3MCKB

Crystal structure of anti-beta-amyloid antibody c705
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
226
structure length
226
Chain Sequence
b'QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTTDTATYYCTRSSGSIVIATGFAYWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C705 MONOCLONAL LIGHT CHAIN
publication title Antibody modeling assessment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 226
sequence length 226
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mckB01
4KPHL 2FGWL 1PKQE 2DWEB 4KTDH 4YIQB 4DQOH 4M61A 2VO5A 4NWTH 3VG9C 4NRXA 2CRIA 2ZOLA 5C0EA 5E4IA 3KPQB 3QA3B 1QVOA 3H9ZA 4MD0A 1UH2A 4NQEB 1A0QL 4HKBA 4Y4FA 3PJSB 2OSLB 1T1YA 1YN6A 3TWCL 4WI5A 4ODVH 2XRAH 4DJMA 4WHTA 1DEDA 1A22B 3CXHJ 2M26A 1HOCB 3IGAB 2R9HD 4G6JL 3IDIB 4X7SH 2CK0L 1QG3A 3KYMB 1YEFL 2EIDA 2VDQL 2EH7L 2FEEI 3VFVB 2YUWA 2F5AL 4TUKL 1SYVB 1T5WA 2OI9C 1IKNA 4MX7B 4LCUB 5DJYB 3QUYC 3NIFE 4LKXB 3SBWA 1V3MA 5ESAB 3F12B 5C0DA 3OGCB 1GZPB 3QUMA 1LNUB 5HSFA 1N6QH 3JWOH 5LWYL 4JPWH 2YC1A 1J0JA 3H0TA 4OI8A 4GKNA 1P69B 1JK8A 2BY3A 3VFMB 3WE6A 3F7RA 4PJFB 3D0VA 2WM0A 4BH7A 2H2SD 3L3GA 4OCSH 3C8HA 2E8ZA 3OF6D 3LEXA 4JFZH 8FABB 5CINH 1PJ9A 1MCQA 1ORSA 1BQHA 1Q0YH 1KB9K 3UTQB 3U4EB 1ZLVK 3LS4H 4LPTA 4LEXL 1MJ7L 3GHBH 1F02I 1UCTA 1OL0A 1D5BA 4WFED 5J6GB 2E6PA 4HS6A 4K2UH 2CJUH 1MCPH 4KC3B 3H7BB 3MV9A 2X4PB 1FBIL 3P4NB 3SJVD 1RUKH 2L7UA 3SGDI 2G5RA 4MD4B 1HXMB 1YY8A 4LPWA 3SE4A 2GUOB 4UAOC 4L29A 1MCKA 1UB6B 2V7HA 1OGAA 2OCFD 3M07A 2D0FA 1XH3B 4R97B 2B39A 4WTXA 1ZXQA 5H35B 4ODHL 2FJGA 4BSJA 5EIIA 5ITFA 4PUBL 3AMKA 2W9DH 4L4TB 1XCQA 2OM5A 2NZ9C 3DRTB 3L6FA 1VFOA 5BZDB 2H1PH 5SX4I 5I66A 5MHSD 4JKLA 3FRPA 2HJFB 1SEQH 2VXQH 3MMEA 3MRJA 5GRYA 3PXJA 4OF0A 4KDVA 2X4OA 4GAYB 3HNSL 4NJ9H 4QRTB 3TV3L 1DN0A 2WBJD 1G9NC 3UROR 5TE4H 3ULSB 4M3JA 5E9DB 1IC7H 2NY5L 1CBVL 2VDKL 5DMYA 2MQCA 2X89D 2R9HC 1AE6H 2CR6A 1P4BL 2AJUL 4K7PX 5EC1A 1TQBC 2PYFB 4ZFOL 4JQXC 1A6AB 1T3FA 1EAPA 2HMID 3G9VA 1I1FB 4JREB 1X5XA 2IAMB 3H42H 3M1BA 2DI9A 4G9FE 3EBAA 1IGMH 1TNMA 5DQJA 4OD1H 2D03H 4JHWH 5DHVB 4ELKA 2ERJC 5CAYB 4NIKB 4TUOA 3QO1B 2UUDH 5BS0B 3KLSA 5EFIA 2F54D 2FBOJ 1OAQH 4YBHA 3T0EB 1FFPA 3OR6B 4CUCA 4S1RL 4ERSL 5DJDA 1A3RH 4K9EH 4NZRH 3DUSB 3D39B 2KZWA 5JW5A 1RUMH 4JFPA 5DHXB 3L7EA 3MO1B 4CJ1A 1ES0B 4LDOB 2UV3A 2R1WA 4D3CH 4LPXA 1SBSL 1CD1A 4HJGA 2FJFA 1RMFH 3G5ZA 3K2UL 3CH1A 4G80A 3LKRA 2P43B 1ZHLA 5D7JA 3C6LA 3BQUA 1L6ZA 3BKJH 3Q6GH 1I7UB 3C08L 4RA0C 5JXEA 1CFNA 1F2XK 5FF6A 4NUJA 5I18H 3SDAB 4K3EL 5H2BA 4M1CD 4EXPX 3MOQA 1VFBA 3V4PH 1T6VN 2EO9A 1R5VA 3DUHA 2AEWA 1T2QL 3QDGA 5FKPA 3MLVH 5GGSY 4YE4H 3FQNB 3SGJC 3C6SA 3MRCB 1RZ7L 2IADB 3KR3L 4ONFL 4P4RA 1G6RH 3QIBC 1OP5H 2OXHA 2DTML 1U8MA 3WNNA 2YD2A 4IRJA 1AHWC 2VN4A 2K3TA 1R5IB 4HV8B 5C3LD 3VXSD 1NCWH 3CVHH 1X9QA 5FO7A 3RRQA 5IP4A 1ODAA 1HNFA 5IIEB 5CS7A 1QBLH 1BX2A 4CVZA 4DW2H 3FFCB 4OZFA 3GDBA 4QTHB 2AJXL 3D3VB 3T8XA 4EDWH 3CFIC 3X3FL 1BP3B 3SDXA 1G7JB 4WEBL 4V1DD 4I18C 5I8EB 3MJ9H 4PJ7A 2DQEH 3VG9B 2KL6A 2DQJH 2GJ6E 3HUJF 3MJ8B 4V2CB 2BSRB 2HMIC 4XC1L 4XMPH 2GFBB 3RX5A 2L0DA 4FQHB 3VJ6B 4GXVL 1CDIA 1F4AA 1QPXA 2VZTA 3JBG7 3LEVH 4NZTH 1J5OL 1BBDH 3CSBA 4PGZA 4UNVA 4M7ZC 5FYJE 1TZHA 3LY6A 5LAXB 3F7VA 1OT1A 2J6EH 3BESR 1AD9A 2V5YA 5T1KB 3O4LD 5D7KD 4NQXA 4XP6L 1IGCL 3C8KB 1UQSB 3IT8D 5C07E 3KWWA 4P3CH 3WFDL 2XPGA 4JDVA 3GK8L 3KPMA 3PABA 3MUHL 1JHTA 1BGXH 1SM3H 1JPGA 2P7TB 3MC0A 3QUXA 4RMTA 1CLZH 4HCRL 3MJ7A 3MV7E 2A6IB 3JV5A 3TBWA 4X6CF 1JRHL 1ITBB 3EGSB 2PYEE 1WICA 3NABH 5KSVB 4JKMA 5D2NA 5IEKB 3T3PF 3RJQB 1KBGL 2DTSA 3FL7A 3U83A 4YDJB 4N0YL 2DJ4A 4LHJB 2APXA 2LQRA 3GIZH 4G6FD 4PJXF 1BJ1H 1I8IB 3LS5L 1ERNA 4MYWB 4RZCB 4CGTA 3EYUH 1IRAY 3MRMA 4LRIA 1M71A 5E94B 5GGRA 2A9ML 3UYOD 2ITCA 4O5LL 4M1GH 5C71A 4PJAB 3DVGB 5KSBF 3HAEH 4RWYL 3MYJB 2MOVA 3RL2A 1J0HA 3SDYL 5CBEB 1ORQA 3QXTA 4C55A 5CD3A 4M62H 2XV6B 5D7LD 3W11C 5JOPD 3LV3A 4UILH 1K2DB 1G7MB 4MA3B 2I9LB 2YZ8A 1C5DA 2R0WH 1T6WA 2BSTA 2F15A 3QEGL 1KCRH 4NN6B 1WZ1L 2JB5H 3PWVA 4OF6A 4QOKA 5AWNL 1XR9B 5JZ7D 5IB1A 2VKWA 4NT6A 1LEGB 5F9DC 3WXVH 3S35H 1FVEA 2Z31B 5KSAD 4M7LH 1J05B 5ICXA 2EDHA 2YPLD 1CD9B 1P7QB 4N9GB 4IHOA 5D7IF 3RWJA 1PG7X 4G8IA 4S1QL 4XVTH 3MFGB 1HILB 2NY3B 1PD6A 1LO3H 4L4VE 3SY0B 1NDGB 1RULL 5FO9B 2VUOA 3NPSC 4LAQL 4RMWA 3W39B 5IVXE 1FQ9C 5DVKA 4OSUL 3FQRB 3D25B 3HI6H 4KJWD 5CJXC 1C08B 1G6RA 2D9CA 5IJVB 1CWVA 1S9VB 1OGTB 4XI5D 4OLWL 1IT9L 4P46B 1IARB 1QO3A 4FFWC 4JDTH 3F5WB 5A16A 4IRSB 4E41E 2HJKB 4AIXA 4ZAKB 5F9JA 2ZSVB 4LMQE 2HFEA 4LPVA 4PJEB 3N50A 4R90L 3BPNB 1BAFH 4ZFFA 1JI2A 2BVPB 3ARBB 1KOAA 1U58B 3VDAA 2C3GA 1TIUA 3D9AH 2R2HB 4LLAA 4AG4H 1IZJA 2FX8H 3RGVA 4H26B 2V5TA 3MJ9A 5FDWB 3L7FB 3MRLA 5ETUA 4NBXB 1ROWA 2R2BB 3MLTA 1D5ZB 5HHNB 1A1NB 5MERB 4AQ1B 4G8EB 1KLGB 4GMSH 2ZCKH 5DS8A 1OQOA 4ISVB 4LHUA 2V6HA 2FBJL 1PBYA 5CEYB 2DI8A 4HS3A 4YHZH 2XQYK 1GHFH 3CX5K 2Z4QA 5J13C 1S7QA 4LLWB 4ZXBA 2AABH 1FZMB 4NQDA 5C09A 5KOMC 1F4WH 5D8JL 1PZUB 1T1WA 4YGVB 2O5XL 1NGPH 5IVZB 1KJ2L 3MRIB 3VRLE 3HE6C 1R5WA 2LAGB 1FL3B 1KGCE 3MREA 1FFOB 1SJHA 3QWRD 4LVNB 