3MD3A

Crystal structure of the first two rrm domains of yeast poly(u) binding protein (pub1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
165
Chain Sequence
RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the First Two RRM Domains of Yeast Poly(U) Binding Protein (Pub1)
rcsb
molecule tags Rna binding protein
molecule keywords Nuclear and cytoplasmic polyadenylated RNA-binding protein P
total genus 33
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3md3A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3md3A01
1PGZA 3VAKA 1WG4A 4LIRA 2HGLA 1XN9A 3TO8A 2CPDA 3B4MA 2DGXA 1VQMS 2DB1A 2MQNA 2D9PA 1X5PA 5LJ3Y 1QM9A 4PR6A 3CCSS 2MKKA 3G4SS 1A9NB 2KI2A 1R8HA 5DM6Q 1FT8A 3G9CA 1FJEB 3UD4P 2CQDA 2MKHA 4YOEA 4V19X 2NLWA 2UP1A 5ITHA 3VAFA 2M88A 4WFNQ 2JWNA 3H2UB 1M1KT 2EK1A 1HL6A 4CH1A 1KOHA 2KYXA 3SXLA 3LQVA 2M4MA 1U1QA 3NS6A 1U1LA 2MXYA 2MQPA 2MJNA 3RW6A 2E44A 4Z2XA 2N3LA 1SXLA 4Y00A 2DNYA 1YITS 4W90B 2KXNB 1UAWA 1WEYA 3PIPQ 3BO3A 1W2BR 2J0QD 1X4HA 1WG5A 1VQ9S 2KXFA 1Q82T 5HO4A 2RUGA 5CA5A 1WF0A 1SJ3P 1YWXA 1VQ4S 2DNMA 2AYEA 1U1NA 1G2EA 1Q7YT 4F25A 3NMRA 3V4MA 3MD1A 3CCVS 5LJ5Y 5GAGU 3H2VE 5GMKa 2MGZA 2M7SA 4WIIA 5JVGQ 3G6ES 2AYGA 3UWTA 2RNEA 2QFJA 2VOPA 1HD0A 2DNKA 1FHTA 2J76E 3CTRA 2MB0B 1URNA 1VC0A 2N82B 2E5JA 2ZJQQ 3MDFA 2MKJA 3CULA 4YB1P 2E5HA 3ULHA 2DHSA 2DNGA 2KHCA 2Q79A 2OJ3A 2EVZA 2YTCA 3FEXB 2PE8A 1VQ7S 5DDRC 1SJ4P 3CPWR 3CC4S 2LA4A 1QVGR 2DGSA 4FXWA 2VODA 3MUMP 3U1LA 4QU6A 2F9JA 1HA1A 1YJNS 4QQBA 2DGWA 5FJ4A 2KRBA 3CC2S 2OIHA 2DNQA 1U1PA 3G8TA 2XSFA 2RQ4A 4PRFA 4WF9Q 4TU8A 4TLQA 1UW4A 1N8RT 1OO0B 5MLCV 2QEXS 2RS2A 3UCUP 1S72S 1OWXA 1ZZNA 1P1TA 1DHMA 1UP1A 3S8SA 4A8XA 3SDEA 2I2YA 2DH9A 2FY1A 3UE2A 3CCMS 2CQ0A 2DNNA 2DGOA 3P3DA 3U1MA 3CMAS 1N52B 4WKRA 2PEHA 1M90T 1S79A 2X1BA 1R8PA 4OZ1A 1WF1A 1VC5A 2DIUA 2L41A 4C4WA 5LXYA 3G96A 3SDEB 2HGNA 2QA4S 5CXTA 2DNRA 2MSSA 1WI8A 1U6FA 4M5DB 5IM0A 2MMYA 4PKDB 3J7ZT 3ZZYA 2KFYA 2LYVA 2M8DB 4QU7A 1WEXA 2MY7A 1VC6A 2E5GA 4TU9A 3IWNC 1VQPS 2MKCA 2CJKA 2LXUA 4UY8T 2MZRA 2RVJA 2DGQA 1X0FA 3CC7S 2CQ4A 3G71S 1H2VZ 2FC9A 4C0OC 2AD9A 3DXBA 2MQMA 4RU2A 2M52A 5LSLA 2K3KA 3CCES 1D8ZA 2YWKA 2HYIB 1RKJA 4QPTA 2CPFA 3CMES 2HGMA 2DHGA 2DNOA 2MY8A 5GADU 3N9UC 3THTA 2N3OA 3MUVP 2MZSA 2XS7A 1JMTA 2MKSA 3BS9A 2RS8A 2F9DA 4WFBQ 2MJUA 1YJ9S 3VAIA 3CCRS 4IOAQ 1P27B 2AYMA 4F26A 4C7QA 2MZQA 1YJWS 2YKAA 3K0JA 4J5OA 4U67Q 2DITA 3VAHA 4IUFA 1X5TA 2JVOA 3ZZZA 4OZ0A 2CQ1A 1JJ2R 3CCUS 2XNRA 2XS5A 1YTYA 1SJFA 3CD6S 2KN4A 