3MCKB

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTTDTATYYCTRSSGSIVIATGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords C705 MONOCLONAL LIGHT CHAIN
total genus 42
structure length 226
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB01
4WWID 2BNRB 3VFGL 4AJ0A 3QG7L 4PJ9B 2GJ6E 5LQBL 2AJXH 5J3HD 3TN0A 1X5YA 3NAAH 3NH7H 3Q2CA 2HFGH 1I8LC 4J3TA 4X80L 3BUYA 5IOPA 1SYSA 2IQAA 3F58H 3VG9B 3BOVA 3SBWA 2BP3A 2YPLA 4OFYA 4LPTA 4Z7QF 2EE2A 4G6FD 1QBMH 2H9GB 5C0RL 4CVWA 4L8SA 4ETQB 4CVXB 2ZCLH 3SJVE 1FAIH 1F4WL 4F9LC 2NNAA 5DJZB 5MENB 1HZHH 3GSNA 3N1GC 3MLPA 3CH8A 5GRXG 4MD0B 1U8JB 2WW8A 2B2XL 4KK6C 3DMMA 5ACMA 5C0DA 3NFPA 4NFBA 1F4WH 1WITA 3ARFA 4YHZH 5DFVD 3GRWL 4O02L 2F53A 1MJ7H 1D6EA 4MJ4A 5B38G 4OT1L 1S9KC 1JHKH 4ZS6D 3K46A 3KPPB 5D72H 5C8JA 4KJWC 5D5MA 3CFCH 4IRSC 1D9KA 5E70A 3K8LA 4S11A 3L6FB 1ORSB 3LKOA 4PRNB 2Y7QA 2WANA 1CXIA 2GJ6A 2PN5A 4O58H 3HG1E 4ZSOB 1NGPL 4K2UL 1YPZB 1VADA 3KYOA 4PLNC 4LLYB 5ILTL 4P4KB 3V5DA 5JW5B 3MA7B 4XTRC 1KG0A 1WUNT 3LN5A 5DK0B 4P5TA 5BZDB 3VH8B 1MRDL 2DWEA 4OUUB 1R3JB 3BESR 4LDOB 3RWCB 3L1OH 1DE4B 4CJ1A 3WIHL 3F65A 3ZSSA 2YSSB 1NBZA 4MS8D 2R2BA 5CBAA 3CCHA 1KPVA 4JN2B 3REVB 3AMKA 4WHYG 3TN0D 1QNZH 4I3RH 4D0DA 4CMHB 1HWHB 2APVA 2F8VA 1CIDA 4GO6B 1QR1A 5B39A 1EAPB 1RUPL 3SKUD 4PGEA 2PW2A 5JMRA 1X3DA 3LRHA 1JE6A 3V5HB 2DL2A 5A16B 1I3RB 1IM9A 1T2XA 5HJ3A 3C6LD 2IADA 2XN9B 2BRRH 4PFEA 5C0DB 3FFDA 4B5EA 4YXHH 3O6KH 5E8DL 3LQAC 4G6KH 1YYLL 5JPMB 4XCCH 4LVHC 1HHJB 3GB7A 4YFDB 3EBAA 3QEGL 3TFKD 5ACZB 3UJJH 4MJ6B 3RZCB 4I77L 4X6CA 5A2JH 3RNKB 3VFUA 4YXKH 5EUKA 2KQNA 2W91A 5IVZA 1B6DA 4KVCL 1YEGL 2J88L 2DIAA 2UWEE 2X9YA 2R29H 4S2SA 5T1DL 5C0CB 4ALAL 1RIVH 3F7YB 3LDBC 3A67H 5I30L 5E4EB 4U1MA 1FNFA 3ZTJH 4XB7A 5CZVL 4S1SH 2E7MA 3QFJA 3BWAB 4Z7UA 4MA1C 4PJXA 1XR8B 1YJDH 4F8QA 1MCDA 3PWUA 1IGMH 3RX8A 5AZ2H 1JUFB 8FABA 5FK9B 3RIAF 5I30H 5SV3A 2XKUA 2HWZL 4LLDB 4M9OA 1U8OB 4XXCC 4CKVX 3FFCB 1A7RH 3OZ9H 4GG8A 4TNWK 2FJFB 2JJTC 3VXUA 4JEGB 3I50H 1UKTA 4G9FE 5F70A 2EEBA 1TTUA 2AJVL 4JN1L 3SCMC 4BA8A 4HMEA 4OM0H 5CEYB 2J2ZA 1T7XA 1RUKH 2RB8A 1P7QB 4FQJH 2O93L 2HRLA 4DOHE 1I1YB 2AXHA 3PL6C 2YPVH 2G5BA 4LCCC 4ISVA 25C8H 4OCNC 1YUHA 4UB0H 5DRWB 4WIQA 2YRLA 2ZZUT 3V0VB 1FSKB 1FNLA 1CYGA 4K7PH 4K94L 3W82A 4RRPA 2PCPA 1NGXA 4UT7H 1DL7H 4MHHI 4XNMB 1HHJA 3GB7B 4EUPH 3L3DA 1PQZB 3ARWA 3BP4A 1GRWA 4LEOB 5T5NF 3WFDL 4X6CB 3MNWA 4GJTB 3A6OA 3CVHH 2NZ9C 3VXMD 2E8YA 1DVFC 3GSWA 3RX7A 2EICA 3QIWB 1M05A 2MCPL 3GK8L 4F7PA 1JWMB 3HE6D 4ZNCD 1J11A 4EIGB 4BFEA 5D7IB 1YMMA 1CN4A 2A6IA 4TPRH 3QUYD 3UAJD 1U36A 5HYSG 1IBGH 1NLBL 3QO0B 3GZKA 3IXAB 5IK3A 1FZMA 1DUZB 3IDYC 3TBTA 2X4RA 3SGKA 2MTPA 4PGCB 4RWYL 4QY8B 1ZHNB 2FEDD 5DQJB 3S34L 4P3WA 4U3XA 5IV2A 3T1WA 4DAGL 5DGRA 3TPUA 5D7JD 3VXUD 5ESAA 1VFAB 3DMMC 2OR9H 4I8DA 2CRZA 3U7WL 1XIWD 1T1XB 1T4KB 4H0HB 5I74C 2P46B 2G9HA 4OLVH 4AEEA 4QGYA 5C0AA 1CLOL 3BIKB 1FVEA 2V2XA 1Y0LB 2BNUA 2EZ0C 4M1DL 2WP3T 2IAMC 5ECJE 2FD6H 2NXZD 4NP4L 3U0PA 2MMXA 3NH7L 5D1XB 3P9MB 1JJUA 1Z9OA 3MLZH 5MI0B 4HIEB 1Q0XH 2MSPA 3UJIH 1UJ3A 4V2CB 1O7SA 2MKWA 1U8NB 4NQXA 4YGVB 5EOCJ 5FGBC 4GKSA 5EOTB 1K8DA 2GQHA 3GSQB 1EZVX 5JHDE 1SEQH 5HGGS 4XP5L 1SBBA 3ZYOA 3BJ91 3PDDA 4M6ML 3VFMA 2H8PB 3BRDA 3CLEH 3VXMA 5FUZL 1ZKAA 2R0LL 3D18A 3BFOA 3DUSA 3HC0B 4TUKH 4LNVA 2DWDB 4PJ9D 15C8L 2VDNL 5KSBB 2IQ9H 1YN6A 4R2GC 4LEXH 4XRCB 4Z7WA 1ORSA 5AYUH 2PYFB 4JG1L 1XGPA 1QO3A 4LSQH 5DD3H 5F3BB 1Q9WB 4KHXL 1A4KA 1S8DB 4N8VA 1BBDL 5CLTA 1JNHB 2FHFA 1YMMD 4QF1A 3TBSA 4LASH 5CEZH 1L7TL 5IIEB 4JFED 1A9EA 2NY1C 3E1F1 4PJ5B 4UIMA 3ME0A 1W0YT 4HUVB 1Z6JT 2CQVA 1QSEE 5KSUA 3S96A 3WUWB 1UXSB 4H0IA 5D96C 3I6LE 5T3XH 3LEXB 5GS0L 2D7TL 4LP5A 1HQRB 2UWEB 3HI1A 3IDMA 1MH5A 3MRHA 4JHWL 5E08L 4KUCD 5HGBA 2BERA 3BXNA 4FMFA 4QRQB 5E00B 4RAVA 5J6HA 3L3KB 5D6DA 3SPVB 1MRDH 2QADB 3MCKA 1JHLL 3KS0H 2FLRT 1Q72H 5J7CC 2P5WA 3WIHH 3QA3A 5HHPA 1JGUL 3HC3L 4WFFE 3STBA 1AP2A 1FNSL 3DOSA 4X98B 5CEXA 2NY1B 4FTVA 4W68A 1CXKA 5D2LE 5DMGC 4YIQA 4PP1D 2DLFL 1AY1L 1YC7A 3U9PH 1I1FB 4KQ4L 1J5OH 4HJGB 1JHLH 4L9LC 1NGYA 5ID1A 1I7TB 4PTTB 4UV7H 5HD8C 3MRJA 4MB5A 2OR8A 1XCQB 32C2B 5E1AB 1C1EH 3FB5B 4XBEH 4MJ6A 3RZCA 5KTEH 4ONOA 1A7QL 4C4KO 1URLA 2XQBH 1IKNC 3K2UH 1S7QB 3FRPA 5L2KA 1ZHLA 4WI5A 4HJ0C 4XBEL 3UTSA 4F33A 4R0LB 2UYLA 1QSZA 3O9WA 2IPTL 5DMYA 5GZNC 4YXKL 1CDUA 4QHMA 3FRPG 3I84A 3MA9H 5SX5K 3B83A 1YEGH 4ZO9A 5EC2A 5SX4H 4PD4J 4XP4H 5HI5C 1AD9A 2NTFA 5I8OH 4XPTL 3SGEH 3QBTB 4X4XA 1NFDA 4P5KB 5FGCB 2LV4A 2EXWD 1D5XA 5EIQA 1FPTH 1TZIB 1BIHA 4QO1A 5LGHL 2CUIA 2V17H 3RGVD 2AGJL 3OPZH 1OAXL 4RCAA 1A7NL 3F5WB 4M3KB 1HSBB 1MHHA 4BZ2H 3DVFA 5J1AB 1IQWH 3PGDB 3F12A 3QYCA 2HKHH 3O6ML 2IFGA 2QHLA 4NJ9H 1WICA 4Y19B 4GAJL 2A1WL 5LCVL 2YRPA 1YUHB 3IFPA 3QEHB 1S7TB 5C0IA 3GFUA 3FO0H 4RNRA 2BSRB 5T1LD 1LD9B 4BH8A 3QHZL 4V1DE 1G7QB 2H32A 3Q3GA 2C4FU 6FABL 3WMSA 5JA8B 1FL6A 4UAOC 1EVUA 2OX5A 1NCBH 1IAKA 3A6CH 4WUKL 4LHUB 1A8JH 1RZIB 4KKBC 4WW1A 3V4VL 3VJ6A 2DI9A 4PY8J 5IVZB 1AHWA 4EEEA 1Q8MA 3T09A 4NQEB 3WBDA 4XNQB 4WEBL 1RJZA 1MPAH 