2K1MA 2NY6C 1NDMA 5EPMA 5JZ7C 4UV4L 4KVNH 3QB7C 3TBYA 1KUMA 3QXUA 4ONOA 3GMQB 4ZPVB 3NFSL 4B7LA 4BQ8A 1UENA 1Q9OB 4Q6IA 2EH8H 5MEPA 5F44A 3TT3L 2Y06H 4ZUWA 1FN4B 3OJDA 2YXMA 1P84J 1HIMH 4Y4KC 5KG9A 2EEBA 2WSKA 5E2TL 3ZDYE 3MQIA 4LLMA 1JNNH 5FUCE 4WW2B 3RPIB 3VMPA 1DLHA 4UI2A 1ITCA 1NUFA 4U49A 4X98B 2F53B 4PY8I 1VEPA 5DK0A 1B0WA 1OY3B 4NKOB 1U8IB 4FFVD 3E3QC 1Z9MA 3M8OL 4KJWC 3E2HB 1F6AB 4N8VG 1GPOL 3HAEA 2PCPB 4PP1D 4XI5C 1T1XB 5FYLD 5L8LB 2HT3C 3PV6A 1D5MB 1LDPL 2DIJA 5IMLA 1TZGH 5IJKC 2CIKA 3HE7A 4RQQA 1X5JA 1FSKB 2V9TA 1MF2L 3O8XA 4XNMA 3HZVB 1L0QA 3C5ZD 1JWUA 2FL5A 3S36H 3GSNB 4GG6E 4N8CH 4JZJA 1QKZH 1RJLA 3L5XH 4JY5H 1KENH 4JO4L 3TBTA 3VFNB 3I6GB 3DV6A 1NMAL 3IU4L 2BY0A 1DCLA 3N06B 1KELH 3CVIL 4HAFA 4HKJA 4KROD 4HUVA 4NQCB 4L8DB 1X5GA 5C0AA 4LKCB 5MEQB 5HDBE 3WKNA 5DJ8A 1WWBX 2C3VB 5F9OL 1FVDA 5CUSL 4EBQL 3IVKA 5I1LB 3V7MA 5DSCB 3A6BL 1ZT7B 5MENE 2BJMH 2ARJB 2BSED 5L0QC 1YMHB 3ARWA 4LLYB 4R3SA 3ARUA 3U0PB 4G8GD 1NEZB 4XH2A 4F7MA 3SOBL 4NQUA 3BKCL 3HI5L 3SGKC 3BP5A 1RZFL 4WFGD 3VWJD 5C0CB 3V6OA 5A2LH 2AGJH 1TETL 2GSGA 4P2QA 3LQAH 1IKNC 1MCOH 15C8H 3EHBD 1L9MA 3QJFB 4U05A 4PS4L 4K3JH 1UEMA 3GZKA 3REWA 2P8PB 4NO0A 5C70A 3NA4A 2Z91B 5TQ2L 2C1PA 3ALPA 4FQLL 1J1PL 3OJMB 4RDQG 1TJGL 3BIKA 3H3PH 3HUJB 4WUUB 1JGEA 4XCCL 3MNWA 3O3BB 1NAMB 2E6JA 4S1DC 5IMMA 2WINB 4LSPH 5ENWA 4RAVB 4FQXD 5L6YH 2JCCE 3T4YA 5A2IH 1HSAA 1YYLL 2F58L 1CK0H 3VXMD 1ULVA 3VGHA 1J86A 2RHEA 2V9RA 3C60B 5E00B 4P0DA 3CZJA 2BNRE 4X5XB 5E2WH 3AC0A 5CJQH 4TSCL 5FV1L 4GRLD 3GMMB 5SWZA 3HB3D 1XGUA 4I3SH 5DJ6B 4YXLL 2EYTA 2VIRA 1MQKH 1K6QL 3ZKNC 2NTSP 4Z77A 2EZ0D 1F5WA 1NC2B 4PLJD 3VXRA 5D1QA 3OPZL 1MI5E 2P5WD 4NFCA 3O3EA 4GXUM 4X6CB 5HTSA 3VFOB 2CDGA 3BWAA 5GRWA 1NGYA 2YN5A 1A3LL 2ENYA 3MBEA 1I9EA 3R4DA 5F3BA 5D9SB 4EI6B 5DMGD 3C2AL 4OCRL 4OUOA 1TPXC 2DQTL 2Q86B 4JDZB 3QQ3B 5FKAB 1F3RB 2IEPA 4PJXB 4KROC 4XPBL 4S1SL 5JHDA 4PRPB 5EU7C 4FTVA 1VEOA 1U8KB 1U2CA 5E8NA 3PP3H 4OF7A 4D94A 2H3NA 2V5MA 3F7PC 2QSQA 1U92B 2PW1A 4KQ3L 2R1XA 1N8ZA 5IGXL 3FB8A 4RX4A 5KVEL 4OBSA 5ESQA 1P1ZB 5BV7B 5M7QA 2E27H 3QNXB 3DO7A 5JQ6L 1BZ9B 3Q6FA 1G7IB 2VR5A 3IDGA 3OKKB 2HKHH 1VGKB 4HK0A 4MHHG 3BDXA 3GO1L 4W6WB 4PGEB 4PIRF 3VWJC 4L1HA 1QFOA 3KVQA 4Z7OF 5FHAH 3WS3B 1CN4A 4HIJB 2V7NB 2WLYA 4K7FB 3RAJL 3ZSTA 3EHBC 1EA9C 4EDXB 5IB3B 4BKLA 3RZCD 3QFJD 5D7IB 2JJSA 3HE6B 3MYZA 3SDXF 5KJRL 3VXOA 1Q0XH 2WP3T 4ZO8A 2HFFA 5F89B 4FQXC 4PJ7F 2P46B 2AEPH 2NTFB 3TZVA 2R1YB 3FHAA 4XNYL 3BPCB 1UM6L 5L9DL 2OTWB 5EB9A 1EJOL 4N1CA 5E4EB 4Y4KB 2VXTL 1KACB 1I7RB 2R69H 5FHBL 4OUUA 1S5IH 3TNMA 4Q9CA 2UZYB 4GRLC 2PTUA 4NM4L 5E6IB 1DBKL 1YQVL 3RA7H 4OCLC 3ZKQD 1CT8A 3Q2CA 2HFGH 3A0OA 3RUGF 3BQUC 4YQXH 2EZ0C 1R0AH 2F8XC 2WBJA 1OP9A 5D1ZD 1W72H 4L8BB 3UTZB 4IBLT 2KQMA 3JVGC 3OKEB 1G9ML 4MNQB 4MXWH 1UWGL 1UZ8B 2NXYB 3DTXB 4P2OB 2Z92B 4FN0A 4E5XB 1GC1H 4L3ED 4JQIL 5C08B 2W0KA 3TYGL 2CXGA 4XCFH 2HKFH 4Q9QL 4F7TA 1BBJA 1KIUA 4C57C 3B9AA 1SYSB 4IRJC 1R3IL 5J7CC 1CLCA 2YD9A 1I7ZB 1MCNA 4LAJH 1PAMA 3CU7A 1L7TH 4HD9A 5C0BB 1YMME 4ODUB 4JRXE 2W38A 4LFHG 2Y07H 4DGVL 4M9PA 2EEAA 2X4NB 3B6SA 1CGTA 3CFKB 1CICD 3EUUA 2VL4A 1FG2A 4NRZB 3V5HB 1WIOA 43C9B 2DMKA 4DUWA 1WISA 4EQ2A 3BAEL 2GITA 3QDMB 1OP3K 3K2MC 3CLEL 4ODXA 1RZ8A 4M61B 2X05A 5IT2L 4NRXB 5I30H 4RMRA 5C0EB 5I1KL 4OD3L 3IDXL 1QVOB 5FIEA 1OW0C 3KPSD 4WO4D 4MD0B 4HKBB 4Y4FB 3RZCC 1T1YB 1YN6B 3DXAE 25C8H 4U6VL 4M9OA 5ADOH 4WHTB 4KY1H 12E8H 3NFPB 5A2JH 5DI8A 4I5BA 2PUQT 4NC1C 3S88L 4ODTL 1IFHL 2WUBH 5GHWH 1CD0A 4K7PH 4WI6A 2IQAA 5AZEH 1T5WB 3RIFF 3CFCH 4XP1H 4APQA 3FHQA 5C0DB 5DC0A 4I1NB 3QUMB 2B0SL 4PJ9C 2R0LH 3L3DA 4J4PD 5FUOH 5C9JB 3L3OA 4XXDA 2YC1B 1UWEL 3H0TB 4ZO7A 4ZS6C 3FCTA 3O4OC 4BZYA 2QV2A 2CGRH 4OT1L 5H94A 4TSBH 3HC4L 3J8F7 3WKMH 1JK8B 4X4XB 1QLEH 3WE6B 3TJEH 2FO4A 4N5ED 2AERT 4BH7B 1RURH 3L3GB 5D1ZC 3LEXB 3O3AA 1ZLSH 5J6HA 1MHPH 3MV8A 3Q48A 3K4AA 1BQHB 4ZO9A 5LGHH 5JPMA 5D71H 2VZ1A 4R2GD 4TNWK 4PGDA 5ICYA 1JZ4A 1V7ML 1D5BB 1U3YA 2CKBL 3U1SL 4HS6B 4Y4HA 3SO5A 3MV9B 4PBWD 4JRWA 5DGRA 2CK2A 2WW8A 3EJJX 1KB9J 3S37H 4GS7B 2DL2A 1YY8B 1FC2D 3RU8H 4L29B 2V7HB 1H15A 1OGAB 1NUGA 3BRDA 2V9QA 1UH3A 3T2NH 1RZJC 1CICC 5EBGA 3IJSA 2FJGB 4U1JA 1E4XI 4LCWE 1H3GA 2ADGA 5EIIB 3TBSB 1DBML 3ZL4H 4RFEA 1XCQB 5IG7A 2AQ3A 2VDPH 4P9HC 1DJSA 3L6FB 4IS6B 2NZIA 3PNWA 5I66B 1F2QA 1Q38A 1W72A 3MMEB 3MRJB 3UZEA 4NO3A 1Z9SA 2X4OB 5D4QA 4YR6A 4YGAB 4H0IA 3P11L 4F9LA 5ALBL 3T3ME 1DN0B 1ZSDA 5J12B 5EO0A 3UTSA 2XQBL 4QRQA 1B3JA 5FYKE 2Q7NA 4DGIH 5I1CL 1PKQA 4RGMC 5EC1B 5I1HH 4HPOL 1T3FB 2CMRL 1EAPB 1T20A 4UZGA 3U0TB 4AY0A 3M1BB 3H6JA 1I3GL 1QBML 2YSSA 4HBCL 4J3WA 5DQJB 5FYLH 1ZLUK 4PB0L 1Z2KA 3KJ6H 5ECJE 1PW3A 4ZS7H 5HHPA 4B7IA 4TUOB 3H7LA 4PRID 4FXLA 5EFIB 3RDTD 2XZQH 3UJJH 1KB5A 2I60H 3OAZK 1C16A 2FB4H 3RWCA 1JV5A 5DJDB 1YC7A 4TRPH 2VSDA 2ZNXA 3O45A 4OCXH 1FNSH 1U8JA 4RGND 4WENB 5JW5B 4N5EC 3OAYH 3L7EB 5FM5O 1T83C 2R1WB 1MHEA 2C5DC 4LASH 1YYMH 2WLZA 1CD1B 1ZK9A 4HJGB 2FJFB 4PRDA 1A6UH 3BKML 2C9AA 5JW3H 3G5ZB 4D9LH 1IBGL 32C2A 3CH1B 4G80B 3LKRB 1ZHLB 4RNRA 5D7JB 5I1JH 3C6LB 1QTYT 4YAQA 4FQQA 