1WHVA 3S6EA 1A7GE 3CCQS 2CQIA 3NNHA 3LPYA 1K9MT 1X4CA 2VOOA 2DNLA 2CQ2A 2J8AA 5D77A 3P6YC 2KM8B 3B4DA 3IRWP 5LSOA 1X5OA 2G1DA 2YH0A 2MZJA 1YIJS 1DBDA 1U1OA 1ZH5A 3CCLS 1WHYA 5GAEU 2LMIA 2MHNA 3I55S 4ERDA 2CQBA 5GAHU 5HL7Q 2M2BA 2KRRA 2DIVA 2SXLA 3OW2R 1NO8A 4ZKAA 2BOPA 2ADBA 4BS2A 3CCJS 5LXRA 2KXHA 3VF0B 2LQ5A 3EX7B 4W92B 2FC8A 2AYBA 2M8HA 2X1AA 2I38A 3JB9k 3EGZA 2L9WA 3L3CA 1JJHA 5D78A 4EGLA 1VBYA 1K73T 1FXLA 1KQSR 5DDPC 1CVJA 2DISA 4IO9Q 3NNCA 1U1MA 1PO6A 2LCWA 1F9FA 1DZ5A 2CPEA 3NS5A 2O3DA 5DDOC 2LXIA 2JVRA 1L3KA 2LKZA 2OTJS 3NNAA 4YUDA 2MPUA 2MSTA 2M9KA 5GVQA 1OIAA 1VBXA 1K8AT 1Q81T 2MGZB 1D9AA 1VQLS 2CQCA 3SMZA 3MURP 1N88A 1WHXA 1VQNS 2LA6A 1M5PC 3FEYB 3US5A 2DO0A 2KVIA 2CPHA 4LJMA 2BZ2A 1M5KC 1H6KX 2MQOA 3P49B 2MZTA 4WCEQ 1WWHA 3J7YU 4P6QA 1VQ6S 1QVFR 1M5OC 1X4FA 1KOOA 2HVZA 1FJ7A 2CPJA 3R27A 3UCGA 3D2WA 2KG0A 1U2FA 1WI6A 2D9OA 3G8SA 1KC8T 1WG1A 5IM0B 1SJQA 2DGTA 2RU3A 4F02A 3P5TL 2RT3A 3TP2A 3R1HA 2G4BA 2KG1A 1FO1A 1X4GA 1FNXH 5JVHQ 5DM7Q 2RRBA 3VALA 2U2FA 1U1KA 1VQ8S 2KH9A 3VAJA 1M5VC 2K8GA 4IOCQ 1X4DA 1YHQS 1WHWA 2U1AA 5IQQA 3MXHP 3TYTA 2DNHA 3UCZP 3MUTP 2X1FA 3R1LA 1U6BA 2DHXA 1NJIT 1DRZA 4LMZA 2CPZA 1WF2A 2N7CA 1H2TZ 1X4BA 5IFMA 2EK6A 2CPIA 2KU7A 4CQ1A 2CPXA 1VBZA 2DGUA 3S7RA 3BO4A 1X4EA 2DNPA 2LEBA 2D3OR 2CQPA 1H2UX 1WELA 3MOJB 5H1SV 1AUDA 2RRAA 2DHAA 2ADCA 4WFAQ 2HZCA 1N54B 2KT5A 1VQ5S 2LECA 3HHNB 5EN1A 2CQGA 2KM8C 3I56S 2ZJRQ 1WTBA 1JJ4A 3Q2TC 4CIOA 3CXCR 2LEAA 1BY9A 2MYFA 2XNQA 4TU7A 2DGVA 4FXVA 3CUNA 2OSRA 3RW7A 2G0CA 2GHPA 2E5IA 3UD3P 1Q86T 3EGNA 1ZZFA 3THPA 1U1RA 3BO2A 3S01A 4ED5A 2NZ4A 5DDQC 2JRSA 2CQHA 2DH8A 2OSQA 1B7FA 1HD1A 5CYJA 2MKIA 2YH1A 3MI7X 2ZJPQ 4CH0S 1X4AA 2WBRA 3PIOQ 1OPIA 2MQLA 2M0GB 2V94A 1UFWA 2A3JA 2J0SD 2DNZA 2CQ3A 3VAMA 1YI2S 1O0PA 2RQCA 1RK8A 2DH7A 2FPHX 2XB2D 2XS2A 5BJRA 1FJCA 2CPYA 2FHOB 3Q2SC 1NU4A 2M70A 2MQQA 1VQOS 5DETA 2ERRA 3DLLQ 2VONA 4UQTA 1X5SA 3VAGA 1VQKS 3CF5Q 1KD1T 2X1GA 2DO4A 2MZ1A 2OTLS 2DK2A 2L08A 1WEZA 1SJRA 2GO9A 3HI9A 4Y0FA 2JX2A 2F3JA 3MD3A 1IQTA 3BEGB 2B0GA
chains in the Genus database with same CATH superfamily
2HQDA 2HMIA 4KPCA 3TZWA 1AROP 3VAKA 1WG4A 4DV3F 2UUBJ 1EAYC 2K7JA 5ETRA 3TO8A 1AYEA 2UU9F 3B78A 4F4KA 2XY7A 2YY3A 1RT2A 1NDCA 3ELHA 3KJQB 3NS7B 4MFBB 2C3UA 1QE1B 1XQIA 1LXNA 2VG7A 1J5EF 2DGXA 3FRYA 4H4KC 1I94J 3R97A 2D9PA 1HWJA 1U0HB 1R8CA 5KFAA 4CRJA 1IKYB 2DCUB 5C25B 5LJ3Y 4KGVB 4LSZB 1RT7B 2KB2A 4DX7A 1TL5A 3O8WA 3CCSS 4DFJA 3QRQA 3BQ1A 4QZVB 2W4PA 4FYXB 4MTPA 5CD4A 4GVBA 2WCXA 