3MCKB

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTTDTATYYCTRSSGSIVIATGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C705 MONOCLONAL LIGHT CHAIN
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 226
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB01
1ZTXH 4PJCB 4WJ5B 4GRMB 3RWFA 2IAMC 4WW1B 1GPOH 3DWTA 1IGMH 4JREC 1IAII 5F9WC 4PP2A 5EB9A 2IBBA 1C1EL 3DSFL 3GSXB 4M3JA 3T0EB 1CD9B 1PY4A 4DGVL 3EGSA 1HWHB 2NY1C 2EKSA 1CGSL 4D9LH 4C56A 1RIVH 3LEYH 1T5WB 1NFDF 4JN1L 5L2JA 2NR6D 3KDMA 3UPCA 1CICA 3MBEA 4Z18A 3N85H 1FG2A 5FHAH 3G9AB 2F8XC 2VDPH 3V6BR 1OWRM 4POUB 3G5ZB 4CNIB 1DDHB 1BQHB 3HE6A 2G75B 4MJ6B 5EU6B 4Z76B 1JNNH 1YQ2A 2DQIH 4P2QA 1HK6A 3MRBB 2Z91A 4HKJB 4PY8I 4BZ1L 3HMXA 4MHHI 3UTSA 1RMFL 1YEJL 2VDOL 5CIPH 1SBBA 4DGIH 1FO0A 1NFDA 5EOCL 4KROB 4BQ8A 1YJDH 3ARBC 5FGCE 3MBEC 3UZQA 5HBBA 5BV7H 1XF2B 3BPNB 4XVSL 4G8IB 5E8OA 1P5VA 2NTFB 3NFSL 4LSTL 2EDXA 5IEHB 2XQYK 1DUZB 2BFVH 5AZ2L 2XN9E 2QADD 4O4YL 1F4YL 3S37X 1XGTA 3FFCB 2Q86A 3HN3A 4XC1L 3L5XL 3IDYC 4R4FH 2GCYA 1CLOL 5E5RB 5F7UA 1RJLA 2VDLH 4ELKB 1FN4B 3FOMB 4M93B 2P8LB 1TQBB 4Z8FL 4CAGA 5D4QA 4IJ3B 1IRAY 4QTIL 5E9DB 5F88A 4XNYL 4XPHH 4QYOB 3CH1B 5HHOA 4O5LL 4D9QE 1JPST 1G0DA 2FDBP 3RWFB 3JSSA 3EOBA 4MA8H 4PP2B 1YJDC 2YZ8A 4P2OD 5FIEA 3MBXL 2HVKA 5LWYL 12E8H 4WW2C 5BV7C 3EGSB 1ZHNA 4LIQE 5F7HA 2EKSB 2DMKA 3QFJA 2J7LA 1BF2A 4C56B 1II4E 4J23A 3RPIA 5L88L 5L2JB 5CZVH 4LFHG 3WSQL 1NLDL 3KDMB 5D6CA 3WN5C 3WUWA 1CICB 3MBEB 1FG2B 3AY4A 4F2MA 3K1DA 3HE6B 3VW3H 5MEQA 4JFFE 3FT4A 2GT9A 1SBSH 4P2QB 2Z91B 3G5XA 3S5LG 1VESA 2BXZA 5JW5A 3UTSB 3QIUC 1FO0B 1NFDB 2YR3A 3HZYA 1H3PL 5DJXA 2DB8A 1OHQA 1JZ8A 2AEIT 4OCWH 3T3PF 1N4XH 1UWEH 1ZVYA 2E27L 1RUAH 4OZIB 1PEWA 3ARYA 1NMAH 4JCLA 1DTUA 4CGTA 4PB0L 5E8OB 3AC0A 5HI5C 2J8HA 2NW3A 3SQBA 1YNTA 1XGTB 4QWWD 2ICEA 1H3VA 4Y19E 4NFCA 2Q86B 3MRIA 5KW9L 4MWFA 2GCYB 4WU5A 5F7DA 1RJLB 1TETH 2AXFA 1FG9C 1KOAA 2YPLE 4WO4C 4BQBA 5F71A 4OQTL 1K8IA 5B38A 4KPHL 2NTSP 1A6WH 3KYNA 5GSRA 5GZOD 3HC4L 1FGVL 5F88B 5FEBA 4KH2A 4POZC 4GLRH 2FIKA 5E5MA 4HEPG 5HHOB 3E8UH 1C1EH 4U31A 4U6XA 2OK0H 2QQQA 4NQSA 4LRNH 4ZSOE 1F2QA 1Z9MA 1P7QA 5DLML 3EOBB 3EJZD 2VLKA 2HVKB 4X5WA 2RB8A 2H1PH 4TRPH 1ZHNB 3U9PL 4J7RA 3WKMH 1WSST 2Y7QA 3QFJB 3BN3B 4O9HH 1CDBA 1FNHA 3RPIB 3UYPA 1REIA 3LDBC 1BD2A 2ICES 3V6FA 1BBJA 3CC5A 5D6CB 1LWRA 3WUWB 2ESVE 5E4EC 2AJVL 4F2MB 1CGYA 4TNVF 3QEQD 1RMFH 3B4NA 1YEJH 5MEQB 1OAXL 3OTTA 3FT4B 4Q9CA 3WD5L 2GT9B 3GO1L 1JBJA 1WIUA 3PL6A 3GIVA 3G5XB 4ORZC 1I1AC 4N5EC 5JW5B 3Q6FA 3PHSA 3HZYB 5DJXB 3IDUA 1N0XL 2UZIH 4HS8L 4LSTH 4RMWA 4O4YH 4TN9A 4YK4B 4X5LA 4XC1H 4UILH 5DWUL 2VLJD 3DO7A 2ZUTA 1PYWA 2NW3B 5KAQG 1YNTB 4U0QB 5JPNA 5C0GA 2ICEB 3MRIB 2ZJSL 4MWFB 1I3UA 1T22A 4WU5B 5F7DB 15C8L 4X4YA 2AXFB 2QKIA 4LQFL 3QULA 1K8IB 3IU4H 5B38B 4KVCH 4M7KL 5CCKH 1KJ2L 5EU7E 4FFZH 4O5LH 1JRHI 3KYNB 5GSRB 3N1GC 1C5BL 2FIKB 5CINL 1NMCB 4PS4H 5E5MB 3ILQD 4J8RA 1YEHL 4U6XB 4LP4A 5E4EB 2CRMA 3WDJA 1YECL 4GAFB 4WFHD 1CD0A 4NQSB 5J7CC 1P7QB 2HT3D 1HZHL 3S88H 1E28A 4NN5B 3WSQH 5HYSA 4X5WB 2UV3A 4FG6D 3U4EA 4Y4HC 1ZLWH 4LDLB 4TQEL 2Y7QB 4XP4L 3KPSD 2V7NA 2GTWA 3O3DA 4FFVC 3V6FB 1BD2B 1BBJB 3S98A 4XP1H 1QNZL 3H7LA 3B2VH 1RURL 5DJ8A 5I71C 3QDHA 2XA3A 4G8GE 2HTKC 3V8CA 4CBPA 3CZJA 3C6LD 3EAKA 1H3PH 5LAXA 5AZEL 1KB5L 4HBCH 4WI2A 3PL6B 3GIVB 4R8WL 3B9EA 2F53E 1YYMH 5FDWA 4FZEL 2VLME 4FFYH 3Q6FB 3LB6D 1U93A 2E27H 5DC4B 1WAAF 4AIZA 3D0VA 2BJML 3MNWA 4PYGA 4X7SH 3MRPA 2NR6C 4YH6A 1PAMA 5C0CD 3U7WL 5DJ6A 1RFDL 2EDKA 5KW9H 1P2CA 3NIFF 1O5DT 4RFOH 3DO7B 2AP2A 1G6RL 1PYWB 1T1XA 4C54A 5JPNB 1VB9A 4U1NB 2H26A 5ALBH 4FQJL 4KPHH 5C0GB 4PRDA 4XPFL 3L5WA 4ZFFA 1T22B 3HC4H 3BUYA 4OM1L 4UT6H 3SE8L 5IR1A 4X4YB 5F1OB 2QKIB 4CVUA 2X6MA 2OZ4H 1WAAA 3QULB 4BKLA 4CMHC 4JVWA 4NHUA 5SWZA 2F74A 5GXBB 2ZCKH 1GAFL 1UM4H 5AEAA 1J05A 5BXFA 1DANU 2VL5A 1CG9A 5ITFA 1KV3A 3X11A 4TYUA 4XCNA 3S3PA 3OJ2C 4J3OC 4J8RB 4X9BA 4OQTA 3MUZ1 4K8RH 1SEQL 2J88H 3U9PH 3V7AG 1TITA 3RBSA 7CGTA 1MCPL 1JL8A 1E28B 1T7XA 3IS0X 3PWJA 4KU1A 5CFHA 5HYSB 4UI2A 1JF5A 3U4EB 3V8OA 2CPCA 2P45B 4P2OA 3EDFA 1MFEH 4KJWD 3WMSA 1V7MH 5I1KL 1UACH 2V7NB 2GTWB 3O3DB 2W07A 5HYJE 4JPKL 4WTZG 5GJTL 3IU3B 1OAXH 3TVMA 3GSNL 4LLMA 3GO1H 4X9HA 4JFQA 5E95B 5DJ8B 1UEYA 1DFBL 1OOAA 2ENYA 1IC4L 3OJMB 5LAXB 3F5WA 2BVQA 3O6LL 2VQ1A 1NEZA 3JTSA 5FDWB 4HS8H 5CJ8A 1PSKL 4P2OC 4JO4L 4EBQH 4RAHA 3TBWA 1U93B 3QXUA 5I1HH 1TPXC 2Q76A 2R2BA 5DWUH 4AIZB 2EIDA 3D0VB 3MNWB 4KRLB 4WEBL 5MEPA 3U2SA 4CMHB 3MRPB 1S9KC 3RU8L 1MFCH 5DJ6B 4QNPF 2UYLA 1OY3B 1P2CB 4X4MA 4L3ED 1BEYH 1T1XB 4LQFH 4HJGA 2H26B 1OD7A 3SGEH 5D71H 1KJ2H 4PRDB 1S5IH 3DPBA 1XGUA 3L5WB 5E7BA 4ZFFB 2X89A 3BUYB 5HHVL 5IR1B 2QADB 1WT5A 1FDLL 1XCQA 4BKLB 4WHCA 4NHUB 5SWZB 1YEHH 2F74B 4JB9H 3RVTC 2ZP0T 1J05B 2ZOKA 3OKLA 5BXFB 2VL5B 3SKJL 1YECH 1D5IL 2AJSL 3LKSA 3PUCA 5C0IA 1C5DA 1CG9B 5ITFB 3X11B 1HZHH 4UIMA 4XCNB 3P4MA 4LSQH 3V5DA 1C12A 3QUYC 4DTGL 4QHLA 1J1XL 3ARZA 3BIKA 5AG8A 4GRLD 3TBSA 3SO3B 3PWJB 3KPLA 4S0TD 3QI9A 2NY5H 1MHCA 2C1OA 5DURD 3T0WA 2YD4A 3HNSL 