5CEXB 1PX3A 3MRNA 1G7HA 4JO3L 2ZWLT 1WC7A 2HRPL 1CFNB 3HRPA 5FF6B 3MLXH 4NUJB 1MIEH 3D5OF 5EBLA 5H2BB 1BD2D 3BKYL 3WD5H 1VFBB 3JUZA 1X5KA 1EO8H 1R5VB 5DO2C 4EUPH 3QDGB 1FFQA 5FKPB 3B4NA 5E70A 2MPAH 2AS5M 3C6SB 3IETA 3JV6A 3FT2A 4NWUL 3WFBH 5IUSA 2D3VA 4P4RB 1TCMA 1OB1A 2WV3A 3P0GB 1U8MB 4Z7NE 5C86A 3VFSA 2PR4H 4IRJB 4Q9BA 5I1AA 4YEEA 4BSWA 4L3AA 2VXSH 3NCYP 5FO7B 3QT2A 4H88H 4FQIL 4POZC 3QUKA 1LE9A 2JK5A 3MLRH 1BX2B 4CVZB 2AXGB 4PJDF 2N7BA 4YWGH 1MRFL 3VXUD 2AK1H 5JW4N 4LDEB 4P9MH 2UZXB 1A7QL 2IFGA 5T33H 3T8XB 4BZ2H 1JGUH 5DURD 3SDXB 4MJ2A 5FUZL 4Y5VC 4XNXL 3ROOB 3STBA 4PJ7B 3DECA 2Y5EA 1N6VA 3DLQR 1S8DB 2JIXB 4KKLC 1N0XL 4GMTL 4DN3H 5HGHB 1PG7H 4FFZH 5A2KH 3GI9L 3RY6A 2VWEE 4WCYL 1J8KA 3GEWB 5DFTA 3O8XC 1IGIH 3IXTB 1CDJA 2X1PA 5KW9H 5ISZD 1MELA 1RK1A 3RDTC 3F7VB 1YEGH 5CZKA 3VFRA 3QEHA 3QIUD 3T0DA 5BO1H 2DF3A 1AD9B 3SQOH 3KPRE 1IAOA 3KWWB 4RGNC 3BMVA 2XPGB 2R39A 4JDVB 3TVMD 3KPMB 5DMIL 1OWRM 3PABB 3R8BB 4ZODA 3QIWA 4G9FA 1JHTB 2P5ED 2BSSA 5BS0E 1PSKH 4XMLH 1JPGB 3QUXB 5E08H 4C56E 3GGWA 3MJ7B 5J57B 3TBWB 3KPNB 1MSPA 1D5IL 3OKOA 3SHSA 4OFIA 3IAGC 5D96B 2NQCA 5D2NB 5DJAB 4J23A 5CGYD 1U8LA 3QQNA 4R26H 5HVHB 3GNMH 4RWHA 5EU6D 4PBVC 1MWAA 3EAKA 5ERWA 3NACH 4OLXH 3JTSA 4NDMA 3RBGA 2ESVD 3SN6N 2VXVL 4MXQD 5SX5K 3BJLA 3MRMB 1M71B 3BPLB 1I9IH 5GGQL 5JOFA 1YNLH 4OI9A 2JKXA 2ITCB 4HT1L 3A67H 4FS0A 3BN9C 3C5ZA 3RL2B 3DGCR 5EWIH 1FO0L 5ANMA 1I7TA 1ORQB 1QLFB 2AVGA 3CX2A 4Q2ZA 1EEYA 1RUQH 3TC9A 3VDBA 2ZG3A 4QXUL 3LV3B 5K9JL 1C5DB 1NBVL 1AJ7L 2BSTB 1F97A 3ZTNL 4YDIL 3PWVB 4QOKB 5E56A 4NN7B 5IB1B 4BFIA 2BC4B 5SWSD 2R23A 1WZKA 1AXIB 1BZQK 5I15L 1FVEB 2E8YA 3MRFA 1K8IA 5GGVY 5ICXB 1AI1H 2XI9A 1U8NA 2OR9L 1AC0A 1MFDL 4IHOB 4OTXL 1EGJA 4LIQH 4G8IB 1WF5A 2E9JA 5GRJH 5K59E 3BI9X 1FLRH 1FNEA 2HLAA 4OKVA 1XGYH 4EUPA 1E28A 3GSUA 4P23D 4R9HA 2E3VA 5GIRA 1QQDA 1G6RB 4NSKA 3C87A 3QIUC 1Q9WA 3N1QC 4MSWB 4OJFL 1DEEA 1DN2A 4HJJH 2GCYA 1QO3B 3U30C 4X5LA 5A16B 1A6VH 2GJ6A 3WFHA 1J1OL 1AIFA 3TVMC 2I5YH 5F9JB 2HFEB 4HIIA 1LEKB 2X4TA 4QRPE 4JG0H 4ZFFB 2XOTA 2YBRA 3NTCL 5HXMA 4W4OA 4X9GA 3VWKD 3I6LD 4AEHH 4YHYC 3RGVB 1FRGL 5DRZA 3MRLB 4G7VL 5ETUB 4LCCA 5F6HI 4Q9RH 4NQVA 2EE6A 2NY0D 3CIQA 5EZLA 5C07A 1T5XA 5DS8B 1EBAA 4LHUB 2QEJA 2M1KA 4XGZA 1A7OL 3KPOA 4HS3B 3V52H 4JKPH 3MV7A 2IPKA 3V0WH 3MUGA 3FQUA 1S7QB 4ZXBB 3NZ8A 3SPVB 4F57H 4M03A 5DEGB 4MA1B 1U91A 4NQDB 3I85A 5AYUL 1NLDL 2QADD 4TN9A 5C09B 4YBLB 2Q3ZA 3QH3A 4ZOCA 5DUMH 2XY2A 1T1WB 3HFMH 2AJVH 4K3DL 1SMAA 1BZ7B 5F7WC 2XXCB 1R5WB 3MREB 1SJHB 4FXKA 1FNGA 2VDOL 1NDMB 5EPMB 5DD3H 4WFHE 2EDKA 3TBYB 3ULUD 2EC9U 1F3JA 4ZFGL 4KZDL 3MRDA 1X5HA 4Q6IB 1XF5A 4I0PD 4OM0H 5MEPB 4PG9A 4XWOD 4ZUWB 5I9QC 3OJDB 1QR1A 1L4IA 4XAWH 5KG9B 3NN8A 4LLMB 4F9PC 4JPIA 3OKDA 4M6OH 1I3UA 2OP4L 3MRHA 1DLHB 1E6JL 5IBTL 5F93C 4QY8A 5DK0B 5DGQA 4R4FL 4ZUTA 2VDRH 3B9VA 3U4BH 4AM0A 4Y19D 5E7FA 5HI3D 3VH8A 4HUMB 2YK1L 3NCJH 1SEBA 4CMHB 3VFWA 1CGSL 1OARL 5TPWL 3HAEB 3MLSL 4KUCF 3PV6B 4OLYL 4ZQKA 1HDMA 1GGBH 4M6MH 5IMLB 4XXCA 3DMMA 4KRMB 2CIKB 3TM6A 2VLKD 2DJSA 3HE7B 1NJ9A 1OHQA 4HDIA 3WJLA 4RQQB 4NNPL 4L4VA 4FABL 5B8CC 1Y6NR 4XNMB 6FABH 1MFBH 3PDOA 5DD1L 1JWUB 2FL5B 4X0KA 1FGVH 4EXKA 1TCRA 2VISA 3VFGL 1AGCA 2A9NL 4JZJB 1NGQH 2YD3A 3N85H 2VZUA 3VWKC 1RJLB 1YJDL 4OI7A 1NCTA 3QULA 3MJ6A 3TBTB 4IOSD 3EJZD 3DV6B 3S5LA 2NY0C 2JJVA 5C0RL 4PY8J 5JORA 3HCVA 5K9KA 3IDUA 4PJEE 3VXNA 5E8EA 3U9PH 2FGWH 4HKJB 4HUVB 3ARDA 3NCFB 4QYOB 3MTRA 4X9BA 5C0AB 2GQHA 2DMBA 1T89A 5DJ8B 5EUOE 1UM5L 1H9VA 1NC4A 4HLZH 1DQJA 1FVDB 3WNMA 3IVKB 1A0QH 3QP3A 1T7WA 4ZNEE 2VH5L 2AQ1A 2J8HA 4NHCL 1P4IL 4GQPH 1KCKA 4R3SB 1MREL 5H8DA 5IW6A 4G6JH 4HIEA 1CS6A 2CK0H 1FORL 1YEFH 2VDQH 3U36A 2EH7H 4X6FA 1T80A 4XH2B 2F5AH 4TUKH 3U7YL 4F7MB 1UKTA 3VFPA 2GSGB 3ULUC 3NFNA 1KT2B 4KK9D 2DLHA 3F58L 4P2QB 3SE8L 4I0PC 2D0GA 4XWOC 3G5XA 1ACZA 1AQDA 2BNUA 2D7PA 4APQC 5LWYH 2QL1A 2ZZUT 3HC3L 3REWB 5EUKB 4O51A 4NO0B 1WAAE 2C1PB 3DSNA 1BJ8A 3LRGA 5IWLA 4XP5L 3BIKB 3PWNA 3QDAA 1JGEB 3MNWB 4H8WL 5IMMB 5HI3C 1T7ZA 3A6CL 1RJZA 5DLML 5ENWB 4HJ0D 3MGOA 3T4YB 4P5TA 5TH2A 1HSAB 4LSDA 2I24N 2FR4B 5EU3B 4LLQA 4H20L 1JGVL 1TMCB 2Y72A 3CFEA 2IGFH 4NQSA 4UOJA 2KUTA 3FJTA 3DROA 3H9HA 5SWZB 4LEXH 1XGUB 1FYTD 1MJ7H 3PHQA 2R2CA 3B3IA 5IESL 2EYTB 2NW2A 1KJ3L 5DK3A 1MAMH 1FBIH 4PG2C 4XVUD 4G8FA 4Z77B 4POUB 4I8DA 3VXRB 1BFOA 5D1QB 1QSZA 2VNCA 2M2DA 2X44D 4HFWA 3BWAB 3NIFF 1NGYB 3DSFL 1FZKA 1MCDA 4UTBL 1EX0A 3MBEB 5F3BB 3LRHA 5IM7A 1F90L 4ODHH 3VXQA 5E8DL 2YXFA 4IM8A 1BF2A 2CUMA 4BH8A 4PUBH 2ADJA 2OR7A 4KMLB 1FZJA 1VB9A 1INQA 4TNVF 5JHDB 1J7VR 3MCLL 1C12A 4PTUA 4R0LA 5E8NB 4DTGL 4GG6A 4NYLA 2H3NB 3R06A 3HNSH 2PW1B 2VMFA 3K4DA 2R1XB 3TV3H 1N8ZB 5FGBC 3FB8B 3MCKA 3GI8L 4XVSH 3KLDA 4WU7A 5F3HA 4Y89A 2NY5H 3DO7B 4DGYL 1CBVH 2VDKH 4NFBA 3C5SA 3BD3A 5IQ9A 3Q6FB 5D93B 3IDGB 1P4BH 2AJUH 4DUXA 1NH6A 5LVEA 3RI5F 4HK0B 4HXAL 5HI5D 3GB7A 3LRSA 1VGEL 4KK9C 5T3XE 1ZA3A 5I16A 5K9QG 5HGAB 3GBLA 2DI7A 2FCBA 5J0BA 2ZG2A 4MJ6A 1J87A 5MENA 4BKLB 4H0GA 1VADA 1FCCA 3EFFA 4S1RH 4PJ5D 4ERSH 4C4KO 1C1EL 4QLRA 3VXOB 4YXHL 2O5YH 2HFFB 1S7SB 2AV1A 