3MCWA

Crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
195
structure length
195
Chain Sequence
APLRFSSDKPLLLLIDMQQAVDDPSWGPRNHPQAEQACAGLLQAWRARGLPLIHIRHDSVEPNSTYRPGQPGHAFKPEVEPRPGETVIAKQTNSAFIGTGLEALLRANGWLELVVAGVSTSNSVEATVRMAGNLGFAVCLAEDGCFTFDKTDWHGRRRSADEVHAMSLANLDGEYCRVCGSADILAALGNIAGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Crystal structure of an a putative hydrolase of the isochorismatase family (CV_1320) from Chromobacterium violaceum ATCC 12472 at 1.06 A resolution
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 67
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3mcwA00
3OQPA 3O94A 2WTAA 4WGFA 3S2SA 3HU5A 2FQ1A 3O90A 3OT4A 3UAOA 4WH0A 3O93A 3IRVA 4H17A 3V8EA 2H0RA 3TB4A 3O91A 1YACA 3O92A 1NBAA 3LQYA 1YZVA 3EEFA 1X9GA 2B34A 1XN4A 1J2RA 2A67A 3MCWA 2WT9A 3KL2A 3R77A 3PL1A 1ILWA 1NF9A 1NF8A 4L07A 3HB7A 3R2JA 4L08A 1IM5A 3TXYA 3TG2A
chains in the Genus database with same CATH superfamily
2VQDA 1W5TA 2FSPA 3IKVA 3LY7A 3DE6X 3AILA 2NVWA 3O2NA 4HXGA 4PRZA 5F3RA 3K05A 1B6RA 5H82A 5BQPA 3TK1A 4PYNA 1D4ZA 2CSXA 4KLNA 2ATCA 2P9YA 4WT7A 1NJ5A 4CLRA 1T0HB 3LC7O 4BCDA 2OBXA 1PVOA 3N2GB 5DYGA 1Q0ZA 4J29A 5JASA 1YZVA 1RQRA 5BWNA 1UBEA 1WY5A 4BP3A 4UCFA 2VQ6A 4YI3A 4A5OA 2N1BA 1JWBB 1QP8A 4KFUA 1EH5A 1FCJA 4PAQA 1FXWA 5ALNA 1QR6A 1ZLYA 1AO3A 2RGCA 1MV8A 1Y98A 4B82A 4YACA 2W8ZA 5HOEA 4QICA 1Q7GA 2IV7A 4CQLB 4LBYA 2XOKD 2G76A 2R68A 3RT9A 1H23A 1AKEA 3D7RA 4BGUA 1Y8ZA 3BK2A 4FR2A 1AZLA 1NNEA 4H17A 3CW8X 3QZUA 2HPZA 2VJCA 3KL4A 3WO0A 1C0IA 1HQYE 2ZTHA 2RBGA 4ILEA 5EKTA 3QVVA 1LPOA 2EGUA 2HMAA 1ZNZA 2JVKA 2R6ZA 2YXPX 3C8ZA 4FSDA 4IDEA 4KP7A 4R1LA 2VUTA 2QEQA 3HCRA 1GA6A 4JLOA 4N8DA 1ENZA 1G6KA 3MTIA 1FLNA 3G59A 4PCAA 5E1MA 3BC1A 2CF6A 3MQ4A 2E6UX 4MIOA 2KLHA 4QHYA 4B9EA 4X5OA 2WAMA 4JBHA 4V38A 3ZJYA 1NOJA 2Z1DA 5HJ2A 1ZGZA 1R3UA 2Y0CA 3BFVA 3DNMA 5F5XA 2J4CA 1BIFA 5CNKA 1L4BA 5J5CA 3UUGA 1GRQA 2IQIA 4WBNB 1DJQA 2VRNA 5LFAA 5EIEA 4YTEA 5A2QA 2Y99A 2VYQA 2QOEA 2QMZA 1SXJC 1QX4A 2IXFA 2ZLBA 2B21A 2ZR0A 3O1IC 4RNDB 4LJYA 4C0LA 1T2FA 4BEJA 3U4IA 5A9RA 1O77A 1LVHA 1GDDA 1N75A 3EY4A 4PX2A 2BM9A 5BWCA 2FEPA 1GJRA 2PSFA 2YXDA 3IAM6 2AF4C 4UU1A 2FCRA 1W1IA 4GDFA 3LLMA 5U1PA 4EX7A 4M1ZA 2NVUA 1V5EA 2Q3LA 4F04A 5IAAA 3WGGA 3T15A 3OUZA 2JVIA 4ITRC 1D2AA 1OYWA 1W8IA 4OHOA 4TMVA 1P0CA 1A71A 3OT1A 3P9PA 1WU8A 4IAOA 2VJLA 4OK5A 2XMCA 3QUAA 1BJTA 1ZRSA 2GHQA 1XGKA 3RYFB 4O2RA 1VE9A 5HCUA 4OBBA 2I22A 3A36A 2BDUA 5EXSA 2QVXX 5D5PA 3CB2A 1KH1A 1CRQA 1QPGA 2PV0A 2EU8A 3COWA 1EM6A 3L43A 1JG2A 3VJKA 3ESDA 1O96B 2HMWA 4PO3X 1SKAA 5KJEA 2I4MA 2OMEA 1C1YA 3ILVA 3HBAA 4MXDA 3EFOB 3UF0A 4EARA 1RCTE 2YHBA 3OOHA 5AW8A 2OY0A 2PUHA 4GSLA 5CA1F 2XYVA 1IOVA 2VJOA 3V55A 2CXXA 1CQJA 3VPCA 2YJ3A 3DXYA 3HR7A 1GIAA 3VR6A 1I7QB 4K5QA 2J9ZB 3ZS9A 4LWPA 2CT8A 4C6HA 5TIIA 1W49A 2J87A 4HOYA 2J33A 4HQNA 1T5BA 1GGFA 1HDXA 1MNAA 3P26A 4X66B 1BXGA 2GEFA 2B25A 4IMPA 1FPMA 4MB2A 3ZCXA 3WHKA 5IK2A 3K5HA 5FLYA 3LQ4A 1AKWA 2ORWA 1UMDB 4X3CA 3WDMA 1KR5A 4XDHA 1I10A 2FSUA 3C3BA 2GF2A 4ZU3A 3AHJA 3UXYA 2BH2A 2YFQA 2PIAA 5GADl 3W8EA 1SG9A 2BFCA 1NASA 1TF5A 4ZOAA 1D7AA 2B30A 4MRSA 1EMDA 3WSVA 3NETA 5A4MS 2WVHA 4FZ3A 4BGDA 1P1JA 1SUWA 3DONA 1NATA 2O20A 2RC5A 2Q3EA 1E2FA 3QNMA 1K6JA 4FGZA 2ZUVA 2IHTA 3ET4A 4YNBA 5CYOA 3A9RA 4EYOA 3UV6A 4X63A 1NW6A 4BX0A 3CX3A 4CUKA 2BE9A 2DQKA 1QTRA 1LLDA 4C1BA 3OIWA 3GZTB 3I53A 1ZD8A 1PHPA 3LNCA 2V7QA 4JQSA 2P77A 4DLNA 4PLGA 5MFPA 3UC5A 5BP7A 1X7YB 3H4VA 1I80A 4JELA 4QYXA 1JJAA 2C97A 5EP1A 2FWMX 3IPYA 3O8NA 1QO9A 1ZMOA 4KZKA 3TEMA 2IPOA 2IV2X 5K6RA 3ZEAA 3D7LA 2BY4A 3PWZA 3O03A 3IAXA 2Q3MA 4LOAA 1AGRA 2NUAB 3PK0A 3PDJA 3SHOA 1BVYF 3QI7A 3SIRA 3F6SA 3W7AA 4B6PA 2QRVB 6REQB 5LQAA 2ZWIA 1ABFA 3DWEX 5B37A 4X84A 3HYSA 2QUIA 3OZWA 4TKUA 2CVOA 2YY7A 1DOHA 2VJDA 3CB4A 3V8QA 4EJ6A 5C2JB 4NHEA 5EJ6A 4X7MA 1W5SA 2VPIA 4E09A 5DASA 2IE8A 3ZNPA 2CBXA 5AW1A 1BOFA 1U1FA 2OFWA 2IYYA 3NKVA 2JEZA 3AR4A 3R5KA 4B5KA 2IVFA 5K2OA 2UXBB 3EPKA 4EAAA 3DLHA 5KNBH 4FHDA 2Q62A 1BDJA 1FQJA 2XY4A 4HVTA 5TMPA 5DWVA 2Y1DA 4OHWA 3PTAA 2PEZA 2VP0A 3KEFA 4CCYA 2HRBA 5ECYA 2QM8A 1RKQA 3GBVA 2EKQA 2C9BA 3M1YA 4RJLA 5L6LB 3AESB 3EIOA 2VA9A 4B45A 5TNXA 1WXGA 4MAFA 1FNNA 3L01A 5JR3A 1P9LA 4D81A 3ZGZA 3F8TA 4G9GA 4AM8A 2IH5A 2Q5FA 3T0IA 1L5HA 1OZGA 4O6VA 4BVBA 2YDYA 2Q6VA 5LPNA 2I71A 1KIMA 2QIOA 3DB2A 4EYKA 4NECA 4B3XA 3FOZA 1NVUQ 2RHDA 1YDHA 3UWOA 4EG3A 4DNOA 4A1FA 3OHMA 4UM9B 2O6LA 3RT7A 2Q0XA 4OSEA 1VMDA 2A33A 2YOGA 4K05A 3ELYA 2R751 5CFQA 4IO1A 2ERXA 2G04A 3B53X 1VYHA 4LW8A 5HS6A 1SGWA 4PG5A 2VATA 1UT6A 3BA1A 2GEVA 2WKWA 1P81A 2FX5A 3EPJA 1C8VB 5CJJA 3FTNA 4FT4A 5G53C 5FPSA 4BMYA 1C30B 4BJ6A 4P8RA 5IZCC 2PY6A 3E84A 2JA2A 3D9QX 1L7PA 1E77A 4D9BA 3ITKA 1Z35A 4MDEA 2P62A 2Z5VA 4Q15A 1VB5A 2VUHB 3STWA 2D00A 4EUFA 1J0AA 1XZCA 3FNFA 4NEHB 3PPIA 5JE8A 4DGQA 4FSHA 3G0DA 3A4MA 3SVZA 3I64A 4FJ0A 4V1CB 3SXPA 5MN6A 2RB5A 1AF7A 3ZN2A 3SZUA 2D06A 4JB0A 5C9ZA 4DNPA 2AD1A 3RVKA 4FLFA 4MUFA 1U7UA 4F0JA 1AGXA 1KOFA 2BOVA 3PC3A 1OASA 4FMCB 4EL0A 1W76A 3HGTA 2J31A 1SZDA 4TM7A 1F5SA 2VO1A 2AMJA 4YBZA 1WPXA 