3V0WL 1WQVT 1P7QD 2QHRH 4KDVA 4K9EH 5IVXF 4HF5L 1RULL 5L2KD 3G04B 1I9IL 1CI5A 1AD9B 3SDXA 3MFGB 2NY5H 1V7MH 3O9WD 2QEJA 5I75C 5HYSA 4CN1A 4IIQB 2PTTA 1Z0NA 3WN5C 1A5FL 4ZS6C 5FGBA 1FORL 3TC9A 4WU7B 5EU6E 3H9SB 4YHKL 3QFJB 3GM8A 4Z7UB 4NO3B 4JVWA 3WNLA 3OXRA 2YEZB 3W2DL 2ESVA 3WXVH 2XTJD 4LIQH 4GSDH 2VO5A 3T3ME 3F12B 1ROWA 4DGVL 4XP1H 5D7SH 2BNRA 3UO1H 4DN4L 5BOZG 3OJDB 1L0XA 3QUXB 1ZLWH 4RISH 2Z91A 1ZA6B 5ICZB 2NTSP 3P77A 3QI9A 5I1GH 4KGLA 1CICD 1OD7A 5JORB 3B6SA 4FA8A 4FXKB 5AZEL 1VSCA 4KC3B 3BDBA 4LK4A 5CLWA 3V6ZB 4L3EB 3FN0H 5ISZA 4OGXL 3IB4A 1U6AH 4XNMA 3DX8A 3GI9L 3WUWG 3NAAL 1J8HA 3MOAH 1FC2D 3KHQA 1CDIA 2AI0H 1ZTXH 3GSXA 3RVWC 5GXBB 2Q76B 2W0KA 1R24B 1JK8A 2P8MB 3IGAA 3GI9H 5L9DH 4GRLA 1K2DA 3WLBA 35C8H 5FYKU 4PS4H 4HJJH 4QHKI 5IFHH 3VXUB 1P6AB 5ANME 1QPPA 1FH5L 1QFOA 1WBXB 3BISA 1PG7H 3UDWC 2PYFA 1IAIH 4YDVA 1P7QA 4YHYC 3MRQB 3CC5B 5D7IE 4LCUB 1TFHA 1DDHA 2DJUA 3MBEA 3D6GA 4HKXA 3EHBD 1UM5H 4ZDHA 1MJ7L 4L4VB 3ZSTA 2IQ9L 5HHOA 1OT2A 4LLYA 1T20A 5EO0B 4X6BA 4KHTH 5IR1B 3CFCL 4PJFF 3MFFB 3S96B 1ZEAL 2CMRH 4D9RE 2X4PB 1DBBL 5T1KA 4LASL 5CEZL 2HFGL 5CSZB 3MOBH 4MDIB 3PABA 4RFEB 3VD9A 1XF5A 3PL6D 3KPRB 4J4PC 1L9MA 3MLYH 5IW3A 3FB7B 1IRAY 1CFNA 1FNEA 1EJOL 3VGFA 3DRTA 4R2GD 1PSKH 1JHTB 4PJXE 5A2IH 4LQFH 3FT3B 4U7KA 1I3GL 3NFSL 4PG2A 2ZCLL 3G6DL 3D5OF 1LE9B 1YNTA 1ZT7B 1BZ7B 4GRWE 3TWCH 4ONFH 5E6ID 3WD5H 1BBJB 3VMNA 3D25B 5IBLC 1EFXD 1C5DA 2NY1D 4K8RL 3WIFB 4QHLB 1E0OB 4ZYKB 3VI4E 3FFDB 3SDYH 3VFMB 2H9GA 3UPRB 3CVIH 3MRLB 3MTRA 3SE4A 1D7FA 1ZK9A 1FNGA 4YO0A 3VWKC 4NQXB 1CL7I 3EYUH 2EDFA 1N5YH 3CSBA 4B7IA 1K8DB 4KK5C 5CJ8A 1HDMB 5IFJA 2IBGA 5IBUG 1KCUL 5HHXL 3GMNB 4HXBL 5MENE 4PRPD 4NDMB 3CFBA 1EHLL 2D2OA 3W5MA 1EXUA 5HDBF 3TNMB 4AT6B 4L4JA 1FYTD 4OZHB 1VA9A 2N7BA 4JFHE 2OI9C 2VLJD 4HBCL 4JRYA 4M6AA 4KMQA 1NGPH 4MZ3A 1UM6H 1QVOB 4J3UA 2P7TA 1U8LA 2R8SH 3WNNA 3U2SA 1NCTA 2QQNL 4EOWL 2WV3A 1MVUA 4PJAA 5I1KL 1CLYL 3HCVB 3IAQA 4KROD 3D2UD 4Y4KC 3IJYA 2YZ1A 5HGHA 1AH1A 2VLME 2IPKA 2NY6D 3U4BH 1VADB 4EDWH 2AJ3B 1HKLL 2FDBP 4P2CG 4CL7A 2YS4A 4HWUA 3WS6A 2BVOA 5CZVH 1KELL 3QCVL 4JY5H 3T2OA 1KENH 1S9VA 1HXMA 2NY4D 4NFDA 4PRDA 4U1SB 5J9PB 2QQQA 3DXAB 2IAMD 4YC2B 2AP2A 4ZXBA 1BGXL 3HE7B 3SE9L 4YBLB 4PJ8D 2FZ3A 2XWJB 5D1ZA 2KZWA 1VDGA 2EH8L 1J1PL 3BZEA 1FV1A 3QISA 3NABH 2F15A 5DMIH 2EIEA 1KIQA 1D9KD 3PV7A 1KN2H 3JWOC 5A40E 2X05A 5E8PB 4PJHE 5ID1B 2FIRT 3RVXD 3MRCA 5D1QB 3K1DA 3QRGL 4NUJB 5HI5D 5T1LB 3FQNA 1IEHA 1UB5B 4M5YH 5DHXB 3UTQB 1BQLL 3FMGL 4HW6A 5K9QG 1BVKA 3HNVL 4HK3J 2K7QA 5BQ7B 4XPBH 3OR7A 5IMLA 1CG9A 4JB9H 3F6LA 1SQ2N 2J88H 4YUEH 4HGKC 1K8IB 3O2VL 3NBNA 4JRYB 4QRTB 1IE5A 3QEQE 2BY1A 3ECBB 5IGXH 1HHGA 1ZLSH 3WJLC 1XGRB 4N0CC 4JZJC 1DQTA 4JQIH 4C56D 5EU4A 1RZJH 4D9LL 1S5IL 2D03L 4MCYB 3X14A 3KXFA 3VFUB 2GK0A 2OTUA 3BN9D 3GSUB 1SYSB 2DQEL 1AR1D 3B2VH 1D5ZB 1FE8H 2APXA 2F58L 2VAJA 3L3GA 4K9EC 4GQ9L 2VZVA 5GS1C 1QSFA 4E42A 3I02A 5CEXB 4JGMA 4JQIL 1OCWL 4G42B 4CUCA 4WV1A 1R3KA 1NCWL 4HDIA 3ZDYF 4UDUA 2ICWJ 1RK0A 1UJ3B 1R5WB 2X10A 5DJ8A 3QFDA 5CJ5A 1I9IH 1QFWL 2ADGA 2YHGA 5D93B 4G8EB 1JUFA 3GSOB 5ADOH 4DVBA 5T3XD 1XR9A 1WAAF 4N5EC 2XTJB 5IB2B 2P5EB 4CJ0A 1I7RA 3HMXA 4NCC2 3RQ3A 1JPTL 4L9DA 4JR9H 4YH6A 3M8OH 25C8L 1T66C 4G8FB 1GOHA 2V2WA 4UTBL 2NMSA 2EEDA 3PP4L 4RWYH 1NFDE 4NJAH 2R0KH 4OSUH 4Z7WB 4RNRB 2JK5B 2UZXB 5E5MB 3O3BA 1I8MB 4B41A 3E6HB 4F3FB 3UO1L 1G7QA 4CNIB 1UB5A 2HN7B 3IFLL 2X4UB 1FC1A 1UGNA 4V1DA 3V9FA 3GSXB 4PY7B 3IFPB 4RGMC 4ZUVA 3KPOA 3QDGD 5IVNA 4NQUA 3RWHA 3RWGB 4W6XB 3QFJD 2ZCHL 1KC5L 3VXOB 4NSKA 5HHMB 2X9WA 3CLFL 4LCIL 4TOYL 3WHXB 3WXWL 1P69B 3MRDB 1J12A 4X6EA 2WP3O 3SDDB 1Q0XL 1GGCL 1U8IA 4JPVL 1IZJA 4TUOB 3KG5A 2CDGB 5J13B 1FO0B 1EBPA 4NN7C 3WXWH 1JIBA 5D2NC 3BI9X 2ZNXA 2J7LA 1EAPA 2EDOA 5B39G 3V4PH 5KSAC 5BJTA 3ZDYE 2B0SH 3H9SA 1Q0YL 2X41A 3ARVA 5K9JL 3R0MA 4WUUB 1ZT1B 1MLBA 3DX9A 3H9SE 2Q8AH 1EUUA 4HJ0D 3SKJH 1EV2E 1YZZA 3ARPA 1KTDB 4OLXL 3Q5OA 1KB5B 4HIXL 1B0GB 2FBJL 3MBXL 5JQHC 4WVRA 5BXFA 3VXNA 2BY2A 4IRJA 2PW1A 4HPYH 1OWWA 4X8XA 4ZD3H 1Z9MA 5E5MA 4ZUTB 4AIZB 2FX9L 2YC1A 3IU4L 4RAVB 5BZWB 1ADQL 5ICZA 4OTXL 1H3GA 4U1HA 2FEEI 2FCBA 1C7SA 4JRXE 5MEPB 4MXVE 2MOVA 4HFUL 3HE6A 1NEZG 1E4KA 4TSAH 2VDML 2BXYA 1EERB 1Q9OB 2VZOA 5FYKE 3PHOB 1NJ9A 1TJHL 4NO0D 2PTVA 4V1DD 4LSPL 4NSKB 5HVFB 1YEIL 1DN0A 3EFDH 5DQ9A 5C0ND 4N0RA 5CZKA 1I8IA 5CJQL 8FABB 2GIYA 3W11D 1A6VH 2CKBL 3AUVA 1DBKH 1OTSC 5D1ZC 3FFCA 3U30B 1OGAB 4Q74A 1DR9A 4JG0L 3ZYIA 4EI6B 4HWEL 3FOMB 1LHZA 3CVHB 1X4YA 4LCUA 5JDSB 2EDXA 1L7TH 4N0FB 4LAJH 3R8QA 3I6LD 4Z0XB 2AJYL 1OARL 1QFPA 2BMKB 2VMFA 5ACZA 1BECA 2NZ9D 5T1MB 1YA5A 1IC5H 3WDIA 4WW2B 1UZ6E 3JXAA 3ARBC 1NKOA 3AY4C 2X7LA 3STZA 4HXAL 1UH2A 1NBVL 4L9LB 1MHCA 3D2UB 5TF1L 3IF1A 4KVNH 3L95B 4MMZC 1BOGA 1W72A 3U7YL 3MODH 1NFIA 1L7IL 3V79C 2MHAA 3KXFE 4F7MA 1A6PA 1S9VB 1BHGA 2IANE 4EOWH 4OZIB 4LIQE 2H26A 4PRBA 5CGYC 4XPHH 3RVTC 4IRJD 1I3UA 2WINA 5K59F 5T3ZE 4XPTH 2XPGA 1FYTB 1MAML 1KN4H 5INDB 4AENB 1FG2B 5I66A 1BF2A 3RVWD 2DLFH 3SE4C 1KIQB 4LPXA 5DD5H 1A0QH 5E8PA 5CJXA 2NY3D 