5LGJA 2LVCA 3TZVB 1VENA 3BIBX 3D85D 2M8XA 1IAIM 3CPLB 5HHME 2ZSWA 2UY6A 1CFVL 2OYPA 4OUUB 3TNMB 4UDTA 3K2UH 2EDDA 1GGYA 3AS1A 4XWGL 4DZBA 3IS0X 2PXYD 1Z0MA 1CT8B 4MQTB 3QFDA 1MH5A 3ABZA 3BFOA 1AFVL 3C08H 1OCWL 3QUZA 2UY7A 4TVSa 2OTUA 2JCCA 1LHZA 4K3EH 2WBJB 1I1AA 4CNIB 2VTFA 5I1EL 1T2QH 1Q8MA 1PDKA 4WWKA 2C4FU 4P57A 5IROA 3MLPA 2BNRA 4OFKA 5MI0C 1MJUL 1RZ7H 3KR3H 4ONFH 5TJWK 2DTMH 5J11C 2KQNA 4NPYA 1NSNL 2KBGA 4F7TB 1BBJB 4J6RL 3AREA 3AU1A 3O6ML 2Z8VC 1MI5A 5C0ND 3L5WA 1IL1A 2XA8L 1V5JA 2AJXH 4PRPE 4U0RC 3X3FH 3O9WD 1XZ0A 5GSRA 4IIQC 3S3JA 3B6SB 3ARZA 1ZTXL 1W2KT 1FG2B 3SDDD 3EYOA 4X7FC 4XX1E 4RRPG 5HI5C 2GITB 3GSVA 4IMKC 4ODXB 1RZ8B 1X3DA 4MQ7A 4GXVH 4EVNA 2EXWD 3QHTC 1EFQA 4K71B 4N9OB 1J5OH 3RY6C 3DO3A 2GYSA 2IAND 2Q87A 4YXKL 1B2WL 1ZV5A 3BW9A 1W8OA 4ZSOA 3KPPA 3N9GH 5DVOA 2FEDD 2ICEA 1ZEAL 2NX5D 4QRRE 3BUYB 3FTGA 4XP6H 5DI8B 3GMNA 3WFDH 5I8KL 1KFAL 3GK8H 1JPST 3IXAA 4EOWL 4Z8FL 2IQAB 5HHQB 4HCRH 3NCMA 3B5TA 3FT3A 4CW1A 4APQB 2G5BA 3QIWC 1JRHH 3ARGA 2H8PA 3BP7A 2BVTA 4P4KA 2PXYC 1KBGH 4XRCA 3L3OB 1NFDA 4XXDB 4QKXB 4ZFOA 4KTEL 4N0YH 2VZ3A 3FCTB 1IKFH 8CGTA 5FXCH 5H94B 3LS5H 2HT2D 4DN4L 3FFDA 3MODL 4AH2A 2SEBA 4G7YL 4GBXA 4LVOC 3UP1A 2VZOA 1ACYL 1LO4L 2A9MH 3O3AB 2NXZD 4O5LH 2L4OA 4WTWA 3MV8B 5DUBA 1F58L 1WZLA 4RWYH 3CSYA 2JELL 1KULA 4YC2B 3SDYH 5EO1A 4PGDB 2D31B 5EU4A 3T0AA 5ICYB 3TFKC 1XEDA 4AZ8A 1JTPA 4Y4HB 1QD0A 2WANA 4MNQE 1WZ1H 5C0NC 4JFEE 5AWNH 1T66C 3IKKA 4Q6YA 4UMGA 3MBXL 5DDHA 5CMAA 3HG1D 1H15B 1A8JH 5MP6H 3O9WC 3AROA 3W5MA 1F6FB 4LF3A 3IJSB 3HN3A 3SDDC 4U1JB 5T1DL 3ZMRA 2ADGB 4ZTPL 4S1QH 3TN0A 2FLBT 2AJYL 4FRWA 5IG7B 4FZEL 5C0BE 1NLBL 1NCDL 4ALAH 2FHFA 3L5HA 3WNPA 1GGCL 1RULH 2YRLA 4RDQF 5I1IL 3PNWB 4LAQH 3VG0L 1W72B 4XC3L 5DZOA 5L2KE 4NO3B 4OSUH 1BECA 3V5DA 4GLRH 1YMMA 4YR6B 4JFQA 4JRXA 2AK4E 5J4MA 5EU6A 1UM4L 4NRYA 1YDPA 4G6FB 1ZSDB 2FEDC 4OLWH 4M4RA 1VA9A 1IT9H 5EO0B 3UTSB 2ESVA 3GSWA 4D0DA 3LIZL 4ZTOL 3RHWF 3W0WD 3RTQA 3O2DL 4AT6A 4PRHD 3BH9A 3MA9L 2DICA 4KK8C 1T20B 4F7CA 4R90H 4U1SA 4U6TA 4WHDA 3DX7A 3H3BC 2EDEA 4OD2A 5FM4A 3RX8A 1OVZA 2YSSB 4UIKL 3DXAA 5HHPB 1G9MC 1UJ3C 5I71B 1KB5B 1C16B 1PX4A 3RWCB 4CKVX 1JV5B 2HT2C 5BVJA 3OSKA 3UO1L 2FBJH 3O45B 1U8JB 4FQ1L 5KSAB 2VLME 3TP4A 5IK3A 4UB0L 3RVWD 1NEZG 3UDWA 5DJ0A 2NXZC 5HHXL 1MHEB 1W8NA 2MQ3A 4ODSL 4YLQT 3TCLA 5D8JH 2WQ8A 3QYCA 4PRDB 1LEIA 1FJ1A 32C2B 4JFHD 3CU1A 5J1AB 1FHGA 3IU3A 4RNRB 3QWQB 2O5XH 3B5HA 1KJ2H 4YAQB 4FQQB 3PGCA 2N7AA 3FN0L 1G7HB 3MRNB 1BFVL 4HK3J 3WO3B 1WC7B 1G9NL 4UV4H 2NY4B 2OS7A 1A9EA 3NFSH 1DL7L 2FZ3B 5ID0A 3G04A 4Y16A 2VJXA 3TT3H 1EO5A 1QSVA 2J8UE 4KV5E 2XKNA 5E2TH 4LMQI 4QXTA 1Q94A 3JWDL 1KV3A 3JV6B 3FT2B 2YUVA 1OB1B 1KXVC 1YPZE 4QWWC 1ZA6A 2OXGA 2A1WL 4KKCD 5I1AB 3SKMA 4BSWB 4NKIL 4ETQA 4P2RE 5F21B 2VL5B 4ODWA 4JQVC 1A4KB 1U3HC 2CLVA 5DFVD 4MJID 2DM4A 3QUKB 5E2UL 1LE9B 3M8OH 2JK5B 4JY6A 1GPOH 4U0RB 3VFTA 4KVCH 4CL7A 2VN7A 3MACL 3RVUD 3KYOA 4M6AA 4NP4L 1NBZA 5E99L 1GZQA 1ZWIA 3CGTA 1ZGLA 2YA0A 1MF2H 3O6FD 5D70L 3ZTJH 3VRLF 1OTTD 1I8KA 2YD7A 5IOPA 5FGCE 5CZXC 2PF6A 3LHPL 3SDCD 2LE9A 4DEPB 3WN5C 4JO4H 1R6VA 3H9SE 2XACC 3LH2L 4KHTL 4NM8L 1FNFA 2H6PA 1NMAH 1RK1B 1I85C 3AAZA 4XX1G 2VSCA 1QZ1A 3IU4H 4JANA 3VFRB 1B6UA 4KRLB 3QEHB 3ZDYF 3OKMA 5DVMA 1RUAL 4J3SA 3CVIH 3JSSA 4OLVL 4ONHA 3GBML 1F11A 4LFHD 1IAOB 3BD5A 1DZBA 4HZAA 3RVWC 1DLFL 1SHMA 4L9LA 5F9OH 4G9FB 3P30L 1G1CA 5CUSH 4EBQH 2GY7B 2EDXA 3GGWB 3L3HA 2P44B 1BEYL 2D7TL 3A6BH 5LCVL 3L1OL 3OKOB 5BCAA 2H2PD 3ZDXE 1U8LB 4MX7A 4Z78A 1MJJA 5A43C 3BOVA 3ZT7A 3PF2A 4KKBD 3F12A 3BKCH 1MWAB 3HI5H 3Q3GB 5ERWB 1RZFH 2O5ZL 1LNUA 3JTSB 4NDMB 3X14A 4EIGB 1BLNA 3KYNA 1CXFA 1TETH 3SO3C 1V7NL 4OFYD 1ADQL 2BVQA 3WS6C 2XN9D 4GG6F 5HHVL 5JOFB 3MNVA 4PS4H 1W0VB 3VGGA 3RIFK 4HGMA 5TQ2H 4WFFE 1NMCB 4D9QE 4I3GA 4HMEA 4FQLH 1J1PH 4RMSA 5C0IA 1TJGH 3C5ZB 4KKCC 4GSDL 5ANMB 4XCCH 4M02A 1I7TB 4Q2ZB 1EEYB 1OP5K 3RWEA 1G0XA 1OLLA 2Y23A 3PL6D 5DFVC 4A2LA 1Y18A 1YYLH 2F58H 4MB5A 4HQQL 5HDBF 5IVOA 1KCSL 1K4DA 3WIHA 1UEYA 3PP4L 4BFIB 5CSBA 2DLEA 2R23B 3T2OA 4TSCH 1PKOA 1KJ2A 3IDYC 4PLOB 1JJUA 2X4PA 3MRFB 1K8IB 3BEVB 5H37G 4YXLH 2H32H 1U8NB 4MD4A 4Z7VB 1S7UA 3ARQA 3DRQA 3FT4A 3O6FC 2FDBP 1K6QH 3VA2C 2APBA 1FNEB 2HLAB 4OKVB 1CFTA 2UVFA 3OPZH 4EUPB 1E28B 5KAQF 3GSUB 1HINL 2NLJB 3SDCC 5LBSL 4G8GB 4QGTA 1A3LH 5GIRB 4YPJA 1QQDB 4NSKB 1V8HA 2CUIA 3KXFE 1WIPA 2DQTH 1KIPA 1Q9WB 4XPBH 1DEEB 2VR4A 4S1SH 5HYQA 1NCBL 2EDTA 2GJ6B 3WFHB 4QRTA 4BELD 1AIFB 4NO5A 3IRZA 4NKDA 1Q72L 4X6BB 1J0ZA 4HC1H 2OK0H 4HIIB 2X4TB 2JCCF 3GSRA 4KQ3H 5B21A 2YBRB 3AB0C 5KVEH 1E4KA 2HTKC 2DQHL 5JQ6H 1HH9A 4UT7L 2R56L 5DRZB 2NY1D 4LCCB 3ILQD 4JLRB 2C1OA 4NQVB 1MY7A 3WBDA 2IFFL 3KPRA 3DX8B 5EZLB 1A3QA 5C07B 3GO1H 5DHVA 3OTTA 3QR2A 4YFLF 5ITBL 4TOYL 1HXYA 3TH2T 3RAJH 4XGZB 4C56A 3KPOB 3VI3E 3WUWA 1FYTA 3MV7B 2IPKB 2DLFL 3FQUB 3MUGB 3MUY1 4YFLI 4KGJA 1U91B 4Z7UE 3QPXL 5JA8B 3ULVE 1Q9LB 1D9KD 4GAGL 3MO1A 5ILTL 3QH3B 3NGBC 5KJRH 3KPLA 1F8TL 1DBAL 1P6AB 5T3ZD 1IQWL 4U1GC 3RKPA 3PL6C 4KI5D 2CRYA 3BN3B 4XBEL 3GSQB 3ARFD 4FXKB 4O2CA 1FNGB 4XNYH 5DJCA 1UM6H 5L9DH 