4OGAC 5L0QC 4P2OB 1MCLA 4U49A 3B43A 5FYKH 4EI6A 5IHZA 4OLEA 2OSLA 1RAMA 2W0FA 5IB2A 5IP4A 2P5WA 3TVMB 3KS0J 4LLMB 4P5MA 4JFQB 1KB5H 3ARGC 4R8WH 1LDPL 4J3VA 5C0JA 5DYOB 2NCMA 4DN4L 3QDJD 3CLEL 3ULUH 2A6IA 3F5WB 2BVQB 2VQ1B 2BJMH 1NEZB 2UUDH 3JTSB 3U0WL 5CEZH 3EJZC 2XY1A 2XTJB 4LVOC 3TBWB 1R5VA 2XZQH 5DQDL 3U7WH 4LCCA 4L4TD 1RFDH 2A6KA 3OAYH 4OLZH 2Q76B 2R2BB 3EYUL 5I0ZA 1X7QA 1ZVHA 5E1HB 5MEPB 3U2SB 5INCA 1MWAL 1U92A 3SJVE 3V9FA 5ITBL 2UYLB 1R3JA 2RIKA 4XPFH 3HE7C 3QG7L 5D2NE 4XPBH 4HJGB 3RY5A 5C2BL 1TJHH 2VLJA 5HGBA 1XGUB 1I9IL 5BJTA 1XCQB 4I3GA 3TM6A 1DBBL 2EZ0D 2CKBL 4HFUH 2ZOKB 3OKLB 1N59A 4G7YL 4N8CL 2DL9A 1JI1A 3LKSB 5C0IB 1C5DB 3GBML 3BESR 1X5HA 5EZIL 1MCPH 3RL1A 3ULUC 3R8BB 5IM7A 3OAZH 4UIMB 4FMFA 4M7LL 1CFVH 3P4MB 3TN0A 3JV0A 1R6VA 3V5DB 2W0KA 5I73B 4HHAA 3BE1L 1C12B 4KDVA 4PJ7F 2D7PA 3TC9A 3S96A 4YE4L 3ZDYF 5KSAC 1BZ7A 4QHLB 3BIKB 5I1KH 1XIWD 2AEQL 2OL3A 5MP6H 3TBSB 1UFUA 3KPLB 2E7CA 3QI9B 5GJTH 3VG9C 4GMTH 1MHCB 4OCXL 4LCWD 2C1OB 1HHGA 4LPVA 1GC1L 3MV01 4EI6B 2LQRA 1KC5H 3ESUF 5IHZB 2DF3A 2OSLB 5DD5H 2W0FB 5IB2B 2IQAA 2HH0H 2P5WB 4G6JH 3D48R 4P5MB 3MV8E 2KZWA 2YZ1A 3O6LH 4PJ7A 1NCWL 3ILQC 5E5UB 1GGBL 1PSKH 5C0JB 1ADQL 4JO4H 3VRIA 1F90L 1A8JH 2J12B 1CS6A 4P9HH 3SCMC 2A6IB 3D39A 4P4KD 1QRNE 3GSNA 3IDXH 4WEBH 3NVQA 1AC6A 4PRHD 3C6LA 2ERJC 4FG6C 1R5VB 4LCCB 1V7NL 2A6KB 2C3XA 3TT3H 4RAUA 1X7QB 4JG0L 3HMWH 3E2HC 1CF8L 5INCB 1U92B 2ZCHL 3PDGA 5F6IC 1R3JB 4YHKL 3RJDA 4MNQD 5C0CA 1O7VA 5B3NA 5BMFH 4WIQA 4NKOA 2VLJB 5ESVA 5HGBB 4LFHD 3BXNA 4WI5A 3S36X 3SKJH 1DBJL 4HWZA 1E6OH 4TUKL 5BJTB 4PJXF 3T2NL 4ALAL 4ZNEE 3EYFA 1HHJA 1BJMA 4XCCH 1YEKL 1A6ZA 1QSEA 1N59B 3B9VA 3VFGL 1I3RA 4O51A 1WQVT 1ZK9A 1J1XH 3RL1B 5IM7B 4WV1C 2HTLC 4FHBD 5B22A 3TN0B 4G9FE 4HHAB 3D1MC 3S96B 2KPNA 1BZ7B 1NH6A 3R1GH 3HNSH 1X4YA 1HHHB 1MCCA 4WI4A 1URLA 1YA5A 2OL3B 4PJXA 5EO0A 2DJSA 1HHGB 2X1WL 1DN2A 1ND0A 3LOWA 3PGFH 1LDPH 2JJUA 3IDIA 4S1RL 5J3HC 2SEBA 3AM8A 1AR1D 4M1DL 2MHAA 2IQAB 1WICA 1IAKA 4MDIA 4XI5C 4PJ7B 3SDCD 4OQ1A 3OMZA 3VRIB 1EBAA 1S7RA 1LO0L 3UBXA 4ZTPL 3BJ91 4U7MA 1F13A 3D39B 2QSQA 3GSNB 1U3HA 1OVZA 3ARTA 3C6LB 2VZOA 1AQDA 5ITBH 4JO2H 1QR4A 4JY5H 1OTSD 2J5LC 3S3JA 4JFHE 4LVNC 4RAUB 5TQ2H 2P5ED 5C2BH 1AHWA 5J1TC 4UINL 4UUJA 2Q7YA 1CFBA 5K59F 1I9IH 1LO4H 5EG6C 1Z2KA 3FQRA 1QYGH 2IG2H 5C0CB 4HS3A 3GKWH 3KPNA 1X6LA 4TSBH 1DBBH 4NKOB 1MWAA 4QOKE 5ESVB 5ISZD 3S4SA 3C2AH 3BDXA 3BXNB 4HH8A 3Q5OA 4HWZB 3GBMH 4WHYG 1JV5A 4MXQD 3EYFB 3WBDA 1CXEA 1HHJB 3BD3A 1AHWC 1A6ZB 1FGNH 1QSEB 3BE1H 4DZBA 1I8KA 1I3RB 4E41D 4O51B 1FIEA 2AEQH 1DQMH 1JGVH 3BKMH 3QUKA 3QDAA 2AI0H 5C0NC 1NUNB 1UXSA 4KI5C 3FB6A 3A6CL 4N9OB 1EHAA 3BISA 4U1GC 4PJXB 3W0WD 5EO0B 2XV6B 2YUWA 4P2QE 4RCAA 2ZCLL 4GRLA 2I24N 1FL3A 1ND0B 3QXTA 3IFNH 4UAOC 1ZGLA 1S78D 3IDIB 1GGBH 1ADQH 2SEBB 1F90H 1NFDE 2QEJA 2MHAB 1E4XH 2AK1H 1KIUA 5EWIL 2UY7A 3PP3H 1IAKB 4MDIB 5BOPA 2Y07H 4OZIE 1S7RB 1C8PA 3UBXB 5D2LE 4YDKH 3VG0H 5DD3L 1N64H 3CSPA 1YC8A 4MVBD 1UM6L 5DMIL 2QR0A 1U3HB 4IS6A 4JKPH 1CF8H 1KSRA 1AQDB 3EO9L 1QSZA 2W9DL 2PYED 2P4AB 2V7HA 4YHKH 4HGMA 3VXSE 2VLRE 2R2HA 4L4TA 1AHWB 1GC1C 3P9MA 2EC9U 2IANE 4UUJB 4K2UH 3BKYL 2Q7YB 3QT2A 3UROR 3FQRB 2R0KL 4TUKH 1AE6L 1FFOA 1OQOA 4HS3B 1JPGA 2DQTL 2E9BA 3KPNB 3BHBA 3U30C 1MHHA 2DM7A 1MWAB 4UOJA 1YEKH 1F4WL 1CK0L 3S4SB 3Q6GL 2FIRT 4IRJD 3VFGH 4JO1H 3G5VA 4AEHL 4M5YH 4JCMA 1RI8A 3VXQA 1JV5B 5ILTL 4ZUUA 3ARPA 4DZBB 1MCHA 1MEXL 1I8KB 4EDXA 1H8OA 3TBVA 1DANT 3SEPA 1S7SA 3QUKB 1AGDA 2W0LA 3O41A 4NM8H 1MLCA 3MNVA 2Q87A 3BGFB 2VXVL 1UXSB 4TNWF 3ULVH 3RTQD 4JFYA 3JWOH 4S0SD 3FB6B 4CMMA 1ZANH 4NBXB 3T0DA 5DRZA 3MLVH 1XIWA 3D18A 4GRLB 1FL3B 1CL7L 2MWCA 1EJOL 2YD5A 5HVFB 1ZGLB 4XNXH 2EZ0C 2PTTA 3O4LD 1JHKL 5DURB 1BVZA 4U33A 4X7TA 3CDFA 5FYKU 4HIJA 3QZWG 4AG4L 1EBPA 1I3GH 2HFGL 4RGNC 1HNFA 1UG9A 1RVFL 1RZJL 1XIWC 4E5XA 4D9RE 2QR0B 4IS6B 4K94H 4D0BA 4UT9H 1Q72H 3FTGA 4UINH 2V7HB 1BMGA 2W38A 4WFFD 4PRHA 1K6QL 4HKZA 3L1OH 1PBYA 4EKXA 2R2HB 3CVHL 4Y2OA 1IQDA 4L4TB 3VGBA 5IMLA 3P9MB 4XTRD 3CX2A 4LHJB 1KACB 1BX2A 4MLSA 1GZQA 2ED8A 5TPWH 4DVBA 5C2UB 1NUDA 2NYYD 1I8LA 4WUKL 4M4PA 3MJGX 1FFOB 2RCSL 3NIGE 1JPGB 1UGNA 3MRFA 3BHBB 1MHHB 4NDMB 3CFKA 2ADFH 4OUOA 4P4KC 4MNQA 2R0WL 4TSCL 3G5VB 2I5YH 1I3VA 1OP3K 3VXQB 2DD8L 1A6UL 4HFWA 4WFED 4ZUUB 5BW7A 1KIQA 4LBEA 4KY1H 4EDXB 2YK1L 1G0YR 1QBLH 4LHQB 4MAYD 1TJIH 1S7SB 1AGDB 3O41B 4K94C 1MLCB 3MNVB 4M6MH 3K81A 2KUTA 4JFYB 5GRYA 3AROA 3S5LA 3KXFD 4CMMB 4Y16A 1NKOA 3QWOA 2AQ2A 4F57H 1NCNA 1F6AA 5DRZB 1XIWB 3D18B 2B20A 2D0HA 4XWGL 2PTTB 3FHQA 5DD3H 4YEFA 5FCUL 1T1ZA 3HMXH 1UM6H 4PY7A 4HIJB 4P59H 3EO9H 2QHRH 4OZFG 1TENA 2AV7A 5DVOA 3BPOC 4F15C 5IFAH 4E5XB 2XKSA 4I13B 4D0BB 1JZ4A 4G80A 5ALCL 3IDMA 4YPGA 3FTGB 2B1AH 4QXWA 3BKYH 4UV7L 4L29A 4PRHB 5BO1L 4HKZB 5FFLA 1IQDB 1AR1C 5IMLB 2CDGA 4AH2A 1LK2A 2NLJB 4LMQE 4Y2DD 1UT9A 1BX2B 3SKMA 1GZQB 4MJID 4DVBB 2P5EA 3SGKC 5B21A 3SDCC 4AEHH 1OPGL 3A0OA 4MMXC 1TJGL 3RY6A 4R2GD 2XA8L 3MRFB 3V0WL 4JFXA 5GISH 3CFKB 4UB0L 3AMLA 2PN5A 3P9WB 4MNQB 4ODTL 2H2SD 3F58H 3K4DA 3LN5A 