4IG3B 4DX6A 3FRZA 3HHLB 4IKAA 1A9NB 2X3DA 1XJWB 4Y2CA 1HMVB 5AJ3J 1FJEB 1TL1A 2CQDA 2MKHA 2WHOA 3M32A 4ATNA 2NLWA 2UP1A 2QYCA 3D54A 2Q66A 4LR9A 4C11A 3BF4A 3KWMA 4DX8H 3M30A 3FK4A 1UL3A 3M6VA 1UMJA 1BE4A 3MTKA 4XDCA 4DS5A 2IVFB 3QLHB 3WC0A 1K47A 3C8YA 2VPYB 3BPDA 4I7FB 4B3OB 1QSYA 1AW0A 3UFCX 4FNHA 4MK7A 2RF2A 3IR7B 3O2IA 4J9OA 3FFIA 3PFEA 2HBZB 4M1KA 1Q95G 3DRRB 1GK8A 1YG0A 2HFNA 3JTPA 3NXZA 4M5JA 1YITS 1G7CB 5E3PA 2MLYA 2J7KA 1O6XA 3J80U 2XCAA 5HVGA 1V5VA 3ZTRA 1OPZA 4OYPA 5KG1A 2F40A 3DRPB 3RG6A 1WEYA 2YNFA 5HANA 3Q8QB 2GFFA 2WSEC 4P9SA 4YB7A 3ISZA 3MPYA 4NCGA 4YDXA 3C6UB 4NX9A 3PIPQ 1R0AB 1F6TA 1W2BR 2F8HA 3ZTQA 1Q82T 3ITHB 4HHUA 1PAEX 1TKZA 2OI2A 4YQWA 4GC6A 5DQGA 2VG5A 2RUGA 1S9GA 3HZEA 5CA5A 4C8KA 1GXTA 2VKZG 3T9ZA 2D1CA 1HW9A 2ZBCA 2F1FA 2J9DA 2AYEA 2VL1A 1PYTA 3BDPA 1RTIB 4OMFG 1KNZA 1Y00A 4C8YA 2QRRA 5KFFA 4R0JA 2UU9J 1BWVA 4QWCA 3DDKA 4EU0A 2FGOA 1LWEA 1LXJA 1HYSB 2XMTA 3CCVS 4DV0J 5GAGU 2DR8A 2W2MP 2WB4A 4OYIA 4TKTA 2GV1A 2B9YA 3SCLE 3I31A 2ZH1A 2RDIA 3H42A 3OR1A 1HQUA 4AL5A 5JVGQ 2BRKA 3G6ES 3ZTOA 4M5DA 2VOPA 2QFJA 4QWDA 2Y1JA 4ZP9A 3KK1B 3HD2A 3IMQJ 4EZ9A 2FVSA 2A2DA 4Y2MA 1YBAA 3UQSA 3AFGA 1TUVA 3CTRA 1N6QB 4RW6A 2MB0B 2DJWA 4JI3J 2ILZA 1HMVA 5F8MA 4WIQA 1URNA 1VC0A 5DS7A 3MR2A 4KHPF 4JYAF 2AU0A 3IS9A 1L3SA 1F2HA 1UWAA 2LP4A 1RBAA 3BSNA 2MKJA 1RE1B 4DR1F 4EBDA 1HQEB 3ULHA 5C7PA 3DXSX 4X66J 3CULA 3I5AA 3W8PA 2FDNA 2Q79A 1VLOA 1M1GA 1IR2A 2EVZA 2YTCA 1VQ7S 4R5PA 2ZITA 3N6LA 1Z2LA 1HLWA 4DPXA 5DDRC 1SJ4P 3CPWR 3EZ5A 2LA4A 2X3GA 3EICA 4ZVPB 5I3PA 2ZH6A 3OFEA 4NLTA 4J9PA 4YB5A 2QSWA 4LBPA 3EDRB 3EPIA 4FKXA 3TAPA 1D0EA 3GYGA 1QE1A 4YR2A 1PYSB 2K06A 3EUNA 4NMLA 1L3VA 5CABA 4FS2A 1DQ9A 5FJ4A 2KRBA 3JSRA 3CC2S 4P75A 2DNQA 1U1PA 2XSFA 2RQ4A 4WF9Q 3D6HB 3N28A 4RNNA 2OEJA 2ASJA 4RW8A 4YMEA 3C6UA 5B0BA 2VA2A 4K5SA 1IN0A 3BN4A 3FGVA 2DVIA 1S72S 1URRA 3K17A 3NLCA 1EP4A 1RCXB 2IIHA 2YQ0A 5ETTA 4FF1A 4OX7A 3GJTB 2I2YA 2HIQA 3H8YA 4ZS6A 5L1JA 2XMJA 3N79A 3UE2A 1J2VA 1REGX 2BQRA 4GKJF 2MLZA 4WKRA 3U1MA 2RDJA 1B7YB 1N52B 2W9BA 3HCXA 4QR1A 1QAIA 1PAUB 2NXUA 3GPAA 2BW7A 5HQ8A 5CYMB 2J9DE 2ASDA 4KFBB 2UUCF 4Y65A 5FIIA 2R7SA 1NHUA 3MM5B 2DR5A 4ED7A 1XR5A 2UXDJ 3U1NA 4DZDA 1NHVA 1HNXF 2DIUA 1O5JA 1RCOB 3PDNA 2EFVA 1NKBA 3G96A 2JOQA 1H38A 2F65A 3QATA 4C8OA 4K8RA 5B7WA 2QA4S 1A0OB 1JLGB 5CXTA 1Q53A 1HWKA 2QZ8A 3LUYA 4ES2A 2C28A 2MSSA 1S6OA 4F3OA 1MLAA 1Q7LB 5IV4A 3LWLA 3HVTA 1R0CB 2ZH8A 5LMUJ 4PKDB 2UVUA 1TKXA 2FD2A 1NSQA 1X9WA 2LYVA 1FDDA 2QLBB 3W9HA 4DSJA 4BWMA 