3KLHD 2YMXL 4UOW1 1EJOH 1F3JB 2NCMA 4JRYE 2VXTH 3I3DA 3MRDB 3V4VL 1XF5B 3EZ8A 5IB5A 5FHBH 2X1WL 2ICWJ 4PG9B 2C3XA 3MXWL 1YQ2A 1QR1B 2JJTA 4NM4H 3PG2A 3BZEA 1DBKH 5DUPL 3NN8B 1RZIB 1YQVH 2GSIB 4JFXA 3SDAA 4JPIB 5K9OA 3OKDB 5CWSB 4XPGL 3MRHB 2F74A 4XCEA 4QY8B 3X11B 1MFEL 5D1XA 1B0GA 1BQHG 4ZUTB 4JM2A 1A14L 4AM0B 2Q6WA 3VH8B 3EIFA 4P59L 5EOCL 2ZUWA 2NR6D 1H0DA 5F6IB 5F1NA 3VFWB 4GW4A 1G9MH 4H1LG 1YECL 5T1LD 3VGDA 5IQ7L 3KJ4B 4ZQKB 5HGBA 1AO7D 1HDMB 4JQIH 3S97C 3TYGH 4Q9QH 1OAZL 1FL5A 2KZ1B 3DMMB 1NFDF 2IJ0C 5BW7C 2HG5A 2VRAA 4HDIB 4EN3D 4JHAL 4M43L 5GS2D 1R3IH 4L4VB 4KMQA 3PDOB 3PHOB 2DQDL 2QTEA 4X0KB 1TCRB 2VISB 2DM2A 3MJGX 1I4FB 1KCLA 4J1UA 1H3UA 4DGVH 3BSZL 2H32A 3G08A 2X4QA 2NY1C 4JFDE 3FRPG 3BGFC 3ILQC 5FCSH 3S5LB 4FQHA 5JORB 5K9KB 3VXNB 5E8EB 3BAEH 3B5GA 2MCG1 1J1XL 43CAA 3ARDB 3CJJA 3G6JA 4Q0XL 2WQRA 4QRPA 5I1KH 4OD3H 5IHZA 1SY6A 1NAKL 3IDXH 1NC4B 2NYYD 3P3YA 2MSPA 4YHIB 1DQJB 4D0CA 2DS4A 4TPRL 3WV0A 4U6VH 2XTJE 2EDFA 2PN5A 5IW6B 2P4AB 3MOBL 4ONGL 2EXYD 3BUTA 3UBXA 4HIEB 3S88H 3GJFK 1IFHH 4ODTH 4P5KA 4KI5C 3UEZA 3U36B 3BPOB 4HC1A 4X6FB 3ARFC 5E8OA 5HVFB 4LU5L 4UT9L 5DC9B 3VFPB 3NFNB 3EDFA 3PGFL 2BCKA 4L3EB 2ZJSL 3X3GL 2B0SH 3NH7L 2J5LC 1AQDB 2BNUB 1WEJL 4DFIA 3QDJD 4EI5D 3ARGC 2FSEA 1UWEH 1JF5A 4O51B 4MLSA 1GAFL 3QEQD 4XB7A 3HC4H 1T7VA 1NKOA 1XGQA 3LZFL 3PWPD 2YPVL 4ZPTA 3MRRA 1RJZB 3EOTL 3MGOB 3DVGA 4P5TB 5TH2B 3EDDA 3MYJA 4RFNC 1G7LA 4LLQB 2EC9T 5JA9A 4O2EA 3SCMD 1XFPA 2EKSA 1B90A 3CFEB 1JNLL 2WZPD 1HHIA 4NQSB 3T4AA 1CIUA 3BP6A 3DROB 3H9HB 3PHQB 1V7MH 3B3IB 3I6KA 3MLYL 4EN3C 2CKBH 3U6RA 5CCKL 1X6LA 2NW2B 4RIRB 4WO4B 3TO4A 4TTGA 2D7MA 4G8FB 4PJBA 3DV4A 4I48A 3TA3A 4F58H 1BFOB 2W60A 4U1LA 5HY9A 3UTTE 3IRPX 3QI9D 3TEUA 4HFWB 5C92A 1I75A 1UKQA 5FGSA 1FZKB 3QXWA 1CE1L 5IM7B 5BZWA 4UNUA 2DQFA 2IALA 5I6XC 5EOCJ 5INCA 1CXKA 2EDRA 1DBMH 2A6JA 1P4LA 1FZJB 2IF7A 1INQB 4WEMB 3WEXB 4PTUB 2D7QA 3ALWA 4RRPA 5GGSA 4R0LB 2X5PA 1JZ8A 4PB9L 3SEPA 4GG6B 4NYLB 4PBXA 2VLRE 5GPRA 5T3XH 5DF0A 4WHCA 3P11H 3AS3A 2ZNWA 5ALBH 3WFCL 3TPKA 1KLUA 1A4JA 3MCKB 4TUJA 3GIVA 4WU7B 5F3HB 2XQBH 3BP4A 4ZAKA 5C0AE 2NY2C 1JRHI 3C5SB 3RWGA 4JB9L 5A2FA 4PJEA 5I1CH 5IQ9B 4NCC1 4PRBB 4GFTB 2CUHA 1DDHA 1BQLL 2BVPA 1UB5A 4HPOH 4LCWD 2CMRH 1GOFA 3GB7B 2R2HA 3LRSB 4NGHH 5F7NC 2YEZA 5EUOA 3GSXA 2IPUG 3P2TA 1ZA3B 2P42B 5I16B 5BMFL 4WHYH 1I3GH 1QBMH 4HBCH 4ZNEA 4PB0H 4R2GB 3BO8A 3AM8A 4MJ6B 4EI5C 1IEBA 1LVEA 5B38G 5MENB 4OV6F 1LGVA 2FECL 4ISVA 2CDEA 3VRJA 3QISA 5KSUA 3WDIA 3V6OE 3EFFB 4P2QE 1WBXA 1HYRC 1MRCL 4ZO6A 2AV1B 3K3QA 5LGJB 2DN7A 4NQED 3V6ZA 3GKWL 3I3EA 2GW5A 5F1OB 1PGRB 3SCMC 4M48L 2E7MA 2ZSWB 4L8SA 3U82B 2MHAA 5IVZA 4Z9KB 3T1FA 4R4NC 4J12A 3BKMH 4UDTB 1DQML 1JZ5A 1IBGH 1NCNA 1WT5A 3T3MF 4DZBB 1WAAA 4TVPD 3PWLA 4YZFE 2WK2A 4OB5L 4LSTL 3QFDB 3S35X 1MH5B 4JO3H 1ZT1A 3QUZB 2HRPH 3HR5B 2BNQD 1MFAL 4GKOA 1C8PA 2FHBA 3BKYH 3MNZA 1I1AB 5IF0A 4OCWL 1HSBA 1JNHA 3S6CA 4WW2A 3THML 4WWKB 4P57B 5F1SA 2BNRB 3OZ9L 4X98A 3CK0L 3QRGL 5F1KC 4PRHA 3BVNA 4NWUH 4UV7L 4YHKL 3QQ4A 4GLRI 2FIKA 3KPTA 2C7UB 4NPYB 3NIDE 1A7BA 3DJ9A 3MV11 1DSFL 3FRUA 4PY7A 3AREB 3H8NA 5C7XL 3AU1B 2EDQA 4FQIH 2FX9H 1NBYA 1YNKL 3OKYA 1MI5B 5I74C 3L5WB 1MRFH 5TF0A 1EUUA 5F88A 1IL1B 3PP3K 2MQ0A 1A7QH 4JPKL 4L8CA 5DZNA 1LD9A 2BXYA 5JHDE 1WITA 4NWTL 1MVUA 1RHFA 5GSRB 1DUYA 1XZ0B 4TULH 3BWUC 1BJMA 2Q76A 3I02A 4XNXH 3EYFA 3EYOB 1A1OA 1AQKL 4HWBL 3GSVB 3ISWA 1RI8A 4HG4K 4WCYH 4MQ7B 1JF6A 1U93B 2B1AL 3FKUS 4EVNB 2KH2B 3ZE1E 5ADPL 1UZ6E 4M93B 4LLDA 3BW9B 4ZSOB 4TYUA 4P2YA 3ES6A 1WUNT 4CU6A 2ICEB 3GM0A 4L4TD 1WJ3A 3ESUF 3FTGB 1BD2B 3GMNB 5FCUL 2VQ1A 5DMIH 3JWOL 5HDQL 3IXAB 4WFEE 1RHHA 1A6ZA 5E8PA 4OFVA 3TT1L 5CGMA 3O41A 4XPFL 3OQ3B 3VCLA 3WFEL 4LLYA 3SJVE 1Y0LA 3FT3B 4CW1B 5JW4M 2G5BB 4OKDA 2H8PB 5E9DD 3BP7B 4HGWA 4LHUG 3V2AR 4Z0BL 5BOPA 4P4KB 4XRCB 1NFDB 4MAUH 4ZFOB 1ZGLP 4HF5L 5INDA 3HR6A 1TNNA 5CSGA 1MQ8A 3OJ2C 4LEOA 2IAMD 2VXVH 1JWSA 1IGYA 3FFDB 1IM9D 2SEBB 2B4CL 4GBXB 1FVCA 1IEAA 3MA7A 3KNBB 5GGQH 4KJYA 5MHSE 1TVBA 2CO6B 3UZQA 5BS0D 4HT1H 5TE7L 3AY4C 1NAMA 2PO6A 5DUBB 3T0ED 2WIMA 3CSYB 3FONA 1QR4A 1FO0H 2DD8L 5EO1B 3D39D 5EU4B 3U79A 4QXUH 1RIVL 1IC4L 5F7HA 5K9JH 4M4PA 1H3VA 1NBVH 4CDGC 1AJ7H 3ZTNH 1DBJL 3JTTA 4YDIH 2VDLL 2AV7A 2R2EA 3C5JA 5DDHB 5CMAB 3ZO0A 5I15H 1JF1A 4ETYA 3OKNA 2C4FT 1S3KL 2GHWB 2E7CA 3TO2A 3LQZB 3S36X 4LF3B 2OR9H 2R4SL 1MFDH 5LGKA 4OTXH 3VA6A 3HAEG 3NAAL 3B43A 3TN0B 5KZCB 1KYOK 5C0JA 1A7PL 4OF3A 5D9SA 1KN2L 5JDSB 4Y2DA 1CU4L 4R97C 3V5DB 5GZOD 1YMMB 4JFQB 4JRXB 2YD4A 5EU6B 4NRYB 3LMJL 1YDPB 3QPQD 1YEDB 4K3HA 3CFDA 2ESVB 3GSWB 4IJ3B 5SV4A 4D0DB 4OJFH 1NGWA 1KXTB 1UYWH 4U6XA 4HMCA 4NJAL 3RTQB 1U92A 1XF3A 1KIRA 4AT6B 4N1HB 3BH9B 3T2QA 1JCKA 1OF2A 4F7CB 4LCYA 1I8MA 4I4WA 4U1SB 4M7KL 3DX7B 4JM2F 3NTCH 4J2XA 3P40A 4TNVK 3FFCD 3GMRA 3EJYD 3D3VD 2OJEA 1U0QA 1H5BA 3DXAB 1E4KC 1FRGH 4G7VH 4GG8A 4QRRA 5JXAL 5GS2H 4D3CL 1JYXA 3BT2L 4JREC 2E7BA 2IAMC 5BVJB 2EDBA 4Y1AD 5K59F 2RGSA 1RZJL 1A7OH 4YO0A 2PKDA 3RI5K 4IMLB 5I2IA 2BVYA 5DJ0B 4O58L 5AYUH 1NLDH 3T0EC 4GKZA 2W65A 5F89A 3TCLB 4D0BA 3WXWL 5T1KD 