1A1NB 5JHDD 1OAQL 5JXED 2C3WA 4HFWB 2YD9A 1OTSC 3EO0A 3PNWA 1KIQB 4OAWA 1WTGT 3MJ7A 5FYJL 1IKNA 4TTDD 1PKQA 4LBEB 4PRNA 3WL9A 2ZUUA 4ENEC 4XNUL 3OV6A 1OTUD 4E41A 3NZHL 4HZLA 4MJ5A 3BMWA 3ZE2E 3D3VD 3KJ6L 3S5LB 3W11D 4Y16B 2LTQC 1RUQL 3QWOB 3OBAA 1JHKH 1BQLH 1RUML 5FM4A 1ZWIA 1F6AB 4ONOA 2VXTH 4OBRA 4MXQC 1G6VK 4NQCD 1DLFL 5I8CA 1WIOA 4AG4H 4X0KA 1CXHA 2OYPA 2ARJQ 1RVFH 1T1ZB 1RZJH 3GBNH 5C3LD 4PY7B 3A67L 5DMJB 2VERN 3K8MA 2QL1A 1MI5D 2X7LA 2AV7B 4GKSA 2RBLA 3CXDL 2CMRL 4ZAKC 5IKCA 2FEDC 3P0VH 2YPVL 3NOIA 3DUHA 4G80B 2PUQT 2FHCA 3IDMB 1JGUL 4YPGB 3GJEA 4ZOEA 4JRXD 4LSPH 3MLZL 2ZNWA 5DJ0A 1X5FA 4L29B 4MDJA 3KLHD 4WUKH 4PJHF 2P43B 2PYEA 2CDGB 2EXWD 4AH2B 1LK2B 3FMGL 3ARVA 2AW2A 3SKMB 2BDNH 1BREA 5E56A 2R0WH 2P5EB 3NIFE 5T3ZD 2J6EA 32C2A 2VUOA 5I66A 4OUUA 5BCAA 3MV7E 1U3JA 1ZLSL 4UTAH 4JFXB 5IBTL 2Y23A 4HWBH 4LCIL 3LN5B 3GNMH 2VXSL 4APQA 3WS6C 1RZJC 4OLVH 3AXLA 4PJHA 3EO0B 3PNWB 5KOMC 2FBJL 4OAWB 3BP5A 4RGMB 3MJ7B 1PKQB 4PRNB 1RD6A 3WL9B 5CZXD 1JMXA 3QQ4A 5T1DH 1QFUL 1YY9D 3QCVL 4E41B 4KQ4L 4HZLB 4MJ5B 1B6DA 1UZ6F 2FGWL 2N1KA 2YMXL 5B3JF 1FVEA 1EEQA 4JFZL 1ZWIB 4IRJC 4WFGD 1JWUA 3F8UB 2GJ6E 5LQBL 3UXFA 5FCUH 5LXGL 2F5AL 3HI6H 2AJYL 2PKDA 3PGCA 3VFTA 4MA1C 5I8CB 2Y36L 2X1OA 4X0KB 1D7FA 4ODHL 5EUOE 4EI5A 4EEEA 4RRPG 1NCBH 5JIHA 5L2KD 5ALCH 1HCVA 2EH7L 1IBGL 4P9ML 3UYOD 5F7EL 5AD0A 2X7LB 1S7TA 1DBAL 4GKSB 3RTQC 4UV7H 3O6FD 5IKCB 3VDBA 2BZDA 3ZT6A 4PJGE 4DUXA 4K3EL 5HPOA 3GJEB 1AXIB 1T83C 3K80A 5DJ0B 4D3CL 4MDJB 1NCUA 1MCFA 4MQSB 4PGCA 3DLQR 5I1EL 3VWJC 5A16A 4MQXC 2PYEB 5T3ZL 4XCFL 4OF3A 2W9EH 2AERT 4ODTH 3UJIL 4J12A 3BRFA 3OZ9H 32C2B 5JR1L 3VGDA 5I66B 2F54D 3B8YA 4XMLH 3SE3A 2D4FA 3NPZB 3CFDA 1OAQH 1KNOA 2A74A 5FYJH 1LILA 3WO4C 1CCZA 1H15A 4APQB 3QDGD 2GAZA 3IRPX 5SX4H 1TNMA 3AXLB 4PJHB 1Z3GL 4XNUH 3BP5B 3U9UA 2GSIA 2XT1B 3NZHH 2D7TL 1A5FL 4QXGH 4ZD3H 2LVEA 1M7XA 1S7VA 3QQ4B 4XTRC 3KPRE 1KCSH 1TVBA 1BBDH 1RUMH 2R9HD 2V9RA 4OCLC 4BQ6A 1UYWL 9CGTA 1F4XL 3WNMA 4BFEA 1H8SA 1FVEB 1AO7E 2KQMA 4BELD 2NY4B 4ODUA 1BIHA 2L7JA 5D72L 3TH2T 4N0CD 2E7MA 1JWUB 3D5OF 3QEQE 1JZ2A 1DBKH 4R97C 5JW3L 4YGVA 1JPFA 4MQTB 4CN6A 3A67H 1IGFL 3B5GA 4ODBD 3PGCB 1OB1A 3VFTB 3ZYJA 3IB4A 1G9NH 3EYOA 1OP5K 5DRWA 3KS0H 3IT8D 2ZUSA 4Y7MA 3MQIA 5EO9A 3ZHLA 2CUHA 3CXDH 2CMRH 1AD0A 4MNGE 4EDWL 2QHLA 4I48A 4EI5B 4MAYC 4Y89A 2YPVH 1FBIL 1JGUH 5B8CC 5AD0B 2Y6SC 1S7TB 3R4DA 3ULUE 5AWNL 5CEZE 5DJYA 4PG2A 3O8XD 4EUPG 2ICWI 2C9AA 1QSFD 3FMGH 4QRPD 4KKAD 4PJIE 3ULSA 1SM3H 3V95A 4PGCB 2IJ0C 3WFHA 1IM3A 3DYOA 5A16B 1R0AH 3WXWL 1V5JA 5CGMA 3BP4A 4AT6A 3LN4A 5IBTH 5CLWA 5I17A 5TDPA 2AEWA 4LCIH 3MRRA 3O81A 1TXKA 3OB0H 4Y2DA 1KNOB 2A83A 2VXSH 5CSBA 3IYLW 1BGXL 5DSCA 2A74B 4Z0XA 4G6AD 3EDKA 1G9NC 1RIUH 5EU4A 43CAA 5DO2D 1H15B 4XAKE 4ZS6D 1PG7X 2GAZB 1QFUH 5BOZG 4YUEH 4IOIA 4KQ4H 3U9UB 5JHDA 2GSIB 3L7FA 2FGWH 3PV6A 4HEME 1FC1A 4HCRL 5I8KH 1S7VB 4Y2DC 4OD2A 1TVBB 3DTXA 4M03A 3DX6A 4JFZH 3KPSE 1G7HA 3CK0L 1ZLUK 2BNRD 5LXGH 3ZDYE 5CSZA 3ARUA 3O4OB 4KXZH 1KN4L 1U42A 4ODUB 2PETA 2H2SC 4ODHH 1CZ8L 4GXVL 4NZTL 4H20H 1JPFB 1Q9OA 4YGVB 3ZTJH 1VSCA 5JXEC 1OB1B 3E0GA 5KS9F 1GGIH 3BZDA 3EYOB 4ZOCA 3VI4F 4P9MH 5DRWB 4HG4K 3QRGL 3NH7L 3MOQA 5EO9B 1LNUA 4M7ZC 5C92A 4BUGA 1AD0B 4YX2L 3J7HA 4I48B 1UJ3A 3O45A 3RHWF 3VFWA 4X9IA 1OTUC 1KUMA 5BS0D 3MRLA 1YNLL 4NIKB 1GOGA 3NGBC 4KTDL 4NQDD 3W11C 1Q0XL 5DJYB 1INDL 1MI5A 1GZPA 4WWKD 3KR3L 1PFCA 4GKNA 4WI3A 3ULSB 4X6CF 1DQLH 3L3IA 1KN2L 1QKZL 5TFSL 5KS9A 3P40A 5E4IA 1CE6A 5HGGS 2KL6A 4U1KA 3WFHB 1IM3B 3RDTC 5JXAL 3PJSA 4W4OA 3BP4B 4AT6B 2B2XL 4JRXA 1WFUA 3LN4B 5LCVH 2NW2B 3MCG1 4OD3L 5I17B 2EH8L 5TDPB 4J3UA 2D9CA 2W0PA 5T3XD 3I02A 3MRRB 4ZUVA 5TF1L 1LO3L 5ACLA 4Y2DB 2A83B 3RKPA 1LHZA 1Z3GH 5DSCB 4Z0XB 3RRQA 3TH3T 3UP1A 3DIFA 5D5MF 1N5AA 4O2CA 2D7TH 3JXAA 5EU4B 43CAB 4R2GB 5EORL 4X6CA 3E6HA 4RNRA 3R0MA 4KK6D 3TBYA 2Y5TA 5CJOH 3WFBH 2AAVA 4CN4A 4MYWB 3L5IA 4IOIB 5JHDB 3L7FB 2X70A 2DI7A 2V5TA 1F4XH 3PV6B 2JJWA 5CBAA 1KCRL 5EC2A 3ZT7A 1OAKL 3HKFA 4OD2B 3DTXB 3DX6B 5C08E 5D72H 1HKLL 4TPRL 4KJQD 4ODXA 1I75A 2LU4A 4I18A 5CSZB 5JW3H 5D5MA 1W72L 1OARH 1BFTA 1KELL 2D0GA 4HDIA 3PHOA 3OXRA 2OS7A 4HK0A 3WO3B 2KBGA 1K2DA 3K46A 2C4FU 1Q9OB 1CFSA 1YMME 1VFUA 4YBQD 1CTOA 4XP5L 2Z0BA 2EYRA 3EO1A 1LNUB 2EE2A 1OQXA 3DVIA 5CZXC 1UJ3B 3O45B 2PXYD 3VFWB 1YY9C 1UH4A 1L7IH 1PLGL 1EGJL 1WWCA 4P3CH 3MRLB 2B1HL 5IEKA 5JW4Q 3Q2CA 1OCWL 4U3HA 1T1WA 1HQ4A 4LMQI 4PJAF 3F6LA 1MI5B 1GZPB 2X4PA 4L3EE 4AIXA 4KI5E 4GKNB 4FQLL 3MV9E 3L3IB 4C58B 5KS9B 4TTGA 2R8SH 2VC2L 2C3GA 1CE6B 2EIEA 3FKUS 4U1KB 1TLKA 3PJSB 1MFBH 5T3XL 2XN9D 4JRXB 2CIKA 4NOBA 1JPSL 2QQKH 4U0RC 2V2WA 1KTDA 5SV4A 3I02B 4NP4L 4ZUVB 1VEPA 3MX0A 4Z7NE 4LSDA 2IGFL 5C6TH 4PJAA 3W39A 2ZKHL 3DIFB 3O6FC 1N5AB 2V9TA 4O2CB 3VFUA 3W5MA 2R1XA 4X6CB 5DUML 3E6HB 3RZCD 1WITA 4RNRB 4HCRH 4YQXL 3TBYB 1XGQA 2Y5TB 2QSVA 2B8OT 2ZG3A 4DKEL 4DEPC 4BK4A 4D9QD 1AFVH 3B9DA 2X70B 3QDGA 1MOEA 4Q6YA 3EHBD 5CBAB 5EC2B 3KYKH 3JWDH 2V17L 1JI2A 1KN4H 4J3XA 2DDQL 1FPTL 2PO6A 4P2RD 5F6HJ 4XC3L 4ODXB 4O2EA 5JIIA 5DRNA 2DM2A 4I18B 