 3GRWL 4H1LG 3MRGA 4NUJB 5HY9A 4OLUL 2CMRH 1A7BA 1NCCL 5C2UB 3SKOB 4PRIA 2APTA 4QXGH 4BSJA 4JQXC 4RBPH 5FO8A 2X1QA 4TNWK 4ZTOH 4OCYL 2QEJA 4J8RB 4JO4L 5FYKE 5F7DB 2FECL 3TVMA 1T03L 4R2GB 1ZLVH 3T4YA 4LVEA 3DPBA 1RUML 3MO1B 4PUBL 2FEDC 2VDQH 4N1EA 1A1OB 3AS2A 4CNIA 1A5FH 3VFMB 3L5IA 3L95A 1U93B 1P2CA 3BKJL 4QRTB 1VGEL 4GRWE 3KLAA 1OB1A 3W2DH 1IKFL 3NCMA 1UB6A 3VFWB 5JOFA 5HDQH 1KNOB 4MNGB 3QO1A 4G8GB 4WCYL 3CFKA 4NN6C 5ADPH 4O9HL 2VZ1A 4OF5A 2NY3D 3KJ6H 5CAYB 3VGBA 3VH8B 4MCYB 1YQ2A 3QXWA 3RWJB 4ZYKA 5FO9B 5E2WL 5TDPA 1NCBL 4R97B 4UB0L 4YDJA 3UJTH 4JFQB 1DVFA 1ZT4A 4HC1H 4ZDHA 4UV4L 4KK9C 3SDXB 1EHNA 5L8KB 5AUMB 5F1IA 1DANU 5T1LB 3V4UH 1KENH 1QFUL 3EYFB 5C0CB 4S1DD 4JR9H 4WUUE 3DETC 1KIPA 3FO0H 3TYFA 5L2KD 5A43C 2Z4QA 5IR1A 5ANME 3INUL 5DVKA 3Q5OA 1WISA 2BSSB 3IXAA 3OZ9H 1HZHH 1MJJA 1IGYB 5FKAA 2C7UB 3LV3B 2HRPL 3QWOB 4QOKA 5HYEA 3UPRB 3O9WB 2XQYK 3IRPX 4HKJB 4QRRD 3V9FA 5JXAH 1G6RL 3O3AA 3BPNC 4JHBA 4NWUH 3FAWA 5E94B 5ACLA 3QWRD 4JO2H 1N6QH 4OV5A 5E8EA 2ESVD 1JK8B 1RZJH 2FATH 3GSWA 3DXAD 1LO4H 1P1ZA 2P8MB 1ONQB 1MCPL 5C09A 5D1ZA 5K9JL 3BYYA 3TA3A 4LSDA 1S7RB 4LLWB 1NCAH 4AIXA 4D9QD 3L3JA 5KN5B 5FYKU 4PRDA 4JB9L 3MRLB 3PDGA 3MOBL 5F9OL 5GGTH 3L3KB 3Q6FA 3S88L 5IW6A 3U9UB 5CWSB 4ZSOE 4MXVE 3NN8B 5C0BA 2IFGA 4HJ0C 4XTRD 2DD8L 3FQTB 3G5YB 3D39A 2P8LB 2EDOA 2YSSB 3MA9L 3ARUA 3GIVB 3HLAA 2NCMA 5T1MA 2HG5B 4ONGH 2MKWA 1I7TA 3TIEA 2R56H 5FUCE 3IXTB 2JK5B 1J12A 4KDTC 2AJSH 3MLZL 4OB5L 4HF5L 5I1AB 2BNRB 1R3JA 2HFFB 5TQ2H 3RVUD 3TPUA 4U0RC 3LKPB 1CK0H 2NX5B 1T66C 1ZHLB 4FTVB 4U6YA 2N7AA 5ELIA 3RDTD 4HUXB 3BP7B 2YC1A 4IHOB 5KVGH 2V9RA 1FBIH 1E27A 1FFRA 5DEGB 4MB5A 3KNBA 4ZAKC 5EC1B 3GJFA 3KPQA 5IVZB 3QUKA 4RGMB 5BJTB 3WD5L 5BQ7B 2C4XA 1YNLL 1DQLH 3DSFH 4XVUD 3TH2T 4ELKB 3T65A 4NKQB 4QGYA 5IJVA 3SDAB 3DUSB 4JGJA 5GS1B 2GY5A 4G9FE 3AB0B 4Y2DD 4Z7UB 4K3EH 4CJ0A 1T2XA 2V6HA 3QEQD 5TE6H 3AXLB 5L8LB 4PB0H 2OL3L 5ICZA 1F3JB<