1LEIB 1FJ1B 4JEGB 4JM4H 1UWXK 3OAUH 1WTLA 4P23B 4K3DH 2IC2A 3G6AB 4V1DE 4PJGA 3PGCB 2J4WL 2VDOH 4HHAA 5EA0L 2QSCL 1M7DA 4AL8L 4KZDH 4ZFGH 1K85A 3U7AA 1A9EB 1XF1A 5ID0B 1CL7H 1EHXA 3G04B 4Y16B 4BM7A 2MWCA 2DQUL 1YZZA 1ONQA 3KGRA 2XKNB 2F5BL 3FOLA 3S4SA 1Q1JL 4CVUA 4QXTB 1Q94B 1JYWA 2OP4H 2JJTC 4KK5D 1B0RA 1ZA6B 1E6JH 3MV01 5IBTH 1Z9LA 3SDAC 4XP4L 3SKMB 1KPRA 4R4FH 4ETQB 2EDJA 3O4LE 4Z7QE 4ODWB 2YK1H 4JFEA 2CLVB 4N5UA 1V05A 5JIHA 1MCEA 1YY9D 2ITDA 4JM2C 2X7LA 5GZOC 1UA6L 3UBXI 1ZVYA 4JY6B 1OARH 5TPWH 4WFHD 3VFTB 3UPCA 3LN9A 4UDUA 3MLSH 1FO0A 2ZUQB 3KYOB 5AG9A 3P73A 4OLYH 4LPUA 3CNKA 1NBZB 1RZKL 4LK4A 1GZQB 1ZWIB 4YUEL 5JOEA 1I7ZA 1WFOA 2EDLA 1ZGLB 2X2YA 4NNPH 1E4XL 4FABH 3X13A 5C0BA 5DD1H 1OTSD 1EJ6A 1I8KB 2QADB 5L2KA 2JE8A 3OG4B 4HH9A 3VFGH 2P24A 4DKAA 4NUGL 5IOPB 2A9NH 1HZHL 1YJDH 2Z31D 3KYKL 2AK4A 5DA0B 4PRNA 2H6PB 5IHUL 2NZ9D 4O02L 3AAZB 3HMWL 4JANB 3FMGL 1CLZL 3ARSA 3OKMB 4NQTA 2NY3D 4ZDHA 4ONHB 1F11B 3WJJA 4WIQA 1CQKA 4X6DE 5D7LE 1UM5H 4WY7H 4CJ0A 4M8QA 4L9LB 1RU9L 2HVJA 3NFPA 2VH5H 3L3HB 4X7TA 4NHCH 1XF2A 2IMMA 3FO9A 5DYOA 1P4IH 4MCYA 4P3DA 1BIIA 3VI4E 1MREH 3R0NA 4KTYA 2X41A 4Z78B 1FORH 1MJJB 3V0VA 4K8RC 2QQKH 3U7YH 4BFEA 3X14B 1KCVL 1BLNB 3KYNB 3ARBD 4JVPA 4AMKL 1T4KA 3SE8H 3F58H 5F9AC 5T1LA 5C9JA 4WU5A 1QRND 4KDTC 2BVQB 4OV5A 4IOFD 1XMWA 3S3PA 1CF8L 3MNVB 1OTUD 3E3QE 3HC3H 4KK5C 5TF1L 4X4XA 2JB5L 4XP5H 5C0IB 2A73A 4PJEF 1FNHA 4H8WH 2RIKA 1XR8A 3A6CH 3RWEB 4JE4B 4ODBD 1Y18B 2DOCA 1YY9C 3IJYA 4RAHA 1K4DB 5EUOF 1BVZA 2J8UA 4H20H 1JGVH 1WBZA 4J3TA 4Y5YA 1LO3L 4I77L 4U2YA 5F8RC 1KJ2B 4NZUH 1YPZA 4NOBA 4H1LA 5GRZA 2EECA 2F9BT 5IESH 1DQDL 1S7UB 3DRQB 3FT4B 1KJ3H 4NN6C 4P2RA 5GRUH 3PDGA 2ZP0T 1OTSC 5BRZD 1FP5A 5JW4Q 1F00I 2R0ZL 1CFTB 3UJTL 5D7SL 1C5CH 2Z31C 5D5ME 2VKXA 5EOQL 3TA3C 3QIBD 1YUHA 2APWA 3DSFH 3TBSA 4HBQA 4UTBH 5JPNA 1UXSA 2IBBA 1F90H 3QCUL 5E8DH 1N6UA 1KN4L 4IS6A 1KIPB 1BREA 5GS1A 2A38A 4XB8A 1XF4A 2F53D 2NY3C 1WAAF 5HYQB 3MCLH 3VU2A 4NO5B 5C6TL 4NKDB 1ND0A 4DTGH 3ZE0E 2HLFD 2A2QT 5DRWB 4F37F 3HZYA 3GSRB 3F6LA 2X09A 2Y36L 2IPTL 3GI8H 3H9SA 3QEQA 4GMSL 4P46C 4WW2F 1CCZA 1T21A 1HH9B 4DGYH 3JWDC 4IRSC 3WNKA 1JMZA 3K8MA 3U0TA 2C1OB 4JN1L 3ULVH 4ZAKC 2ZCHL 4BFBD 4DWHA 3KPRB 4HXAH 1OPGL 2IH1A 3BPNC 1VGEH 3ARBC 4MJ4A 2BDNL 3RHWK 1HXYB 1JVKA 4IOFC 1S5HA 4C56B 5C6WH 2YA1A 3WUWB 1OTUC 1FYTB 1X5FA 3WIIL 2GT9B 3NIGE 2YD5A 3UYRL 1CE6A 4GT7A 1BIHA 3IFLL 1QSED 5CILL 5FYLE 4NQCD 3KPLB 3RZWA 1C1EH 1B88A 2XFXB 4YXHH 3QI9A 4UT6L 2DYPA 2N1KA 3P0YL 1CG9A 1WFUA 4O2CB 4XPAL 4EKXA 1V3JA 5DJCB 1H8NA 2W92A 1EFXD 2PNDA 4JGMA 3CFBA 5IB5B 4YPGA 5ANME 5E0QA 2E7LC 3DX9B 2NW3A 4L8SC 4XWGH 4YHPA 5CEXA 4G6AD 3BZEB 4RMUA 3O2WL 3S37X 4JFXB 5K9OB 4LVNC 4M5ZL 3D48R 1AFVH 4LLVA 4X7CC 1OCWH 2F74B 4XCEB 5C0CD 1DQLL 5D1XB 1B0GB 4JM2B 2Q6WB 2V5SA 1CDGA 4PJIE 1KCUL 5DRNB 4DZ8A 2Z8SA 4MMZC 1H0DB 2YWZA 5F1NB 4Z7VE 2I07B 2QHRL 1MJUH 4GW4B 4KAQL 5GJSL 2HVKA 4WW2C 4X83A 3W11D 3RQ3A 1FG9C 4WUUD 1MUJA 5HGBB 2WMPA 1NSNH 3O3DA 1FL5B 5FM5M 2R29L 4J6RH 2AXGA 3HNTL 2HG5B 5EH1A 2OJZL 3O6MH 4G8GE 3WHXA 2AXJA 2HLFC 3E2HC 5GZND 4FZ8L 1VFUA 4WFGE 2ZCLL 4PJ5B 2XA8H 3ROOA 4J1UB 4LGSB 1S8DA 3KXFA 2H32B 3G08B 1ZKAA 2JIXA 2X4QB 3CXHK 6CGTA 5HGHA 3B2UD 1ZTXH 5DMJB 2EO1A 1Z5LA 1FSKC 2CLZA 1HYSC 1QFWL 3NCCB 3IXTA 4JFOA 3PQYA 4HFUL 1NC2D 43CAB 3OX8A 4HWEL 3G6JB 1LO2L 1IEHA 5IMKA 4QRPB 1Y6KR 4B41A 5IHZB 1FDLL 1PG7W 4D0CB 4YXKH 1G1YA 1JZ2A 1ZLUH 4FFWD 1LP9E 3EDEA 1TJIL 1ZEAH 5KTEL 5B38A 3D69A 5EZIL 3LQAL 1DQTA 4PJHE 4PRPD 2QHLA 3UBXB 4P5KB 3OAZH 1KFAH 4GQ9L 4EOWH 5E8OB 3KPNA 4Z8FH 2GK0A 3V8OA 4XNUH 2LVEA 2P45B 5DJAA 4X4ZA 3CUPA 2BCKB 2L7JA 4G6AC 2ARJQ 4Z7UA 1D6EA 5DQDH 2FSEB 3NZHL 4KTEH 4MB4A 4UOW0 1ZHKA 1TQCC 1XGQB 2B8OT 1EZVY 3VE0A 4ZPTB 3C9NA 3MODH 1EHNA 5CJQL 3MRRB 4G7YH 2P47B 5I17A 1ACYH 1LO4H 4GRWH 4JRYA 1G7LB 3DHJA 3R1GL 4O2EB 1QLFA 2WWMD 1MHHA 2EKSB 1F58H 3C09B 3BDBA 4JHZA 1L0YA 2JELH 3HE6D 5E1AA 5D6CA 1HHIB 3T4AB 3L95A 3BP6B 3UPAA 1RVFL 2NY6D 3I6KB 1R3LA 3U6RB 3EDKA 2BC4A 3TO4B 3PHSA 5GZNC 3G5VA 3DV4B 4I48B 3C60C 4PJBB 3TA3B 1FL6A 1R3KA 4Y4KD 5AYQA 7CGTA 2Z93A 3MBXH 2W60B 4U1LB 5HY9B 2NX5B 1S7VA 4LLUA 1G7PA 5E6ID 5GGVH 4AEFA 1DVFA 3B2UC 5BZWB 2DQFB 2IALB 4JZOB 5INCB 3ULUL 5T1DH 2VZSA 4W6XB 3QFJE 4ZTPH 4LVHB 2A6JB 2AJYH 1P4LB 3X12A 4FZEH 1IQDB 4PV9A 1KJMA 4H0HB 1NLBH 1NCDH 5GGSB 3VW3L 2E27L 2P1YA 1GGCH 2X4RA 5I1IH 5DR5L 1MIML 3VG0H 1GVIA 4XC3H 1HHKB 4NC1E 2HT3D 4MSWA 4LIQE 1VKXA 1JTOA 5AEAA 1UM4H 4GRMA 1CR9L 2FX7L 3CVHA 2NXYD 1KLUB 3I2CL 1A4JB 4P2OD 3GIVB 4TUJB 4JFDA 5C08D 1L7IH 3LIZH 4ZTOH 5CEZD 3BP4B 4HS8L 1IM9A 4Y5XA 3RWGB 5ICZB 1LEKA 3MX0A 1DDHB 3O2DH 5ID1A 3NCYS 3MA9H 4Z7WA 1UB5B 5KVFL 3HZKA 3P0VL 3MRPA 1DQQA 4I0CC 4KQ4L 2YEZB 3PXHA 5EUOB 1MJ8L 1MLBA 3GSXB 5BV7C 1OM3L 1J8HA 4Q97A 4UIKH 4OGYL 4K94C 4A6YL 1T7XA 3BO8B 5DZLA 1IEBB 2AEPL 5CJBA 3HC0B 5HVGB 3ARVA 1YEJL 2CDEB 1I1RA 3CZFA 3VRJB 5KSUB 5HBBA 3QDMD 3EW3B 2WNGA 1KNOA 4IOIA 1GL4B 3DPBA 1WBXB 1TXKA 3K7UA 1JPFA 2CQVA 2J6EA 4G6ML 4L3EE 3UO1H 3K8KA 4FQ1H 3SPVA 2VXUH 3LOWA 5DEGA 5HYSB 3CDFA 1EPFA 5J9PA 4UB0H 2X9XA 3RA7L 