1X5LA 1AY1L 5D5MB 4P46D 1QA9A 4HDIB 3PHOB 5C7XH 3QRGH 1PY9A 3OXRB 4HK0B 4G43A 1K2DB 2Q8AH 1QEWA 3QDJE 4YX2H 2FX9L 4YR6A 1CFSB 1CLYL 4RSVA 5MENE 1CQYA 2HN7A 2XPGA 3EO1B 2EYRB 4NJAH 5IROA 5ADOL 1HHKA 4KJPD 1INDH 2WIMA 5DA4A 4U0RB 1QKZH 1BWWA 2BNUA 5AUMA 1T1WB 1HQ4B 5DD0H 2X4PB 1T6WA 5HHMD 3DNKA 4N0CC 3KYAA 1FL5A 4NHCL 1UJTA 2EH8H 3O8XA 2Z35A 3OR7A 1I7ZA 5TF1H 1V3LA 4YNYA 1KEML 1T7YA 2CIKB 5DI8A 4JFEE 4CJ1A 2V2WB 5SWSD 1KTDB 2A77L 5EORH 4FQXA 2DQGL 1KCVH 2WZPD 4LL9A 2DKUA 1AGBA 3RA7L 2HLFD 4PJAB 4TOYL 3W39B 3MRNA 2APBA 3VFUB 1CIUA 4R4ND 2NY0D 3OR6A 2R1XB 2NY3D 4NC0B 4Y1AE 1FNLA 2Q3AA 1XGQB 5D7SL 1KCRH 1MAMH 4RGNE 1OAKH 1Q9LA 3GMNA 1WJ3A 3U82B 2YD3A 4CU8A 4RIRA 4LPTA 4NQVA 1HKLH 3VI3F 3O9WC 3X12A 2DIJA 1A6TA 1T7ZA 3QDGB 2OM5A 5FYJU 1DL7L 4HIXH 4XPGL 5DMGD 2R4RL 1W72H 4LCWE 3OJVC 3VWKA 2IBZY 2PO6B 3CSBA 2CLVA 4TVPD 3HI5L 1OWWA 4O2EB 4NM4L 3QIBD 5DRNB 1F4HA 2EDNA 1UM5L 5F1NA 5J1AA 1TNNA 4DOHB 2FATH 1E4KA 2MFNA 2QQNL 1QA9B 3MUJA 5FAAA 2BNRA 4G6AC 4JM2D 4X5XA 4XP5H 4G43B 5J6GA 1JUFA 4NFDA 1QEWB 2DIAA 1HYRC 2QSCH 4MS8D 4QKXB 4YR6B 4UIKH 5J57B 2JJSC 3I6KA 5FCSH 4LLDA 2HN7B 2XPGB 4F9PA 3STLB 1HHKB 2Z8VC 3MYZA 1PX3A 1R24A 4HMDA 5A2LH 4I3RH 2AVGA 3X3GL 4PRPA 4M7JH 1ZLVK 1E4KC 2NXZD 5DFTA 3G04A 2BNUB 4Z7UF 5AUMB 1A0QH 4PBVC 4KC3B 5A3ID 1VENA 4ZS7L 5BS0A 2FYYA 3MLUH 4JZJA 4PLJD 2A73A 4NQDA 3L5HA 1BLNA 1EGJA 3OX8A 3O8XB 4JPWL 2Z35B 3OR7B 4WWKA 4ZXBD 3THML 4EQ3A 3CU7A 1I7ZB 1F6LL 4E9LA 3DI3B 2NY2B 4QRRD 4YNYB 1FH5L 1DJSA 3RBGA 5GS3A 5DI8B 5DXWA 1MCSA 2VDRH 1IZJA 2HYMA 5M95B 1A21A 3IJSA 4FQXB 5DUMH 3QCUH 3TA3D 2ZPKH 1T04A 4Z7UA 1AGBB 1R3KA 3RIFF 4DKEH 4G9DA 1WFTA 4FA8A 3MRNB 1NAMA 3N1MC 2W60A 3OR6B 3I3BA 3F7YA 3GMNB 1Q9LB 4YWGH 1XGYL 2DDQH 1FPTH 3C8KA 3I6GA 4LSSL 4XC3H 4XT1C 4NQVB 5DJAA 3X12B 4U2YA 4JFDA 1A6TB 4HXBH 2OMBA 4TVPL 1MCWM 1E6JL 5F1KC 3VWKB 1DZBA 3QZWA 3MLYH 1DQJA 3HNTL 3MPCA 1G1CA 2CLVB 3MNZA 4PJ9A 4OCSL 3QHZL 4MXWH 1ZV5A 4X7FC 1WVZA 5GGTH 3UO1H 5F1NB 5J4MA 1P84J 3V6ZA 5J1AB 2NQCA 4LDEB 1CLYH 3KVQA 1PD6A 4JY6A 5IMMA 5CEYA 2BNRB 3LEVL 3REVA 5F72S 4NN6C 4G6KL 4X5XB 1AH1A 1L7TL 2D7NA 2X4TA 5J6GB 1JUFB 5ADOH 4GO6B 4KK6C 1I8IB 3SGDH 3N50A 2H2PD 4X80L 3I6KB 1W0YT 5ADPH 2WMPA 4G8GD 5K9JL 4LLDB 4YDIL 2P44B 2IBGA 1BFVH 2BX5A 4GAJH 1T0MA 3LD8C 2F53D 1R24B 2VLMD 1HXMA 5IUSA 3SDYL 4PRPB 4MXVE 5IHLB 4L8SA 4KJQC 4NC1C 4L1HA 1G0XA 2CSPA 2NXYB 4LPYA 3G04B 3RZWA 2PXYA 5ID0A 5FA3A 1KENL 5CS7A 5BS0B 4ZUSA 2FYYB 5KVMC 4JZJB 2VQTA 2A73B 4NQDB 3BW9A 1KEMH 5CP3A 3GI8H 2EDWA 1P1ZA 1X5XA 3VXNA 4LARL 1BLNB 4M1CD 3SPVA 3OX8B 4KV5E 5HVHB 5D7JD 4WWKB 3GMOA 2X44D 3QCTH 5ISZE 1B90A 2DRUA 4JGJA 3C2SA 4M4RA 1A7RH 3WFDH 4IEFB 2D7QA 1OTTC 3ECBA 3QO1A 2QBWA 2EDOA 4Z5RA 3CFBA 1NQBA 1JGLH 3IJSB 3TJEL 2XN9A 4K7PY 5IMOA 3DX7A 1T04B 4Z7UB 4KKLD 5IT2H 1R3KB 3OQ3B 4G9DB 1NAMB 4M48L 2W60B 3MFFA 2WP3T 2DTSA 3GI9L 1S3KL 4WENB 1DL7H 4MZ3A 3F7YB 1GHFH 2R4RH 4XPGH 3U4BH 3C8KB 3I6GB 4JQXC 5DJAB 4JFDB 3HI5H 2VLLA 3MXWL 3W0WE 4NM4H 3MOAL 3GMPA 1OT1A 1QP1A 1UM5H 3IXAA 4H26A 1QUNA 1BZ9A 3QZWB 5KANG 1DQJB 1J88A 4OZFA 4JQVA 1TIUA 3MNZB 4PJ9B 5JTWA 4M1GL 3FFDA 4YZFE 3T09A 2DLGA 3P4LA 3V6ZB 3RWDA 3RWGA 4P2RA 5D1QA 5CJQL 4JY6B 5IMMB 5CEYB 1SY6L 1ZVSA 3REVB 1H3UA 1UWGL 2X4TB 4P23D 3RZCC 1MF2L 3H42H 1OL0A 4KKBD 5DQJA 4LLUA 3V4PH 2J1KA 4TUJA 3JUZA 3K0WA 1T0MB 5IHBA 2AQ3A 3O0RL 1AQKL 1KCUL 1MH5A 3FO0L 1FFQA 3G6JE 3BGAA 4L8SB 4HUMB 1CT8A 2P48B 2PXYB 5DEGA 5FA3B 4JPWH 5ID0B 3HUJE 4MLIA 4ZUSB 4P46C 3FN9A 1FH5H 4MNHA 1S7QB 4NO2A 3BW9B 1IM9A 1TZGH 1P1ZB 3VXNB 3ARDA 4N9GA 5FGCB 3NABL 2H41A 1BAFL 3B9AA 4KK9D 1E27A 3GMOB 2AEPL 2XIDA 1QBAA 3P30L 4OFKA 4KKNA 4CRPA 3ECBB 3NA4A 3QO1B 4Z5RB 3CFBB 3N0PB 4OSUL 4L5FL 4PBWD 2X42A 4S10A 3K1KC 4KJPC 2XN9B 2E3VA 5IMOB 3DX7B 3DX8A 3TYFA 4M6NL 2BK8A 5TE4L 1XGYH 1S7WA 2X5PA 5GS1C 3MFFB 2HJLA 2YPLA 5AG9A 4J2XA 3HG1E 1KJVA 4WGVB 4TVPH 5GJSL 1E6JH 4NSKA 4Y5XC 4GSDH 4BFGA 1WF5A 1U8MA 3U46A 1KEGL 4RFEA 4I77L 1MNUL 2VLLB 3QHZH 1PW3A 1C7SA 3K4ZA 1R3IL 3ZKSD 3GMPB 4NQXA 5LKNA 3IXAB 4H26B 3H8NA 4JFOA 1RSFA 1Z9OA 4P5TD 1BZ9B 3VD7A 2PF6A 4KAQL 3LQZA 4OZFB 2R29H 4U3CA 3LEVH 1JJUA 4YC2C 3O4LE 4ZSOA 3FFDB 5J6HA 1Z5LA 4LKCA 2Z93A 1WWAX 5KVFL 4G6FD 3RWDB 3RWGB 4P2RB 4W4NA 5D1QB 2HLFC 2FH6A 1ZHKA 4HPYL 3QIBA 1ZVSB 3D87B 4UDTA 4XMPL 5K9JH 1RZ7H 3EJYC 4R4NC 2NY0C 3ARFA 1YN7A 4YDIH 2O5YL 1W8NA 4M5ZH 3RVVC 5C0FA 2QV2A 2KH2B 3UTQA 5DQJB 5KVDH 3QG6B 3SDYH 2VYRE 1T7WA 4LLUB 2ESVA 2VZSA 4TUJB 4NZDA 5IESL 1INQA 2R0LH 3UMTA 1KENH 4NWUH 1NGQL 1MH5B 3GFUA 3UYRL 4WFFE 4JJ5A 2MKLC 4OFDA 3DV4A 1CT8B 4LARH 5JQHC 3BP6A 3KLAA 5DEGB 3WLBA 2RFXA 3K2MC 1U3ZA 4PV9A 5TF0A 1MJUH 1TDQA 4G5ZH 3BH9A 4MNHB 4NO2B 4JM2C 3FRPA 4P2YA 1IM9B 5GS1B 4JRWA 3ARDB 1KB9J 2A6JA 4N9GB 5DD6A 3FN3A 1JPTL 1E27B 4FABL 2R0ZH 4OGXH 1A7NL 3F12A 2JIXD 3TJEH 4L8BA 1NBQA 3TIEA 4PJ8C 4ZXBA 4MCYA 1DSFL 1OT2A 1MQKL 4M48H 4Q2ZA 4WFEE 4QRRA 3IVKA 3H2WA 2VDNH 3DX8B 5GRVK 3TYFB 3B2UC 2DQJL 4DQOL 2MMXA 2VQUA 2NXZC 3RVWD 1KT2A 4H25A 1S7WB 1XZ0A 1DN0A 1CR9L 1D5MA 2HJLB 2YPLB 5FYJE 4MD0A 3PWLA 1KJVB 2E9WA 3ZKXC 