4H4CA 3VVCA 1WBBA 1ACMA 3JWJA 2Q4EA 4L72A 2AUMA 4IG9A 4E5KA 3P9RA 121PA 1QYWA 2IF2A 1RZ3A 3FHOA 1Q7RA 3GRKA 1LF5A 3RU3A 2QJFA 4AQDA 1P3JA 3I9MA 2EJCA 1G8JA 2HU2A 4H7KA 1S2NA 5FTWA 3RO7A 4AJLA 1EESA 4Y7DA 1PL6A 4FFLA 1ZMTA 1QB8A 4CF3A 5HF5A 2R6CA 4QUHA 2GM3A 2IVZA 1R18A 2OLEA 1H0SA 3DKPA 3FFWA 4AKGA 4QGHA 5KTKA 4JC0A 1I6LA 3A1FA 4MKRA 4NJMA 3U3MA 4HYQA 1BS1A 2P6PA 2VAMA 3Q10A 3NIBA 1V2HE 2RHRA 3W8RA 5AKXA 4AKTA 4F71A 2HJRA 3DYVA 5B7NA 1KQFA 1I3KA 4Y2TA 1W85B 2O2YA 2RHHA 4A0RA 4WXRA 4JXXA 2ZBPA 1VMKA 4MIYA 3DL7A 3H8VA 1AUXA 1SU7A 1JQ3A 2ACWA 3BFJA 4JODA 3RIMA 1NXPA 4KE8A 3TS1A 3LCCA 1U0JA 2IYOA 2PEYA 3ELUA 2E21A 4QDUA 4KKVA 1QWOA 2YFYA 1F20A 2CXTA 2ZBDA 4RTNA 5KYXA 5LNK6 3HP7A 5CW2A 4R9NA 2XCQA 4DSUA 4WCVA 3USCS 5JNLA 1QC5A 3QWAA 4GPIB 2GAOA 4ER7A 1XVIA 2CLCX 2AJDA 4CUZA 2J3HA 3DAYA 4JKYA 2QAGB 5LYJB 4PR3A 3SJ7A 1QU2A 5K0TA 2C8KA 2O07A 5U4XA 5DHRA 4EK9A 3DTTA 1L6IA 1MAHA 1QDLB 2A3NA 3I9LA 1EFKA 2AUTA 4OKIA 2W2VA 4D2IA 2WTNA 1WXHA 2GQ0A 3LKVA 5DNAA 4KIWA 3TLGB 3VHLB 1RC8A 1RMYA 1HLPA 1TGYA 4ZRMA 1KE1A 1B0ZA 1E5TA 2E2WA 3ZDQA 1X7DA 1SVWA 3GZ4A 4YO8A 4BKMA 1WHTB 1T9CA 2VDUE 2NM0A 2O1XA 3FRIA 1Z2EA 3K0AA 3KBOA 2FGKA 3I5XA 1Z4PX 2BUCA 2OKGA 2WU4A 2YN2A 4IKEA 3LXMA 2OBNA 3EAQA 2CNOA 2IXGA 3FPBA 1HH4A 1Y4SA 3LHKA 4RVNA 2ZAIA 1O9BA 4EKDA 4EUNA 3QXSA 5AJYA 1D2HA 2OCAA 2RGNC 2D0IA 4IPTA 3TX2A 5D7BA 4CL3A 2OLJA 2W6ZA 3MTEA 1GAXA 4P38A 5JWOA 1LPAB 4BXOB 1E1LA 3AM3A 3AQIA 5G02A 2ZT7A 2ORIA 2JGIA 2BMAA 1E9DA 3IPAA 2AOUB 5AM0A 3U44B 1NBMA 1Q21A 5AVOA 1XK7A 3D3WB 4PM4A 2GYWA 4UUNA 2WFAA 2XSZD 3IT1A 2GD2A 4KR2A 1ECJA 1XNHA 3R20A 3N74A 4CKWA 1G0NA 3BWCA 3KL2A 1FSZA 1PT9A 2MOKA 2BE7A 2HNKA 2P8JA 5IM4A 1RXWA 2BEKA 2PVSA 1Z5NA 4TMZA 3UC9A 2FMIA 1ML3A 2C3YA 1NRJB 3GCWA 3IUJA 1TYCA 1FL9A 3PPWA 5J2TB 4KGDA 5KOJB 3GLFB 4FWIB 3W5IA 2Z56A 3SDBA 3FI9A 4GR9A 3ZE8A 1DJLA 2D8AA 4J43A 3LRPA 3JZMA 1NLZA 4MHOA 5HGXA 3M9LA 2BCGY 5AR1A 5HK9A 1YRAA 2WD9A 1O94C 3H9UA 3QBDA 1CF4A 3URKA 2QORA 4QFDA 3ZWQA 2OZLA 4OP1A 2C9ZA 4F4JA 3HBMA 5I7RA 4CG0A 2UZ1A 3SE0A 2YWJA 4RBNA 4PBSA 5EEHA 5KJCA 3N0WA 1PR4A 4M49A 5BO5A 4DV1B 3ZWPA 2QM0A 3EOBI 1UAYA 2VXCA 5FUWA 1VSQA 1QMPA 2GTIA 2VUUA 3TQHA 3M4JA 4G24A 4Z49A 1WPRA 5JNUA 3M6MD 3HCCA 5IDYA 1HQCA 3LCVB 1B1CA 1OWLA 4X60A 2I6SA 4MEBA 3ESBA 1PSWA 1QO7A 2HDWA 4S1NA 5ALVA 4EY4A 1O03A 1AC5A 2JJ2A 1WTAA 3JQAD 3PUWA 4MVYA 4YCAA 3RU2A 3VGJA 4F5WA 5KJFA 3I9JA 2D1FA 3ZWYA 1UL1X 1Z5UA 4FEEA 4LSZA 5H70A 3QVGB 3JRNA 2FWPA 3H6HA 1RMTA 3EVDA 1AQIA 1DLJA 1Q2XA 1V71A 2XE8A 1HNZB 1ZWLA 5A62A 2GILA 3G0GA 4LYFA 4OREX 2YBDA 3GXOA 1Q7BA 2P65A 4MUMA 1N8TA 3HKBA 2YTZA 2V7UA 4B0OA 1NLFA 1MFPA 3GAMA 3LQQA 2OCDA 3OJCA 2XGOA 2A9PA 4L85A 4PC3A 1W5BA 2JH9A 1X1CA 4IRUB 5T5QA 2FR0A 1V7ZA 2J6CA 2V4UA 4Y2RA 4O4LA 3S68A 5EHIA 3DHNA 1FS5A 3N53A 4LRXA 2F1IA 4MX8A 4ZVRA 2Y27A 5KTTA 4BO5A 1REQA 1SHKA 3L8CA 2BN4A 1EFPB 4OHFA 5JCXA 1ORWA 3A04A 5BNIA 3MTJA 4ZQGA 2CNWD 4XEUA 5F76A 1B6GA 3JZFA 2G4LA 1M6WA 1OX4A 1VSBA 4V0QA 2ZRIA 2F17A 4BATA 3RSFA 2ZSHA 4FYMA 3F3MA 2X76A 2CJPA 2P1ZA 5AJUA 3KV1A 3NHYA 3HO6A 1ZGHA 2GHIA 3SQMA 1CEQA 1NI4B 4F3YA 2C2ZA 3ELWA 2O2HA 1TMOA 5DB4A 5ESWA 1NWCA 3CH6A 1J56A 3OWHA 2P2LA 5EXXA 3STHA 1F2VA 1U4OA 2JBAA 5AHRA 1Q3HA 4QLOA 1JEJA 4N5IX 3ZZ1A 4BMNA 3UYLA 1U3TA 3D3JA 5M04A 5ITZA 2Q5LA 4DREA 3TEJA 3OM1A 4MITA 4PLTA 3V1UA 2VKQA 1EVIA 3H6GA 2J3LA 1WKBA 2P40A 3Q7PA 4LRWA 4O25A 3T1YB 3KPJA 4Q7LA 3W3AD 3T9FA 1TTTA 4YAKA 3S55A 1S2GA 1CETA 2LIPA 2XWJI 2GX6A 3D8UA 5DM0A 3F3YA 1Q0RA 2HO5A 3J80A 2NO9A 5F9FA 1VCOA 1E3EA 3L5KA 1JXOA 1QF7A 1KAHA 1KY2A 4QNNA 5B2FA 3O0DA 3PXBA 3EB9A 1ULAA 4IJ5A 3QE2A 4MGEA 3PNMA 1OT5A 3AUXA 1XRMA 3QTTA 4MLCA 5B1EA 4KR9A 1EB9A 4B8WA 1Z4LA 4DAEA 1QVZA 1U0EA 2AOVA 1GG2A 4X6YA 2WJZB 2CJWA 5KOHB 1CUHA 4WESB 1PGOA 1CE8B 1OAAA 1VM6A 3CC8A 1DWQA 3AY7A 3DEJA 3GJQA 3T7CA 1YCFA 4XPIB 4CFZA 2QJRA 1C0PA 1DPGA 2PFKA 2VYVA 1NDQA 1JZSA 3FMGA 2X40A 3U4MA 5K4AA 4B3GA 1XXLA 2WZQA 2OHXA 3RS9A 2QMHA 4XARA 5BQXA 5KJ1A 4OHYA 1H8HA 3U7FB 2B7LA 2FMHA 2I99A 1DIRA 3FIJA 4L27A 3S2EA 4ZMRA 1TYEB 4N47A 1HR0B 2AMYA 1X92A 3N2EA 1N3IA 3RVMA 4AY2A 2ZIGA 4L4ZA 3UT5B 1Q15A 2O7SA 5LQJA 5C53B 2ZSKA 2XQKA 1VGQA 3L4EA 1YD7A 3SS9X 4AJ2A 4UTRA 1K5GA 1M1ZA 1U4NA 2ICAA 2MT9A 1UMCA 1AMNA 5AXDA 1OROA 2RHWA 3HEMA 4MKFA 3UO8B 4GLOA 4EPWA 5JEEA 3DEZA 1E3TA 2WAYA 2ZVPX 4RKEA 5AM1A 3VNQA 1LLFA 4C0BA 1M72A 1HZJA 3F5MA 4TTAA 1JP7A 1HE8B 4DLYA 1U02A 4Z53A 5A9SA 3L8HA 4W1QA 1E69A 3QLUA 2C78A 1XDDA 1X1DA 1ZN2A 2YVLA 4RYLA 4BZWA 4L78A 1DQSA 1XAHA 3GDOA 1CY7A 2DUUA 1O5OA 1WB9A 1GTSA 2A9RA 1IWBB 1Z4NA 3IQEA 4AG6A 4QPDA 1B8NA 1N5LA 2H9IA 4HTAA 5ALPA 4YT8A 2VRCD 1UXJA 1NWHA 1QXSA 3OCVA 1UWCA 3TRHA 5JAIA 5JQWA 4BNFA 1Y9EA 1JQ5A 2GMWA 4XVHA 2CL6X 2JGLA 3U37A 3CRRA 1Q3TA 1PR0A 3DKIA 3CUVA 3QPCA 4NY1A 4YCNA 4Q19A 3H05A 3FGOA 4MYCA 5TJHA 5H02A 3HY6A 2RB4A 3A1UA 1P5FA 1LC3A 2ZIXB 5DM1A 3RSCA 1MW9X 1QBKC 4AMUA 4XX0A 4AXXA 4LF7B 2HW8A 2OHOA 1TVKB 2XKAA 2O7QA 3GRFA 1QFSA 2P3QA 3GDFA 4RGBA 4LJRA 2FW6A 4URVR 2H48A 1KOLA 3RRJA 3RNLA 1JKFA 2Y4OA 1FFEA 1PX2A 2GAIA 4J9VA 1M75A 3DLTA 1XQWA 2A1UB 3JTMA 3NC0C 4I6JA 4QTTB 