1UA1A 1VC6A 4EZ6A 2RSQA 4UTGA 4EMDA 3CT9A 2VPWB 1H3DA 2DXFA 4TU9A 3OXLA 1AUSL 2HHTA 2CJKA 2LXUA 2RVJA 3GU0A 1UZHA 1S76D 3PW7A 4K5RA 2MLXA 2YNGA 3OQ2A 4G1QA 2H48B 2IAJB 1RUSA 1VISA 4YHHJ 2V63A 2ZHAA 2IM2A 1BUXA 2GCFA 2BM0A 2DRAA 1AFJA 1IKXB 2FC9A 1OYDA 4NZ7A 5L1LA 3D7SB 4X64J 5AE2A 1IBKJ 3EXCX 1OMSA 2W2QP 3IXQA 3DLGA 3VGVA 1WD6A 4YR3A 2J7WA 2YQ1A 2WB1D 3TJ8A 1VRUB 2XY5A 1WOSA 2K3KA 1BQNB 4IDKB 5KT4A 2GHWA 3Q0AA 3I4PA 2H4YB 2LVWA 1XNRJ 4B3MF 1DQ8A 4J9QA 5KFKA 3KMSA 3CMES 1S5ZA 3IGVA 2DHGA 3KLIB 1TVRB 4CO4A 5KT7A 1MROA 1LW0B 1DJ0A 4TXSA 2GJ2A 2KJVA 3N9UC 2MZSA 2XS7A 4LREA 2DD8S 4ECXA 1NB7A 4M5IA 2UVRA 4M95A 4JYAJ 3LH2S 2RU9A 2PIIA 1R8AA 3HHEA 2D69A 3MWBA 3P4UB 3ITHA 2NSCA 2FUG9 5KFVA 1ROFA 4CT8A 3Q8PB 1MW7A 2HNZA 2AEMA 3POTB 3QAUA 2E7VA 4KGKA 2HNYB 4RUCA 3WHIA 1LWEB 4MK9A 2YKAA 3K5OA 1SPBP 4IOBA 3SSSA 1YJWS 1HNWJ 1QJHA 2DITA 4F3QA 3W60A 2KTQA 2PGCA 4PXCA 1BMQB 4OZ0A 3V6DA 1T03A 1ZS6A 3GFXA 3OJSA 4LQ3A 4DV6J 5KFEA 1YSJA 5K8NA 2VJVA 4ZVRB 4WJBA 1IUJA 3DLHA 2V2VA 2YVSA 3HHKA 3CD6S 3LF0A 4DL2A 4DFPA 1EQMA 4WTOB 4ANEA 3F73A 2GHVC 1JKHB 4I7FA 1SH0A 3PRVA 2RB7A 8ATCB 1RGVA 3MM8B 4F0MA 4QR0A 4J9RA 1XIQA 1REVB 4B9NA 4R8UB 1YJ7A 1FKPA 1LWFA 1UFKA 1X4CA 2B4UA 3EMTA 2DNLA 2CQ2A 2J8AA 4B9MA 1B0PA 4WYLA 3H4DA 3IRWP 3VGUA 3PEJA 1X5OA 4FYDA 2IJNA 1N6QA 1NK4A 1YIJS 1U1OA 1ZH5A 3M32B 5BYSA 3CCLS 3RBDA 4LF5F 5GAEU 3RUBL 2AWZA 4HH1A 5C2CA 4LFBF 2MHNA 1EARA 2YBVA 4R5PB 1J5EJ 4GC7A 2R42A 4FP9A 3SZ2A 2IBKA 4ZCLA 2QSFA 2L9NA 2R2SA 3OT9A 3PKMA 2V50A 1FKOA 4DSFA 2FHJD 2DIVA 2SXLA 5B09A 3GIMA 2W9BB 3TARA 3AJ2A 2JZ5A 2BOPA 2FZCB 4ECUA 3GR1A 2CFXA 5LXRA 3FBCA 3FBEA 5CYQA 1Q8BA 2HQFA 2UUAJ 2NS1B 3H7HB 2P9GA 4PQAA 4EWTA 2W9CB 2R9LA 3QIPA 3I82A 4FXDA 2HRUA 4DV7J 2I38A 1R0BG 1SQEA 4O4RA 5A2QY 2HW3A 4Y6IA 1S59A 3QFWA 4K4ZA 3PRDA 2IBOA 5BYQA 1FXLA 1KQSR 2CZVC 3GSIA 2DISA 2JC1A 4ZCKA 1U48A 1QUPA 2AKWB 3NS5A 2G2YA 1NDPA 2CJAA 5U47A 1CEZA 2HURA 1LW2A 2O01C 4HI2A 4OZ3A 2GMLA 2IFXA 3UI3A 3HSZA 2JL9A 4TQRA 3GYXB 1FDAA 2EFGA 4U7UK 3DHXA 4CTAA 1L3KA 3OHAA 2W4DA 1LKZA 4YEAA 3KJVB 3ETMA 3OFGA 4YUDA 1PYOB 1LV5A 4MH8A 1T11A 2C3MA 2MSTA 2YWGA 5GVQA 4PYDA 3HFKA 4UQGA 1FVQA 2UZAA 1PC5A 4ECZA 1N32F 2ZHBA 1K8AT 3ENVA 3K5MA 2EKNA 3QYYA 2ZEJA 2IRXA 4ZDNA 3I6PA 3RR8A 4QOTA 2DPIA 4NLYA 3RRGA 4OLOA 4A8OA 3CD7A 3NBPA 5BXIA 2EG1A 2KVIA 2HWIA 5KFBA 4LJMA 2LLZA 4LBIA 3G6VA 1H6KX 5HP1B 4DWIA 2CJBA 5H9FK 3DM2B 4WCEQ 2IJRA 3M6UA 3KK1A 1QVFR 1M5OC 1T8EA 4OYMA 2HSEB 1QTNB 2R2RA 2HS3A 4CI0B 1SKWA 5KFWA 2AF6A 2F4VF 