2Z9TA 3ALWA 4QRPB 4KTDH 3L3IA 1F3DH 3MV7D 2NXYC 3HMXL 3DGGA 2ITCA 3LV3B 1VFMA 4Y4KD 1DQJB 2Z8SA 3T3PE 3WNKA 1NGWB 2J5LB 4AM0B 4FTVB 1DUZA 1A64A 3IVKB 4Q6IC 3BZFB 1KXTB 5DD5L 5GGRB 5DMIL 3KDMB 2DTML 4XNYL 4X6DE 3WKNA 5LJYH 2FB4L 3R4DA 4HC1L 4HWZA 3HR6A 2DMBA 3EGSA 4R3SB 1EO8H 3B8YA 3MRNA 5D5MB 3JTTA 2BRRL 3UYPA 4P5TC 4NKQB 3P4OB 3FZUD 3KPNB 4OZHA 5AZ2L 1E6JL 4ZAKB 5FYJE 3TO2B 1U8LB 1EVTC 5DDHB 4X5LA 3HRPA 3MA7A 4ZPTA 1A7RL 4E41B 4KVCH 1U3HB 4PJBB 2PR4L 2AGJH 3LN5B 3OPZL 5BZDA 4WFHE 4IRZH 4NBXB 1M7DB 2GCYA 4JREB 5F72S 5AWNL 3GSVB 2X2YA 1KCSL 6CGTA 1NCCL 3OB0K 4OFDA 3IDGB 2AK4E 5C3LD 2PR4H 2UZIH 1D5IH 3PXJA 4OCXL 2FX8L 2YPVL 5DZLA 1QLFA 3WLWD 2DWDA 4OFPA 5FCUH 1QRNB 1FCCA 4DUXA 1PYWA 1L0QA 1DLHA 1RZ8A 2NY7L 4CNIA 5FYJH 4AH2A 1VFAA 3I75B 2LFGA 1IARB 3BPLB 4TRPH 4G8GA 3H0TA 3VFNB 2XN9A 1C08A 5DO2D 4NJAL 4YHOH 3QQ3A 4X6BB 1ADQA 4YAQB 5IR1A 2ZJSH 3P30L 3TV3H 3P9WB 1T80A 1RZ7L 4Z5RB 1QSEB 3C5JA 3FN0L 3E8UH 1A1MB 4I0PC 3B9KB 3X3GL 4TQEL 3RTQD 2B4CH 1WIPA 4U33A 2CKNA 4UMGA 5TH2A 2AV7B 3A0OA 2CIKB 2ZJSL 3RGVA 4M1GL 4GKZA 1AFVL 5EN2B 1KJ2B 3VGBA 1C5BL 2I07A 5LAXB 1Y6MR 2VLJE 1EBAA 3FT3A 2NY2C 5DSCA 1FYTE 3N1FC 3VWKD 4DCQA 2DQFB 3MUZ1 1J88A 4HT1L 4P46B 3RY5A 2R1YB 3GSNL 3HNTL 4DKEL 5IHLB 3BPLC 4Z9KB 1P1ZA 3NACL 1GHFL 4C58B 4MJ5B 4X4YB 5ICYA 5FUCE 1SJEB 4ZTOL 4Q58C 4QT5A 4N68A 5KVFH 4LIQL 3GIVA 2QQLH 4PJCB 4ENED 4EUPA 3ZKND 5T1LA 1D6VL 1PKQE 4TVPE 4HDIB 2Z0BA 2CK0H 4K7PX 3GBMH 3MXVL 4LOUD 1U9KA 2E7LC 1UM5L 3BPOC 3JWDH 5F7WC 5KJRL 3S8WA 1J0ZA 3PP3H 2RR3A 2K3TA 1GXEA 4PY8I 4X7FC 1M6OA 3VFPA 4G9FD 1RIUL 4NKDB 3VXTA 4DUVA 1I1YA 1G0DA 1U6AL 5HVHB 4KKCC 3HI5L 2HKFL 1DANU 1OGTB 5E99L 3OKDA 3TYGH 4MCZB 5DURD 3TGXA 5KSAD 1RAMA 4KRLB 4EZMA 2GSIB 1I4FA 3BP7A 1H15A 3DGCR 3BEVB 3H3BC 1T0NB 2HTKC 4QHKJ 1G9MC 4CVXA 1GAFH 4PS4L 2VN4A 3IJYB 4W6YB 1KB5H 5HHPB 3FT2B 3HAEH 5IFHL 4XMPH 2VH5L 3OKLA 1V5JA 1ZE3C 5KSVA 2BOBB 5HVHC 5EZOL 5EFIA 1OTTC 5DSCB 2BZDA 2X4SB 3GMMB 4LCYB 4PJDA 4ZPVB 5K93A 3KPQA 1KB5L 2UVEA 3TNMA 2DBLH 1H5BC 4GBXB 1AE6L 5I6XC 4JFFE 1IGJA 3W9DB 5J6GB 4YEEA 3IDXH 1DCLA 2DRUA 1FVCA 2YD4A 5DJAA 2Y5EA 1PFCA 3L5XH 2C7UA 1S7QA 5C0BE 1GC1C 4HS6B 4ZQKB 3HPJB 1XGYL 2GTWA 4LLAA 5D2NE 4JFOB 3HZYA 5CINH 4Y4HC 4YHML 5DUMH 3WDJA 4G6ML 4L5FH 3VGHA 4GRWH 4LSTL 4FQLH 3ARGD 1IGCL 1PG7W 3B8SA 3TF7C 1I9JL 1AIFA 2HH0L 1KTKE 5C07B 4F9LA 2YK1H 1HCVA 3VXOA 1GYAA 1FZOA 1I1RA 2BY3A 1A4JB 2IEPA 4XAKD 4MNGA 3EOTH 4IIQC 3MREB 3NIDE 4P59H 2IBBA 3LZFH 1ZT4B 4FQQA 2DB8A 2VXTH 5E94B 3CX2A 5K33A 5JXED 4UINL 3EYVB 2XQYK 4X5WA 5HI4C 2BSTB 2Q1EA 1IFHH 3GSUA 3UTOA 2NYYC 5GHWH 4L8BB 4P2OA 3RL1A 3RUGE 3GJEB 2NNAB 1IM9B 1I9EA 3NIGE 4G42A 1CR9H 4FQ2H 1CWVA 3VE0B 5KG9A 3FQWA 4NO2A 4JZNA 1J0KA 5HHOD 3H3PH 1OGAA 4L3CB 1SY6H 4G43A 4KWUA 3ULSB 1NANH 5SV4A 3SY0A 1JNNL 1NCDL 1LILA 4P3DA 2OXHA 4MWFB 4HEPG 3S37H 1FNSH 1A1OA 4AEFA 1LD9A 4LPUA 3O45A 4FP8L 3E2HB 4MNQD 3BMVA 2D3VA 1HHGB 3NA4A 4JFZH 4C57C 5IQ7L 2Z8WC 1SY6L 5BV7B 1CGYA 4PJGE 4H5SB 1KYOK 3DXAD 4YNYA 4EBQH 4QF1B 5I15H 1NGZB 4JY6A 1NUGA 2YD8A 3DSFL 4YHPB 3KNBB 1YYML 3L3GB 1NEZA 4E9LA 2NXYD 5C09B 3MV7B 1HIML 5TFSH 3GUTA 4Y88A 4G80B 3PHOA 3G5YA 4OZFG 5E6IA 3TNNB 1TJGL 1W0WB 3MJ6A 1EFXA 2F54E 4HHAA 3CU7A 5TE7L 2Q76A 4UU9A 1N26A 3B2VL 4HIJA 5BV7C 3CUPB 1CGSL 2WUCL 2WZPD 4EIZC 2YWZA 2EECA 1AQKH 3QG6B 3T0WA 2IPKB 2MHAB 2IH1A 1T6VN 3SDCB 4XH2B 2Q20A 1EHXA 1OAZH 4GXVH 1YN7A 2FL5A 4U1LA 3ZL4H 3INUH 2A9MH 1FFQA 5I1EL 5TPWH 1BX2B 2Y1VA 4ZXBB 5JXEA 5D70L 1YEJL 5EU6B 5C08D 2VLJA 3QDJE 1ZA6A 1D5IL 4MGXA 3O3DB 1Z5LB 2C9AA 4D9RD 4LNRA 4QOKA 3RHWK 2FNBA 2V9TA 3DROA 4MMXC 3BEWB 4M43L 1NGQL 3KPLA 2AQ3A 2AERT 1CXFA 1BIIA 1RU9L 5T1KB 5TH2B 3TBVB 1CIUA 3VD7A 5IBLD 5IMKB 2FH8A 4M6NH 1NUNB 1CG9B 4LHUG 5MHSE 5KSBF 4I3SH 1N6QH 3P30H 2YA2A 2L0DA 2YD2A 4UDTB 3F7YA 1A2YB 4Q9QL 4APQC 1DQLL 2IBZY 3C6SB 4TYUA 5D1ZD 5EIIB 5EO9A 1F90H 2P8LA 5EU4B 2DTSA 4KK5D 4JJHA 5GS1B 3MLRL 2XKNA 3OAYH 2BVYA 4HWNA 1M7DA 2GCYB 4PUBL 4Z77A 4ZFZB 1C5BH 3K3QA 3QIUB 3VGAB 1DQLH 4IRSB 4L8SB 1U8OA 1FBIH 2YD1A 3DHMA 3MV8E 4QXGL 4GUPB 3EZ8A 3TH2T 3N85L 4QXTB 4FFZH 1ES0B 3PWUB 4KRPC 4JHAH 4FABH 3KPSB 4M3JA 4CVZB 2MJWA 1E4WH 3ZE0E 3RUGA 4IJ3C 4U1GB 5FHAL 4Y19A 1HEZA 3JWDC 5ESVB 1I7RB 4Y5XB 2AEIT 3N85H 3SQBA 5A2KH 4FHBD 4OZHE 4S1DD 4ISVB 4NN7B 4MJIE 3QEHA 2IC2A 4C56A 1B4JH 2AVGA 4DGYL 3P4MA 2IQAB 5DJ2A 1FSKC 1JWSA 2LU4A 2V2XB 2XRAL 3DETC 5JQ6L 3GHBL 3VWJD 5J12B 5MHSD 1QBAA 5K9KA 1RIHL 4EVNB 5C9JA 3IU4H 1KB9J 2R2HB 5DDHA 3K4ZA 5GRUH 1EPFA 4Z0BL 4PJBA 1TVHB 3CSYA 4HFUH 1T0MB 1W2KT 3V5DB 4BFGA 4DOHB 1F4HA 4UNTA 1T7VA 1U95A 2X9XA 4FXGB 1VGEL 4JFEE 1VKXA 4IJ3B 3IDGA 4AL8H 1BD2B 1F3DJ 5L2JB 3L5HA 5C0RH 1FGVH 4XP9L 3CFDA 5D2LF 2Z92A 3KPPA 4RMWA 4XP6L 1W0VB 3DPBA 5GGQL 3MXWL 4F7EB 2B2XH 4TUOA 2C7UB 4W4OA 4PRNA 1QHPA 2OR7A 4XP9H 3QIBC 3D69B 4MQXC 3DRQA 1PVHA 4OT1H 1UEMA 3G08B 4PV9B 1KEGH 3CFJB 4J3VA 2H45A 4QY8A 1F00I 5DVLA 5FUCC 3D9AH 1ZOXA 5GZOD 1NAKH 1CK0L 4KZDH 2BNQB 4HWBH 4N0YL 4BSVB 5J3HC 2A38A 2E7LA 4MCZA 3K80A 2OLDA 3DX7A 4HMCA 5INDA 3O0RL 1NC4A 3HTLX 5DO2C 1L7IH 