3CSSA 1MH9A 4BLTA 4BWVA 4MQEB 1PYGA 4P5PA 1SAYA 3CYFA 1ZD1A 2M9MA 5TPWA 3HU1A 3KTAA 1XI2A 5G1OA 2LUOA 1YA6A 1Y8QB 3VV3A 3PZRA 2QRHA 1KJ9A 2RH9B 5DTQA 3AEXA 2JAXA 1W88A 5KZMB 5LSAA 4KPYA 2GDZA 1UBNA 1E3DA 2MSLA 4G0WA 2P8SA 3DCIA 4OLBA 1V7QA 3EW9A 1NFFA 2C2MA 1CG6A 3N0RA 3OE7A 2HXGA 1GLGA 5DOZA 1Z4QA 2GN9A 3K0KA 4GPTA 1L8QA 1AQYA 3ZDBA 4LK2A 1INLA 3JQ8A 1R4AA 3VZSA 1CUVA 1ZM2A 2P5SA 2AQ8A 3ENZA 1I6KA 1YKGA 4FI3C 1KO1A 2WUVA 3GFPA 2SBTA 4PO9A 1HE4A 1OHHD 2G1AA 2C77A 4JKIA 1UJ4A 4ZANA 3NWEA 2IU3A 5GPBA 1G16A 4H7PA 1LZLA 4PFJA 3K9GA 1TKCA 2YYSA 1T3SA 2HK8A 2ODPA 3NDJA 3OBBA 4AKIA 4JJ7A 2I91A 3NHZA 2Q5IA 2ZQ5A 5ERGB 2R2GA 1R6XA 1VA4A 1BGVA 1U3UA 3NMUF 5B1SA 2CXUA 2NSDA 2W83A 4NYMR 2VJNA 1ZICA 3BSYA 2ZUEA 2QN3A 3O2QB 1SCNE 5JWRA 1MDBA 1NE7A 1EM8B 1URPA 2DSNA 1ZJYA 3RT1A 5K45A 5HBGA 4A82A 3AGPA 5IUNC 4DKXA 2ZIUB 4FDUA 1K06A 3DZCA 3WXMA 5JYBA 3GLFE 1R0BA 3KUKA 3WGMA 3IMFA 4BP1A 4RQUA 3CRNA 1I4EB 1V1MA 4OFZA 2R5NA 4BV3A 5DMXA 4U2BA 5CDHA 4FFOA 4AYWA 1EFVA 1I1NA 1V5IA 2O3JA 3AV0B 5DX1A 2H1IA 4RHFA 3V3TA 1EUCA 4TS4A 2YXEA 5ES4B 2ZYTX 3T52A 4O4LF 3EIWA 3QXXA 3U2QA 1IBSA 3SR3A 2NU8A 3HWRA 4DW8A 1EGVB 3AHDA 4MR9B 2JHCA 4NBUA 4JB3A 1BU5A 1P8AA 2ONKA 3KOOA 2AS0A 4HB0A 4OB8A 4TWAA 5CDGA 1RLJA 3A14A 4ZVSA 2NPFA 1OFVA 3NUGA 1PCXA 1GTMA 3OJ0A 3KKEA 1R8YA 4R54A 2HQOA 2JFBA 4Q48A 1TIPA 2QRJA 4INPA 2L42A 4KSBA 5AHOA 3V6MA 2VL7A 4B2IA 3LU1A 4D5EA 2P9EA 4HH1A 4OPMA 4MSUA 4R2HA 3CLRC 1CRWG 1DFIA 1ECCA 1WLSA 1R5NA 3CJRA 3BEDA 4WOJA 3H9JA 4K3UA 1SBTA 5KNDH 3T5PA 1XA3A 3W2EA 4EY8A 5K8UA 2O8EB 2E85A 5D00A 1L5FA 2HTFA 2OP1A 4OJQA 4NZZA 3N5KA 3DJFA 4WY2A 2VA8A 4HHEA 1ISHA 3KZCA 1MAUA 1P6UA 1RJGA 1TIBA 2NU6B 4G0PA 4RVSA 3Q8XB 3JALA 2PGJA 3O4HA 4CKBB 5B1DA 4GFDA 1GN8A 2O8BB 4FEYA 3W04A 5IFLA 1QKIA 3HB1A 3D8TA 4WY8A 3R4VA 4Z8XA 3TR5A 4QVGA 3TNDA 1MA3A 1W0JA 2DUJA 3PA8A 4WTOA 2RG7A 2ZTLA 4Y67A 4N5LA 3PT5A 2BISA 3K35A 3UW3A 4BCBA 1A4UA 1WB6A 3K9LA 2H1SA 3KXLA 4HDAA 1ISFA 2X5JO 1V6SA 4HLUC 2CBZA 3BMOB 2QAIA 1UJBA 4R2MA 1XEFA 2ZPTX 3TJMA 4DN6A 1DXHA 4QEKA 5F52A 2GFHA 3PFKA 2I4TA 4A6PA 1KPIA 4YMWA 1KXJA 3HKDA 3RK4A 5AESA 2WIKA 1YBHA 1AKVA 4V3CA 2IEDA 3E2PA 3O93A 1Z07A 5BYJA 4KSCA 1ZXLA 4EDHA 1WUTA 2B3DA 3AG6A 1FRFS 3EH1A 2DBQA 4R31A 1ZVQA 3C1UA 4ARZA 4Z9YA 1UBKS 2PKRA 5C3UA 2VSOA 3ZGNA 3WFZA 4JSYA 1KI2A 1LQUA 1WMAA 3UV3A 4A0GA 1WD5A 2XZLA 1W48A 3WQHA 2FPGB 1JEQA 4E6PA 4TS3A 1XZAA 2C2XA 3TPZA 1MX3A 1V1JA 2FQQA 2JD0A 2CNLA 2V8OA 4GZLA 4B8YA 2WBLC 1N2EA 4H08A 3SF8B 1NBOA 1G5RA 5ICMA 2JLYA 7ABPA 2UU9B 1IPFA 1WXEA 4GOMD 5HF9A 3WZMA 2IC5A 2D2IA 4MRRA 3A8TA 1F4VA 2NLOA 3IIIA 2B4RO 3P0RA 3Q3HA 2LE0A 1XE3A 1D03A 4JP5A 3GGGA 4XIGS 4BNUA 1M6NA 3I1JA 1RLMA 1O6CA 4J0KA 5DM60 3RKUA 1DUIA 1A8UA 2AT1A 2BM8A 3ZNOA 4JBYA 4A8JC 1DG9A 1GY8A 3K1TA 2IIPA 4M7PA 1E32A 4IZOA 4QJIA 4DSOA 1QFZA 2DQ4A 3H16A 3GPBA 3QFSA 3TFQA 1FDSA 2Y1XA 1E5LA 2H6EA 3UUFA 2FHPA 1R0ZA 1TUGA 2P0AA 1S2LA 5GONB 3S5JA 4F72A 4XUDA 5TVGA 2CLLB 3R75A 1SFRA 1Z6QA 2ZB2A 2AEEA 2CUTA 5AD1A 3BXEA 2Z5FA 3W6UA 2YYYA 1E2NA 1BXRA 2X8AA 2WDPA 1H4TA 1FDIA 4TL6A 3CR3C 5TARA 3THRA 4BCCA 5BMOA 3EIEA 4G5OA 4J0FA 5E1OA 5C7LO 3EQ9A 2VJYA 3IR5A 1J22A 1PR3A 2I8AA 4B46A 2QMEA 1OWOA 1JIXA 3M1LA 1Q16A 3N76A 1J99A 4KXVA 3O9MA 4OLHA 4DA7A 1L5MA 4FFVA 4X0EA 5C51B 3FSRA 2YWFA 1SIOA 2E48A 2X9GA 4HDSB 3I8OA 4KL8S 4V2UA 1NR1A 2OVFA 4Z9XA 5CK4A 1XDBA 3SC4A 1TM5E 1ZH4A 5K09A 3L1UA 1FFXB 1X70A 2AOTB 3QKUA 3OJXA 4QDKA 2V7EA 2X3YA 3TE6A 2B0JA 4C7BA 1D2EA 3NVDA 1E66A 4FGWA 5IDQA 2WK1A 3OEHD 2FPOA 3ZH9B 4ZDKA 1UKYA 1F7VA 4UW9A 2RGAA 4G5FA 2E4UA 3INGA 3G9QA 3BGWA 3SXJA 1NPYA 2B7BA 1AKTA 4B33A 1AURA 1JGTA 3CH5A 2PX2A 1AK1A 3PQ6A 4LKRA 1G20A 4Y7CA 4G4SP 2C4UA 4L75A 5HQ3B 1ZHOA 2OCPA 3C3KA 1BH2A 1HGXA 1U2SA 2FQ1A 3BMNB 3OZUA 3ZCRA 4D6YA 4D99A 4Q7QA 2KMLA 4DXHA 2OORC 3QPUA 3SU8A 2QVLA 5LD2C 2FFAA 1QF6A 5CNJA 4D45A 4BVAA 3FLEA 2QG4A 4AY5A 4FILA 4OAOA 2E3JA 3NHUA 3F7TA 1UKZA 2WWFA 4DQKA 4C7KA 1NDHA 4LQ4A 3R6WA 3H1EA 3C3JA 1LJLA 1M2JA 1SCAA 1A9OA 1VCMA 1PTJC 3BCRA 4X8MA 1M2HA 1Q12A 4FYHA 3WK7A 1TL7C 4BHTA 4EDFA 1R1DA 2UUPA 2OXEA 4FZ5A 2VSQA 2BPOA 3LHDA 2OOKA 4H18A 2AFVA 3I6ZA 4MYTA 2WP8J 5I7HA 4U7PB 3U0VA 3NKFA 1ZSNA 4FTWA 1QO0A 5CHYA 2HJSA 3DTVD 1YT5A 4QFMA 1W2GA 2VTEA 2IDZA 3B82A 4JEIA 1ATIA 2PXAA 4I1YA 3E3OA 3G0IA 2MR6A 4FYPA 3O7WA 3NHFA 4TL8A 2QU8A 5BSRA 3PFGA 1D7OA 1ZOSA 4K0RA 4CU5A 2QB5A 3MYYA 1G1AA 3RLIA 4F1KA 1RYNA 2BFWA 2BLNA 2OECA 1ESMA 2C5EA 2KJQA 2XLBA 4XW2A 4JBGA 1M76A 1Z0AA 1E2KA 1U6KA 4TPKA 1ZKDA 2VWGA 4KAJA 5FQOA 1S3SA 1BCSB 5AVXA 2NO6A 2BJVA 2FWJA 3QKRB 3LX4A 1RYBA 2XXAB 4IHQA 4U3JB 2DPXA 5I3ZA 3CKLA 4ZHSA 1KI6B 3L79A 4KVAA 3GRAA 2FMXA 1GEEA 2V5UA 1PR5A 2PK3A 3HB5X 5AXBA 1DTEA 5JZVA 4UOZA 3UWMA 1O5TA 2ZT5A 3QRWA 4O0MA 3M49A 1FLDA 4IX9A 2IDJA 2V65A 3MOSA 4GYWA 1QV9A 2ODTX 1POWA 3NBZC 1HDEA 4OXRA 3DQPA 3Q85A 1O57A 1USUA 1RJWA 2ZJ5A 2TMKA 2C9CA 3EA5A 4M0EA 3VRHA 3X1XA 3ZBPA 4JT2A 5L3ZA 3UAYA 2XQVA 1L3BA 3OZXA 1NSTA 3HB7A 4AZ3A 4MLPA 2YZKA 3OTGA 3RC3A 2XB2A 1TCAA 4GRDA 3L0YA 1TKAA 3VO8A 4JR1A 2Z8ZA 3B5IA 3SM3A 3ASVA 1RKUA 2V9ZA 3RARA 3VR0A 5LR6A 1BGWA 3SC3A 