1LK7A 2B6AA 1RAAB 4C8MA 5A6PA 3KHRA 1UETA 4EK2A 1DAXA 2KG0A 3M8YA 4K0KF 1MSWD 1WC1A 4WXOA 1WG1A 4OI4A 5IM0B 1NSPA 3SEOA 3IM8A 4L72B 4OI3A 3BGRB 2PDAA 3PO4A 4B9LA 1FX4A 3DDIA 3BQ2A 2VBYA 1N4LA 3ZXWA 2B8QA 3G82A 2DY1A 1T9YA 4NRTA 2G4BA 2GMHA 2KG1A 2G2ZA 1QDUB 4HDGA 2I6WA 4PWUA 1FNXH 2UXCJ 1RB0A 4Y3CA 5KFQA 2R4FA 3SFGA 2XSJA 1U6ZA 3VALA 2U2FA 3BYRA 1RABB 1NZ8A 3ICLA 1S9GB 4B02A 4DF4A 1EB0A 1YRUA 3UN2A 2GQ2A 2OLWA 3PX6A 2CWKA 2Z2YB 2K8GA 4IQMA 1R6YA 1X4DA 3TRGA 5B0CA 4DCOB 2FJDB 5IQQA 3B8HA 3HHLD 4CM2A 1E6VA 2X1FA 3R1LA 1NXIA 3NCRA 2ZOFA 4K59A 1NJIT 4YN3B 3DDNA 2XY6A 2UV8G 1UJ4A 1H2TZ 1X4BA 1XERA 3MCSA 2Z2ZA 4DHVA 4C3KA 1JLEB 2CPIA 2EK6A 5HMXA 3MM7B 2HK2A 2FLPA 4DLEA 3QO9B 4WK1A 1F5BA 1FDBA 2DGUA 1T3NA 2LEBA 2IA0A 2D3OR 2CQPA 2JH3A 2MQ8A 4LF2A 5F9NA 3QLHA 1F60B 3K57A 1AUDA 2RRAA 1GMUA 1SI9A 4MYUA 4J9UE 3OUYA 2BE2B 2EBGA 1N54B 1FE0A 2AJ1A 4RWXA 2W9AA 2XYPB 4TN2A 2KM8C 3SYZA 1BGXT 3DN9A 2RUSA 4OJ3A 3I56S 4J9VA 3H40A 3JSYA 1SQGA 3IP0A 3D6MB 4X4SA 4ICLA 4PUOA 2HLUA 2HLTA 4FYVB 1N34J 2QIFA 1IBMJ 4G65A 5AE3A 2FHKA 3TUPA 5KFRA 2BJ8A 2HHQA 3MAHA 1AZSA 3J81U 4QWBA 4RZRA 5L38A 2HRYA 2D41A 2GS8A 1RXOB 3PHTA 3DCAA 1RTJA 3H5YA 3V4IA 2QV6A 3DOLB 3LP0A 4CLFA 4YY3F 1IWGA 1T94A 1U25A 1WC3A 2VG5B 1YJRA 2ZH4A 1YJTA 2HIYA 2VFRA 5L46A 2E1AA 4NXMF 5LOQA 1NJXA 3LAMA 4DL3A 1FF2A 1RAFB 3GONA 4NE9C 3T5JA 3QBCA 3QFHA 4DV4F 4B3SF 2ZJPQ 3DRXA 1WOOA 4RNFA 5KFMA 5HROA 4P74A 2WBRA 4E98A 3PIOQ 4RW9B 4AQYJ 4FPIA 4JOUA 4DUYJ 2OEKA 1CLFA 3KDOA 5DJBA 4DV0F 3L4BC 1S1WA 3O44A 1S0VA 5THWA 4JV5F 3NOGA 1JB0C 1WC6A 4RW8B 5E5NA 5D3GB 2HMIB 2CQ3A 1CJVB 2B8PA 3H59A 1O0PA 1YI2S 1RK8A 1TAUA 1RT5B 3FVYA 4F4ZA 4L74A 1NPKA 3PW5A 5BJRA 1AFIA 1FJCA 3TVYA 1RSCA 3ZZRA 2DR6A 3H4BA 3I0RB 1Z4UA 3EXYA 4CLWA 5DETA 3SV4A 3KLGA 3PX0A 3TUIC 4CLYA 3Q24A 3DLEB 4FN5A 3GYNA 4J91A 1VQKS 2H65B 4RWWA 1SB6A 1NPPA 1BQNA 2X1GA 4AUKA 4OHYA 2DO4A 1R6VA 5F8HA 5IT9U 2MZ1A 2UXDF 2DK2A 2L08A 3DI6A 1TL3B 2P6SA 3KLFB 5HLFB 1Q4RA 5DQHA 2I9SA 3U27A 1EX8A 2VASA 4JI7J 3HI9A 4JV2A 6FDRA 2BM1A 3DNCA 3PYEA 5EWFA 3MD3A 2F3JA 2F4VJ 4X4QA 3MM6A 3DU5A 4ZVQB 2DR7A 2BA9A 2XM3A 1T95A 3D1QA 4NI2A 1NLKL 1TELA 5A8WB 1KSPA 3EVWA 3TAMA 3I0SB 4FF3A 5HVHA 2MHEA 4OZ2A 4DOZA 3DMJB 1NAQA 2E5LF 4ZLJA 3ENAA 5A8RB 3BH6B 4HKQA 4QYZK 1BD6A 1X5PA 5B0DA 1OSDA 2LQ9A 1LFPA 3NOCA 4PR6A 3IN5A 5I3UA 2WW4A 2HHSA 4LIWA 2QYGA 1RYSA 2C42A 2YPZA 1NJWA 1E6YA 2MKKA 1JX4A 2HZVA 4NLXA 1WOPA 5T7LB 4DQQA 3R5BA 1R8HA 5DM6Q 4X4VA 5LM7E 3JSMB 4KPYA 2BJ3A 3AOCA 4O3SA 2CDRB 3M8WA 3MPDA 