4L3EA 2DS4A 1NLDL 1AI1H 4U0QB 1UA6L 1R3LA 3DX8B 4DCQB 2P5WB 1IEAB 4ZSOE 3O3EA 3RKDC 2A74A 4MJ5A 4X4YA 3VWJA 3VFWA 4JHWH 3BUYB 5IOPB 4HIHA 4JFFD 1MF2H 4UQ3B 1YQ2A 3G6JB 5BOPA 3VXQA 2DLTA 2QSQA 4MQ7B 4NQCA 5FYKH 1XAUA 5JTWA 3VXSD 4K7PY 1QBBA 1ZS8B 3F7VA 1KTLA 2X4TA 3R1GL 5C07D 3IJHA 3LH2L 3MRFB 1F3JB 2ICES 4IDJL 4A2LA 5I0DA 3CMOL 1MCFA 2FJFA 2DM4A 2HT3C 4MNHB 3KYNB 1OW0A 1X5KA 5HHVH 1AGBA 3SDYL 4XCYB 1NEUA 1WAAE 1J5OL 5DR5L 1JNNH 1NCDH 2IAMB 3UC0H 4P2RD 3HS0B 2H2PD 4P23B 3UPAA 4UOJA 3P0GB 1FGNH 1LP9E 5IWLA 3T2NL 5LGKA 2BJML 3U7YH 1G7MA 5DRZA 5E2TH 3ARBB 5HGAB 3BGFC 4KKLD 4B0MM 3FL7A 3RAJH 2VLLB 3M45A 4FRWA 4QRRE 3K2UL 1FIGL 3KXFB 5SWSB 4J8RA 4M1CC 4FXLA 4GH7B 4ZQKA 4DGIL 5B4MD 1G6RL 5J13C 1T1WB 3PABB 4YBQD 2OQJB 3LKQA 1NFDF 4GW4B 4RFNC 5LBSH 1A6TA 1BFTA 1ODAA 1REIA 4GG6F 5BS0A 1RJLA 1CLCA 5MP6L 2SEBB 5E9DE 3TT1L 2CK2A 2F54A 4WEMB 4J1UA 5E94A 4PRHD 5F6HJ 3T1FB 1QLFB 3FFCD 3SDCD 2QADC 2D0FA 3UZVB 4PJDB 5CWSA 1YJDL 5M95B 1FO0H 1U8KA 3QA3B 2Y07H 2ZG3A 3MGTB 1NC4D 1NCCH 1T7YA 4HUMB 1NBZB 1IGJB 5F9WC 3RVUC 3X13B 4LLUB 5ITBH 1I1AB 1PZUB 2VR9A 5GGSB 3BP5A 5SX4I 3W11C 2NXYB 2AEQL 2Q7YA 3DTXB 4LQ1A 5FA4A 3SQOL 4OCMC 3KAAA 3RPKA 1PBYA 4H88L 1NSNH 1OWRM 1NC2A 3I2CH 1Q94B 3UP1A 4JZOA 4WDIA 5FEBA 3VXSA 4RA3A 4UILL 1WZ1L 1CDHA 4K3EH 1ZHNA 3V7AE 4NFCA 3X12A 1CFQB 5D7LA 2Y72A 2C1PB 5I1CH 3RDTB 3P73A 5EZJB 2Q6WA 1HK6A 1AJ7H 1NGQH 4ZMAT 5BO1L 5ITFA 4G6JH 2R0ZH 3WHXA 2QSCL 1OPGL 1M71B 3QUKB 5F7EL 4TQEH 5GS0C 4AY0A 4HHAB 3KPNA 2YA1A 4OCRH 3MV7A 2NPLX 5A3IC 4GUPA 3BZDA 3RVTD 4KDTC 4HS3A 4Y2OA 5DHVH 3VE0A 1WZKA 5KG9B 1QZ1A 4IOSD 4TVPD 2ID5A 4OI7A 3QQNA 1NCAL 3F5WA 4KKBD 1NDGB 4ZFGH 2D4DA 1BOYA 2VL5B 3T0EB 3D0LB 1IAIM 4Y4HD 4ODSH 1DFBH 5ETUB 5GJTL 4WO4D 1K4CB 3SDCA 1MFEH 3ZKSD 1Q9LA 1S7XB 3OJVC 5CBEA 2D4FA 1JRHI 1S7WA 1IKNA 4LVNC 2GSGA 3TBWA 3IXTB 4X6FB 1QACA 4I48A 4DGVH 2WBJA 2BSRA 5T1MA 4FFWD 3IETA 3QDAA 4IRJC 2VLMD 3SE8H 1YPZF 1YEHH 5IROC 2OR9L 4G8GB 4HMDA 3ZHKA 3GJFK 4NNXA 3TBVA 1KIUA 3QUMH 3M07A 2VIRB 2XRAH 5FDWA 4QTIH 3G5VB 4R8WH 1K8IA 4ZS7L 4PJXF 3SDAA 2NYYD 3TO4C 1D5MA 1S7UB 1QBML 2Z31B 4HUUB 3QUML 1ZLVH 4GW1B 2ZCHH 1I7UA 4OZHF 1KJ3H 4HUNB 2VZSA 1ORQB 3KR3H 4MD4B 2DM7A 3D85A 3ZKMC 4OD3L 4EI6A 1SEQL 4QHUB 2D7MA 1BX2A 35C8L 1QKZH 2YOCA 3VMPA 5E8NB 5DQDL 2QR0B 3MPCA 1FH5H 1Z2KA 5FYLD 2VDNH 1MFCH 2X70B 2Y23A 1FDLH 4PJEA 3ZO0A 4Q9RL 5IG7B 1OP3K 3D0LA 3NN8A 2BNQA 4ZFOB 1G6VK 3O41A 5F93C 5C86A 5I1DB 1E4XL 3NPSC 4R90H 5D7LE 1AO7D 4UUJA 4MSWB 4YHMH 2EEAA 5F7DA 1VHPA 2VE6B 5HY9B 3DVGB 4UOW0 3F58L 5HPOA 1U41A 3QJHB 5C9KA 4FQXC 4X7EC 2BFVL 2IFFH 2YBRA 2R2CA 1NAMA 3CAFA 3WS6C 4LSPH 3MR9B 1ZVHA 3VWKA 5EU5A 2D7TH 3L3OB 4OD2A 1SMAA 5KVDH 1MVFA 4M93C 4FMKA 2I24N 4HPOL 2B1HL 4GS7B 1I4FB 3BP7B 2CLRB 1JYWA 4HFWB 1EMTH 2XZCH 4FXGA 3X3FH 1G7PB 2HJLA 2J4WH 2QSTA 1LK3H 4WCYL 5E0QA 3W81A 4U3CA 2OL3H 4LSVL 5L2JA 1UJTA 1TVHA 4GAFB 4HS8L 4W6WB 3SDAD 3D3VB 4PJ9C 3OWEA 3OXSB 5DTFB 3EOBB 4DEPB 3GIZH 4WTZG 2A6KA 3HG1B 2XZAH 5KVGH 3EZJB 4ZNEA 5D71H 3BGMA 4R96A 4RIRB 1WT5A 5SWZA 2VLKE 2IPUK 3FO2A 1E6OH 1EEYA 4OQ1A 3B5HA 1GCFA 4P49A 2IALA 1AD0B 2R69L 3OAZK 4XX1G 1ETZA 5HGAA 3ULUF 5KSAA 4PG9B 3ULVD 4LOUC 1A7QH 2P48B 5HGDB 4MLSA 4XCFL 1IC4H 3GKZA 4JFFB 5DR5H 2ARJB 3U9UB 4OF8A 2FLBT 4JM2D 5ICXB 3GMOB 3V0VA 5EO1B 4PR5A 5I15L 2R2HA 4PRID 3LHPL 5KBNC 1KJ2L 2YPKA 3LZFL 4P46C 2VLRA 5C1MB 5EBLA 3VFVB 4XCFH 2R0WH 4H26A 4UINH 5D2LA 1CT8B 1AO7A 2W0LA 4R4NC 2PYED 4RMVA 2XICA 2KBGA 5L0QB 2D31A 3BPNB 4JQVA 1BMGA 2ZOLB 4F57H 1U3JA 4U6XB 4V2BA 3QDHA 4FQ1L 5IVXA 1TZGH 3OZ9L 1IQDB 4MAYC 1BQHA 5B22A 1CFBA 5C0IB 3BEWA 4YXHL 5I1IH 1MHPL 1XF1A 1T21A 2VDQL 3ARQA 4JZJA 5CP7A 5GRVL 4M7KH 4XVUD 4YFLF 4R7NA 3C2AL 4GRMA 1HOCA 1RZGB 2IG2L 2X4TB 5DYOB 2WIMA 2ERJB 1NSNL 4EUPG 3LQZA 1S7SB 4UV4L 1MCWM 4E5XA 3S3PA 2JTDA 5EC1A 1OGAE 4NQSA 3ARDA 4H25B 3PNWB 4MNHA 1CZ8H 1CL7H 5EORL 2Y5TA 1M71A 3QUKA 1F11B 1XEDA 3LKOB 4LLMB 3OKMB 5K9OB 5CUSH 2KPNA 2ARJA 4IMKA 3PV6B 2OP4H 5DJCB 3GSRA 1D5ZA 3B3IA 4M6NL 1NGZA 1IGFH 4MA1B 5CP3H 4P2OD 3MCLH 1RURH 4XB8A 5GGSY 1GGIL 3VXRB 4YDIH 5IEKA 1S9XB 2BHUA 3RGVC 1AKJB 4MX7A 5IUSA 4QT5B 3QNXA 3MACL 4G9DA 5I1EH 1P4BH 4PGDB 3UJTL 2AXJA 3UTZB 2JELL 1SEBA 1FHGA 5FA3B 3V6FB 3IS1X 1BD2A 3CUPA 4KMTL 5IB4B 3CCHB 1RY7B 4WFGE 4FZEL 4WWKA 1YQVL 4Y4HB 4ZFOL 2J12B 1TZIA 1LEKA 4XMLH 5EULV 1I9RH 4Z7QE 3OHXA 4FQCH 4NQED 5IB5A 2DQGH 3LDBB 4KK8D 3LKSB 4OB5L 1WFTA 2GJZB 3HLAA 2PO6B 4PP1C 1T2QL 3MRMB 4G7VL 5TQ0H 1MCIA 1N4XH 3HZKB 3MV8B 4M43H 2V7HA 1MJJB 2UZIL 3S34H 1T22B 4PJHF 1CVSC 4N8VB 3ESUF 1F6FB 4Y16D 3BZEB 5B38A 2DQGL 1WTGT 4C56E 2VZUA 4L4TB 1N3NB 1DJSA 2LVCA 4XC1L 1CFQA 5D7LB 3U7WH 4P9HH 4YHNA 1ONQB 1ZSDA 1U95B 4JKPL 3FT4A 2WK2A 3QUMB 3RWDB 2JIXA 5GGVH 3V5KB 2D0HA 4M48H 3NCMA 2VXVL 1CGTA 2W0PA 4KH2A 4XC1H 3MREA 5KANI 4I18A 4TPRL 1X5XA 2OK0L 4L4VE 3VFTA 1LK2A 3SDDC 5DI8B 4X5WB 4QCIA 5H2BB 3QWOB 3GKWH 4Z6AT 1CE6B 4WW2F 3WEXB 1NAMH 4OIIL 2YUVA 1ZLUH 5C08A 3IDIB 1UACH 4UT9L 5I74B 4PJIF 4G6AD 1HILB 5JW4M 3TFKC 4JCMA 1H8OA 1OAYL 3E2HC 2HLAB 1MLBB 3DX9B 4LRNL 4LLVB 