5DVNA 2XQBL 1J86A 3LRHA 5BVPH 4NSKB 4IRZL 2NX5D 1U8MB 1D3CA 4XH2A 3D9AL 3QNYA 1E4WH 4GH7B 3KXFE 5D7IE 4RFEB 2NY3B 4R7NA 3U46B 1JMZA 4PJFE 4L8CA 4M1GH 3CX5J 5FGBA 2A2QT 4NQXB 3TPUA 5F8QC 4JFOB 1NFIA 5CJQH 1J11A 3LQZB 2BC4A 1RULH 2XOTA 4R0LC 1ROWA 4X9GA 3EDDA 2VO5A 1UWGH 4ZSOB 4YXLL 2W92A 5J6HB 3X17A 1Z5LB 4LKCB 1OLLA 2Z93B 3TA3C 1CD1A 1E4XI 1ZHKB 3QIBB 4UDTB 4DK3A 3ARFB 1YN7B 2HWZH 1OAZL 3VGHA 5C0FB 5LBSL 2G5RA 3O0RH 3RAJL 1IL1A 3UTQB 1KCUH 4NKMA 1KULA 3IFPA 4J6RL 2ESVB 3UZEA 3VMOA 5IWLC 1XR9A 1U0QA 5D7LD 1INQB 1UADC 2UZXB 5I19H 4WHDA 4UBDD 4FFWD 2FX7H 4G8GA 4GAGL 1H9VA 5IVZA 3MGTA 1PEZA 3VCLA 1KF9B 4LSUL 4JJ5B 3PQYD 1EERB 1GSMA 3DV4B 2F53A 5D1XA 3BP6B 3KLAB 4H0HB 4G7VH 2RFXB 2Z31A 5HJ3A 4PV9B 3SE4C 4ZMAT 3JUYA 2AEPH 4MJIE 4YHPA 3P30H 4EN3D 5HDQL 1NGXA 3BH9B 1MIEL 3NCBB 4PJ5D 1YC7A 5HYIA 4Y5VC 3WJJC 2A6JB 5DD6B 4LLWA 1F11A 4OSUH 4FQ2L 5MHSE 4ERSH 3F12B 2H2PC 4L8BB 5EBMA 3ZDXE 5EIQA 4HIHA 2FD6L 3TIEB 3V52H 2OBGA 1WFOA 2O26U 4XMKH 4ZXBB 3UJJL 1P69B 4LRIC 4MCYB 4Q9BA 4Q2ZB 4QRRB 3IVKB 1WIPA 4ZUTA 4K71C 5GJSH 5D96B 5J11C 2ZUYA 3VFOA 1KT2B 4H25B 1XZ0B 1DN0B 2OR9L 3VD3A 1AGEA 1KEGH 1D5MB 4MD0B 1R3IH 3B8SA 1RU9H 5D93B 2XI9A 4KWUA 5C86A 4XH2B 3WIIL 4G9FD 3QNYB 3D3VE 4M1CC 5FYLD 1FRGL 4R7NB 5D7JC 1MY7A 4L8CB 1RIHL 1WEJL 1U8KA 1DVFC 3TPUB 3PWVA 1LP9E 2HJKA 5GS2D 4DUVA 1J1PL 3RJQB 1NFIB 4RDQG 1MCOL 2BC4B 2GHWB 3LMJL 4GQPH 4NQCE 4JDTH 1AC0A 8FABA 2WUCL 2O5YH 4KMTL 1UZ8A 4JAMA 1GYAA 1CD1B 4LPCA 4KKLC 1CBVL 2BVTA 4UNUA 4EUPA 4OT1L 3SOBH 1CGUA 3CVIL 3BEWA 4FQIL 3C60D 2N7BA 5IESH 2A1WL 2APWA 3FQTA 1IL1B 5HYJA 4NKMB 1NGQH 4P23A 3VFNA 3TEUA 3IFPB 5KS9E 3C09B 3LIZL 1BIIA 1XR9B 3B83A 4KQ3L 3PWUA 3OL2A 4G8GB 5IVZB 3MGTB 5T5NF 4Y4KD 3VCLB 4J4PD 5EPMA 2F53B 5D1XB 4LVHC 3TYGL 1JPTH 7FABL 5HJ3B 1A7NH 3LQAL 5KBNC 1YEIH 4YHPB 3QUXD 3BPLB 5MI0C 1NGXB 5T3ZE 1HINL 4IDJL 2DQFA 4ZNCD 5FOBA 4NUGH 4P23C 2NY1D 4K3GA 3ZKMD 1HWGB 4LLWB 1F11B 1MQKH 2VMFA 4KKBC 5EBMB 5GGSY 1H3GA 5DC0A 4HIHB 5J06A 4FZ8H 1QPXA 1WV7T 4DQOH 2R39A 1FNFA 1UCTA 4QOKD 1P9MC 2BRQA 2R4SH 5IJVA 4ZUTB 3DECA 1OD9A 5JOPD 2XQBH 3C08H 3I50L 4IRZH 2XZCL 3LH2H 5EH1A 3VFOB 3QIWD 1I7RA 1DLHA 1AGEB 1T21B 5DJ2A 4HC1H 1R5IA 4V1DE 5FYLL 3SGJC 1D5ZA 1NC4A 2QTEA 5E6ZA 2YD8A 1R5WA 4RBPK 1YEDA 3WNPA 4Q6IA 4F80A 5JO5A 3ARBD 1WC7A 1BECA 4IRSC 4YXLH 4O00A 2XICA 2APFA 1U8KB 2FX8H 3VFPA 3PWVB 2HJKB 5CILH 3IS1X 3P0YL 1UH3A 2R69L 1BFSA 4XNZB 2E6QA 8FABB 4OV6F 4KHXH 3MA9L 4LEXL 1UZ8B 4HSQA 2VJXA 4JAMB 3M8OL 1IAIH 4Y4FA 1NUFA 1IAOA 3VD5A 4EUPB 1F58L 1D6EA 1LVEA 3RVXD 3CD4A 3BEWB 1VCAA 1VEMA 1QR1A 5L2KE 4UV4H 4P5KA 1CWVA 1FAIH 4A6YL 3FQTB 4U6HA 1Y18A 5HYJB 1MCWW 1P4LA 4P23B 3VFNB 4LSUH 4MCZA 4X6FA 5I1DA 2B4CH 1NBVL 1RUKH 1BIIB 5EN2A 3PWUB 4NCC2 2F58H 2GK0A 2W1NA 4LGRB 4P5TC 4BZ2L 3CFCL 5HDQH 4JZNA 1G7JA 2I60L 2X2YA 5EPMB 2WUBL 3DUSA 2D2OA 5CJXC 3T65A 4DKAA 5L9DL 2MQ0A 2ADIA 3EOTL 2VZTA 4FQ2H 3VXSD 2VLRD 2V5RA 1GOHA 5IGXH 3IETA 2FD6H 2DQFB 4S11A 2F54E 1QACA 5FOBB 3HPLA 3UJJH 3QXDA 2Z4QB 1MLBA 3GSVA 3O2DH 3SJVA 1FC2D 1FLRL 5ELIA 4JN2A 1A1OA 1CN4A 3QJFA 3LEXA 4I9WE 4MX7A 4YFDB 3GSRA 5D2NA 2JIXA 2OR9H 4UMGA 4L9LA 5IJVB 1A6AA 2MJWA 5CBEB 5JW4R 1M05A 4NO0A 5E03A 1SHMA 4LKXA 4FS0A 3B6SA 3IAGC 3Q1SH 3QUZA 1VFBA 5D6DC 4ZOBA 1I7RB 4F7PA 1DLHB 1FRGH 4MMZC 5DJ2B 5FXCH 3DMMC 2VDML 4XCEA 3QSKB 5C9JA 1R5IB 5IHUL 4KZDL 1ACZA 3QYCA 1RIHH 1D5ZB 1WEJH 1JNLL 2LE9A 1ZTXL 1R5WB 1J1PH 1YEDB 2FNBA 1MCOH 4Q6IB 1BOYA 5JO5B 1WC7B 2OXGA 3DHMA 4D0DA 3VFPB 5JIPA 3VA6A 1OAUH 3QHFH 4OT1H 4P0DA 3RGVC 3K8KA 3TNMA 4D9LL 1RIVL 4QCIA 5HI5D 3MODH 2JLLA 4RMVA 1G84A 4JPVH 5E2WL 4Y4FB 1IAOB 5IW1A 1D6EB 1D6VH 4OIIL 3RVWC 1DUYA 3N85L 5FHAL 2VDPL 1QR1B 4X98A 5LVEA 4D0CA 4P5KB 3MJ9H 4KQ3H 2BY2A 2I9TA 4OI7A 4U6HB 1Y18B 1JNNL 1P4LB 2DQIL 4GXUM 5F9JA 2R2EA 4MCZB 4X6FB 1HI6A 5I1DB 4LPXA 1X44A 1YDPB 5EN2B 5I75B 1QSFE 4QRPE 2GK0B 4DVRL 3QPXH 1HSBA 1YJDL 1G7JB 4JZNB 3TZVC 4OD1H 3DUSB 3T65B 1XFPA 4DFIA 1BVKA 2ADIB 3I3DA 4NKQB 4WWID 3BO8A 1GCFA 3IETB 1T0PB 1U8JA 4U3XA 5DDHA 3WXVH 4OF0A 2E9IA 3HPLB 1IEAA 3GB7A 2BFVL 3P0GB 4EZMA 3OAUH 5EOQH 3QXDB 1QG3A 4OM0H 1MLBB 3QJHB 4EN3A 3SJVB 2ZUQC 4CUCA 3NCYS 4JN2B 1A1OB 3QJFB 3LEXB 3I50H 3WDIA 3UTTE 4MX7B 2XZCH 3GSRB 2PCPA 4OF6A 5D2NB 2JIXB 3OB8A 1BM3L 4UBDC 4FFWC 4L9LB 3BWAA 1A6AB 5FYLH 1MHEA 1M05B 4NO0B 3NCYP 5FV1L 4LKXB 3ESVF 3B6SB 3NZ8A 3QUZB 4NNPL 1VFBB 2DOCA 4XPHL 2APXA 1VDGA 2DQDH 3BKJL 4HWEL 4F7PB 5C9JB 1E0OB 4N5ED 4ZNEA 4WHTA 4B7LA 2BNRE 1X5ZA 3LQAC 4UNVA 4MA8L 4D0DB 4LEXH 2WBJC 3MA9H 3F7VA 1INEL 1FFRA 1CDUA 4G9FA 4Z7VF 1R3HA 3DO3A 3TNMB 4LAQL 4LSVH 4QCIB 3QAZC 3AS2A 4LOUD 1JIBA 1HN1A 2A0LC 5FK9A 2F15A 5IW1B 2FHFA 2DLIA 1DUYB 3QDMD 4HKJA 4GRWF 4Z6AT 4X98B 1FNAA 1NBVH 3TWCL 3BRGC 4D0CB 1I1FA 2UUDK 1T0NA 2I9TB 4FQCH 4Y88A 3CSGA 5I6XC 1SBSL 4S1SH 2ID5A 3C60A 4BZ2H 5F9JB 1UKQA 2R2EB 1HI6B 2WUBH 4Z7VA 4JM4L 2ZUQB 4JQIL 3WKNA 3OKYA 1J12A 1ONQA 3CU1A 3E6FA 5L7XH 3EOTH 5GRWA 4OCYH 1MCDA 1HSBB 4A6YA 4CDHA 4OCWL 3X14A 3KJ4B 1BVKB 1UWEL 4JKLA 3WNKA 1RUAL 3L6FA 1DQQA 1T4KA 1YYLH 1NMAL 3B9KC 4Y4KA 