4YOEA 2CZ9A 3QIPB 3KTQA 4C3LA 2FYXA 3MEEB 3LTOA 5ITHA 2OD4A 2RQMA 2V8DA 3BM7A 3BSCA 5L9NA 4OX9J 3D68A 2JWNA 1M1KT 4J9SA 1GX5A 4PXBA 4HT5A 3VCDA 1I51B 3VHQA 4CLZA 3HSDA 3SBMA 1KOHA 5LSRA 4ED3A 5HN0A 3PX4A 1U1LA 1U1QA 4U7UD 2F63A 1WKJA 3FKBA 1RTJB 4EYHB 2BDPA 1YRXA 3RW6A 4DBQA 2E44A 1P9YA 2PO4A 3AODA 1H74A 3BREA 3OR2A 4USMA 1SXLA 5IV3A 4Y00A 3GZ7A 2DNYA 1LW0A 3GR0A 2NXJA 4M5HA 2VQEF 1HNZF 1K44A 2BMBA 3MEEA 3BDEA 3W9IA 2KXNB 2DEIA 4U8YA 3HP6A 3ZZUA 4NLGA 1C1BB 1D9FA 5F8LA 1IWAA 3H0PA 1PC4A 2YNHA 2BJ7A 3BO3A 1IVZA 4URGA 4DDFA 3JQJA 2VICA 1FTCA 1WG5A 3FMWA 2KXFA 3KLHB 3RBXA 1NJZA 2FVCA 1NK9A 2HHHJ 2BV3A 1KQFB 2BJ1A 2HHUA 1ACMB 5KT3A 5K8OA 1HHQA 2LFVA 3NWRA 3MFIA 2WTFA 1SH2A 1WF0A 2F8EX 3WDOA 1SJ3P 1Y11A 3V6JA 2P9CA 4K4YA 2XI2A 5ETSA 3ZNUA 1TKDA 5DRKA 2NZCA 1VRTB 4CDIA 5HQLA 1RWWB 2G2OA 4IRCA 2HRTA 4CTAB 5MAOA 2BE2A 2CDQA 4DSKA 2RE1A 3MMBA 5F0UA 1E6YB 1ZBTA 4F2RA 3H2VE 4Q0BB 3FBFA 1S6QB 2EXUA 5GMKa 4OX9F 3TNVA 5HQMA 4AXJA 1CJVA 1U26A 3AA9A 1RQ0A 4WIIA 4J9KA 3K2YA 4A8YA 1DURA 1S99A 4I56A 4NLDA 3J7Z5 2NXNA 3VQTA 4USVA 4DUZF 1SL2A 4E0DA 3F44A 4KT0C 5G0RB 3G2XA 4A46A 3OV7A 3FMBA 4O4GB 2J76E 1FJGF 4A8SA 2EBEA 4QWEA 4CNYA 3DLBA 1LK5A 3OD2A 4IG3A 4ZLNA 2V69A 5K14A 1VOMA 2VZ9A 3V81B 2FB0A 2KKHA 1HBNB 2E5JA 2WVBA 4I2QA 1S6QA 3MDFA 3MEDB 3NAHA 1IR0A 2DHSA 2JJ4D 3CCRS 2QL5B 3AH6A 4A8FA 2OJ3A 3FEXB 2PE8A 1S7IA 1APSA 1S1WB 2C2NA 1H7XA 3GV7B 5J1EA 2PSZA 2YWEA 2ZDOA 3I32A 3M2RA 1C1BA 3VZHA 3TQ1A 1YLXA 4OI1A 4K0KJ 3ADAC 2WVFA 1EZZB 4LVOP 4OX6A 3RAQA 1BHNA 4NZ6A 5KT6A 1X9MA 1TK0A 3M2VB 1V3SA 3BSOA 4OL8A 3AJ1A 2BUNA 3U1LA 1TFYA 1JXLA 4IFYA 3EDQB 4M5NA 1YJNS 2YPYA 1TTHB 2ACYA 3QWUA 1RWPB 3RYLA 4HTIA 4X64F 3QGPA 1IKWB 5FD1A 3G8TA 4NMXA 3P5BP 3FSIA 4B3RJ 3MMJA 1UW4A 4TLQA 3SQGB 1RTHB 4C98A 4C0BA 1OO0B 4RU9A 1N8RT 3QJJA 5D4LA 2RKIA 4URQU 4CLSA 3GQCA 3MPWA 4OYXA 5AXNA 4I6WA 2GQCA 3HKWA 3BGUA 4S0MA 3BKFA 2ILYA 3CJQA 1ZZNA 4LF4F 1DHMA 1Z2ZA 2WVDA 3CNQP 4PUOB 2PFFB 2C2KB 4ZVEA 1RT3B 5ETQA 2H5IB 2QL9B 2DH9A 2IC3B 2NYIA 1RHKB 3UPFA 3PKYA 2FHJA 3PW4A 2CQ0A 1WACA 2DNNA 3HHDA 3MTJA 3A8JA 3P3DA 3HSGA 4RBVA 2QE5A 2VFVA 3NCPA 3RGIA 1NK0A 2X1BA 1NUEA 1R8PA 1UEKA 4UZBA 2ZM6F 1RWNB 3W66A 4OZ1A 2XI3A 2OPPA 4ECVA 1TAQA 2WVEA 4DV4J 4B3SJ 1Y5IB 1WF1A 2ZKUA 2J8SA 5A8RA 3EM1A 2CA9A 2L41A 4C4WA 3EE3A 5KFDA 2GIRA 5CZXA 3SQOP 2IAJA 1BQXA 3TX0A 1SC3B 3A3NB 2J5AA 2AJ2A 4CP5A 1E6VB 1KQKA 3S1TA 1RT2B 1YJVA 4WYWA 1C1CB 1B99A 3LP1B 1SV5A 2VG6A 4CZCA 4M5DB 3ZZ0A 4P10A 4DL0C 1GMVA 4XO0A 2KFYA 1KTVA 5F41A 1FKAF 