3WIFA 4G8EA 3TLRA 1FNHA 4LGRB 1X6LA 5AYUL 3F6IA 3TCLA 3TIDB 4IRSA 5DJ6A 3NCBB 4L3AA 4G8FA 1KPRA 5CEYA 3A6BH 5JXAL 2K9UA 2UUDK 4JFYB 1K6QL 1PKQA 2JCCF 2Y06H 2VXSL 4Y5YB 1JNJA 4NGHH 1QRKA 1D6VH 5F97E 3O3AB 4WWKD 3W0WE 4LARH 4JDZA 1J7VR 1ZEAH 2CMRL 4HIXH 4IOFD 4BZYA 4JM4L 4NWTH 3ARFC 3I6KA 1HHHB 1W72L 3OQ3B 3M1BB 3PWJB 1YNTB 4ZD3L 2IBZX 3U82B 1X44A 4Z5RA 5LKNA 2IFFL 4ZUUB 1NLDH 2DWEB 3WHE1 4H20H 5EC2B 5FUZH 3RGHA 1MIEL 2D7OA 3LKRB 5CBAB 3QFJE 4Z7UE 4LSUH 1Y18A 4P5MA 4A6YH 5JOEA 5KVDL 4KFZC 3EYSH 3DMMB 2B1HH 1XZ0B 4P4RB 4RMQA 3GMNA 5GGRY 5T5FH 4XH2A 4D8PB 4YDLC 5DD3L 5LXGH 3BPCB 3CX5K 4NT6A 3TVMA 2OL3L 4XMPL 5D7IA 5E8NA 4WI2A 4LSUL 5ICYB 1WEJH 1MFDH 5A3ID 5TF0A 1HINL 2GT9B 2EDJA 4IEFB 1F13A 4LSTH 1SBSH 4F9PC 3HZMB 3PE9A 5KTEL 1G1CA 4GQPH 4YHZL 1GOFA 2BHYA 4L3EE 3FAWA 3GMRA 2ZUSA 2RHEA 4WO4C 4JQVC 3QDMD 3ARDC 4Y5VC 3O0RH 4OIBA 2JCCE 4P0DA 2DJ4A 5FF6B 1UA6H 1OF2B 1M7IA 1FZKA 1UM4H 4JO4H 5DWUL 4WHCA 4YHIA 5TDNA 5H35B 4HXAH 3WJLA 2PYEB 5TDPB 4PGBB 2K7PA 2BNQE 1WIUA 5IVXB 3PGCA 3FO1A 5M7QA 3EIFA 1OVZA 3SGEI 3AS0A 1HXYA 3V6OA 3O6FD 2C4FT 1UCBH 1OT1A 3MGAA 3BYTA 3GMPA 3QEQD 1IM3A 5GGVY 2PXYD 3EDEA 2GUOA 2JJSC 4YX2H 2AXFB 5I2IA 2BHZA 3AB0B 3FQNB 4FG6C 3CMOH 2UVFA 3S35H 5MEOB 3ULUC 4UDUB 4N1HB 2H1PL 1HYSC 1KJMA 2H8PA 3DUUB 1RI8A 3L3HB 1DEEA 4MNGE 4FQIL 4HBQA 3WDHA 3DUSB 3HC0A 5JPMA 4NQEE 4U1IA 4WY7L 3RY6C 5IJKA 2F53B 1FGNL 1VPOL 1QYGL 3AAZB 1DQQB 5C0EB 4YE4H 1JWUA 1ZWIA 5EZLA 2EYTA 4ODTL 4MQXD 1BD2E 3QCTL 5C6WH 4KPHH 1FFPA 4NKIL 2DTMH 4JVPA 3F8UB 4BSWB 3HE7D 4DKFL 1YJDC 3RPIA 3BHBB 2DKSA 5IIEA 1G6RH 3V52L 4NQDA 4FFVC 4ODTH 1D9KC 5FYLH 2Y4SA 2ZUWA 3NPZB 4ODWA 3FKUS 1XGUA 1GJIA 4HS3B 1EA9C 5C6TH 2W9LA 4Y19E 3GSVA 3LSOA 1YYMH 3SJVA 4HF5H 4F7TB 1F4AA 4YHIB 5F7UA 3P2TA 4Q9BA 2IANA 2FO4A 2E27H 4U3HA 3U36B 3BW9B 1BEYH 2YD7A 4X4ME 4TSCH 4AEIH 1OCWH 3BO8B 2B5IC 3REVA 2BVOB 4OGAD 3VH8A 4U6YB 1EEQA 3RWIB 2DDQH 4PREA 3SHSA 1DE4A 5DD0H 1CGSH 3HZKA 3S37X 1QOKA 2AK1H 4XCEB 3C8HA 1OSPL 1A47A 1WV7T 2JCCA 3EO0B 1T0PB 5I2IB 2VERN 4E41E 1QPXA 4BH7B 1DDHB 3MBEB 4JAMB 1DSFL 3O6FA 4AM0A 1LO5B 4J3SA 1VFBA 4D0BA 4FQCL 4ZDHB 4BZ2L 2VUOA 5I1CL 2AS5M 4GRWF 2O5XH 3ULVF 1LEGB 1OSPH 2XTJE 3IS0X 4ZOAA 2WBWB 2VQUA 3CH1A 4FQJL 3FT4B 1TMCB 3QDGB 1E4XI 4ORGB 2H3NB 1SHMA 4ODXA 4NUJA 5E5UB 4WEBH 2BVTA 5JPNA 3MRDA 3GSWB 2Z31A 2WAHA 1DLFL 4K9EL 5ELIA 4JO2L 2EXYD 5FKAB 2FYYA 4LCWE 2KKQA 1RUQL 4YHPA 3LEVL 5F9DC 1NCBL 3ARDB 5EU7C 2BC4B 2GHWB 4U6VH 1X5ZA 2NX5B 4O2FA 3CVHL 1ERNA 4P46D 2YMXL 1SJEA 4YQXL 3FHQA 2NY6C 4NQDD 3B3IB 3GBNH 2X70A 1H5BA 4TNVF 1N2RA 5DHYA 3FRUA 4ZUWB 4HIJB 4X9GA 5KS9A 4IHOA 1MJUL 1MI5E 3CXHJ 2ED8A 2VITB 5GJTH 4G7YL 2BVPA 4OZFH 5DQDH 1K5NA 3LRSB 1DBJL 1R5WA 3QPQD 1N64H 2IAND 4Q7DA 3DARA 4LRNH 5KAQG 4DN3L 2LABA 4NRYA 2VL5A 1PX4A 4FQXA 1H3TA 4LDEB 3JTSB 2VLKB 1DBJH 2NY2D 2ZG2A 3WV0A 5HVWA 2A6DA 3GJFB 5E95B 3OKKB 5DURB 5D4QA 2AEPH 4R8WL 3AS3A 2HVKA 3I75A 5CGMA 3EO9H 3CFIC 4PBWD 5DQ9B 1QSEA 1FCGA 4JM4H 1TQBB 4LHUA 4PJ8C 4X9BA 1X4XA 3ZKXB 3RVUD 3MYZA 3VFWB 3NIFF 4M7JH 3KPOB 4NWUH 3ZE0F 4Y1AB 1TITA 3HI6H 4U7MA 4JFPA 4WI4A 1RUML 2WWKO 2A2QT 5AD0A 4GXUM 2I07B 3AU1B 4JRXB 1U8MB 3MLZL 3EO1B 5IHZB 2FR4A 2YSSA 2LU3A 4WO4A 5JZ7D 3FQTB 1YEFH 4XI5C 1YMHA 4RZCB 5C0GA 2NX5E 5I6XB 2HLAA 1JNHA 3VW3H 4IHOB 1FFNA 4JREC 5T5FL 3TA3A 2FJGB 3BP6B 3U9UA 3CXDL 4KAQL 3WE6A 1TVBA 15C8H 3UBXB 1NDMA 1MFDL 4XP6H 4ZSOA 5A16A 1U8QB 1V7NL 4G6FB 4HBCH 2F9BT 4PJCA 1M4KA 4EI5D 3H7LA 5GGRA 1UC6A 3O3AA 1IC4L 2JIXB 1XGYH 3DXAE 3QUZB 5SWQA 2DQIL 1HH9B 1DQDH 4PGBA 4LKCB 3P11H 1KPRB 5IF0A 5JORA 3BRFA 4FQLL 4P48A 2VKXA 1N6UA 1SYVA 3LPWA 5D5ME 1F3RB 4NNYA 1AXTL 4P23D 1QG3A 1BQHB 4O2EA 1T0NA 1UT9A 3EW3B 1WWAX 4J4PA 4LSVH 3L1OL 4TN9A 4JO1H 4X6DB 5CHNB 1X5IA 4GMSH 3L3OA 1T66D 1T1ZB 1Z3GL 1HKFA 3VGDA 4HK3N 1P4LA 4QHNA 3C5ZA 3LN4A 1LP9B 1OTSD 1YECH 4HULB 1NGYB 2XZAL 4ELKA 5KVGL 1S9XA 1MQ8A 2D9CA 1Q72L 3MV9A 3FT2A 5DJ6B 4ONFL 32C2A 3LQZB 2JF1A 4KTDL 4E5XB 4OZFB 1BVLB 1HHIB 1RQ5A 1NC2B 3QQ4B 3GSNB 2BVQA 2X4NB 2AK4B 4LCWD 3S35L 3CK0H 1U8JA 1MCOH 3OV6A 1UWXH 4UIKL 4XBGB 4JY6B 4XBPB 1YNKH 1PG7X 3T65B 5E8OA 4PJBE 5KZCB 3LHPH 3O3BB 5I8EB 1G7IA 4OZIE 3QT2A 1RZKC 2G5BB 3IETB 4LCCA 3PQYB 4ZUSA 4FG6D 1I85C 5C0BD 3PG2A 4Y89A 1J10A 4ZO8A 1YY9D 3BIBX 3EDKA 4U4BA 2A83B 5KSUB 2W07A 1P9MA 3VH8G 5CSZA 1S5IH 2D03H 3HZYB 3Q6GL 1NCUA 3DSFH 4E41D 1FN4A 1UM6L 4JY4A 3MLWL 1YPZE 5GRZA 4S0TD 3C6LB 3LEXA 5HYFA 4GMTH 4X99B 1AO7E 4HUVA 5FO7A 5F6IC 5JW4N 2RFXB 3K81A 3E3QC 2MQ3A 3RGVB 2WUBH 4YDIL 3RI5F 4PRBB 4JGJA 3VRLF 3QXAB 1UEYA 5C92A 4GMTL 4EDWL 5I1JH 1QFWM 5DJXA 5FO9A 5MP6H 1VEMA 1ZT4A 2HWZH 1MJJA 3HUJF 1A6ZA 3ROOB 3RUGF 2F5AL 2JELH 2D31B 1MWAA 1TTGA 3QRGH 3BD3A 5E6YA 4F2MB 2RQ8A 1JTPA 5IBTL 4J4PD 2YA0A 4U0RC 1L6ZA 1I1FA 1GC1H 2YZ8A 4ONGH 5DD0L 1BFVH 3ABZA 3T0BA 1I85A 3QXDA 4OFKA 4L8CB 1IC7L 4G7VH 2E6JA 5JIIA 4I5BB 4NNPH 1TTFA 5E7FA 1UZ8A 5EORH 2R2EB 1X5HA 5HJ3B 1GC1L 1ND0B 3FO0L 3MSPA 1OHQA 4H88H 2Q8BL 4IOIB 4RWHA 5F7EH 2YRZA 3MRRB 1IC7H 1P2CB 4F37F 3ULVC 3N1PC 4NNPL 1H0DA 3T0VA 3AAZA 4AIZA 5JOFB 1I8KA 