3BO8B 4G8FA 2H32A 4Z7UE 5F7LB 2Y72A 1U8JB 2IAMA 2BY3A 5DDHB 5T3XE 4Y4HD 1IEAB 3GB7B 4EN3B 4RMTA 3AREC 4F7TA 5A2FA 4ONFL 4FTVE 3CLFH 2PCPB 5HXMA 2AV1A 2VDMH 5IHUH 3BWAB 1T3FA 2VAJA 1FSKB 1MHEB 3OAZK 5IF0A 1JNLH 1WWBX 2JCCE 5CHNA 1JVKA 1WISA 4Y4KC 4J4PC 4QOKA 3NZ8B 4QF1A 4JLRA 5KZCD 2GJZA 4AENA 2F8OA 3ZE1E 2HKFH 5CUSL 4JHAL 2GSGA 3QUXC 2APVA 3E8UL 4DKFH 2OK0L 4WHTB 4NC1E 4QGTA 2FJFA 4LRNL 2A9NL 1JRHH 3ZKMC 3KPPA 4ZG1A 1OP3H 1JTPA 4HJJH 3CMOH 2DI9A 4QRSA 5E2WH 3F7VB 4KRPD 4G9FB 3VDCA 2H1PL 3LVEA 4UTBH 3ARBA 3IDGA 4TRPL 2Z8SA 4OIIH 3WKML 1R3HB 1J8KA 4O9HL 2DQHH 4OZIF 3BD5A 2WP3O 3NPSB 3MYJA 1RZKH 5A40E 5FK9B 5D2LF 5EA0H 3WFEH 5ESQA 5AYQA 3CSYA 3RNQA 3DI2B 3QIWC 2H9GA 4DAGL 4KDTC 1Z9SA 3O3AA 1AR2A 1I1FB 1T0NB 2XZAH 1YPZE 3FHAA 1MFAH 4DVRH 3C60B 2Q8BL 4WW2F 2Z8WC 4Z7VB 1KYOJ 4NRXA 1ONQB 2CXKA 3E6FB 4OZIA 2GIYA 4A6YB 3PWPE 5D2LA 4OI8A 2UZIL 3D2UD 3BT2L 3X14B 3TO4D 5HSFA 3CFJA 4GBXD 4GRWB 3TH4T 3L6FB 4K9EH 1DQQB 1T4KB 4Y4KB 5CJ5A 3RVXC 4G8FB 2H32B 2I07A 4UILL 2IAMB 1PVHA 1JCKA 1F2XK 4MD4A 4HXAH 2IALA 4JREB 5F9WB 4V2BA 3VXSA 2VLRA 1KJMA 1MFDH 1BM3H 4PD4J 2WWKT 2NY6C 4F7TB 1GIGH 4WW2A 2DLHA 5A2KH 2NY1B 4NQED 5SWQA 2IANA 2ZNXA 3MV7D 2E8YA 3PDDA 2ICWA 4NNPH 1MRFL 3BKJH 1KTRL 4HWEH 3IU4L 2AV1B 2E6JA 4KVCL 5DZNA 2VDKL 5CCKL 3W9EA 1T3FB 5J12C 2F5BH 1RJZA 3WN5A 4FFZL 5IF0B 5M94B 5CHNB 4QOKB 4QF1B 2OR8A 3TLRA 4JLRB 2GJZB 4AENB 3GM8A 4QGYA 3WIFA 4PS4L 4Q97A 1I9EA 2GSGB 3MACH 3LS5H 4P2RE 4DN3H 1KGCE 2R56L 1YY8A 1INEH 5E2TH 5ENWA 3SDXE 2FJFB 3GGWA 2E8ZA 4OFIA 4ODVL 2BY0A 3KPPB 3M07A 4LAQH 4FQHA 3S88L 3QIUA 3GSWA 4Z0BH 1B88A 4K8RD 1A02N 4QRSB 2ZUWA 2A38A 4HLZH 1G9EA 2GK2A 1F6FB 2DQCH 3ARBB 3IDGB 1U41A 5CEXA 3H9SE 5CD3A 4M6OL 3TWCH 4PRAA 3MYJB 1J0KA 2GJ6D 1JTOA 1DE4A 1ZT1A 3QUML 4XP1L 5ESQB 3CSYB 3RNQB 1PZ5A 3B2VL 4GW1A 2H9GB 4ORGA 3O3AB 5I18L 3N06B 4JM4H 4JQIH 3IDYB 2O61A 1N3NA 1RZFL 2VZVA 2MOVA 3RVTD 3CNKA 3G6DH 2P49B 4HBCL 4MGXA 3IF1A 4WO4A 2VRAA 1YYML 3WDHA 5DUBA 2P7TA 4FFYL 4RAVA 5HHME 4NRXB 3OKEB 5IQ7H 3GK8L 3MZGB 2AJXH 1I9RL 2F8VA 3DYMA 1T03H 5D2LB 4Z77A 3NIGF 4NC2B 3BFOA 3QQ9D 3QUYD 4X7SL 2PTUA 3G9VA 5MERA 3CFJB 3RIAK 4RZCA 3SE9H 1J5OL 1J1OH 3VGEA 4ONFH 2I07B 3HAEH 1Y6KR 4ELME 5SWSE 4RFOL 4MD4B 2IALB 3VXSB 4OGAD 2VLRB 1GGCH 1KJMB 3GKZA 5ALBL 2FGZA 5HDOA 4WW2B 5BV7B 3VFRA 5SWQB 2AS5M 1B2WH 2IANB 1IZKA 4UT6L 4RX4D 2DTMH 2ICWB 3JWNC 2OZ4L 3BEVA 5C0AD 3ARGD 5CUSH 1QFWM 3W9EB 4JHAH 1M4KA 1RJZB 3WN5B 3PXHA 2ZCKL 1UM4L 4HUNB 4YXHH 1L9NA 3UDWC 4M3KB 1U91A 1RUPH 2A9NH 2DJ4A 1A3RH 1SVZA 4HZAA 3VH8G 3WIFB 3VRJA 1ZGLM 1MAKA 4OV5A 1EEYA 1ZAGA 1YY8B 4TVPE 5ENWB 4K8RL 3GGWB 2J88L 2J8OA 3KPRD 5D1ZD 4HULB 4JRYD 1I1AA 4FQHB 3Q48A 4PPTA 3QIUB 4F7EA 4Z7OE 3GSWB 1XGRA 3MV11 4PBXA 5E6ID 5CEXB 1AO7D 4HX1A 5GGRA 5CD3B 3ARSA 3HE7D 1MFEL 4ZFOL 4AY0A 1V7ML 4DAGH 1UACL 4PRAB 1ZT7A 1DE4B 1ZT1B 2CK0L 4ZTOH 3MRJA 5FYKD 4Z7WF 1EVUA 1PZ5B 2Q8BH 4GW1B 3KGRA 4ORGB 1IT9L 1OW0C 2GJJA 1TTUA 1IGYA 3KPMA 2O61B 1N3NB 3KPQA 3L3GA 3HC3H 2OCFD 3IF1B 4WO4B 5DUBB 2P7TB 5E8DL 3SKNA 3BT2H 4RAVB 3ULUD 4EBQL 2P1YA 3RUGE 4OLYH 1S8DA 5F7WC 5I1HL 2Y06L 5CEZD 5ICZA 5CP3H 3TJHC 4Z77B 3IAQA 4LOUC 5KSAD 4QRRE 1YNKL 4Z7WA 3LAFA 2VN7A 5MERB 4U1NA 3WNNA 4RZCB 1MFCL 4YHOH 3WUWG 5C8JA 5JQ6H 1C5CH 1BEYL 5H8DA 1MRFH 2VDKH 2ZSWA 5D71L 1HHIA 4Y4HA 1S5IL 4BJLA 4XCYA 3VFRB 3WHE1 2Q6WA 4HW6A 3FN0H 3F7RA 4WEMB 3BEVB 3FRUA 4EXPX 5DEZA 5KSUA 3LDBB 4HWUA 2MQCA 1TQCC 3ALWA 1F45A 3C5ZC 4JB9L 2R56H 5FM5M 4XAKD 1CU4L 4AL8L 5JHLH 1U91B 3QB7C 3ZE2F 3SCMD 4OJFL 5E8PA 4ODVH 3VRJB 3IKKA 4TNWK 4OV5B 1RZ8A 1EEYB 4LSQL 4M62H 1LO2H 3U0PA 4QXTA 4ISVA 3WFCL 4CU6A 3F6IA 4YGAB 1I1AB 1D9KD 4CL7A 4M6OH 3JV6A 4F7EB 5L8LB 5C0EA 4CDGC 1XGRB 3IU3A 3QUMH 2NY5L 4U05A 4HX1B 5GGRB 5E8NA 3VGGA 3ARWA 4Y5YC 4B0MM 5FYKL 5I18H 1ZT7B 2NNAA 3OKNA 1RZFH 3MRJB 1GRWA 3L9RA 4X4ZA 2KQNA 5F9DC 4R90H 4K07A 2VSDA 4HUVA 5J56B 3GK8H 1IGYB 3KPMB 5JUEL 1I9RH 2VAAA 3KPQB 3L3GB 4G3YH 3ULUL 2FR4A 3V79C 5T5FH 5T33H 4L4VD 5CEZL 1NFKA 3SKNB 4NRYA 3DETD 2HTLD 4KRPC 3FQNA 1DBMH 2XZQL 1S8DB 4K7PH 1J5OH 4PJDE 5CGTA 4X6DE 5FHBL 3HZMA 4OLZL 3W2DL 5ICZB 4ZFGL 2IFFL 3H9YA 4Z7WB 1U8PA 2HFTA 1K9TA 1P7KA 2EO9A 1XF3A 3D2UA 2AJZA 4HQQH 1KIRA 3VE0A 5BQ7B 5C8JB 4OGYH 4QRQA 1QRKA 4GBXA 5CP7A 1FYTE 4XPBL 1R3LA 3TPKA 5CMAB 2ZSWB 1I8MA 1TJHL 5J3HD 1HHIB 4Y4HB 2DWDA 4XCYB 3RVUD 4I1NB 4LVEA 2Q6WB 2XFXA 1F3RB 3FRUB 2BXYA 3CDGA 4LK4A 5KSUB 4XI5D 3CMGA 1F02I 3UPRA 4NQEA 5EFIA 3MV7A 4HFUL 3MC0A 5FM8A 3O6MH 5I71B 4KKCC 1KPRA 5E8PB 3TO4C 3TCXA 2AK4D 4GBXC 2EYTA 1RZ8B 3O2VL 1CFVL 5F9OL 2OZ4A 3PF2A 2GUOA 1HOCA 3U0PB 5DF0A 5KZCB 4QXTB 4ISVB 3GEWB 5F8RC 4J1UA 3LPFA 1NL0H 1LEIB 2XZZA 2V2XA 5C08D 3JV6B 5MP6L 1S9VA 5C0EB 2IPTL 4GMTL 2CK0H 5T1LD 5EUOF 3S3SA 5E8NB 1KC5L 5HGDA 3EFDL 5DYOA 1IT9H 2DYPD 1CXLA 5DD5L 2NNAB 2HH0L 3OKNB 4N0RA 4G6JL 1YMMD 3L9RB 1ZLUH 1WBXA 4PJGF 2GJ6A 5E8DH 2PR4H 5I1LA 2CUIA 1EJ6A 4HUVB 1WLHA 3L3JB 4HV8A 1GGUA 1NEUA 2VAAB 2Y06H 1U8IA 3VD4A 4P9HL 2FR4B 1QFPA 1U8LA 4Q0XH 2Q3ZA 3IDXL 3QQNA 4NRYB 5I74C 1YNKH 1V3KA 4K8RC 5EUOA 4N0UE 4N8PA 3FQNB 