2M8DB 1N5QA 2WONA 3F41A 2MY7A 4HDHA 5CD4H 4GKJJ 3CB4A 2ASLA 3LP1A 2WSCC 1F3VA 1FWLA 2OPSA 3NP5A 3V2UC 4KH1B 4GKKJ 4LBHA 1FESA 3IWNC 1VQPS 1IKVB 1CBKA 2B9XA 2MKCA 2XMUA 2Y0SD 3WIUA 1XC9A 5IT4A 1IBKF 1RT4B 1EIYB 4JI5F 1RBLA 1MN7A 1V9OA 3W7BA 4WU2A 2CQ4A 5B0GA 2HAIA 2L9DA 4OYWA 1CPZA 1H2VZ 3SQGA 3ZC4A 4F7VA 3MMAA 1UPPA 1QSSA 2LQJA 2OHDA 3R7NB 1U45A 3CD5A 4P73A 3NKYA 4M5KA 2V6AA 4ZOSA 1U1KA 2R2UA 1TKXB 4O3PA 5M2PA 3D4JA 2V68A 3THVA 3VGSA 2R7QA 5B0EA 3KK3B 4UUXA 4CH7A 2XMAA 1D8ZA 2AX1A 2YWKA 2HYIB 2BW2A 3NGSA 3R2DJ 4QPTA 1LFWA 3BZQA 1RT4A 1YQHA 4N77A 4QIWD 3MCNA 1F9HA 2DNOA 4X4NA 1D9DA 5GADU 1N48A 1DLOA 1BC6A 2VV5A 3MPVA 3T41A 2MKSA 2F9DA 4A47A 3CDAA 4CNZA 1YJ9S 3VAIA 1JLBB 2W1BA 1GMWA 3D1HA 2UXBF 3A13A 2J0XA 4RNMA 5D3GA 2IM1A 2Z0GA 3EZOA 4AFFA 2B5JA 3W5ZA 2MZQA 4JI8J 2K3IA 3NRBA 5E2QA 4JUZA 3K0JA 2FQQB 2A10A 2AHOB 1Y10A 1WSRA 1X5TA 3GILA 4FKYA 3QQCD 5KG2A 3W63A 3RB4A 1FNMA 3SFUA 8RUCA 2E9RX 2CYYA 4UOGA 2ZUGA 1FD2A 4DR3J 1LW2B 2KT2A 2XNRA 2B51A 2XS5A 3W2VB 2XHCA 1YTYA 2PFDA 4JB8B 2HWHA 4DR4F 5EWGA 1S4FA 3HHLA 2KN4A 3PNIA 1WHVA 3PXGa 1N33F 1RAHB 4TLRA 1RAJA 2HAFA 3S6EA 1U8SA 2UVVA 3TVZA 2DYAA 2ZNZA 5HMZA 3MOZA 3TR5A 2VPXB 2XZDB 3DRPA 5EGYA 4KV8B 3M30B 2LECA 2UXBJ 2BKOA 4WBFA 5D77A 2ROEA 3B4DA 3C16A 3UNGC 3E8OA 4K2XA 2VJUA 5LSOA 1SL0A 1UW9A 3AOAA 2VA3A 4HI1A 4PQUB 2HVHA 1WC4A 2XMKA 2VF3A 6FD1A 4LSLA 3HVRA 4DR7J 2RHSB 4DUYF 3NWGA 2WK4A 1FRHA 3K5PA 3MECB 3I55S 3T1HJ 3PG9A 4ERDA 4F4WA 2CQBA 4P7VA 5GAHU 3ZZTA 1FEHA 5ETLA 3GJRB 2Z58B 1RU1A 3KG1A 3W64A 4B08A 3P8BB 3AOBA 4DF8A 1ITPA 2KXHA 1H72C 1U24A 2CNKB 3EX7B 2DRDA 2R8GA 1HYSA 4Y34A 2QA4G 3T6BA 6AT1B 2FC8A 2ZHOA 2R7OA 1RA7A 4HTJA 4MT1A 5F3TA 3ZFVA 2AYBA 2Y8WA 4NLVA 4F04B 3QGHA 1JXVA 2HK3A 2XZWA 2L48A 3OTEA 2QTWA 3JS9A 4ITSA 1IBMF 5KFJA 2IMWP 3WC2A 1NM2A 3CJKA 4LF7J 2H9ZA 3QT6A 5ETPA 4DFMA 3K59A 3UNYA 1C0UA 2XZTB 3LAKA 1Y3JA 2AGQA 3AAWB 1PO6A 4RW4A 3NNCA 4PWDA 2J9EA 1F0XA 2YXLA 2O3DA 5DDOC 2Y8YA 4LR8A 5L1IA 4F4XA 3CJKB 2HNDA 5J2PA 2JVRA 3M8PA 2PMZD 1RWXB 2GGPB 4ZP6A 4Z7CA 1J5OB 2BBEA 2AZ1A 3L7UA 4KYZA 1IM4A 1SC4B 4GVLA 3NNAA 3OR2B 4RLEA 2MPUA 4F4YA 4Y2KA 2DXDA 1OIAA 4KBIA 5J2PB 2HNYA 4CO3A 4DS4A 1NK8A 5AXLA 3H5SA 2CKWA 3E01B 2K2PA 4OHWA 5T7LA 2MGZB 1RHMB 1Q81T 1D9AA 3D66A 3R5DA 4I69A 2R8JA 1JNRB 3DRYA 3H90A 1N88A 3N6NA 4NLPA 2BE9B 4JI0J 4P52A 4DV5J 1NEEA 1KVJA 3US5A 3VVTA 2DO0A 1HQ2A 1KONA 4DN9A 2EPIA 1SV5B 2VG6B 3CVKA 1D1UA 4LF9J 4Q7AA 2QC3A 1M5KC 3M1VA 4CLPA 2ZDPA 1TZ0A 4JI8F 3RBZA 1T9XA 1WWHA 3J7YU 1R7IA 