1KBGH 3TV3L 1QVOA 2ICWB 4MA7H 5GGVL 4XX1E 4ELMA 3EFFB 3EOAB 1AGEA 3VD4A 3TNNA 3PHQB 5K9OA 1H5BB 5IHBA 4DEPC 3PIQA 4GKNB 4QRRA 1G0YR 2HJKB 4PJIE 2Z8RA 5CGTA 1J05B 1F58L 4WI6A 1IGIL 4L4TD 4R4ND 3PWPE 4RGND 2X4RB 3SGJC 5I16B 3OXRB 4E41A 3LKRA 3T4AA 4BJLA 5HPMA 4I0PD 4P2RE 1D3CA 2EC8A 4NN6B 3DBXA 3DVNB 4OFVA 1B2WL 3ROLA 3TZVB 3HNSH 4HQQL 3S88L 1V7ML 1INDL 2BVEA 3EOBA 3KPSD 4P57A 3HMWH 1B6UA 5ESAB 4QXGH 5HBBA 2WWMC 4XNZB 3OKDB 3IFLH 4TUJA 3ARDD 2FJHA 3GNML 5IEHA 3W9DA 5J6GA 3W2DH 3MLXL 5IBUB 2MFNA 5IM7B 3ULUH 3TBYA 5JNYB 2GSIA 3Q48A 3DVGA 4DN3H 5C9JB 1K6QH 1CD9B 1U58B 4X7DC 1MWAH 3TBSB 1OM3H 4LF3B 3Q3GB 1NAMB 1P84J 5F1NB 2I5YL 2GJ6B 4M48L 3V8OA 3PP4H 2AJXL 2A73B 1AQDB 5I1GL 3ZYJA 4TOYH 4NUGH 1RZIA 4WW1B 1WISA 3GO1L 5AZEH 2ICWI 1AIFB 3LSOB 1DVFD 3QXTA 1IL1A 3ZTJG 2I60H 1AHWB 1XF4A 4JLRB 4XNZC 4QWWD 2R4SL 3EO9L 1YEHL 4OZIA 2XT1B 4APQB 1AO7B 1BD2D 4F58H 1E27A 1ZT7A 4NWUL 4ZS7H 4P2OC 2GK0B 1J1OH 1LO2L 3FO9A 2XA8L 1NKRA 2WBJC 1KJ2A 5L9DL 4B53A 3VGGA 1FL5A 2GEEA 1CXEA 2CLZB 1AXSB 1RMFH 4XNUH 3RIFF 4CMHC 1MJ8L 2P47B 5C09E 2R1YA 1RK0B 3QHTC 3CPLB 2CUMA 4QRRD 2FBJH 4U6HA 1T20B 3A6BL 4YC2C 3MXWH 3AM8C 3HE7C 1R0AL 3V8CA 3IDXL 1XR9B 2EDHA 2X4PA 3VDCA 1KJMB 3V4PL 2OYPA 5DRXB 2ARJQ 4NO5A 4H0GA 4LARL 4BZ1H 4X7SH 3CFKB 2XACC 5CJXC 4MDIA 4K3JH 2VQ1A 1FRGH 3HN3A 2JIXD 3LRSA 4PJDF 5EDXA 4RFOH 4QRSA 2QBWA 2A6DB 3WCYA 3FJTA 4DJMA 5IM7A 4JFDB 1ZXQA 3PDOA 5DUPL 1TQCC 1I9JH 3VRJB 3BKYL 3C8KB 2OSLA 1CD1A 1G6RA 5B3JF 2HG5B 4LSSH 1ZHLB 4BUGA 5FYJD 4RFOL 3QDME 2ZSWB 3DI3B 3QIBD 3OSKA 4WCYH 3EOTL 5T33L 2ZUUA 5MEND 3O11A 3WFZA 3MV7E 2ATKA 4GW5A 3FRUB 3HAEA 3KJ6H 2P5EE 5CKGA 4ZOBA 3EJZD 2E7BA 4I3RL 1GIGL 4X80H 3K1KC 1IFHL 3D0VA 1I7TA 2R9HC 1JVKA 2AXGA 2I9LB 4N1CA 4OZ4A 5F44A 4JO1L 3TWCL 1I7UB 2BVQB 4HX1A 2MPAL 1P4IH 3FB5A 1PEZA 2ZCKL 1Z3GH 3BH8A 3QJFB 1J0HA 2OJZH 4MNQB 1OARH 3IKCA 1QFWI 3ULVL 5DLMH 2APBA 3PF2A 4BUHA 1FAIL 2EDDA 3RIAK 1A6VL 2QR0A 1BFOA 4XNYH 1TPXB 3KNBA 1D5BB 4HV8A 4JG0H 3VXSE 5K9JH 2EXYC 1JF1A 4ESKA 1J0YA 3Q0HA 1S7VA 3L7EB 1MFAH 1KB5A 1MCWW 1Q1JL 2BSSA 3CH1B 2O61A 4UNVA 1H3XA 1NMBH 2FIKB 3U36A 3C5JB 4J1UB 3VFSA 1JMXA 4G6AC 3ARFD 3PHSA 1DTUA 4MS8C 2AK4D 5I1KH 3G5XA 1TPXC 5JXEC 1II4E 4PTUB 3DYPA 3CFEB 3MLWH 2X4QA 3HUJA 3H9ZA 4YXLL 1MCPL 2UWEA 1QTYT 5E9DA 4CU6A 2N4IA 3JVGA 1YMHB 2XY2A 3T4YA 5DMGD 2A0LC 5C08B 1S5HB 3DV4B 3KWWB 1VGKA 1JZ3A 4ZYKA 5C0BB 5GZND 5BVPH 1MCPH 3MJ7A 4L8BA 4P2OB 3RL1B 4F57L 1CBVL 2YD3A 4HC1H 5DFWH 2F5AH 2NY7H 3ULVE 3NABL 3CDGB 4HAFA 4KPHL 4ZO6A 1J8KA 4QHLA 3KYNA 2LQRA 3H42H 2BSED 4NRZB 5SWZB 2E5EA 1N7ML 3W39A 5AUMA 2E3VA 3FN3A 2V5RA 2XXMB 3ES6B 1I8KB 4MXQC 3QQ4A 4YHOL 2C3WA 5IFJB 5C0EA 1ETZB 3C09B 2X1PA 1RU9H 2IH3B 4XPBL 5EO9B 2GK2A 4WGWB 4XBGA 4BFBD 1T1XA 4X0KB 5D1QD 2VLLA 3V6BR 2FECI 1EO7A 2F5BL 3NCEB 4ZFZA 2ZUQB 3ZE2F 4NZUH 1H15B 4YDLB 1ZA3B 1JN6B 1J86A 1JL8A 3O9WB 2XY1A 1OPGH 4UQ2A 4FZEH 3EYOB 4TVPH 3C5ZB 3G5XB 2X1OA 3D87B 4XMLL 3ROLB 1GH7A 3O6LH 4PTUA 4LU5H 3GBNL 4GLRH 2V7NB 5MEQA 4WENB 5EFIB 2WMPA 3QNYA 1TCMA 5EUOB 2J8OA 4TVPL 4IRZL 5I1LA 3JTSA 2ATPA 5IESL 4YK4B 1FV1B 4ODHL 4WO4B 2YXFA 4LU5L 1Y6KR 3W9EB 3JV4B 3DTXA 5CD5C 3T3PF 3MACH 3UDWA 4AZ8A 4KK9C 3TH3T 3G9AB 2C5DC 3UTTE 4KU1A 3S88H 3MRQA 4UBDC 3UZEA 1B0RB 1CE1L 3MMEB 3CNKA 4ELMF 4CN4A 2XIDA 3T77B 1G9NH 2FSEB 3S5LB 4NYLB 1TXKA 5D8JH 4NZTL 3SCMA 1B0GA 4U1NA 3O3DA 4TTDC 4OB5H 2DAVA 4YHLH 3UTTB 2MQ0A 5DMKB 2YWYA 5DEGA 3HR5A 3P73B 5E5RB 1JK8B 2P8MA 5DRNB 1J9CT 3SJVD 2ZPKH 2OK0H 4YK4C 4Q9CA 4GW1A 1KIPA 3G6AB 3EFFA 4NQTA 4YQXH 3PV6A 1BAFH 4NM8L 5D7JB 3DRTB 4PJHA 2I9TA 1T3FB 3UAJC 2WLYA 5J6HB 1KCVL 2VXQL 4FFWC 4IBLT 1ITCA 1AFVH 1XR8A 5FYJU 1CGUA 4DQOH 1OAUH 1HSAB 2XA8H 3WFHB 5F7YC 3F62A 3PWPB 5HYQA 4AYFA 2CGRL 4H8WH 3MRFA 4X5XB 1EHAA 5ERWA 2EC9T 4ZTOH 1EEZA 3QFDB 1Q9LB 1S7XA 5T3XE 4Z0XA 3DMMD 2X5PA 1BPVA 4RFNB 4MYWB 4C54A 3QEUA 1H3PH 4NC0B 4AH2B 4QYOB 5ALBL 1MY7A 1OW0C 4KI5F 5MEPA 4FQHB 2A9NH 2OTPA 2EDEA 1IGYB 1T7ZA 3PQYA 1RIUH 3QDJD 2HAZA 2XZZA 4M03A 1YEKH 1XGUB 5SWSA 1V3LA 4QHNB 3SCMD 1ACYL 1J0JA 2R23A 5IMOB 4PJEF 4EI5B 4ZAKC 5T33H 3T4AB 2KH2B 4N8VG 3JZ7A 1KIRA 4MD4A 5K9QI 1MI5B 5BW7C 4RAUA 3SKNA 3WN5A 4OI9A 2W65A 1XGTB 5H2BA 5J1TC 1A3LL 2XWBA 3UPCA 1I7ZA 1WZMA 1U2HA 3CZJA 1EEYB 2M26A 4FQXD 5DC4B 1TENA 4P9ML 3VCLA 1OAKH 2H2SD 4Y8AA 1N5YL 2DICA 3ARYA 5JNYA 5CD3B 2DJSA 1I1CA 4DZ8B 1S78C 1JYNA 3L7EA 5KAQF 4UIKH 2GFBA 5ERWB 1JYVA 1IM9D 5FYLE 1OAKL 1AQDA 5BRZE 1A9BA 3WL9A 4N0UA 3KPLB 4KROB 4YPGB 1JRHH 1V3JA 3MRNB 4C59B 2PKDA 3LCYA 5HHOB 1W8OA 5I9QB 2FGWH 4PGJA 2YD5A 4E0RA 2R8SL 2E8ZA 1IAOB 5HY9A 3QUYC 1QBLL 1N8ZA 1WAAA 3OKYA 4PJ9A 4IMKC 2X4QB 4BQBA 5C0JB 4BKLB 2NQCA 5TF1H 1OSZA 1NMBL 4PRPB 2CH8A 5HHOE 3MROA 2FZ3B 5ILTH 2VC2L 3DX6B 2G60L 1E4JA 3QPQC 5A1AA 5JIHA 3HUJE 3L3IB 4QGTA 1EEUA 1QFUL 2JKXA 2HMIC 1FIEA 1SJVA 3RY4A 2FBOJ 3ILQD 3PQYD 4GXVL 1YPZA 1MAMH 4JFHD 1Z9SA 1EZVY 1NBYB 3KPMA 4HX1B 2VTFA 1C5DB 4LRIC 1J1PH 3KDMA 2R39A 3WN5B 4GG6E 3WS3A 4HWBA 4D8PA 5JW4Q 4NKIH 3CVHA 4EBQL 2AXGB 2I9LA 3RNQA 4DFIA 1WLHA 3UPRA 4ONGL 4NQVA 2Z35A 1MCBA 