2VTDA 2GHRA 5KYKA 2FOIA 2GESA 1L8LA 2G25A 5ADVA 1VECA 2GPNA 3B78A 5HJEA 2BR4A 2CUZA 2F7SA 3TCNA 1XNGA 1X19A 1FRQA 3L6BA 3L0OA 2N75A 1QYVA 2F4VB 3KXPA 2EFCB 2VWPA 1NUPA 1N1EA 2XUJA 2AZXA 4CDGA 1VHLA 2P6RA 1KDTA 1GAJA 1E99A 2FE4A 2LXNA 5JC1A 4KVFA 5E1BA 2GR9A 2GPBA 4MQFA 4MVJD 4Q3LA 4ZODA 2P1DA 3FMVA 2OHVA 4CMEA 3L4KA 4GVPA 1LGYA 4E12A 1V3TA 3L0SA 3FRHA 3FOCA 4NCXA 2CYCA 2V6GA 1CZKA 2PKQP 2NU9A 2C4MA 3MXTA 4LVCA 5J9FA 1L4KA 3U19A 4UHBA 4R2JA 4I1PA 3NRBA 2ZRJA 4CNQA 3Q15C 2YRWA 4JLBA 3I6IA 2V9CA 1K86A 1OTYA 2BGNA 2HSEA 5GAJA 2H1VA 2W2MA 3K70D 4XSVA 1G8YA 4BO2A 4DGSA 3DH0A 1UKAA 1Q1AA 1UXKA 2VQ3A 3QVOA 4MUNA 3WK4A 2OGWA 4N0PA 1GCUA 1WCIB 2VXOA 5AW7A 4N8EA 3HJNA 1ENYA 1W94A 1XG5A 4XRRA 2J0UA 3DOIA 1XA0A 2WM2A 1QCZA 1E64A 1NT4A 3DLPX 2BF4A 4AZTA 4E03A 5FEUA 4RGQA 4MUBA 5FTJA 2HH9A 4E5NA 2WTAA 3JVIA 1KFBB 4ECEA 4URZR 1JQAA 2I66A 2AHOA 2YFKA 4LYYA 4MVJH 3QEOA 3GEMA 3NTOA 4EHJA 2AEFA 2YC2C 1L5LA 4L4XA 5I7FA 5BR7A 1IN8A 1I51A 1N5IA 3KZKA 4TKVA 1M1NA 3KWJA 4G4SO 4ITUA 4RVHA 3BTUA 2WUGA 5IWAB 3FROA 3O92A 2L18A 2N0SA 3KB8A 1CUFA 5FOTA 5CA1B 5IZ4A 1SH7A 4Q05A 5DO9A 4UJ3A 5E6SA 3PI6A 1C50A 4NPCA 1Z4MA 4B32A 1ADFA 1P1RA 3D3KA 3EAFA 4DKJA 1DCMA 3EUFA 1TW3A 5J4YA 3EGWA 1YQDA 2O1WA 1R15A 1FS6A 4WRRA 3PJRA 1E1RD 3F7MA 1DARA 5FDFA 3I32A 1DZ3A 1SZJG 5AI0A 5KU7A 4NAHA 4ZPXA 3T3EA 3QYAA 2BBTA 4ZOCA 1SCKA 2XUOA 3RD5A 3KLBA 4ZRNA 5FAXA 3N59A 2X0DA 4ICIA 2RARA 4JXKA 4OKSA 4DV4B 1FBNA 3DWIA 1KERA 3SYNA 2PXXA 4FYVA 3AL2A 5KCZA 1O2DA 4RU1A 1K2WA 3CO0S 3OPQA 1XN1A 1P3Y1 1PAUA 4W7HA 2C7RA 2GGSA 3JD2A 3KFXA 2DBRA 2VR1A 3MB8A 3DL0A 1O3YA 4DR5B 2A0UA 3O74A 4J9UE 1ZN8A 4KWEA 2IPAB 1ZBQA 1T2AA 4PEVA 3OWXA 1L7OA 1SOAA 1Y3IA 2QTLA 2A14A 1X6VA 3N7UA 3NIWA 1UJ2A 3GLGE 1ZIXA 3RSGA 3GCDA 5J43A 3WKEA 2JCVA 4K87A 1JMKC 5HE9A 4MA4A 3RAGA 1E1MA 2PAAA 2DTEA 1ESEA 5KVCA 4TXHA 1Y89A 5JLJA 3LFHA 3ND8A 2DWCA 4P1ZA 3NC4A 4F2GA 5FUMA 2AHRA 3HSYA 4QBHA 1DAHA 3RRZA 4EHAA 4IDDA 2IPXA 2QMOA 3A7DA 2W8BB 3CW9A 4BJ3A 4YH1A 1E0AA 4CLXA 1KO5A 4HDQB 4BP8A 4R2KA 2IGBA 1OXUA 4U7JA 4W99A 2V97A 2HA7A 2OHHA 1SC6A 5LQKA 3WZLA 2Q6TA 4QUDA 2ODWA 1N2BA 4IW3B 1EFDN 1USGA 2I2FA 4Y0NA 5JTTA 3NWPA 1ZD4A 3QV2A 5KOIA 3BT7A 1C8KA 1XDUA 2JIZD 1WV1A 4QHSA 3FYTA 2WHQA 3WR5A 1T36B 4B48A 2IYZA 3RIXA 1EIZA 1FYWA 2HMUA 1E1YA 3IXQA 1TJYA 3WDSA 1A3CA 3GJYA 4HVAA 3FYCA 3C5VA 2GTHA 2ZE8A 2IXDA 4PS1A 3SKVA 4MICA 5C1DA 3TLAA 5JDIC 3PR1A 1KI7A 1NXOA 2Q45A 3A0RB 1ZY2A 3EA0A 3GOQA 3KR2A 4OSPA 5AQEA 3T99A 1FIUA 2EDCA 5TT0A 3WMXA 2WM3A 4DUZB 4LN1A 4Z9FA 4ETMA 3CPHA 4FGLA 1O6ZA 1V1RA 2XODA 3B7GA 3HQ4O 3JSXA 3K8ZA 4GI7A 4ZEMA 2PKQO 2PSDA 4I4IA 4WOCA 5B6JA 3JQRA 4TWJA 1U0HC 4CLEA 3AF3A 2IOFA 2R48A 2C9DA 1M5RA 4JLWA 3L2OB 2UV8A 4M22A 3CZPA 3O3MB 4OA5A 4QFCA 4X92A 5FPQA 2OV2A 3VDNB 4BFLA 2BKUA 4YAOA 5MFZA 5JS1A 4L74A 2XF8A 2QN8A 1CHDA 1GZ4A 1XC7A 1GCAA 5B1YA 1J7KA 1OZFA 1IDN1 1JJVA 1Z5GA 2IUSA 1E6MA 1OFHA 4GW3A 1VE6A 5FH9A 1J24A 1P0MA 3MK31 5H68A 4NBLA 4UVEA 5F7JA 1I9GA 1BO6A 3D1JA 4W7IA 3J81A 3GT4A 3S8EA 4KHZA 3DXFA 1MB2A 5HZMA 1BW9A 4AKHA 3CONA 1RIIA 1L7RA 1UFVA 2BR3A 2C4TA 4R0NA 3H2KA 4MV1A 2AJ8A 1SZPA 1V26A 1JECA 5FHQA 3VSDA 1RM4A 3SZOA 4AUNA 4EKNB 4HPWA 3U7GA 1W6RA 4JA0A 2OO7A 4XWGA 1DKMA 3BJMA 4IUDS 2GZMA 4NWIA 1VKJA 1SXHA 1QWSA 2XA9A 1L9KA 3NTXA 3U9LA 5C18A 4G5RA 3HCWA 4PCVA 2PJZA 1T0IA 4FFNA 1KAQA 2QL9A 1T5LA 2YUIA 3BRCA 3JASA 4FYKA 1DLIA 1OC2A 1DS6A 1WLYA 2YVQA 3IPRA 5FI3A 4EQ6A 4TZ6A 4J94A 4ID9A 3MUNA 4CM9D 1QDEA 1XLUA 1TC2A 3AR3A 1M2KA 3I2FA 4HRYA 4O59O 2ODAA 1AKMA 3HDGA 4JYCA 4QOJA 3HVIA 1ZMRA 2X1LA 4TZTA 1GGHA 2W2TA 1EYZA 2KLBA 3MT8A 4DIEA 4G0NA 4PLZA 3HKCB 1PJLA 4K9DA 1W0KA 4E1BA 1JQKA 1PFUA 1XROA 4D9FA 2PZBA 5FXMA 5IN5A 1XEXB 2PSSA 4IRXA 2NVUB 4JWKA 3IUBA 4Z7OB 2WF6A 4RMNA 3TNLA 5DDIP 3CX6A 3LVRE 1I2ZA 3ZI4A 1KR2A 3MCZA 4CM4A 4IRMA 4EJFA 1GLNA 1TX4B 1NF8A 3G2LA 1X86B 3RC9A 1U3WA 3OLWA 3UV7A 2R8XA 2Q2VA 3K9NA 1FJHA 1JLRA 1P2BA 3OT1B 1LZKA 5CFLA 3OD1A 3FPSA 5BYBA 1CZRA 1JT2A 3RVOA 2FLWA 3L6UA 5TS3A 1XD2B 2O2GA 1S89A 3ER9A 3KU1A 1TK2A 2QT0A 2HFKA 3VR5H 4ABYA 2VPXA 4RTKA 5E9QA 4P3YA 3FUCA 4XGQA 5IJ0A 3PKIA 1TEVA 2C42A 1DX6A 1WUKS 2OKCA 3FWPA 4QOEA 2WW8A 5EZSA 3CNQS 1Y1RA 3X1MA 1WXFA 5EE5B 1D2GA 4RH1A 3VYUB 4HL6A 4IFIA 3FF1A 1A4RA 1VFNA 2QYOA 3IAAA 3UJPA 1M2VA 3L06A 3ONWA 4WE3A 3RS5A 1CYDA 2F3PA 1C9DB 2GCGA 3DMFA 4P4UA 2BHTA 4HGNA 5L7YA 4GZ6A 5EPOA 4IJQA 3EDYA 4J16C 3S8MA 1QUEA 4GPAA 5J2UF 4ACAA 4CXMA 1T1GA 1YQQA 1OXBB 1BXGB 1NMSA 3HN7A 4QXAA 3GDHA 3VC2A 2Q21A 4F38A 1CX9B 3G2IA 1SUEA 1M1YA 2BRUC 2Y77A 4MUGA 5E2IA 4BQOA 1C4XA 2I6FA 4WKCA 5KSOA 3WISA 4DJFC 1NZFA 4BTVA 1N2SA 2WZCA 3R3ZA 4ZI5A 3MEQA 1L3IA 1R64A 3MD9A 4IX1A 4DMKA 2ZM5A 3ISTA 1WE2A 4FZVA 4ZKEA 3ITDA 3EIQA 4C2AA 4G07A 3KR1A 1T15A 1U0NA 2RIRA 3IXMA 4RVOA 2G4VA 1YIOA 3BF7A 3A27A 2XAAA 4MJLA 1J5EB 1BU8A 1QHGA 2OQVA 4QU5A 4DLVA 3VUFA 1U8AA 3UBMA 3WNBA 2SICE 2XT0A 4J0IA 2D59A 5IXYA 1TKRA 4YP1A 1CC1S 1D1QA 1T3ZA 2PGLA 5CLLA 2VCEA 1QM5A 2ZWOA 3HA3A 3IULA 4JJ6A 3GG2A 3CE9A 1EXWA 2KBEA 3AP1A 1GPBA 4F96A 2CLHB 5BSEA 1FFWA 2R2AA 2XDQA 1OLUA 3G17A 3QE9Y 3S99A 4QBFA 4F11A 5TQJA 1XTKA 