3V6ZB 5AG8A 5HHXH 4Y4FD 5SX5H 1U2HA 2WWMC 4L8SB 2KKQA 3GKZA 2MHAB 4ODSH 2HFGL 3T1FB 1BZ7A 3T2PA 1E4JA 4MAYA 4QHMA 5JO5A 3PWLB 2Q7YA 4CAGA 4WV1B 3LDBB 3B9KA 4KJQD 3FN0H 2B1HL 1QYGH 1GGUA 1YEHL 1ZT1B 3UTPD 4HSQA 1WFTA 2NNAA 1G9NH 4WWID 1HN1A 2C3HA 5E4EC 5JUEL 2H9GA 3FO2A 1DL7H 1PYWA 1W0WA 1GC1L 3MNZB 2C4XA 3E1F1 4XT1C 5IF0B 2Q8AL 1HSBB 1JNHB 5IV2B 5E6IC 1U95B 5E5MA 3ZDZE 3N1GC 3EZJB 1T03L 4PRHB 3BVNB 3KPSE 5DC4B 3QQ4B 4S1DD 2GKIA 2FIKB 2A1WH 3B2VH 5IW1A 4NKIH 4LBEA 1XIWA 3FRUB 4PY7B 3OXSA 2Y07L 4PJ8A 3ZYZA 4BQ6A 2GJJA 1NBYB 1U42A 2DQCL 5E2UH 4OFPA 2PTVA 3T0BA 4U6HA 1QP1A 2DKMA 3UTTA 2NXYC 5F88B 1KB5L 4P2OC 5HYIA 2NY7L 3MACH 4NP4H 1QSFD 4L8CB 1LD9B 5F7EL 4EUPG 1MVUB 1DUYB 5E99H 3ZKND 2Q76B 1RV6X 3I02B 2EIEA 3EYFB 1F4XL 1A1OB 1MAJA 3MV9D 5D70H 4WI8A 1N5AA 4GKSA 3UMTA 2VLRA 3MRKA 2EEDA 1OGAD 5TDPA 5GS0C 3LHPH 3QO0A 4KHTH 3LH2H 4LLDB 4NM8H 4UTAL 2J8UF 5GS3A 4KV5F 3QUYA 3C2SA 4QYOA 4K7PL 3ES6B 3QWOA 3BD4A 1LO0L 1RUAH 3GBMH 1YPZF 2VQ1B 5L8KB 1DLFH 1RHHB 1A6ZB 5E8PB 3ZT5A 3O41B 3P30H 4Y4FC 4HX1A 1EEZB 3VCLB 1Y0LB 2AQ2A 4PLKD 2D7TH 5LCVH 3L1OH 4HGWB 4ZUSA 1CL7I 1TQCB 3O2DA 3MXVL 1RURL 1F3DH 1KT2A 5INDB 4MJIB 4KJQC 5ALCL 4U3HA 1MHPL 3IAQA 2DIAA 2O5ZH 4LEOB 5IBUB 3SBWC 1G7QA 1IGYB 1JWSB 4LDLB 4O4YL 4PD4J 3OWEA 1V7NH 3CMGA 5EUKA 1ADQH 1FVCB 2W0FA 5EULV 1IEAB 3MA7B 5HHMB 5HHVH 5C3TA 1IC1A 3GM8A 4KJYB 1CLYL 1TVBB 3T0XA 2X9YA 3DWTA 2PO6B 2XKUA 1T7YA 4PRAA 3FONB 4GSDH 5DVLA 1H3PL 2FR4A 5EU3A 3LSOB 4F2MA 5L7XL 3FO1B 5AD0A 4HQQH 3JTTB 4OCYL 1KCSH 2UWEE 4HWUA 1YNTA 4MD5A 3PP4H 2R4RL 1Y6MR 2AV7B 2R2EB 3C5JB 2LTQB 4AK1A 1JF1B 3OKNB 1RD6A 4XP9L 3VH8G 3TO2B 5D7JD 3C6LD 3BQUD 4Y5YC 2DRUA 5IFJA 2GAZA 1L6XA 3CDYA 1M4KA 4PRIE 3ZDXF 1CDUA 2DLIA 4LARL 3FB6A 3V95A 4GS7C 5C0JB 3SE4C 1OAKL 3WSQL 2BRQA 1HINH 2G75A 5DEFA 4JQXA 1WGOA 3QDGD 3H9YA 4RGNE 5LBSH 5IB2A 1MCIA 3QQ9C 4Y2DB 1MCSA 4M5YL 2A6DA 3L3KA 4N0UE 2DWDA 3CFDB 4D8PB 4IRJD 1MWAL 1NGWB 4NCDA 3MGAA 4U6XB 1NCBH 1QRNA 1XF3B 5D2LA 1KIRB 1JGDB 1Q72H 1AH1A 3CXDL 3S5LG 1OF2B 1PZ5A 4LCYB 1I8MB 3KG5A 4I4WB 4ZSOE 4PLKC 4J3VA 5J12C 1UACL 3RWDA 3P4OA 2DQHH 3QNZA 3GMRB 1BWMA 2OJEB 1BD2E 4UT7H 3OF6A 1NCCL 1H5BB 2R56H 1N3NA 4FG6C 4GOSA 4DKDC 2OR8A 2XNAA 4GG8B 5IVNA 4QRRB 3U48A 2IFFH 4QRSA 3F65A 3EO9L 1MEXL 5HGAA 1W0YT 1AXSA 1QFHA 1CDBA 5ITBH 5JW3L 1AXTL 4TOYH 4LHQB 2VLJD 5TDOA 4D9LL 2J12B 3OGOE 3WUZA 3SJVA 4YO0B 3MROA 1NFDE 2DLFH 5I2IB 1JHLL 3P4MB 4GKZB 1I1YA 1EGJL 2W65B 3NVQA 1N4XL 1S7SA 4D0BB 1QHOA 2VDNL 1GSMA 4PTTB 1AC6A 5ILTH 1F8TH 1DBAH 1P7KA 2EDOA 2PETA 4X6EB 5FYJU 3SGJA 4ZG1A 1IQWH 1EO8L 1X6NA 3CPLA 5E5RB 3LQMA 1JPSL 3QIBA 4PJGB 1OAUL 4XBEH 4HHAB 3QUXD 4PJ9D 4F15B 1ZAGA 2YMXH 1M7DB 4G43A 3V4VH 2HJLA 3MXWH 3LN4A 4ZS6D 1ONQB 1I3RA 5D7JC 3C6LC 5DUPH 3FOLB 3S4SB 5FK9A 2ICWA 3BH8A 2GTZA 4XPGH 2MKLC 1B0RB 4PP2A 2OBGA 3BDYL 5JXEC 1JYNA 2X4UA 4CNIA 3MLWL 1MFEH 1IGJA 2X89A 1N5YL 1KPRB 4I18A 1NANH 1A14H 1OD9A 3JWOC 4Z18A 5I75B 3B8YA 5T33L 3CH8A 4JFEB 5FYJL 5DMKA 4P59H 5EOCH 4Y8DC 2I25N 1OSZA 2ITDB 4IEFB 2X7LB 2EIBA 1N26A 3OV6A 3VI3F 3VGEA 4UDUB 1RY7B 4OGAD 1FO0B 1PG7L 1YECH 2FH6A 4X9FA 5IQ7H 1JPTH 3P73B 1OQXA 3FQWA 3OHXA 4JO2L 5FDYA 3O6LL 4Z7UF 1OAZH 5KANI 3ULVF 1CLOL 2F54A 2P48B 4JHAH 4M43H 4YDLB 4N0RA 3X13B 3FAWA 5EU6E 4QOKD 5EU5B 2DQDH 5L2KB 3DGGB 4HH9B 2B4CC 2P24B 1QSEA 5GQBA 2ESVE 2VDMH 1QEWA 2AK4B 2AKRA 3BSZH 4PRNB 1U8PB 5DD5L 5JIPA 2DIBA 3B83A 4H25A 2CSPA 4OZHA 1EFXA 4N0CD 1A9BA 4OIAA 1J1XH 2FD6H 4ZDHB 3RNKA 5FEBA 2P8LB 3DVNA 1EERB 5ACMA 1EEUA 1K3IA 4M8QB 1NAKH 3I75A 2XXMB 4PGBA 1J88A 1MRDL 2HVJB 4R26L 3BUYA 4MA7L 1U3ZA 4TPRH 1YEIL 4X7TB 4AENA 1XF2B 3FO9B 5DYOB 4MCYB 4P3DB 4F8TA 1BIIB 1VERA 5SWSE 2YKLL 3MOBH 4ONGH 5HHQA 5IB4A 3QAZB 3U0WL 3V0VB 3OL2A 4F8QA 3MCG1 3FB5A 3HPLA 3QUXC 4LU5H 4UT9H 3KYAA 1T4KB 4RA3A 5T1LB 3VXSA 1HWGB 4E42B 1ZT4A 1DANU 3PGFH 1RIHL 4WU5B 3X3GH 2ZJSH 4HH8A 4OV5B 5D96C 3NH7H 3RGVD 5D2NC 1IAIL 4FHBD 1WEJH 2CRZA 5KAQG 4HLZG 1YC8A 3HMXL 5CKGA 5HVHC 3VMNA 1CDYA 3LPFA 1GAFH 3EO1A 2DQIH 1NEUA 2A73B 3LZFH 4OQTL 1CFBA 4V1DA 2YPVH 3RFZC 1KC5L 4LHUD 4LRIC 1XR8B 3EOTH 3BPLC 4YBQD 3GHEL 5DJ2A 1AI1L 3IJYB 4BQCA 4ZXBD 5AUMB 2J8UB 4NQDD 5HHOD 1G84A 4PV8A 5C09D 4OGAC 1WBZB 3UJIL 2D31A 3MUJA 1EDQA 4K9EC 4FOMA 4Y5YB 1NQBA 1JNLH 4QXGH 4U7SA 2IG2L 4GAJL 1B4JL 2A74A 5CJXA 1YPZB 4H1LB 1JNJA 3MLYH 2V17L 3L3IA 1FH5L 5CCKH 1A7NL 1GRWA 3IFNL 5IR1A 3TYFA 3O4LA 4P2RB 5DO2D 2Z35A 1NCUA 4NN7C 4LSSL 1A1MA 3EFDL 1VPOH 2HH0H 5B4MC 1CGWA 1KPVA 4G9DA 4NNYA 1YUHB 1A6VL 1CDCA 4BA8A 5JPNB 1UXSB 3INUL 2YD8A 1REIA 5GSVA 3QHZL 4AIZA 5GS1B 4N0CC 1XF4B 5EOTA 4POZD 1T0PB 3EYVA 4Z6AT 3D0LB 5KSBA 4GW1A 4KJPD 3QXDA 1ND0B 4MJ5A 4PB9H 5FGCB 1S7RB 3TIDA 3HZYB 1QFWM 3BISA 3TLRA 3VD3A 3P4LA 1GCFA 3H9SB 3QEQB 1QBAA 1T21B 4S10A 4JB9H 4YDKL 4KKLD 1N59A 2VERN 3HE7D 1BQLH 2ORBL 3O8XD 4YJZL 1FPTL 2IH1B 2ZKHH 1FV1A 4X6DA 5D7LA 2ZPKL 4AYFA 5BJTA 1S5HB 3RGVC 4Y19E 4LOUD 4F3FB 2E6QA 1AKJD 5TE6L 4OGZA 1CE6B 2D4FA 5KSAA 4X80L 1RZKC 4M7LT 1CIDA 2OL3L 4Z5RA 2YPLA 5C0AD 5I76A 3LEYL 1MRCH 3QI9B 2DYPB 4YBQC 1CG9B 4TTDD 5I8CA 2VLKE 2ZUXA 3ET9F 3GKWH 