1PW3A 2RBLA 5DK2B 5SWSE 5FXCH 3QUXA 2EDBA 1TQBC 1MFBH 1F11A 4LLMA 4EXKA 4NZJA 3ZKXC 5F3BA 3KVQA 1WZ1H 4OAWA 4FQIH 1AGBB 5DRWA 5BV7L 3PWNB 1RZKH 2W0FB 1TJGH 2IMMA 4N0FA 3V7MA 4P23A 3X17A 1A9EB 4M1CD 2FX7H 4FTVD 3O2VH 3MRIA 5H37G 5AEAA 5CKAA 2E27L 1A1MA 2HT4C 4UQ2B 3P4LA 4L8DB 4WW2A 4M8QA 4CRPA 1OAZL 4MAYA 3C5ZD 2F5BH 5T1DH 4MNGB 4ZUWA 4L9LA 1FN4B 4JY4B 5L8KB 1H8SA 3N0PB 2FHBA 1IAMA 5EBLB 3VFVA 4LPCA 1PDKA 3BN3B 4APQA 1QLRB 1GGIH 5D2LB 2H6PA 2ENSA 5C0FA 1E27B 3BT2H 3J7HA 4WNQB 3V2AR 3HA0A 1DBAL 4TNWF 3WFCH 5F1IA 3UTSD 3TBWB 3TBYB 3SDXE 4NRYB 1N0XL 5LWYL 3MUJA 4IMLA 3VFNA 4MQSB 1MFEL 4HC1A 1OQXA 3QUZC 4Y2DA 1OP9A 4LAQL 4P2YA 3DWTA 1QA9A 2DIBA 1W8NA 5DEGB 5C0BA 4AIOA 4JO2H 1UJ3C 3KLSA 5EO0A 2Z8VC 3RWDA 5HI4D 3SGDH 3KLDA 3CSPA 1B90A 1TNNA 4I0PB 4WI9A 3RI5K 2P8PA 4U6VL 2Y25A 4GAYA 2UWEF 5KW9H 3RNKA 2CJUL 1BWMA 5GRUL 2EDYA 3RTQB 4K7PL 4BM7A 4RGOH 1CU4L 2P44B 3VFTB 6FABH 2QL1A 3QUXD 3O4OB 4KK8C 4Y5VB 2GI7A 4BFIB 2GAZB 2EH7H 2OBGA 4LVEA 5ITFB 1PZ5A 3G6JE 3CLFH 1F4YL 2B4CL 1UB6B 5DUBA 4NBZB 4L8SC 4NKOB 4I3SL 1T5WA 4LVHB 1DQMH 1RZFL 4XVSH 4WUUA 2ORBL 4X4XB 1INDH 1KPUB 4JQXC 1MAKA 3KPQB 3PWPD 2EIZB 2IH1B 4PRPE 1YY8A 3QXVA 4HKZB 4PJ7A 1MJ8H 5GRJL 2W38A 5IEKB 1FNGB 1QEWB 1G1YA 1Q0YH 3P0VH 1U8QA 1M05B 4UT6H 3QNXB 4HSQA 1GZPB 3VRIB 5KVMC 2GJZA 4BK5A 1YY9C 3CSGA 1F8TL 3GHBH 3D9AL 3FFCE 4NDMA 3C9NB 5J12C 4OLXH 5I1HH 4JHAL 4FABL 2ZG1A 3BQUC 3MUY1 4I2XE 1XIWB 5E4IA 5DJDA 4JVUA 2JB5H 4J6RL 2APFA 5DHVA 1IEBB 3ZTNL 1PQZA 3TYGL 2X7LB 2CXKA 2OM5A 43C9B 1BQHG 2ESVD 4L4TA 3MRHB 3U46A 4D3CH 3MYJB 4PLKD 5BRZA 3G5VA 4XGZB 5FOBA 3BUTA 5H8DA 4S1RH 1WVZA 3SDAB 4CMMB 3S36X 1J1XH 1EMTL 2XZCL 4LLQB 4O4YH 2OMNA 2XKSA 2J4WL 2DQDL 3HG1D 4OLZL 1RZJC 4Y7MA 3S4SG 3UJIL 4BQ8A 5F71A 3K0WA 2AV7A 3OL2A 2VH5H 3GJEA 4ODUA 1FG2A 4ELME 3TO4A 1TDQA 3EYSL 3RZCC 3JUYA 2NY0B 4AG4H 2KDGA 2FEEL 5LAXA 3TYFA 4P3CL 4YDKL 1T3FA 4LGPB 3GIZL 2PYEE 4J2XA 3KS0J 2VDRH 3B9DA 4MHHG 4AK1A 3MRPB 3GMQA 1AXSA 4PJAF 4Q2ZB 1AE6H 5I8EA 2DQCH 1TIUA 3UMTA 4GKSB 4P3CH 3VW3L 1SBSL 5D1QC 3QO0A 4GRLD 2EDWA 1G7LA 2IADB 5GRYA 3MRKA 3T2NH 5CD5D 5I71C 1BBDH 1FZOB 2W9EH 1U93B 1DVFA 1LO4L 3QH3A 4HUWA 4AEHL 5AAMA 4FNLL 1Q1JH 4MA8L 2ZOKA 4LP4A 4KI1A 2V6HA 1PKQB 4Y5YA 1BQSA 4XAWH 5FO7B 1GGUA 3FOLB 4UNUA 5EUKB 1EFXB 4N0YH 1A6AA 2BY0A 4FNLH 1VGKB 4OFYD 3VXPB 1LO3L 3R1GH 2WIIA 4K3GA 4GRWB 1NBYA 3KPMB 3FN9A 2IPUG 4RBPK 4Z78A 5J06A 3ARBD 1ZMYA 1BF8A 1BGXH 1KACB 5CP7B 3REWB 1CXLA 2OJZL 4XGZA 4Z7UF 3ZKQD 2G60H 2OL3A 2X1XR 4Y4KB 3IT8D 4DKAA 3P9MA 3OBAA 3MLUL 2JLLA 1RUPH 1DN0B 4R4BB 3AC0A 4KV5F 4QRPE 4YX2L 1P53A 4YJZL 2PUQT 5JHDA 1KN2L 3T0EA 2AJSH 4MJID 3OKLB 3VGEA 4XXCA 4R7DB 2F53D 4QEGA 3TEUA 5C3TA 3ZDZF 5E24E 3JTTB 5B21A 1TVDA 3OKNA 2X4SA 3TJEH 3TA3B 3HG1A 5IKCB 1XF2A 1MCJA 4FFYL 2PO6A 3TO4D 3MMEA 3KYMB 4XVTL 2HMID 3JV5A 1A6UH 1MCOL 1MSPA 3DSNA 5DA4A 3QIBA 1G0XA 5FGRA 1EHLH 3TJEL 1D9KB 4FFYH 3TT1H 4NKMA 5EU7E 1RZJL 4WFEE 4Q6IB 2F53E 5GGTA 1KLUA 1T5XB 4XNQA 1O7VA 3VA6A 2W9DL 3OR6B 5FYLL 2ICEA 2KZ1B 3FB7A 4P2QE 1HIMH 1CTOA 5TFSL 4F7PB 3QCUH 3UZQA 1CVRA 3EHBC 1NFIB 3ZLQC 4EJ1C 4XXDA 3EYVA 4DWHA 1XGTA 3QB7C 4NHCL 2R56H 1I7ZB 4JRYD 3BE1L 3VXPA 3FO9B 2VKWA 4JE4B 3NA9L 3GMPB 1LQSR 1SJXA 2CDGA 5GZOC 1P4BL 3BGFB 4QHUA 4X98A 2XPGB 1PX3A 3WJJC 4GT7A 1MOEA 4BQ6A 4LLWA 4WRLA 3DUUA 3OAZH 3MJ9H 3GIVB 1KLFA 5FCUL 4L29B 1SY6A 1UXWA 2ZSVB 1ZSDB 1ZHKB 3MJ7B 3LB6D 1IGTA 2EYRB 2OZ4L 5IT2H 3L3DB 3AS2A 3UYRL 1K85A 1JWUB 1ZWIB 5EZLB 2UV3A 3OKNB 2OJEB 5JHDD 3HS0A 3OG4B 4JANB 4ZXBD 4Z76A 4MJIA 3QWQB 4I18C 2P24A 4XWOD 3QI9D 3QJHA 1FVDB 5BMFL 2OCFD 5IW6B 3MRIB 3MJGX 3W0WB 1MRCH 2UYLB 3E8UL 4RA0C 1IGIH 4NKOA 3RWFA 2G9HB 3PWNA 1NL0H 1NMAL 4LCIH 4L8DA 5L2KB 4RGOL 5ISZD 4YDJA 2C3VB 5DFVC 3UTSE 1NCAH 3WKML 5KS9B 1N6QL 3BEVA 2HRPH 1CDYA 3LEVH 4F33B 1J8HD 2R0ZL 9CGTA 5JA9A 1INEH 2VWEE 4OD3H 2VDLH 3TCLB 4ODSL 2XXCB 3STLA 3D18B 5B3JE 3QQ9C 4F15C 1KXVC 1LDPH 4M7LL 4POZC 1NAML 3WYRA 4OZ4B 1EJ6A 4NM4L 3UX9B 1R3HB 5FECA 1YC8A 2NY5C 3MV01 5HHMD 4JHZA 3B9KD 1LWRA 4PGDA 4N1EA 1V05A 5D1ZB 5DK2A 2A6KB 3QG6A 1FBIL 2DD8H 4KROC 3TP4A 4JAMA 3SO5A 1UWEH 3SEPA 4JKWA 1KT2A 1YN6B 2YD9A 4NC1E 4ZFGL 2FL5B 3EYQC 4U1LB 3FCTB 2JJTA 5F9JB 1JZ6A 1O5DT 5D2NB 5I8CA 2DQUH 2VRAA 4Z7VE 5HYIA 5ALBH 2GTWB 1UWEL 1ULVA 5JIPA 1JZ7A 2AJUH 4NYLA 1VFBB 2XG5A 4OCYH 3OR7B 4OTXH 4JPKL 4U1NB 1PEWA 3BPOB 1P7KA 3FTGA 1U8NA 4N0UB 1BLNA 1F4XH 3KYOB 5JQ6H 2ESVB 3DYMA 2AV1A 2DLEA 5JOPE 2IGFL 3UTPE 1VKXB 1F02I 1UG9A 4J6RH 3HR5B 4R26H 4ODXB 1DBMH 5BW7A 2YKLH 3ZTNH 3GO1H 4QTIL 4EN3B 5GISH 3F7QA 1LK3L 3PQYE 5FKAA 1OAUL 4GBXD 4ORZC 2CIKA 3BQUD 4R26L 1MFCL 5GJSL 1MREL 1Q9WA 2NY0D 3LEYL 3OX8A 4BFIA 2Q86B 4QCIB 2PTTB 1U8HA 4XHJD 3WFBL 5EPMB 4JPVH 1PY4A 5MI0C 2LAAA 4S1QL 1K5NB 3SDXB 3DBXB 3DVNA 3BRGC 2XWTB 1WWCA 5TDOB 5D72L 43CAA 5FAAA 1WJ3A 4G8IA 1PGRB 4QXTA 4J23A 2WSKA 1DQQA 4WV1C 4GAYB 2B1AL 3ZT6A 2EYTB 4G6MH 4L5FL 4QKXB 4X6FA 4X7TB 1G7MB 5DRZB 5EOCL 2K1MA 3RUGB 1I8MA 4KI5E 1U58A 1TCRB 4JPIA 1DBBH 4K3JL 4O5LL 4W4OC 5ESVA 4J8RB 3GI8L 1N59A 3O81A 3T04D 1T1WA 3IJSA 4H1LH 