3PJDA 3PIRA 1A8IA 3CPSA 1I8TA 1E20A 3PA6A 5TQ2A 3CLTC 4QBTA 4PICA 2QYTA 2VAXA 2YX1A 3K5WA 2QNRA 1ZVJA 3UXEA 1M3SA 3JQGA 1LWNA 1CUIA 4M46A 2F8SA 4TKUB 1YONA 2B5WA 3C4JA 1E8MA 3U4HA 2UYGA 2FZEA 2GBLA 1C0KA 1J7JA 4C29A 1N32B 4Q34A 2ERYA 5D5QA 4Q9DA 4H3HB 4RHCA 2WNIA 3E1SA 5HMMA 3MQFA 4DIKA 3AU9A 3HABA 5DI3B 4COKA 4UTXA 3PCRB 4F9TA 2AIRA 5K3OA 3IL2A 1G2OA 1HDIA 2W2QA 2WWXA 2FEAA 4UM7A 1TXGA 3NU1A 4G1BA 5HJ5A 2W6CX 3QKSA 3A6JA 4BRWA 3MJRA 3F1LA 3UGTA 3UGKA 2JGKA 3G8BA 3OKPA 3D0QA 4QXMA 4G86A 1PL8A 4CCYB 1E3JA 4TWRA 1KDZA 1NNUA 3IOMA 4REQB 3ADBA 1DE0A 1DKOA 1L5RA 1YUBA 4RAQA 3WQRA 3CKMA 2FVYA 5BMVA 4YRSA 2REQB 1KZ6A 3HS3A 2V58A 3Q40A 4LRUA 4MJXA 5CNMA 2J9FA 2W0MA 2ANCA 4AIIA 1I5EA 5BQ3A 1U2DC 1YR6A 2QENA 1L5HB 5I5GA 4KYUA 4P6VF 4UE3S 5JATA 5C1PA 5KS2A 1K89A 2FEMA 1C7FA 2O2JA 4RJJA 1RWPA 1UH5A 4BJ5A 1SK9A 3RRNA 3NJ4A 2RE8A 3R7NA 1J8QA 2OQIA 2Q5CA 2TS1A 2VP3A 3EDCA 3KZ1E 1VOTA 3DZHA 4HB3A 4JGBA 4LA4A 1DC3A 4H0NA 1XZDA 4LOLA 4TKLA 4X7BA 3R7WB 2GNAA 2HEIA 3G5UA 2ASEA 4YMGA 5CURA 3K6JA 3LT4A 221PA 4YUXA 1VPDA 2Q0QA 4LFAB 1AH2A 3C5HA 4RDXA 3SLKA 1RLUA 2BD0A 4DB4A 4F86A 3BD7A 3TR0A 1ABEA 4Y1FA 2GI4A 4PQYA 2QJTA 4OI4A 3ONEA 4A36A 3ANTA 2PL3A 1UPBA 2YHIA 1I3MA 1FS4A 1GTJ1 2HGSA 4JIMA 2IODA 1L5WA 2AF3C 16PKA 2Y2UA 2Q1YA 3HFJA 4MEAA 3KPUA 4GWKA 2NYRA 1OI2A 2DUNA 2IHKA 3RFUA 3G5LA 3RJ5A 4B9AA 1D3AA 3S2UA 1JR3E 2E0IA 2ZYHA 3AVYA 2PQ2A 4NG4A 4XB6B 2VT2A 1ZOLA 2Y0DA 1NQ5A 3ETNA 2P11A 1DO8A 3TIFA 2QPAA 3NYIA 1ZI9A 5DHSA 2Q50A 3U4QA 3O4VA 1B41A 3R2JA 4FDMA 3ZGYA 1RQNA 4I6GA 3PSAA 3JVVA 3KU4A 4INAA 2WM8A 2FJUA 3A28A 1BDBA 1FSFA 1WW8A 1RI3A 1KP9A 1F17A 3RW9A 4MVXA 3LHIA 4UUPA 1RWOA 4NPHA 2O2CA 2J7PD 1IXKA 4UUOA 4DS3A 3E5HA 4RTJA 1CLEA 1WCWA 4YMVA 2HJ9A 3QWBA 4HFJA 2EZ8A 1U9YA 2DM6A 1AKQA 1E1NA 3MW8A 1AUOA 1HTWA 4A7PA 3LC1O 4M2LA 2PZFA 4M1KA 1YACA 2VYNA 3HDQA 3NOXA 2QE6A 4QKQA 2SKDA 1IXRC 2GWHA 4NATA 2OK7A 1DC8A 2GEKA 2X14A 3OZAA 4JJ4A 5JC8A 3IP1A 3JARA 5EIXA 1O94A 5JCJA 4G0QA 4R2LA 1T4DA 4MKGA 2HJHA 5CR9A 3V4PB 5BV2P 1OGIA 3TNFA 1PSDA 1DAIA 2ZKLA 1NV8A 3B1JA 4Q00A 4Y1RA 5C37A 1VHWA 2G17A 1WKVA 3RS4A 1RPNA 4NJMB 2FQXA 2HMSA 3ZDEA 4KLRA 1KEVA 1X39A 1M34B 2EL7A 2UZIR 2HHJA 3E81A 1GCOA 5F98A 2ZR9A 3PPXA 1XCLA 4NEGA 4JH0A 4YVFA 2HADA 2DFVA 3NTRA 1F0NA 3GRCA 5AK3A 1H69A 4D9IA 1MQ9A 2HCFA 2I1QA 3R6LA 4WFJA 4BECA 3D3EA 1MV5A 5BOVA 5DGXA 2XXJA 2AFRA 2VNJA 3BTVA 4MR8B 2BHRA 4XJSA 4OP3A 3RTDA 4HT3B 3GVXA 4Z6KA 3KJIA 4IXNA 1VJGA 2QVYX 3O47A 1SCDA 4CI9A 5TGZA 4BE9A 1W47A 1C5KA 4RF5A 1UIMA 1YFKA 1M2WA 1Y1SA 3CTMA 3T1HB 1N77A 2H3EA 1FQOA 3WV4A 4BPRA 2FAXA 1TU3A 2VPZA 4E14A 4BBPA 3M6WA 1PJBA 5JT1A 3FIUA 3I5UA 5KYUA 1G2PA 3EZ6A 2H29A 5GV7A 5EIWA 2AQKA 1KZ7B 3KQMA 5KQGA 3PNSA 5K6AC 5CNIA 5MDHA 3SHVA 4TS1A 2WWRA 3K0AB 4XR9A 2FU5C 1RZRD 4M8LA 3ETCA 2ETXA 8GPBA 5CITA 1NQVA 2A9FA 1CS4C 5AVKA 3DHEA 2WV9A 3CUWA 2Q3BA 5A6SB 4H0FA 4JLVA 3VSBA 4FD3A 4B4DA 2YNMD 1EK2A 1RS0A 2ZIFA 4YAWA 3OX3A 3REOA 4E5UA 3P96A 4R3WA 3S28A 3WTBA 1H2YA 2AVDA 5CLIA 3C41J 3KCQA 3M6XA 1G4AE 1NP3A 1QZ3A 2X5NA 3D4PA 4NAUA 3UJNA 1A5AB 1DT5A 2MSCB 2AVNA 2PO7A 1KNQA 1H6DA 4ON9A 3PU6A 3NNNA 4D8VA 1DIHA 1M8KA 2A94A 4GSYA 1ZI6A 3KD2A 4DA8A 2PU7A 4IJ6A 1I6WA 4M9UA 3THWB 4HNRA 2H7CA 2HA5A 4YJ3A 1GYQA 4C76A 4LQDA 2VT6A 1YFLA 3NRCA 3QMWA 4H1HA 4J1QA 2MSKA 2VJMB 2JASA 3T41A 1CJKC 1D8TA 1YIDA 2AG0A 1WDTA 1KMNA 3FZYA 3DO6A 3LXXA 2DGDA 5P8WA 2VS1A 4L08A 2ZWMA 1AGPA 3M89A 1U5BB 1AGNA 4WX2B 3D3NA 1Y5NA 2IXTA 4D0GA 1YZYA 3AYXB 1KVQA 1LBEA 3RU9A 2V3WA 3I2IA 4PONA 3KRTA 3UHPA 2IFTA 1E2GA 2OL4A 3HYLA 4O5AA 4HF7A 4WKPA 3WQSB 2R96A 1W5EA 1RXVA 4KR0A 3F73A 2C5BA 2J7KA 2OZLB 4DUPA 4BLPA 2HY7A 5DV9A 3SNKA 1KMMA 2UZ1B 3H86A 2E37A 4LX8A 3KLNA 4RE5A 1QGUB 5SYNA 5JJIA 3ZWVA 5T57A 2HSZA 3IB6A 2GSDA 1V5WA 5IW8A 4DWOA 5LMUB 3OQMA 2G9RA 4JLKA 1KKUA 3OU2A 1RAAA 2EQ5A 2PGNA 4KODA 2G9ZA 2DJ5A 3W7VA 4EKGA 2FKAA 2IEBA 3MGGA 1ZUIA 3D81A 1D5CA 5A7FA 3NHLA 4UXIA 4MI3A 1QFXA 2HF9A 3TQIA 1TUEA 4EHKA 4XPZA 5FORA 5B1HA 5KX5A 1UBGA 2IS4A 1R6VA 3E8SA 4CTNA 3QEKA 1OGJA 1P7ZA 3PUKA 1ZC4A 2CVPA 1XU7A 4DYVA 1Y4AE 1TT5B 4B75A 3EEBA 3OX2A 2REBA 3NTQA 3UUEA 3PP8A 5TSDA 3EZLA 2C9OA 3FSJX 3CZ5A 4AS1A 3JRWA 3KUXA 2JAUA 3OFND 4IDGA 4GMDA 4OV6B 3GNQA 4MI9A 3BB4A 1HT1E 3D6AA 3MGKA 4IEEA 3L0CA 4WA7A 5AVYA 2AN5A 3HKBB 2WY2D 3PF8A 4H0CA 3H4IA 1ZONA 5DCWA 3UW1A 2IOHA 1OTHA 3KQYA 2J46A 3MLAA 3Q2IA 4G84A 4CKZA 3LUCA 3RIEA 4PG7A 1PDVA 4BLRA 3QU2A 4CIXA 1T13A 1ELOA 2ZVJA 1BFDA 4KYVA 2WD7B 3HA2A 2H07A 4O4LB 2H1LA 3QUBA 5EHNA 5EY5B 1GZ3A 3G5MA 1P29A 3RSZA 2CJFA 1REQB 3OEEA 1GWNA 1EWVA 1JTEA 3ODGA 1EFRD 1PFQA 2NG1A 1OX5A 2QGZA 1C3LA 3FDZA 3MXOA 1T34A 2LW7A 5TVKA 1WABA 3KHTA 4IGAA 5AW5A 3I09A 3GZNA 3TLEA 4NV0A 5A0FA 3PXEA 1JI3A 1ZXBA 5DGDA 5JAHA 2FDCA 1GPYA 2IBMA 3F74A 2C5GA 4R8RA 4EEXA 1R5JA 4MB0A 2C83A 2DPGA 2PUBA 3VZDA 1AKYA 3BQNB 3ESQA 2QK4A 1XDZA 4QM7A 2QNBA 3EJ6A 1MC8A 3PYLA 3L4SO 3HNPA 2JBAB 1O5IA 4HQOA 1GILA 1R4NB 3IE0A 5LQRA 1MO2A 3TJZA 1N5RA 4FS3A 1OV6A 5SY9A 3C87A 2GRAA 2N46A 3K5PA 4US1R 4HATA 1RVDA 1QLWA 4P3XA 4GEGA 2FSSA 5EQDA 1Z74A 2VEOA 3FWNA 3OI7A 2WHPB 3T1VA 2Q3FA 1T9BA 