4MJ2A 4RDQF 5HYSG 1CXKA 3TT3L 2YD7A 3HZMB 1VKXA 1ORSA 4ZDHA 5C0ND 3ZO0A 3SDDD 3HMWL 4KI5D 3WV0A 3MV9D 1EHXA 1U8PB 3DGCR 4OZ4A 4PJGA 4Z78A 1P7KB 1XF3B 3D2UB 2AJZB 3QUYA 1KIRB 3VE0B 4QRQB 3BDYL 4GBXB 5CP7B 4BH7A 1R3LB 1RK1A 1KFAH 3WIHH 4XRCA 2CGRH 5T1MA 4I2XE 5BMFL 1J8HD 1I8MB 2YHGA 1NDGA 2DWDB 1ZOXA 4GQ9H 1CU4H 2XFXB 4AL8H 1E6OL 4RFNC 5F89A 5CD5C 3HI1A 4OJFH 3CDGB 2I25N 3RQ3A 3UPRB 5BRZD 1MJ8H 4NQEB 3EYQD 1B3JA 3MV7B 1A47A 4XCCL 4YDLC 5EFIB 3S35H 3EYSH 4RX4A 3WFCH 1KJ2A 3L7EA 3ARGA 3QNZA 1KPRB 1BJ8A 1OGAE 3QQ9C 2EYTB 2W65A 1VFOA 2GUOB 3VGAC 1HOCB 3BAEL 1K3IA 4YIQA 3F7QA 4UDUA 4J1UB 4P48A 3S37L 3R1GL 4YDVA 2V2XB 2JB5H 3CXHJ 1S9VB 3KPRA 1TPXB 1JE6A 3P9LA 4AZ8A 2LAAA 4PG9A 3SDAC 3UTOA 3PGFL 2DBJA 5HGDB 3WJLC 2H6PA 3BWUC 1AO7A 1EZVY 3ULUF 5JUEH 1CE1L 5H37H 1HDMA 3HE7A 4JANA 1SJHA 3BZFA 4O58H 1PGRB 1AP2A 1WBXB 3EFFA 3QEQA 2KDGA 1QBML 2GJ6B 5I1LB 5MEND 3Q0HA 5KOVC 4G8EA 1UH2A 4HV8B 4PJIF 1BQUA 1U8IB 5D1ZC 5FHBH 2Y25A 5E94A 1U8LB 3W2DH 4W6XB 4KK5D 1CLZL 5KVEL 2DBLL 4ZFGH 4KVNL 2IFFH 4MNGA 1KB5A 5EUOB 5E6IC 1QLRA 1IMHC 2ITDA 1U3YA 4JO2L 4JY5L 1VKXB 1ORSB 4ZDHB 5TQ2L 2G5BA 2NY5C 4H5SA 4B50A 1VERA 3IDJA 4PJGB 4OZ4B 4XAWH 1XH3A 1NCAL 4Z78B 2UWEE 3JVGC 2O93L 5KSAA 1N8ZA 2E7LC 5H2BA 3QUYB 1LO4L 5KN5A 4PJIA 3KHQA 4BH7B 4WI8A 3OGOE 1BOGA 1QYGL 1RK1B 2IG2L 4XRCB 3GKWL 5T1MB 4HIEA 4JFED 1Q0YL 4XGZA 1G6RA 4OCRH 4TSBL 3V4VH 3ZTJG 1PJ9A 5KSBF 4U6VH 1NDGB 4NNYA 3C2AL 3GRWH 4JE4B 5L0QB 3VXRD 4TUOA 5F89B 3HI1B 5I30L 3DRTA 4B5EA 3HCVA 2NX5E 3O2VH 5F9OH 1JK8A 2CIIA 3W5NA 4K3DL 5IBLC 4Y1AD 1FGNL 3RWIA 1KJ2B 3L7EB 3ARGB 3QNZB 4BFIA 1TVHA 3MLRL 4RGND 2HRLA 1CQKA 1HHHA 2JTDA 1M7IA 4JO3H 3CH8A 2ZUXA 2W65B 1DQML 1JGVL 3BKML 4MSWA 2IPTH 4YIQB 3SCMA 3WFZA 4UDUB 2AI0L 3CJJA 3QA3A 4KDWA 5KSBA 3RWHA 4YDVB 3JZ7A 3QFDA 5DRXA 3V5KA 4LVOB 3EFDH 5DHXB 3SBWC 2J8UE 2OLDA 3ULVD 5AYUL 1HYSD 3KPRB 3P9LB 4LP5A 1D9KA 4PG9B 3KPSA 3UTZA 3IFNL 3FAWA 2H6PB 1AO7B 1E4XL 2AK1L 1HDMB 3HE7B 4JANB 5D7LE 1SJHB 3T04D 3BZFB 3QBTB 3W81A 1AP2B 4AMKH 5EU6D 3EFFB 3TV3H 3QEQB 2Y07L 2WANA 1ZA3A 5T1KD 2MQ3A 4G8EB 3PQYE 4YDKL 3VG0L 1N64L 5E94B 5GS0L 3OXSA 1NC2D 1D9KC 3ZZ1A 2BOCA 1NAKH 4JKPL 1KB5B 4JFPA 4MNGB 2OXHA 3ES6A 4KROD 5LGHL 4PJ5E 1QLRB 2ITDB 1UVQA 1T1YA 1CFTA 2PYFA 4HJ0D 3N1QC 5D7KD 4DWHA 3NCMA 4WV1A 1M1SA 3BDYH 2G5BB 4H5SB 3IDJB 4YO0A 1XH3B 1Z9LA 4K2UL 5KSAB 1N8ZB 5H2BB 4MAUL 5KN5B 3FFCD 4PJIB 3RX5A 1BOGB 2E6PA 4MA3A 1TTGA 3DX9A 3JV4A 4HIEB 4XGZB 1G6RB 1DP0A 3VG9B 5I16A 4NNYB 1UENA 4YDJA 4JO1L 4TUOB 5HHPA 3DRTB 1OAYH 4WI9A 5E9DD 3DETC 4M5YL 4P9HC 3HCVB 4LHUG 1A6VH 1JK8B 2CIIB 5FYLE 3DXAD 3BAEH 1LE5A 5FUZH 3RWIB 1OLZA 2NZ9D 4BFIB 2Y9RT 1TVHB 3S37H 1NDMA 1M7IB 2ARWA 3RI5K 4PTUA 1IAIM 4MSWB 2MCPH 4NM8L 2DMBA 3SCMB 3QA3B 2AK4A 5KSBB 3ULVL 3RWHB 3FO1A 3JWOL 3QFDB 1IGJA 5DRXB 4ZUWA 3SQOH 3V5KB 1I85C 2XACC 2ERJB 2UY6A 1ZANL 4C56D 1FCGA 3RVUC 4C55A 3FQXA 2B5IC 1EUTA 1CE1H 3MLVL 1D9KB 3KPSB 5C08A 3RWJA 3UTZB 3E2HB 2XYCA 3LY6A 4Z7VE 1QBMH 4XNXL 1HKFA 5F6IB 5T1LA 2F19L 5DFVC 3FO9A 5ERWA 3NBNA 5DMYA 1IC7H 2VZ3A 1CLZH 5KVEH 2DBLH 2DYPA 4NN7C 4ESKA 4KVNH 1ZA3B 3W82A 5JA9A 4GRWE 3MCLL 4HAFA 3ZL4L 4KI5F 3V0AC 5DQ9A 1YMMA 1I3GL 3V6OC 3UTSD 4YHZL 3OXSB 5E2VH 4U7SA 2BOCB 4K94L 4JFPB 3ES6B 4UT9L 1EAJA 1Q72L 5DK3A 1NCAH 1UVQB 1T1YB 4ENED 1WCBA 1CFTB 2PYFB 4KUZH 2EE3A 2QSTA 3RIAF 1U36A 2XWJA 4WV1B 4Z7NF 4HUKB 3L1OL 4P99A 3GHEL 3FO2A 1Q0YH 4YO0B 3U6RA 4M43H 4L3EA 4ZO8A 1ZLVH 4GS7C 5TPWL 3QEHA 3MV9A 4HS6A 1VA9A 2AABH 5I30H 5JOPE 4MA3B 3DX9B 3JV4B 3FB8A 2EEDA 2P24A 4TULL 5I16B 4K3DH 2ADFL 5GGQH 2VSCA 2W59A 4YDJB 5DR5L 3MLRH 5HHPB 2I5YL 4N1EA 3GHBH 4UOW1 2PTVA 4ZFZA 1LE5B 1MAJA 4MQ7A 2YA1A 3HB3C 3SDDC 1F42A 2CKBA 4KY1L 1NDMB 1EIBA 3KPOA 4ZO6A 5BRZA 1F3DH 4ZAKD 1QBLL 2WWKO 1LK3H 2FEDD 1TJIL 4PTUB 1PDKA 1L0XA 5AYUH 4M6ML 2AK4B 3TBTA 3EOAA 3FO1B 1IGJB 4X6BA 4ZUWB 5FDYA 2JJTA 1WBYA 2X10A 4ZQKA 1N6UA 4F57L 1H8NA 3AB0C 2J5LB 2YD6A 3FQXB 3SY0A 2BOBA 2DQUH 3DARA 4LVNB 2BRRL 4OKDA 1V3MA 1P4IH 5C08B 3RWJB 4H1LH 2V9QA 3MUY1 3EYQC 5T1LB 4YLQT 1CDGA 1AXTL 3FO9B 5ERWB 1ZHLA 3RHWK 4X8JA 5GS0H 3HMXL 2L4OA 4GG6E 4PGDA 2DYPB 2X1PA 2XQYG 3QDJA 1ETZA 5LGHH 1W2KT 1FO0L 1K5NA 2GITA 4P59L 2JJTC 5DQ9B 1YMMB 1EHLH 5C6WH 4U1IA 2QHRL 1F00I 1ADQA 2JB6A 2CH8A 4UQ3A 5MENA 5IFAL 4HAGA 4QY8A 4PLNC 1DCLA 1UCBL 1ERNA 4F9LC 2PW1A 2ORBL 2B1AL 4X83A 1MIML 1WCBB 1NMBH 4PJEE 2ZOLA 4MAUH 1EO8L 3ZYIA 2XWJB 2BNQE 2C3HA 3FO2B 5HD8D 4CN1A 3OG6B 3U6RB 4L3EB 4NDMA 2DQEH 3QEHB 3MV9B 4HS6B 3KAAA 6FABH 4U1GB 3FB8B 3LHPH 5JOEA 2P24B 2HVJA 3MUHL 5GISL 1CYGA 3UBXG 3VGFA 4KFZC 4KK5C 5IBUG 1H5BC 1GVIA 3F58L 4JFEA 4UAOB 2V6HA 4F58H 5GS0C 3I9GH 4ZFZB 3J8F7 3HG1D 5L6YL 4MQ7B 4NOFA 4RWHA 2CKBB 2VDQL 3KPOB 5BRZB 1YEGH 4Y1AA 2IPUG 3VXME 3MRGA 5DEFA 1A9EA 1NCTA 3TBTB 3EOAB 2VLKD 1MCEA 4LSRL 3MLXL 4WY7L 2AGJL 4X6BB 4QHMB 1WBYB 3VA2C 4URTB 3VWJD 4ZQKB 1NUGA 1BQLL 4MQXD 4LCWA 5F96H 3H3KA 1JNJA 2F19H 3SY0B 2BOBB 2VXTL 2E5EA 1OF2A 1HIMH 2FZ3A 4ZO9A 1I1YA 5IVOA 3MCLH 4YFEA 2VXQH 3ZL4H 5IJKC 4NKDA 2CLZA 5JDSA 1Y6NR 1ZHLB 4X8JB 5KG9A 4YHZH 1SYSA 