4Z95L 4ZXBC 2QLVB 4G6KL 4M6OL 3JUYA 4MA1C 2QQNL 4M48H 5J1AA 2OZ4L 3CFBB 4YPGB 1JP5A 1MFCL 4YBLC 2B20A 4XCYA 1DQMH 3RJDA 2NW3B 4YHPB 5HJ3B 4C4KT 3V4UH 2K7QA 2ED7A 1MCHA 4Y2OA 2DKUA 1N0LA 4OB5H 2FZ3A 4LSTH 1FNLA 4LLVB 5F96H 3KHOA 2YRZA 4U33A 1MFAH 4P2QD 3B9KC 4Q6IC 4CMMA 4KRPB 4M6ML 4OCWH 5LQBL 4DZ8B 3THMH 3UTOA 2QSTA 3BN9D 2FATL 2FGZA 3KLAA 3OZ9H 3CK0H 3QRGH 1B9ZA 4NO0D 4UV7H 4YHKH 2HVKB 3RY5A 1S9YA 1J0YA 4QNPF 2VL5A 4BFGA 1MUJB 1A4KA 4LSUL 3O3DB 5I0DA 1DSFH 3IB4A 5E6YA 4JO1L 4KJPC 5C7XH 4CMHC 5DHYA 3WHXB 7FABL 1HQRA 3FO0L 1XIWC 3KDMA 4RISL 5D5MA 4LRNH 5CKAA 3WLWC 3U9PL 2VC2L 1WTGT 4JPKH 35C8L 3M17A 3PIQA 1BM3L 2UVEA 5D72L 3KXFB 5SWZD 4CVWA 4PGJA 2WBKA 2WUCL 3U4AA 3HE7C 2V5RA 3QJHA 4RGOL 1Z5LB 2CLZB 1K5NA 1AQKH 4HWBH 4YZFF 4QHUA 4JFOB 3PQYB 3OX8B 3VXRD 5D1QD 4JZJC 2B1AH 1N64L 4BQ9A 4X8JA 3QWRA 3W9DA 5IMKB 4WGWB 5ADPH 4LOUC 3SGKA 2XZZA 3MUZ1 3MBED 1YEKL 4FMKA 1UGNA 3Q5TA 5GJTL 5A40E 5J1TC 2BNQB 3U9UB 3VGAB 5B38B 3D69B 5TGBA 5JHDD 4FTVD 5FCUH 3B9EA 1OSPL 1RSFA 1D5XB 1O7SA 2JJUA 3NIDF 3FN9A 4LNRA 4TTDC 1FYTE 3L9RA 5HDQH 4I9WD 1JFQL 4KHXL 3TT1H 2GK0B 3Q1SH 4XPFH 2W9LA 4IDJL 1QPPA 3WFEH 4NNXA 4RX4D 3CUPB 4IDLA 3NA9L 3RWIA 2JB6A 5B39A 4X4YA 1VHPA 4Z0BH 3Q3GA 4Z7UB 1D6EB 2G9HA 1G6VK 4HF5H 4BK4A 2A77L 2B5IB 4XBPA 1ZHKB 5F9WB 5HGGS 3V6OC 3LKPA 4JG1L 3VE0B 3PGDA 3C9NB 2IGFL 1W0VA 3N1FC 1QSFA 4G5ZH 2B4CH 5D2LF 4OZFH 4X4MA 4Y0GA 5A1AA 5I17B 4YFEA 4JRYB 2DM3A 3ZE1F 5TE7H 1UZ6F 1WCBA 1MHHB 1MAML 1ZVSA 1S7XA 3P9LA 1IJ9A 1YN7A 2FHCA 2VUYA 4L3CA 3NPZB 4L5FL 5D6CB 5E1AB 3ZT6A 2IBGA 2DD8H 3L95B 4BZ1H 1C5BH 4CRPA 4YDVA 5KVMC 1RIVH 3ARPA 1IC4H 1R3LB 1H3XA 3TZVD 4NZJA 1E6OL 2DBJA 4LL9A 1DBJH 1P9MA 3TBVA 3S8WA 3G5VB 4PJIA 4ZYKA 2VDLH 1FL6B 1R3KB 4Z76A 5T3ZL 3BEVA 2Z93B 2Y7QA 4Z7VA 1S7VB 4LLUB 1CVRA 1G7PB 1S3KH 2BHZA 1PY9A 5DD0L 4X5WA 1DVFB 4GO6B 2N4IA 3GSOA 1C7TA 4UINL 2R4SH 1RFDL 4BSVA 3BRFA 2DLTA 2NLJA 2X10A 3NAAH 2X4SA 4G8GA 3X12B 1QOKA 5D1QC 4PJ5E 1A7PH 4PV9B 1KJMB 4XVSL 1JIBA 2VZVA 4U4BA 2X4RB 5AZ2L 1TFHA 1GH7A 1KN2H 1DUZA 3HPJB 3O11A 3WNOA 3MBEC 3VWJA 1CU4H 5DQ9A 1VKXB 4S11A 4GRMB 3CVHB 3LMJH 3GUTB 3LD8B 4JFDB 1F45A 4X6BA 5HYJD 3G6JE 3HTLX 2I9TA 1IM9B 4Y5XB 3VXTA 4JFFD 2Y5TA 4NJAH 5ID1B 1X5AA 2OTPA 3FAXA 4NC0B 3IFPA 4Z7WB 4HIXL 3TH4T 3HZKB 3MRPB 1DQQB 1SJXA 1MCLA 4U2ZA 4M7KH 1MLBB 2ICWI 4KUZH 1UT9A 1CXIA 4FQXA 2XT1B 4JLRA 2XWJA 1JHKL 1J8HB 4ZNCD 4NN5B 4DK3A 3VXMA 3DX8A 3MR9A 2O5YL 1LP9A 4CU7A 5D93C 3W5NA 4OIIL 2XTJB 4F37K 1AD0A 2VOTA 5EBWA 2H2SC 4D9RD 4HWBA 1LILA 4ELMB 5JXAH 5SV3A 3CZFB 1FFNA 3DARA 4PJHA 5L88L 1KNOB 3BT2H 5J06A 4GRLA 3D87B 4IOIB 5I8OL 4MMXC 3E8UH 2FRGP 1JPFB 1T0NA 1X5LA 1VFAA 5EZOL 1CGUA 3ZZ1A 1RZJH 3MOAL 1F13A 1KJVB 5J9PB 1XGTA 1Q9LA 2D4DA 3WCYA 3QEUA 2CIIA 4O58H 2P5WA 4P9HH 2N56A 2Q3AA 2JJSC 3LKQA 3WXWH 2DM7A 4N90D 4QT5A 3CX5J 4MAYB 3GSQA 4QHMB 4TQEH 1OAYL 5JO5B 3ELAT 4U3XA 4U7MA 2Q7YB 4WJ5A 3JVGA 2ENSA 4YK4B 5CLTA 2D7OA 3TZVC 2XZAL 5FGRA 3B9KB 4KK6D 4OZHF 5HVWA 2J4WH 3JXAA 5F72S 2NNAB 2B2XL 5EA0H 2BK8A 2QSCH 1R3HA 4DCQA 3WMSA 4AL8H 1DTUA 2H9GB 3FO2B 1RZIA 1PYWB 1W0WB 1YA5A 2GSIA 4APQD 1HHHA 1L9NA 4KUCD 5T5NF 2DQUH 4D2NA 5CWSA 1R3JA 2F5BH 3N0PB 1X5ZA 5E5MB 2X1OA 3X11A 1Q1JH 4XAKD 2YUZA 2IANE 1J11A 4J3UA 1KG0A 2YRPA 4KXZH 4PJBE 3SE9L 2VLLA 3LQAC 5IW1B 4XP4H 2XY1A 5DD6A 2WBJC 4LBEB 2NX5E 1XIWB 3OXSB 5DJXB 4MZ2A 4DVBA 4PJ8B 4GRWB 5BVPL 2H45A 4OZGE 2RB8A 3QZWA 4U6HB 1JZ6A 1UA6H 1U6AL 3UTTB 1QRKA 2FJHA 2DJUA 3MV8D 4BUGA 4R7DA 4K23L 1OW0A 4Y1AB 1FFRA 1RZKH 4JJ5A 5DJZB 4YUEH 3RZCA 2VLJA 3QFJA 3PHOA 1BFSA 5DVNA 3HA0A 3FOMA 2A83A 1E4XH 1IAKA 3LCYA 4Y4HD 5C2BL 4I3RL 1I4FA 4PPTA 3QG6A 4YHLL 3MFFA 4CVXA 1CI5A 1N5AB 3N9GL 4GKSB 1HQ4A 4NUGH 3RUGA 3BE1L 2VLRB 2C26A 3MRKB 1HZHH 1QLRA 2EYRB 3KYKH 5TDPB 3T65A 4AQOA 4F7PA 1OOAA 3QO0B 2OI9B 5F7FA 4KPHH 5IHUH 3QUYB 4O02H 3HMWH 3QNYA 3FMGH 1QA9A 4PJ9A 3QWOB 4B50A 2FYYA 3CCHA 4I0KA 3CAFA 4YHIA 4YHML 5IBLD 3NOIA 3F6IA 1RJCA 4K71C 1NKRA 3TWCH 4Z7QF 1RU9H 3ZTJG 4HX1B 1IKFL 3O0RL 4XVJL 5FV2A 4F33A 4WI4A 3E6FA 2QR0A 3DHMA 3UTSD 2A6KA 3ZKSD 4AEIL 4M1CC 4ZUSB 5D1ZA 4ORGA 4JAMA 3HG1E 5JMRA 1U3JA 5TDNA 3WUWG 3DBXB 4KK6C 3QSKB 4G3YL 5HYEA 4L3EA 4HUXB 3H2WA 3QCVL 4WTZA 2WWKO 1KCVH 5FYKU 2BHYA 1FAKT 5JIKA 4AMKH 4X9HA 1G7QB 4M6NL 4OF8A 3IDJA 2W0FB 1NANI 3F62A 1CF8H 5B22A 4I2XA 1JZ3A 5TF1H 3VXPB 4UAOB 4PRAB 2ADIA 1WK0A 1X5YA 2OMNA 3IDNA 3BMWA 4ZUVA 1CICA 3V79C 2XIDA 4F2MB 5MP6L 1P5UA 2OQJA 3W0WE 4YHOL 5AD0B 4F80A 4PRHE 2BRRL 4X6DF 1YNTB 4MD5B 2F19L 4UU9A 4X99A 4HXBL 4YC2C 4JZNA 5FYKL 4JFYA 1U36A 2AP2A 4I77H 1TENA 3KPSA 4RIRA 4WO4A 4ALAL 2RQ8A 3OKLA 2OMBA 1DQDH 3VI4F 5IFJB 2GAZB 4Y4HC 2XYCA 2NY4D 3FB6B 1K8DA 1J18A 2R0ZH 4TVPL 3BHBA 3UJTH 5D7SH 5JHLL 2G75B 5DEFB 1TQBB 3ZE2E 5EOQH 1ZLWH 3WL9A 1SBBA 5IB2B 5C8JA 3TGXA 2YPKA 3WHE1 3QCUH 2K7PA 2A6DB 3WEXA 3L3KB 1P53A 1KN4H 1WWWX 2DWDB 1CD8A 2ERJB 4MWFA 4J4PA 2E9IA 5IBLC 3RBSA 2V2TA 4O2FB 1QRNB 4MVBD 4JFHE 3FB7A 5D2LB 1JGLL 4LQFL 5C6TH 1TZIA 4C54A 3MRBA 1PZ5B 2DKSA 4ZD3L 3S9DB 1FE8L 3P9WB 1WWCA 4F9LC 1GC1C 5GRXG 3RWDB 2Y36H 4PRBA 3P4OB 3QNZB 2IPTH 3RIAF 5GISL <