1E9EA 5H5JA 4XOUA 2AOWA 2F48A 3CUTA 1ZGJA 2HRCA 5HRAA 3G8DA 3T0FA 3AOEC 5CT8A 4EPXA 4X7PA 2PWBA 2F90A 2C3PA 1D6MA 3GEHA 4MO9A 5J58A 4EJSA 3NP7A 2OXFA 1B8UA 5I7EA 4WOKA 3O4FA 1GAEO 4UU8A 5I7UA 5B36A 3WA7A 1CFZA 4GECA 2MMCA 1ATZA 2CJWB 1G60A 4X1KB 5BSKA 6PFKA 3OUTA 2DG2A 4R69A 2AC2A 4D46A 3WTCA 5KTOA 4PZLA 3UK2A 1KDPA 3UAOA 3PRKE 1XWIA 1OTXA 1H5QA 1ORVA 3H2YA 3ZHVA 2VTBA 1AZWA 2RGDA 1MOZA 4REMA 3EDOA 4RL6A 2CFRA 1GUAA 3ENNA 3GFGA 1ONOA 1LBTA 1A72A 1LFDB 2EWVA 2Y66A 4DA9A 2HXSA 2G0TA 2YY6A 3JPYA 3R09A 3Q98A 3RIHA 5BR4A 4YY3B 3HK2A 1BWRA 2MYTA 3O5AA 5TLSA 2YJ6A 3CWQA 1T8RA 3PITA 4U2DA 5JPDA 3R77A 3HVRA 5ALXA 1Z29A 2MJLA 3M2TA 3QEJA 1T1EA 4J90A 3VR4A 1CY8A 1AMOA 4F8YA 3Q9NA 3DA8A 3OP1A 3OURA 4IH9A 1UMCB 4YXWA 1F38A 2AH5A 4B2YA 4DSNA 2PX3A 2BEJA 3I0NA 1E7YA 4P4TA 1RXCA 2XW6A 4C06A 1BH6A 4OCZA 4JQOA 4CRWB 4RABA 4UNPA 2DXIA 3TMYA 2FUKA 4RX1A 1YZGA 1TZJA 3L7IA 1J25A 4M9QA 4XGIA 2UUCB 3LGXA 1GYPA 2PRIA 3ED5A 3OQNA 3PVZA 2WSMA 3N39C 1LRKA 2M2IA 3U61B 1IZ0A 1JDSA 1YK1A 4MS4A 1MA0A 3KKLA 5CFRA 2QGNA 4KR7A 1GRRA 1O95D 2PT6A 3CH4B 2WB4A 3MCWA 2NXJA 2JKYA 4KLAA 3DB1A 3WYDA 3BRWD 4WKNA 1S96A 4QQFA 1IN5A 5LJIA 2G7ZA 2VPYA 1M34E 5BVHB 3COZA 3KZNA 1J20A 4JI4B 4GYJA 1YKFA 5CD9A 2QZSA 4NV3A 3X1WA 3ZHXA 4CTJA 4DQ0A 1C9MA 1B0UA 1VE3A 4HB2A 4CPDA 1QGOA 3VUEA 1QTQA 1WF3A 2JGJA 3CF6R 5IF9A 3I39X 4DEVA 4EMSA 5AMXA 2CK3A 3FCYA 4XX0B 2IZ0A 4A9AA 1CDDA 1G41A 5BNWA 5CAEA 1JYFA 1QHYA 4UEQA 4YJ3F 5LU9A 4W5OA 2HFJA 1KYQA 2XNSA 3KQQA 4GMGA 4B6SA 3NHRA 4RGVA 1QF9A 1QGED 2IKSA 4OOFA 4PHTA 2FW9A 3G2MA 4HQKA 3GO4A 3I9NA 4UAGA 4YRBA 3GH1A 1JIQA 1JT9A 2XYQA 3LKZA 3MWFA 3O4IA 3JAWA 1IWOA 4GX5A 1LRLA 4MV3A 3KTAB 2Q8NA 2X2FA 3DCJA 4ND6A 4TLDA 3DHWC 5TPWB 5BSFA 1U6IA 4Y2HA 4UBKA 3DDCA 4FFMA 1XL0A 4ZZ1A 5K99A 1U8TA 3M81A 4EG1A 5KHAA 3EVZA 5DNVA 4A10A 2GYUA 4PYJA 4QBGB 1LBSA 3HCOA 4YMIA 1S01A 4Z7QB 1F2TB 4FOTA 2P3LA 1X8KA 2B69A 2QL6A 4G5YA 2H16A 1RBQA 4HS9A 4LZJA 4RJKA 5BW8A 1MO4A 3NUZA 3JQ8B 3PKZA 1IBRA 2QLNA 2ZSUA 2J09A 3BEOA 3WQQA 2QN2A 2Z3WA 2JHFA 5EA2A 1JDJA 3ONVA 4RC9A 4BX3A 2DMRA 2HT1A 3NDPA 1DC4A 2O7NA 4JP1A 1V8OA 5D3QA 4K81B 4AQ7A 3G79A 3PQ3A 5C35A 2WQ6A 1RACA 3LOPA 4XASA 1PU2A 4NU8X 5GOZA 3NOQA 4W9NA 4B6QA 2VCHA 4B7ZA 2OCYC 3LUKA 4N7RA 5IVIA 4QT4A 5LZ2A 1H2ZA 4I8XA 3W78A 1NM5A 2IEIA 5KX5F 1NY5A 4YDHB 2JFZA 3ZOKA 3N2IA 2DHEA 3I2KA 1LFAA 1V8PA 2CLFB 1U6JA 3QEAZ 1M67A 4FONA 2BFBB 1RWKA 1NHWA 5EXEA 3OZVA 4UE2A 5FPPA 2PG3A 3SHTA 4N5MA 3U6BA 3LP5A 2PR7A 4RA9A 2M6LA 4HVCA 4ESOA 4BUCA 1VHTA 3DE4X 4CG3A 3ZLJA 2I3BA 1WW3A 1JILA 2IP2A 3CJTA 4H6PA 4P3KA 3F78A 3GRYA 4TT8A 5DBGA 4D8YA 3IEUA 1V1MB 5EL0A 1UXOA 3V00A 2XHEA 4YV7A 5REQB 2PTHA 1HDRA 5J3JA 1DKQA 3ZK8A 1EUCB 2EKDA 3TTWA 2J5KA 5TS2A 4DVJA 4ZYTA 1J2TA 4JBWA 3BB3A 4UQOA 3QHQA 1LLCA 4FDAA 3CVYA 5BYAA 2ILVA 4YV2A 3QVSA 5C8YA 1QVWA 1M2EA 3IAM1 3SKXA 2WSSA 3ZLTA 4F5EA 1HI9A 2CB0A 3MWEA 1Q19A 1MNQA 4IBOA 1V41E 3EF0A 1Z2CA 1HOTA 1YQEA 2H5JA 2PX6A 2C5AA 4HWSA 4KE9A 2WEKA 3E3AA 521PA 3ZE6A 1JDNA 1NRXA 2XMBA 2FSIA 3CZRA 1ODFA 3L40A 5ISMA 5KJ6A 3QA3E 3HXQA 3HYRA 4X20A 2XCUA 4TRJA 3SBDA 2EF1A 5C4MA 5CEJA 1JWLA 1T6XA 4HDCA 5C31A 3GJ0A 2ZJ4A 5T4FA 3A2LA 5B3LA 3KZXA 1MAVA 4D5GA 5DF1A 5GTDA 4BRUA 4QULA 4MQUA 1P18A 5JD3A 2ZITA 4L6CA 3PHHA 2QD5A 3VPHA 5GWXA 3DOFA 3Q8MA 2D6FA 4AS2A 2MYUA 1A4XA 1ISIA 3K8QA 1PNRA 4BV9A 1QQ6A 3OIVA 3OQBA 2BGWA 2J67A 2J3QA 1Y6QA 2QTGA 2XZDA 2VXBA 3FTPA 3GCGA 3NB0A 4TM8A 3TD9A 3T7KA 5B4VA 1QIGA 3FPGA 4JOQA 4JI3B 1GFIA 3MSCA 4N7JA 2YW9A 4YGXB 5K8JB 3COVA 3LBYA 3G82C 4FBMA 4MP8A 5CLFA 2A0FA 3GD5A 3ICCA 1DC7A 2XBLA 2Q49A 1W75A 2ZJZA 5LM3A 3R23A 2B8EA 2ILTA 3KR0A 2C8LA 2WG2A 4Q7MB 1VKZA 3D2LA 4FHCA 5KWEA 1GZSA 1IOLA 1GSAA 3D7MA 3EMBA 1CFJA 3I52A 4LYJA 2AC7A 1Z63A 2BGMA 2JARA 4FI3F 4YFYA 4L76A 4Z3OA 9MHTA 4MDHA 3UK7A 5FPKA 1MD9A 3SJAA 4XI9A 3D8HA 1NMQA 5SZKB 3PZBA 5EINA 1IRXA 1H94A 2Y8EA 2DHQA 3K9BA 5DLYA 3ZWCA 4LDPA 3VI3B 3L92A 3N8KA 4BO9A 3TZQA 3CVVA 4Q4JA 3ET5A 4HZIA 1B4DA 3SP1A 1JEQB 3IBCA 1IN7A 4LMRA 4N03A 2ZYGA 4NBWA 5DIFA 2LCQA 3DOJA 1CIJA 1N9ZA 1FUUA 4HTFB 4M9CA 5HKAA 2R8BA 3DZBA 1G5IA 1FEZA 1V8BA 3RC7A 5ALWA 4EKEA 1MH1A 3SJZA 3R7BA 1LBIA 2R25B 4UULA 2FYTA 3I8XA 1N5OX 5GV8A 4GE3A 4OH1A 5CVUA 4AULA 5LQSA 4DZZA 3BB1A 1JNXX 4UJ5A 5B3JC 5LQNA 1WEKA 4NMLA 1UEIA 1KJIA 4DT1A 1UKEA 2IBTA 3RCBA 3USES 3MWLA 3JQ9C 3VDRA 3IXLA 3WK5A 4UNRA 2RK3A 4PIMA 2FG7C 4EBFA 4IFBA 3SF0A 3DAPA 1HDZA 4HKTA 3R5JA 5I5EA 2AFIA 4EMTA 2P90A 2ZB7A 3ON5A 4BAZA 3EXEA 3R0IA 5ALKA 2ZRKA 1UC9A 1R6BX 1L8OA 1BXRB 4KXXA 2AZTA 1QKKA 1UC5B 1J0BA 4HI0E 4XWWA 1NRWA 1XZGA 1L7EA 5L7TA 2XTNA 1IM5A 1LSSA 4JUIA 3W2GA 9GPBA 5FFMA 4OQFA 3EEQA 3H19A 3B7PA 2OQRA 4G0ZA 2DYKA 1KDRA 3QPVA 4JUBA 2YDXA 1U99A 3KO8A 1LW7A 1Z73A 4RZIA 1MVLA 4CJXA 4AWAA 5HYVA 2UYCA 1FYVA 4YCBA 1DIAA 3EF1A 1RAHA 1YRYE 1K0FA 2VP9A 3SGLA 2M1ZA 4NICA 2PX8A 4E15A 3B13B 4Z0TA 4ZHQA 2ZDGA 4XM0A 1T5DX 3UAXA 4YJGA 3T3HA 3AUFA 2WJHA 4AO8A 3ZQ4A 3BH0A 4OIFA 4FEGA 4Q18A 2OT3B 3CLVA 5DE3A 1G20B 4JS0A 2WLTA 2WNHA 1SKYB 4B3DA 3O1JC 2AKYA 1QGDA 1YXMA 5ECDA 2OO5C 3PQ8A 2ZZNA 2CXOA 2P75A 4NFYA 3R9KA 2RKWA 3C4VA 4KAFA 