5HYJA 43C9A 3NFNB 4CN6A 3ZT5A 1JWSB 1KULA 4MQ7A 4NQCB 5E2VL 3BIKA 1D5XB 1QSFE 5EOQL 4ELKB 1U3HA 4OFIA 3ARGC 5AD0B 3K2MC 1RUAH 1T7WA 5KN5A 3P3YA 3R8BB 5IFAH 4RFEA 3PGDA 4UAOB 3UTPD 2P49B 3RZWA 1QLRA 5EUOE 1I1AA 3KJ6L 4XNXH 1N6VA 3OB0H 3IGAB 1B0WA 3DLQR 4MD5A 3RKPA 1CDCA 2IAMA 1LEKB 1JI2A 1YN7B 4Z7WF 2P45B 2Z93A 3ORJA 5GS3A 3N50A 1MFAL 4JKKA 1DBKL 2E6QA 4GBXA 3CPLA 5D7IF 2AJSL 3BQUA 1Q94A 5EU6A 1CXHA 3V95A 1MCLA 5E8DH 4ACPA 3SE3C 1VPOH 2DQJL 4RZCA 5C0GB 4K23L 4JFEA 3CC5A 1HWGB 3NCYS 2CIIA 1ZAGA 4QHMB 1C08B 4ERSL 1QBLH 1AC6A 3FAXA 3DROB 4ZFOA 1OB1B 4OKVA 2NW2A 5SWSD 1CTNA 4F7TA 5IB3A 3ARUA 3CDCA 2DQTL 2CDEA 2F19L 3VG0L 4IRJB 3ZHDA 1ZGLM 3HPLA 1RK1A 2IPTH 1IAOA 1TZGL 4FQPA 1N5AB 3Q6GH 3TN0C 1BZ9A 4BQCA 2ENYA 3H8NA 5TE7H 3KYKL 5I8OL 2BC4A 5A43C 1HKLH 5DK3A 3TIEA 1R3IH 3WSQL 2NX5A 4UTAH 2DKUA 1Z5LA 5E00A 4OJFL 5D9SB 1A7NH 2DYPD 3LVEA 5I73C 3I50L 4LGSB 1I9RL 1LEGA 5D6DC 4EN3C 3RX5A 2BCKA 4DVRL 1SJHA 4FQ1H 2H3NA 1CCZA 4KRNA 1KFAL 5FFLA 4GKOA 2VZTA 4NN5C 4JRYE 2R4RL 3RZCD 1HXMB 1X4ZA 5F21B 4N9GB 1AC0A 4NOFA 3RWJB 5TQ2H 1EX0A 4N8CL 1I1AD 3CD4A 2Z35B 4UZGA 4P9HL 5C8JB 4M7KL 1R5VA 2VLKA 2EDRA 3RWFB 4PG2C 1YNLL 4LKXA 3X11B 4GXUN 2Y7QB 4JQXA 3SDAC 3M1BA 3PWJA 3PIQB 2DBJA 3T65A 4M9PA 5BS0E 3LS4H 3QUYA 4CDHA 1HHKB 1JF5A 1CZ8L 2WBKA 3HRZB 5HI3D 3BGAA 3QXUA 3P4NA 4ZUUA 1T03H 2EH7L 1JPSH 4X6CE 3NZ8A 4B50A 1JCKA 4UI2A 1ES0A 1XMWA 1CT8A 4ODHH 4MLIA 3TZVC 2CRIA 1KCLA 3CFEA 4DTGH 4P2QD 3SJVB 3WKMH 5J9PA 3WLWC 4QNPF 4OCRL 1TZHA 1MI5A 5GPRA 1F58H 1F6AA 2JJSA 5LWYH 5I1AB 1UZ6F 1E28A 1RVFL 2BX5A 4G7YH 2Z92B 3O6LL 3V6OC 2AQ1A 1IMHC 1S9YA 1A3QA 4PJGB 1XIWA 3ULUD 4LPWA 5JXAH 2VXUL 1EO5A 3MJ9A 2Y06L 5FHAH 1BFSA 4EXPX 3H9SD 2DQHH 4M62L 5DHVB 3ARTA 1R3KB 4OM0L 4RX4A 3MZTA 3RL2B 3ET9F 3GNMH 5FYKD 3VXNB 5F89A 4HLZH 5TQ0L 1OAQH 3KPRA 1CE1H 4XT1C 4NWTL 1CU4H 3CX5J 4O51B 2XFXA 4JKMA 4MAYD 4Y1AD 4Z95H 5ANMA 1K2DB 4Z7OF 5DVKA 5JOFA 1MHEA 1OOAA 1BVKB 1KCVH 1ZVYA 3IDJB 3VWKB 2V5MA 3GKWL 3CU1A 4LKXB 3X11A 4H20L 5C0JA 4APQD 4NIKB 1F4XL 3Q5TA 2BDNH 3C60C 4JKPH 3PHQA 2HTLC 2ZPKL 2ORBH 2AKRA 3CZFA 2VLKD 1WBYA 2QLVB 1DBML 1QSFB 4G8GD 3BP6A 3IU3B 12E8H 1EUTA 4WFGD 1NUDA 4H8WL 2V5TA 4HJJL 4PY7A 1JF6A 2BDNL 2R0LH 5GRJH 3BPNC 2HA1A 3QR2A 5C7XL 3QDJB 1J1OL 3ISWA 1JBJA 1LE5A 3G6JA 1WF5A 4Y2DD 4G9DB 3AROA 2HJKA 3RA7L 4DZ8A 1MCQA 3V6FA 4YDKH 4C55A 4U2ZA 2E9IA 2HT2C 3NOIA 4UT9H 3L5XL 3BH9B 2BNRD 3QNZA 4S0SD 4UUJB 3EAKA 3NCYP 4QRSB 4P2QA 5FHBH 5KVFL 2VR4A 2JJUA 5DUML 3MRBA 2JB5L 4R4FL 3PL6B 1G6RB 1CICA 4GBXC 3HC4L 3S4SB 1T04A 3E6HA 1YEKL 5B8CB 2ERJC 1A6AB 1LO4H 4KZDL 2EZ0D 1K4DA 2DQIH 1TLKA 3STZB 3FQRA 2J6EH 1F2QA 5C6PB 4XHJC 2GSGB 1OD9A 4MA8H 2P5WD 5JUEH 5GS0H 1WBZB 4KJQD 3OKKA 1H3PL 4DAGH 5D7KE 5DUPH 4YDJB 3CIQA 4F7MB 3WUZA 4GS7C 3QUMA 4OIAA 2BFVH 1I3VA 4EVNA 4RX4D 4I1NB 1MHEB 1KTLB 2ITDA 4LQFL 1J0IA 2VNCA 2J6EL 4NOBA 1IEBA 4KRMB 3FONA 5E4EC 2VIRA 5GHWL 4NC2B 3HC3H 4XTRD 4Y1AA 3THMH 3QUZD 1R3HA 5FECB 2B20A 3I6GB 3LS5L 1WBYB 5BRZB 2H6PB 5FYKL 3CFBB 1GGBL 5CJQH 4LL9A 1ITBB 5BVJA 3UXFA 1A14H 5L7XL 5IFAL 2IWGA 5H37H 4NCC1 3MRCB 3THML 3RHWF 2NLJA 2CUHA 1Q9OA 3QHFL 2J1KA 4ZXBC 4JFQA 3CLEL 4ZUSB 4OAWB 4JFZL 4PJAE 2CLZA 43CAB 4LNRB 5EO1A 1B88A 2QQKL 3D39A 3IFOB 5GRVK 4AEHH 1HINH 5DWUH 2VQ1B 4OCSL 1PLGH 1NQBA 4KQ3L 5BCAA 1DEDA 3EYFA 3G9VA 3CFJA 1LO0L 3BKCH 4H26B 3VXRE 4KHXH 3VFOB 4G5ZH 5EUOF 3IFNL 2W60A 3EYQD 3PL6A 4KXZI 2HYMA 2VDPL 3S3JA 1SVCP 2OJEA 1Y6NR 2QQNH 3O2DA 3QP3A 5CINL 1FIGH 3ZE2E 1HH9A 1F6LL 5EBWA 4ZO7A 5EWIL 4ZAKA 4Y5VA 1JZ4A 4X7TA 3DX7B 4J3XA 3BP5B 1BEYL 5FV1L 4I9WD 5BZWA 5JHLH 1SYVB 4Y4FC 2YBRB 4PRIB 4KI5C 4AEIL 3FB8B 4RBPH 4CU7A 2RIKA 3DO3A 3MNVB 1OAXH 4PLKC 5E1HB 3PWLA 4Z7VA 3TJHD 3BKJL 2VC2H 1RHHA 3NA9H 4MVBC 4CADB 1MEXL 3PXHA 3GSQA 2HKHL 3O6MH 3IRPX 3V4UL 3OXSA 1QFUH 1YY8B 4HKZA 4PJ7B 3GMMA 1G7PA 2HJLB 4JRWA 4LCYA 4ZPVA 4HKBA 4PLJD 2N1KA 5BV7H 1CDBA 3O4LA 3DECA 5EA0H 3NTCH 5CZXC 5D1XC 1MCCA 1CBVH 2H2PC 1FYTA 2J8UE 4EDXA 1ZHBB 4I0CC 4MXWL 4Y5XA 3UYRH 3ARED 4NZRL 1HN1A 4UV7L 3NCJL 2EDLA 4N8PA 2HLFC 2Z93B 4WY7H 5EA0L 2A0LD 3D3VE 4KKLC 3V4VH 4YAQA 4KUZL 4PB9H 5K9KB 1A02N 4MXWH 3EYFB 2X4UA 2XN9D 4EQ2A 1MHCB 3D2UA 3IDUA 4UOW1 4NPYB 4Q97A 3VFOA 3D39D 1YNLH 4O2CA 3ARBA 1RK1B 2QHRL 4OZGB 3LPFA 5FM5O 3QIWA 2NY0C 1F90L 3V7AG 2EIDA 5J11B 1U8IB 2B8OT 2CDEB 3MLRH 4XPAH 4XVJL 4HWZB 3Q1SL 3IF1B 4W81A 1FNAA 4Q0XL 1OLZA 4PV8A 1A6TB 1BOGB 1W72B 4DW2H 3T0ED 5K59E 4PJ7E 4X99A 4PJ8A 5I66B 1DSFH 4MD5B 1L0YA 4PJGA 2VUYA 3DV4A 4FFZL 2Z4QB 3H9HB 4WUUE 1FPTL 2PO6D 1AR2A 2G5RA 1UCTA 5F88B 4GSDL 3B9EA 5DJXB 2PTUA 4HKXB 5F7MC 3GMQB 4K7FB 1QLEL 4Z7VF 1JGLH 2XV6B 4PJEB 1ONQA 4G3YH 1OB1A 3RIFK 1UWGL 5IB1A 4URTB 2B39A 4O51A 2X44D 3RJDA 3RWJA 2BOCA 2ADFL 3HFMH 1LNUA 3O6FC 1E4KC 1MWAL 5DZOA 1F42A 5CIPB 5IVOA 2PXYC 5F3HA 3O4LD 3RBGA 2O5XL 5BQ7A 1T83C 4OCWH 5M94B 1F5WA 2FWOA 4KJYB 3EJYC 1OAQL 4U7SA 4U1GC 5DT1H 3LIZL 3NGBC 3HFML 5D7JC 4R0LC 3L5IA 1RZFH 4XVSL 2WNGA 4WUKH 4CW1A 3ECBA 1CICC 1NUFA 2Y36H 5INCB 1XGRA 1ZA3A 4QOKD 1BWWA 1QSFD 2YKLL 3DETD 3O9WC 5CSGA 1AGEB 3WFHA 4X6DA