3RL2A 4PGDB 3GBNL 5J8OA 1PG7W 3KG5A 3QDJB 4OB5H 1ETZB 3PL6D 4N5UA 1K5NB 2GITB 3U30B 3VXTA 4U1IB 3BRDA 4UQ3B 2JB6B 2R1YA 4P4KA 2FECL 3R06A 5EZOH 4U4BA 3T0EC 4R9HA 5T1KA 5MENB 4XVTH 5IVXE 4QY8B 2MTPA 5FGRA 3P0VL 43C9A 4M61A 3ULVC 3GHEH 1HYSC 2H32H 2PW1B 2F9BT 3JWOC 1MJJA 1NC2A 2NLJA 2QLVB 1H5BB 3NACH 4LSPL 2VKWA 1A7BA 2ZOLB 3INUH 3L3OA 3BPCA 4Y8AA 5DFWH 1RY7B 2BSTA 4TULH 4BM7A 1C08A 4XBGA 1SJXA 1HH9A 2BDNL 1EVTC 3OF6D 1ORQA 3FZUC 4RMRA 5DR5H 1A1NA 5I1CH 5BZDA 5IW6A 1YEFH 4YHMH 3LCYA 2WLYA 4LU5H 4JR9L 1HEZA 2HVJB 5FO9A 3H3PL 4UTAL 3M17A 4HWBL 3JBG7 4X7CC 1QTYT 4M02A 3L3DA 4N8VG 4JFEB 4ZODA 3A6BL 4KROC 3GNML 4YEEA 5I1IL 3OKDA 3HRPA 4OLVL 5FYJD 1ZEAH 4HJ0C 3VXRB 2YWZA 3BPNC 3EJJX 2Y6SD 5J0BA 3BOVA 2H3NA 1X4ZA 3FB5A 3DXAA 5T1DL 4Y1AB 4PR5A 4OLUL 5C6PB 3MRGB 4PFEA 4RGNB 5C3TA 5DEFB 5ACMA 1A9EB 4QHUA 1J0YA 1BZQK 2BRRH 4UZGA 4M93C 2L7UA 3QDME 1TZHA 3MRDA 4LCWB 1AXTH 1TQBC 1UB6A 5HDBE 4IJ3C 1L0QA 2AXHA 1OF2B 2FZ3B 3HI6L 1I1YB 2Z8RA 3MXVL 4ODSL 4MXVF 1FO0H 4NKDB 3TT1L 2CLZB 4V2CB 5JDSB 2NZ9C 2I27N 4IMKC 5K9QG 3IJYA 3SGKA 5KG9B 3RL2B 1SYSB 3SDCA 4Z7WE 4BQCA 1B4JH 4L3CA 4LASH 1UCBH 4KMQA 5IVNA 1NCBL 5FO8A 3T0AA 3VXTB 4EVNA 2ORBH 5E2UL 2R1YB 4P4KB 3IDNA 1MIMH 3R06B 4KV5F 4DGYL 4HK3J 1MHPL 5T1KB 4YJZL 1EO8H 4S1QL 43C9B 3Q5YA 4M61B 2OX5A 3U4AA 1A3LH 5IIEB 1MJJB 1NC2B 2P8PA 5HDLA 2VNCA 4AJ0A 3UCRA 4GOSA 1CICC 3L3OB 4GUPA 5EU3A 3BPCB 3MCKA 3VH8A 1RJYA 35C8L 1BJ1J 2DKMA 2BSTB 1C08B 2WIIA 2W9EL 5MHSD 4XBGB 1BP3B 1HH9B 3HE6C 4PGZA 1ORQB 1T7VA 1G7MA 3OZ9L 2ZG1A 4XMLL 4L3AA 5BZDB 5IW6B 1TCMA 4F8QA 5ISZA 3NAAL 5M7QA 3P4NA 4X6EA 1HEZB 2FLRT 3ZTNH 5FO9B 4OTXH 4XXCA 3M17B 1G7PA 2WSKA 5L6YH 4NZRL 2VITA 1U2CA 3L3DB 5SWZD 2VDQH 4QTHA 3OKDB 1NKRA 3CAFA 3FJTA 3QEGH 2C26A 4FQ1L 4NCC1 4QXGL 4YZFF 5KAQF 4ZD3L 2H3NB 4LSRH 3MLXH 4WY7H 2AGJH 4XP6H 4ACPA 3FB5B 3DXAB 1FZMA 1OSZA 4CVZA 1KCSL 1Y6MR 2WWMC 4PR5B 1BBDL 5F6HI 3K2UH 5DS8A 3BPOB 4XXCC 4QHUB 4F15B 4ZAKA 3DV6A 2WW8A 3W0WA 2Y5EA 1FP5A 3S36L 3RDTD 3CGTA 1TZHB 3MRDB 3D25A 3L3KA 1UB6B 4JVUA 4RMSA 4OCNC 1DBKL 4O2FA 3TVMD 4UQ2A 3K4AA 3G6JF 2OTWA 1LQSR 5C0BE 5HHQA 1G9NL 5GRUL 4I4WA 3R0NA 4W81A 3IJYB 3I2CH 1OM3H 3HUJF 3SDCB 1JNHA 4L3CB 2WV3A 3UC0H 1MY5A 5FO8B 5F21B 2HJFA 2ITCA 2YS4A 4EVNB 1KXVC 4YFLI 2IPUK 2CRYA 3TCLA 3IDNB 2XTJD 1Q9KA 5H35A 5FECA 2YRLA 1YEEH 3GSUA 3WS6A 3ROOA 4S1DC 2P8PB 2XRAH 4K23H 5D9SA 3G6JA 1SM3L 1QLEH 3PG2A 3MOBL 4GUPB 1MCQA 5EU3B 5KTEH 3MCKB 3AY4C 3VH8B 1RJYB 1R0AL 4IIQA 3HUJA 4NQEE 1CVSC 2A9MH 4JR9H 2FBOJ 2OP4H 2WIIB 3CVHA 3H3PH 3QO0A 1NLBL 1G7MB 3RIFK 3NMEA 3A6BH 5E2JA 2M26A 2X89D 5I1IH 1MPAH 2LTQB 1CI5A 5ISZB 3P4NB 4X6EB 4IRJA 3DUUA 2AJUL 3IKCA 1G7PB 2B0SH 1CGVA 2VITB 1RIUL 4ZOAA 4QTHB 1TMCB 4IIQC 3LKNA 4V1DD 3O6KL 1U6AH 4OLUH 4YUEL 3H0TA 4H88L 4U1MA 4YK4C 3LS4L 2WBWB 4HWBA 2Y1VA 2HT2D 5HD8C 5I8KL 3HG1A 1FZMB 1OSZB 4CVZB 2UVFA 5IW3A 1QHPA 3DSFH 5DS8B 3OKOA 3RTQA 3PGDA 5HVGB 4DGVH 2XKNA 4ZAKB 4Z7QE 3QI9D 3DV6B 1CGSH 3GJFK 3W0WB 3MXVH 4JN1H 4ODSH 3D25B 3TT1H 3L3KB 1T83A 3JV5A 4X9FA 1NJ9A 4E0RA 1VADA 1EPFA 3VWJA 3O4LA 2M8XA 2P5WD 4O2FB 4UQ2B 4H20L 5E8EA 1BVLA 1CDIA 2OTWB 1IEBA 1NMCC 1GGIL 2VR9A 1A64A 5HHQB 4PP1C 4I4WB 5E2UH 3PDOA 4DGYH 5C07E 1MHPH 4BYHA 1JNHB 4OGZA 4S1QH 4BZ1H 1QO3A 5JW4N 1DEEA 2HJFB 2ITCB 2VDOH 4LHUD 3TCLB 4NN5C 1Q9KB 3V2AR 5H35B 5EOCH 5FECB 1NGYA 2X09A 5EO1A 2YWYA 1CDHA 3GSUB 4RQQA 1N26A 3WUZA 2AXGA 3ROOB 1C7TA 35C8H 4NO3A 3LQMA 1HXYA 3RP1A 5D9SB 3G6JB 1DQLL 4XVSH 5K33A 2K7PA 3NFSH 4IIQB 3HUJB 5AZ2H 5IB5A 4OZHE 4IHOA 3NAAH 3OKMA 5FKAA 1F4YH 3CVHB 3QO0B 5C0AE 5LCVL 2CKNA 2DWEA 3NTCL 1EO5A 3L5XH 4S2SA 4NZRH 5CGYD 1CLOH 2ATKA 5DMKA 4I9WD 3PL6C 4XPTL 4E42A 3C8HA 4IRJB 3DBXA 3DUUB 5D7IF 3OF6A 4WTZA 3IKCB 4Z8FH 4FQ1H 4PJFF 4QTIH 3EYVA 3CFEA 5JW4M 5GRZA 4XNYH 3VFSA 4K3JL 5GSVA 4MA1B 5CJOL 5DK0A 3WFBL 3LKNB 4JRYE 3H0TB 4U1MB 3TN0D 3RI5F 4MAYA 1C16A 3HG1B 3S36H 5B8CA 4OF5A 2HKHL 3MBXH 5LWYH 3OKOB 3RTQB 3I85A 3PGDB 5F7NC 1IGIL 1IVLA 2K3TA 2XKNB 3KXFA 5D7IA 3T3ME 4PJFA 2CR6A 5FYKE 3VXUE 1X5KA 1OARL 1IILE 5L88H 4RBPH 5D70L 2EECA 2VLKB 3LKPA 1NLDH 5GRUH 1NJ9B 4E0RB 1XF5A 1VADB 3OPZL 3VWJB 3O4LB 3BZEA 5E8EB 4WU7A 2GTZA 1BVLB 3NA9L 1HH6A 4NRZA 1IEBB 2R1WA 4NZUL 1A2YA 3CC5B 5HTSA 3AAZA 3MGAA 3PDOB 1MRDL 1XT5A 3GSOA 1QO3B 3D39D 1DEEB 4GAYA 1L7IL 1KTLA 5CJBA 4P3CL 3K74B 5IB1A 2AXJA 3WO4B 4FN0A 1NGYB 5EO1B 3MOBH 3O9WD 3ZDXF 1NBYA 2YD2A 4RQQB 2AXGB 3IFOA 4NO3B 5I2IA 1HXYB 5ECJE 1IC5L 1MELA 1MFNA 2VH5L 2NW2A 2JJVA 2R8SL 4PB0H 1NLBH 1ZMYA 4NBZB 3T0VA 5IB5B 2P46B 4IHOB 1MFBL 3OKMB 4I0CC 2XXCB 5FKAB 3QP3A 3F62A 4MJIA 2GQHA 2AJUH 2DWEB 2QQKL 4S2SB 2CD0A 2ILLA 2ATKB 5DMKB 2PW2A 3UTTD 3NIDE 4E42B 4OQTH 5C6TL 1A7PL 3DBXB 5IFJA 3O6KH 5FV2A 5A1AA 5KSBE 4A2MA 4H88H 3EYVB 4CVXA 1FGVH 3LS4H 4R97B 3CFEB 1LP9F 5JXEA 1QSED 3VFSB 1J0ZA 5GSVB 5DK0B 1RPQA 1CIDA 1EFQA 1Q94A 4J3TA 3HFML 4WUUD 1AFVL 1FFNA 2EO1A 4MAYB 1C16B 2OL3L 3MMEA 3L5JA 5DLMH 3KYKL 5B8CB 3JWDL 4I0KA 1J10A 3BSZL 3D3VA 3KXFB 5D7IB 5BVJA 5A43C 4PJFB 1HSAA 2QADC 2CK2A 2GYSA 1JWSA 1LP9A 3GMLA 4GW5A 3D69A 3LKPB 5C7X