4L95C 4QSMA 3AUTA 4ZCRA 2W58A 4MPDA 4FOPA 4WXYB 1FX0A 3OOSA 3IUQA 4F4HA 4ALJA 4KFCA 2COEA 1KRXA 1Y6RA 2JLWA 3KJHA 5K8LA 2ID9A 1PT8A 2FX3A 3P2EA 1H1DA 1BAPA 3EEYA 4HDMB 4I3HA 4BKQA 4NXNB 3R0QA 2ZE7A 1T1IA 3EYAA 1QZTA 3QFRA 1BDMA 4W8OA 3RB8A 2DR2A 4F1JA 1WEHA 3PHIA 3UMRA 3I9OA 1RI5A 2UZ0A 2ONZA 4FNOA 1W93A 2JIMA 3MRTA 1P61B 4JEMA 3EGCA 3GCXA 4OHPA 5D3MA 5FKJA 1VPLA 4OUKX 4ENQA 1OH7A 1EFUA 1V96A 4Q3OA 3DNFA 1K7SN 2FLVA 2Y1EA 3U9TA 2ZI3A 4ZTZB 2W2KA 3OLZA 4LJ4A 3CURA 5LZ5A 5DKFA 3L3BA 4I4CA 4CKCB 1WUJS 4UBLA 5ALEA 4DIFA 3FBGA 4L8VA 4HMPA 4BN5A 1AB6A 2WFZA 4Z54A 2EZ4A 4EO9A 5C5CA 3K3PA 1Z25A 3TRFA 4X6UA 1C3EA 4PYMA 3R9XB 1A2BA 3QW4B 3T94A 2BEUA 2CKDA 2IU4A 3BM5A 3D64A 1FC0A 1GQOA 2BELA 2MU1A 2E87A 4HBZA 4EF5A 2RHMA 3RF6A 2EV9A 3CXUA 1A69A 4RIFA 4YC7A 1R4ZA 4NU0A 4OL9A 1ZWKA 1YMQA 1WQ3A 4DDUA 3BRQA 4LEIA 4P82A 5EESA 1P4SA 2YCLA 3PPVA 5C8YF 4H6VA 5AW6A 2G1JA 2P9GA 2WWYA 1WZUA 2H5EA 1G8MA 2I6QA 1NP7A 3AJ9A 4IL5A 3OPYI 3GX1A 3V4SA 4RW0A 4DRZA 2I80A 3NEYA 5DIZA 4GD3Q 2Y0BA 3A0UA 3M5PA 4KN8A 3TD2A 2AXPA 4QWMA 4GPD1 1XLTC 2Q7DA 2HXYA 2E4XA 2FW8A 1YSCA 1Z0DA 2GRJA 2H2AA 1CS0B 1F6WA 3HR4A 3NDIA 4IDCA 4L7VA 2VZ9A 4MR7A 1G7RA 3QPWA 4ASUA 4AZ3B 3FSGD 5JXWA 2H9YA 3MGCA 3RYHA 4BKOA 4P92A 3U13A 4C04A 4HUQB 3B36A 2EGGA 5CT6A 3U3OA 1GDHA 1HL7A 3IHLA 1U0TA 1IRIA 3DT9A 4U00A 3WB1A 3SX0A 1B74A 4P58A 1Y9AA 1ZNYA 2GARA 3X44A 1OIXA 4E88A 3HLTA 4LXTA 3ZJ4A 4TMKA 2EDAA 3ANMA 3F7NA 3FGPA 3CM0A 3ASZA 3P4UA 3OPYA 4UUBA 2ZJ7A 2XYRA 3RIYA 1G64A 1XJCA 3K0HA 1DAEA 3UPDA 3O3OB 2FE1A 3S2GA 2WJ4A 1OGYA 2NQTA 3B6EA 5LNK1 1QU3A 1PR9A 1JU3A 2IW1A 3DV9A 2CLEB 1H4VB 2QW0X 4Z9AA 4F2HA 2ADOA 2HLHA 3LO8A 1XRLA 3OLYA 3QJGA 4ZO8A 4UHDA 5GQSA 4H3SA 3RSSA 1NIPA 2H65A 2BFDB 1M5TA 1IJKA 4GNRA 4JJEA 1U7PA 1Y0BA 3SYRA 2ECOA 1JHQA 1K3UB 2CXRA 1GZDA 5KO2A 1PV4A 1IATA 2I7XA 4AL4A 1NF3A 3GJ6A 3SEFA 3F9CA 4ZREA 5A0VA 2X6QA 4Y3UA 4TS9A 1RTKA 1VI2A 3LHFA 4I1UA 1IHPA 4E1VA 1DEAA 5AJVB 1RHKA 4XWOA 1QS0A 4HGQA 4OXYA 4RHXA 5FPYA 4M8KA 2PRJA 2R5WA 5FFFA 3N3AC 1DI0A 1ZH0A 5FA6A 4DIBA 3AEUA 1WZEA 4GC5A 2HLPA 3F9RA 1U2EA 3G49A 4KTVE 4RWEA 2AOXA 3WADA 2GASA 4Q66C 2BFNA 3E9CA 1U7HA 3KWMA 2ZI6A 2XV1A 1XBTA 3O83A 3QTLA 4LV8B 3UZUA 3COYA 3VNSA 2COUA 2AI2A 1NQOA 3NRJA 3QENA 4AAYA 4CMIB 4BMXA 2A9OA 4BU0A 1GKIA 3F6YA 4M0MA 5JXGA 5I6DA 1JFFA 2P4UA 1KKMA 3R4CA 4K26A 4RCYA 1EX9A 5ILGA 2PUFA 4JI7B 1FDVA 4UCXA 4DLXA 3TLZA 2ASVA 2JLQA 4TKVB 1M1NB 3Q0IA 4JL6A 1BEUB 4UFPA 1FVFA 5JO0A 4TN5A 4TROA 1KYYA 4GOND 3G2KA 3AG5A 3VO9A 3JYLA 1NDUA 2O19A 2NGRA 2HPAA 2Z6UA 1M7BA 3IYLW 1SOVA 1GTG1 3U7RA 2GBIA 5I9IA 2DT5A 3K09A 3QVKA 3AERA 3O73A 4O4IA 3ZY6A 3JAKA 5J2UB 5CB8A 5D87A 3ICEA 1ANKA 5KSYA 2GPJA 3N2KA 2R6R1 3TQFA 2IYLD 4PZPA 5KVAA 1ZCAA 4JX8A 2CV0A 2B9EA 3T7JA 1JEAA 1ZU5A 2R8ZA 3EIUA 2DWUA 1XAJA 2IS6A 3B2EA 4WXHA 1JHAA 3VSAA 4F60A 2FW1A 1QVRA 1UBSB 1OXSC 4C20A 4V0OA 1U2RA 1K0UA 2HUNA 3F2IA 3N70A 4TV8A 4ALKA 3EQZA 4RTSA 5DYTA 2QRMA 2XGGA 3SVTA 1ZI8A 3PF9A 2A1IA 2QDXA 3AIMA 4OYHA 3R41A 4EY5A 2PR2A 2HDHA 1ST2A 2O48X 2P1RA 4NARA 4WLOA 4WNAA 2QX6A 1Z6GA 2FDXA 1G8FA 1V0JA 5ALFA 5BN4B 5IVPA 5AIAA 1WCYA 1P1HA 3M4NA 3Q5EA 3PWKA 4GUDA 4BVHA 2QTBA 2FSGA 3FJOA 1Q1EA 4FPXA 4JLNA 2HYDA 5D3KA 4FDVA 1GQSA 1RRFA 3GJRA 1NN1A 2Q7XA 2J0SA 4D9CA 1BD3A 2NO5A 1RBZA 4JOSA 2XUPA 2JFYA 1E1CB 3IBGA 3HEBA 4HNAA 1Z0ZA 3TTTA 4ALIA 1KI3A 4BVJA 3PFWO 3JV7A 1ARZA 1T6YA 3CR7A 2UVDA 4FUQA 3MWYW 1P2TA 2DFLA 1HQDA 1VJCA 4YDRA 2JH3A 1XV5A 2OBBA 3BUSA 1TPZA 4G36A 3A3PA 2FSVA 5DP1A 5ULLA 3OMXA 4I66A 2ZPUA 3DVAA 5GJBA 4L07A 4P31A 2O1EA 1OZHA 3I92A 3KLMX 3NORA 2X1MA 2ZWPA 3C14C 4R1OA 3RHZA 1GTL1 4LZPA 1X87A 5ERXA 1TZCA 4YRTA 1T5HX 4W5HA 2V7QD 3DWFA 3HBFA 2DLCX 3NNSA 2V9PA 5IABA 3TIGA 1C4WA 1U28C 4CKXA 2BHSA 2PX0A 4LSGA 1WVMA 3FCEA 4BNXA 1LPNA 4F2WA 1IZ8A 3PFHA 4L5IA 3HP4A 3N2GA 5G0WA 2FWIA 2IP4A 3NFRA 4NS4A 2JFQA 1U2GC 3IRUA 7AT1A 1LVGA 1ZKMA 3A9VA 1VB3A 5K6TA 4MCJA 1KZHA 1G20E 2GTPA 5CXSA 1A27A 1ULBA 3C6KA 1YULA 1S7GA 1KVSA 1SKYE 3MCUA 4YMTA 5JAPA 4ENRA 2VNIA 1YRBA 3D59A 4WAUA 4QG7A 4ZVTA 2FR1A 4E11A 5EJ5A 1MXHA 4GGOA 1Z28A 2YHSA 2OHGA 3M70A 3ZVNA 2RGYA 3ZW9A 4CQLA 2YS7A 3KYDA 2R11A 3IMCA 4HNGA 4DEXA 4V03A 1FLVA 4JSRA 1V9CA 4PPQA 1MRNA 2OGTA 2ZAYA 3OU6A 5D6OA 1J2JA 5EP3A 3P9CA 3K15A 4QO8A 5DEOA 4DM7A 1SG0A 5G4KA 1V1RB 5DP2A 4EB8A 2IYSA 5HWSA 3BX1A 4A8HA 3W1VA 2H17A 4AICA 2Z58A 4O29A 2P6MA 4LUCA 2F59A 1D04A 4P3PA 4UTOA 4BFTA 4L3VA 1TB4A 4C3ZA 3E9NA 1M1UA 4KNWA 1DPFA 2ZUWA 4D4IA 4ZO9A 1FJ2A 4ID3A 2IYFA 4KBFA 4CN8A 4N65A 2DFNA 4O4JA 4QIHA 4AURA 5AOBA 3H2BA 1NONA 1LPBB 5ALRA 3ZD6A 1C7RA 5DHUA 3JZAA 1DAGA 1NG9A 3QXCA 3R3WA 3SSOA 1ECGA 3CBGA 3EVBA 5TXGA 5IEJA 1WB5A 2G4CA 3WBFA 4PRLA 2Z6QA 2VVTA 5A5VA 3HXLA 5B64A 2A78A 3ZWKA 2PYZA 4DJEC 3MAJA 1NKSA 5G1NA 3DL4A 1OB2A 1ECLA 2O8FA 2AZ4A 2PZKA 3B1YA 1AUVA 3WLSA 4L8FA 4KMMA 1QGAA 2WABA 2Z1MA 2ZRLA 4OGFA 3KYIB 3GEEA 4A0QA 4WD3A 3D7NA 5GP1A 1IY1A 4WXEA 4YJKA 5DJ5A 5FT9A 2A35A 1LV8A 2ZW9A 4KXUA 3KIPA 1BA2A 1QG6A 1J39A 1YDFA 5HKBA 5J2TF 3CRZA 1ZEMA 2VF4X 2WSLA 4G63A 3U60B 1V8DA 3JASB 5HA5A 1PK7A 2C5HA 1UKCA 2H31A 3LKDA 5L9AA 4EQ6B 3IUNA 2VH2A 1NVVR 1O0CA 2ZJBA 2XNKA 3RWOA 3RYFA 1W4LA 2ZRNA 1MP0A 4GL2A 4XLZA 1VJRA 3JWIA 1UQUA 3RFCA 3FA2A 1XJWA 1P3DA 2AA3A 2QJOA 4GICA 4Q7KA 5JSKA 4L6AA 1O96A 3IBFA 3KR9A 4H1TA 1U9IC 3P7MA 2EW8A 3IVMA 4R16A 3KFLA 3RS3A 1FFYA 1KHTA 1VPWA 1MTZA 1CY6A 3EFOA 4AUMA 5JNRA 1ODJA 2GEDA 4RO0A 2JIRA 3PVSA 4AX8A 4MRPA 4JGIA 1IB0A 2KW5A 3AUUA 2PL5A 2BKLA 1B8PA 3EQ8A 4LYGA 3UKDA 2G9NA 2VYCA 4BBJA 3B1KA 1E94E 1RHMA 4R6WA 4NE7A 4WQMA 3LF2A 1M54A 4Y6RA 5M34A 2EQBA 2BV3A 1XZFA 4NOJA 1N7JA 3NGXA 2WB2A 2WJVA 2GK6A 1EEHA 1I2AA 4GC9A 4FKZA 4L9AA 5LZ8A 3ZXXA 3ZVKA 4M3NA 2NZYA 2IUTA 1CERA 2PX5A 3NX4A 4JJKA 4K9NA 5LP6A 4D57A 1UMDA 2BEVA 2FSHA 1PJTA 5IJ0B 2X0FA 4PYIA 2IY9A 5JCOC 3FCUB 2GM4A 1DBVO 1QX3A 4LRTB 4WCFA 1AMUA 2RGGA 1YDGA 1WMFA 1BEEA 3G9XA 4FVTA 5TQVA 3H0EA 4LHEA 1CJVC 1SQ5A 1NZJA 3K0FA 3PDCA 4U0KA 3IQIX 4J0DA 2V0CA 4EUHA 2BP7A 1M2VB 1SKUA 2WWVD 3U7JA 4BDTA 2PYDA 2KB0A 3K9CA 3PD1A 2X9QA 3T54A 1TC1A 2HO4A 2YIJA 3LWDA 4PNPA 4Q47A 4RIIA 3I61A 2R6DA 4D96A 4O4IF 1UINA 4B76A 3PDUA 3TPCA 1NULA 1NFRA 4IQ4A 5CTJA 4Y1EA 4RK6A 5DTIA 4EI2A 3FFAA 1H4SA 4QYMA 4X62B 2BFOA 4G8DA 1LQTA 1MHPA 3UJ9A 4K28A 4XD7A 1X1AA 3O91A 3PRYA 4PANA 4TV8F 5GOTA 2JLUA 4UDYX 3W4KA 2GZ1A 1N6RA 1L1EA 3N75A 4OGWA 3RVJA 3WNZA 2JAOA 2O50A 1SUAA 4UNSA 5K3AA 2F3QA 4YMSA 3HDJA 5IMSA 3KCNA 1XLWA 4JD5A 2O3RA 4IWXA 1FQKA 2IWRA 1N5MA 6REQA 2I33A 5GZ3A 5GVSA 4PFSA 2ISQA 3E53A 3IKJA 1K3TA 3EVAA 2A59A 3OOEA 1VLVA 3L0ZA 4QL3A 4UKDA 2BKVA 1IJFA 3ZX4A 4C0HA 3BFXA 2IHZA 1K92A 1RC1A 3FR8A 3PR2B 4LQLA 1DGQA 5CTAA 1R8QA 4QYTA 3LLCA 1FTQA 4RPHA 3SCZA 1ZIYA 4KMRA 5A71A 3WRYC 3EH2A 5TX7A 4GKJB 4KACA 2KQUA 4BNLA 1VI6A 4Q82A 5KHLB 4EMUA 5EJGA 1DQZA 3HACA 3ILYA 2XDQB 1OLUB 3TL3A 3V34A 3ZC3A 3GIDA 4D02A 2I54A 4QDJA 5DYYA 2ODQA 2PMCA 1EFLA 3TOVA 5AOVA 2EFYA 3L41A 4OLFA 1VG0B 2Y6UA 5E1DA 1J1UA 2EZTA 2JVJA 3OZDA 5TQ2B 3JQEA 2RHLA 3QI2A 1ZA1A 3AESA 4B80A 4IH4A 3G1TA 3KE8A 3X1KA 3JQGB 2HU8A 2O52A 5DHAA 5H4HA 1Z8DA 5EE1A 3UJBA 2J6BA 3TG2A 4Q3BA 1XHFA 4LBVA 4RY2A 4RVUA 3B60A 4NI5A 1JQDA 1LSUA 4KDFA 4O8CA 5U4QA 5JMTA 2Q1TA 4P36A 5CIYA 3DV0A 4M1YA 5CGQB 3A1TA 3JAMA 1NBMD 1UBUS 5FI0B 5LDHA 4M0DA 4S0ZA 1NYRA 1RADA 2L2QA 4QARA 2XGMA 1P2DA 1MMFB 3FKSA 5ITWA 1TF2A 2DWPA 4F3NA 4OHVA 3DZFA 1TUBA 1QK4A 2IUFA 1RQPA 2YY5A 2RAFA 1P7CA 4NABA 5FBQB 3T7EA 4INZA 5HM6A 4C0SA 5JJ5A 4KVZA 1BSVA 1NN3A 2P6UA 3BQ9A 3DGFC 4UQLA 4UUAA 2XMSA 4C4SA 2R0QC 1MIHA 1JJ7A 1GQRA 2WVAA 3FE2A 2RJ3A 2W2XA 4V1CI 4CGZA 2J9FB 5DN9A 1JIIA 5B3AA 3ZH2A 3FM9A 5AKHA 1SXJE 1N6KA 3ANYB 3DF7A 1J07A 4UNQA 2ZTSA 5BWOA 3FFTA 1K6XA 3L82B 4IEFB 4X1YA 3Q11A 2QT9A 4BKRA 3M1AA 2WNSA 5T8KA 3W5AA 8LDHA 3HCFA 3V8EA 5CVTA 1YB2A 4KFRA 4L4UA 4BE7B 1ZMBA 2RJNA 3VR1A 1PNTA 5CK5A 1RABA 1C9KA 4R68A 1CCWA 2YOFA 1P2SA 1QFJA 2YWBA 2A9VA 2ZTUA 3VR2D 1PJ3A 2IDKA 2FZVA 2R7AA 2H7YA 3BMXA 3T0GA 4EIWA 1QIMA 3I42A 1JH9A 4A03A 4PO1A 1ZR4A 4FQ8A 3TQTA 1N6PA 4GR5A 2BT4A 1L5SA 4O4JF 3EWAA 4V1CA 2ZBFA 4HAWA 5KC9A 4LY0A 4NCAA 3FYUC 2XDYA 4ZT3A 2FZGA 4ENSA 1KIAA 4LTDA 4NZNA 2O8CA 3C3AA 3HYCA 2JJ2D 4LGMA 1YB4A 5CM2Z 1GEGA 3MM4A 3ETEA 3PT9A 2NAFA 2JLAA 3HVJA 5CXQA 4Z7JA 4C03A 1W1WA 5AM3A 3UN1A 2RHJA 4M1EA 2CL0X 5H9WA 2O54A 4RKWA 1BN6A 3A2KA 1PLLA 1YZUA 4DUGA 2A5FA 4L4YA 2H5LA 3EXIB 4LXGA 1M2NA 2WF9A 4PLVA 1EVZA 1JDPA 4TUYA 2FEXA 2Z3VA 3GW8A 1K4MA 1UQTA 5BT8A 1QE0A 4ACBA 4QOGA 4FOOA 1QSGA 3U4QB 1V47A 4L0DA 1GUYA 1S2MA 3IDQA 4P7BA 2HWYA 4EA7A 2H8KA 2JL1A 2H8GA 3T1OA 3WGUA 1GHTA 1SQSA 5TEVA 4D9MA 5FP0A 1UJNA 2I8CA 3O26A 2JGMA 2VHJA 2RHCA 4YX9A 5ALMA 3W5HA 4HLCA 5L53A 5EZQA 3I05A 5ALQA 1W85A 4PHHA 1SCBA 3NV9A 3Q3JB 1M6EX 3HJGA 5FEMA 1HTBA 5AP9A 1PT5A 5KEIA 4TTVA 2ZUBA 4ZP1A 3HB4X 1J5PA 1FFCA 1L4NA 3WRXA 4MZXA 1H2AS 5TDHA 3P2IA 5T64A 3D6UA 2R87A 1OCEA 3BOSA 1YKSA 3JARB 1CTQA 3BTSA 3IALA 3TB6A 3T4PA 3V7YA 4DY4A 1J8DA 2NACA 3L05A 5BV1A 3VYWA 4Y1RB 1EHYA 1PNQA 1YBAA 3BF8A 1H42A 3RUHA 2C9MA 1A9RA 4FZJA 1GUDA 1OXXK 5FWYB 5GVRA 3I58A 2MCFA 2TMDA 1IAQA 1Z6ZA 2GO1A 5A06A 5LP6F 2IH2A 1MEEA 1H1LA 1N9GA 3NTUA 3K70C 1T6ZA 1GZUA 1K97A 1L5YA 5EG5A 1UPUA 4HAYA 3H1FA 4BFYA 3I6MA 5L4SA 1ZP6A 2KBFA 1UPTA 2VJQA 3PUVA 3V46A 5THXA 2E1PA 3EIXA 2HQSA 1TKBA 3ESXA 4IDNA 3BDIA 2ARKA 2X0RA 2QSUA 3PUIA 3HR8A 1VG9B 1OFTA 4YP9A 3V1LA 3P0JA 1DKRA 3A9TA 3PYMA 1NVXQ 1EX6A 1P7VA 4UHJA 5DNYB 3GJ4A 3MJHA 3P0EA 4DLSA 3LDUA 1QLHA 2VYVD 3WYEA 4DBVO 2D1YA 4XTCS 2XKKA 3E8XA 1RXYA 4GBED 4NCIA 3SSMA 1BMFA 2FA9A 2VQFB 3ESCA 1H8HD 1KMIY 1T6BY 2AOUA 1NGSA 4IXDA 3VPFA 1S7CA 1PX0A 2GJKA 3BGSA 3GJ7A 4ZGBA 4MA5A 3EC1A 4O1IA 3GGCA 3MZ0A 1CY2A 8ABPA 5KTNA 2X4GA 1ZM7A 1Q3KA 5FOSA 5I01A 2VP2A 4TYQA 2C7OA 1NC3A 1PZMA 2RC6A 5DCYA 1R6DA 4YB8A 1A1SA 3TQSA 4A4DA 4D41A 1BN7A 1MJHA 2BFAA 1JDZA 3HDTA 5TGTA 3V6LA 4ARVA 3GLFA 5BXYA 1RHQA 2VN8A 1DV1A 2GKSA 3H9QA 3WNCA 5KTSA 4MKZA 5K3CA 4LZOA 2JJ8A 3BTOA 4IQGA 1WPGA 4OM8A 1I3OA 2AN3A 3BWYA 1FSSA 4GMXA 1USVA 4LJAA 3O8CA 1KOJA 4TQAA 1U1CA 5GZ1A 1RAGA 2XOKA 4DB2A 4K6GA 1G8HA 1M66A 3IKLA 3ZTYA 5L3QA 4IQ0A 4IO0A 3E27A 5CT9A 4K86A 2NSYA 4NBTA 2K2QB 3UA3A 1QE3A 2XWPA 5EJEA 3HSSA 2WD8A 5FULA 1G8GA 1P60A 5EKDA 4ZVLA 2YC4C 3F97A 1J1ZA <