4N7TA 3GCWP 2C22A 3N4WA 3QMQA 3D9BA 4GMKA 2V5HG 1PBAA 3OL8A 3Q22A 1KOOA 5A76A 2HFZA 2MEWA 5HVFA 3L7PA 3GFZA 4A8KA 2AGOA 1HBOA 3R8YA 1LEOA 2APOA 5F8GA 1FWPA 1QAXA 4OV6A 3R27A 9RUBA 2O5DA 3GIJA 4LF4J 1GNKA 1U09A 2R7VA 2NQPA 1RKIA 2D9OA 1B0VA 5IWAF 3HX9A 2HHXA 5H9EJ 1CC8A 3JYTB 1SJQA 3HVTB 4H4KA 5IT9Y 2IRYA 1GH8A 2F8MA 2AJFE 2HFVA 2JSXA 3PCOB 1M5SA 2NPIA 5T41A 4EO8A 5IT0A 2E7XA 1FX2A 1HNWF 4LRCA 2Y1IA 5A8WA 4A8MP 1RT3A 2ASYA 4DFKA 1X4GA 2XULA 1SIZA 4JI5J 3A4TA 4C0HA 3UN3A 3BB5A 5AE1A 4NYOA 4V1Ak 2W7PA 5M2RA 2XMVA 2RDDA 5KG4A 2C3YA 4OHVA 4M5MA 5A8KB 7FD1A 5HSPA 2C2EA 2DCLA 1HNIB 2ZBQA 3CJRA 3GV8B 1VQ8S 4RNHA 1JLCA 4DL4A 4O23A 3ENQA 3IWLA 3HJFA 4ELUA 2YX7A 1P6TA 3TWZA 1RI7A 4N8NA 4ZJQA 4H54A 3AB4B 1WHWA 4LUBA 1SKRA 1EETA 1ZOTA 4AE5A 1BQMA 4RUHA 3TYTA 1ZETA 1XNQF 1RT6B 2DNHA 3UCZP 2FJBB 1DLOB 3W5XA 2G9OA 1HPZB 2J9CA 1DRZA 1MG7A 2HS4A 1TV6B 5IWAJ 4DV1F 4NASA 3G6XA 2JLFA 3R5JB 2HNDB 2KU7A 2PMHA 4MYTA 9ATCB 3M2RB 1V5IB 4ED6A 2Z57B 2XLJA 1VQMS 3BO4A 3MM5A 5AXKA 2R7XA 1X4EA 3F0NA 2YKPA 2V2QA 3C15A 3GIRA 3L09A 5HBMB 2I8EA 4WP3A 2AIRB 3DHWC 1EJ7L 4K2JA 5IXUA 5KAKA 5H1SV 3QJPA 3ET6B 4QYZJ 2FVRA 2HVDA 4CCHA 1O51A 4FF4A 1ZA2B 1H98A 1JLGA 4G1PA 5HROB 2R7WA 4I2PB 5DLGA 5DG7A 3Q2TC 1YGYA 2LEAA 1BY9A 2ATCB 2MYFA 3JTOA 3M8PB 1V6HA 2DBBA 4PAAA 4Y2IA 1RHRB 3DLKA 1LWCA 1S9EA 5C24B 1R31A 2A0FB 1DTTA 4FXVA 3EGVA 4I64A 4JI4F 2V8HA 2G0CA 4DR6J 3AXKA 1P8GA 4IFVA 4ALZA 4G3IA 1N33J 1ZM9A 1ZZFA 4C8NA 1K0VA 2YX1A 2DHHA 1TKTB 2IVMA 3VV2B 5F3ZA 4ZVGA 3DOKA 1V3RA 5IC6B 2NZ4A 3MAAA 4WP8A 1B64A 2GMJA 3KNGA 1W26A 4NLWA 3T5HA 1UWBB 5M2UA 2DR9A 2NREA 3KLEB 1ZYQA 2YQ3A 3M2VA 3UW1A 4WFXA 5CYJA 4HACB 2BXJA 1WJ9A 3QPIA 3KFWX 5F9LA 4OI0A 1GXLA 1YBUA 3BH7B 3KKFA 1TL1B 3I9V9 4ANDA 4NA2A 4B9SA 3JSMA 5ETVA 2JEGA 5KOWA 2QFIA 2J0SD 2E1RA 4P2FA 2HNZB 3ONQA 4L75A 1JLFB 4K50A 3CJSA 3MHYA 4I1TA 5K8PA 4O3OA 4IQXA 1X0PA 1OY6A 3WQPA 4O0IA 3JTNA 1NPRA 2RJZA 4D3GA 4F2SA 1RDRA 2LEPA 4TYAA 5KFIA 4LF8F 1KVIA 3LWMA 1ZPVA 4L3NA 5AT1B 3IG1A 3FCVA 2CPYA 2FY8A 1NDKA 2HQCA 3LANA 2M70A 3I0SA 4IYQA 1TUWA 4RW6B 2ERRA 7FDRA 3MM9B 3T5KA 3PZPA 4CLLA 3DRSA 1X5SA 3VTIA 2R7RA 4B9TA 3DKDA 2ZH9A 1KD1T 4NXMJ 2ZZNA 2PI4A 2L3MA 4ES1A 4X4TA 1YVFA 4EI2A 3D0GE 1NKCA 3O1LA 2OUGA 2H3EB 4B3TJ 2N7YA 4P2XA 5C5JA 3RRKA 1F1BB 1GMWD 4R8UA 1VFJA 1CJKA 1VYAA 2JX2A 4Y0FA 2ZH2A 3BEGB 3QIDA 1B3TA 1C0UB 1PGZA 4DSLA 2H51B 1SC6A 1N0VC 4LIRA 4JV0A 2HGLA 4X4OA 1HNVB 2ZH7A 1XN9A 4UF4A 1T9VA 1Q5VA 1JWWA 2V4JB 1VK3A 4ETXA 3DLKB 3ZZOA 3HVAA 5HJXA 3M7VA 1GTEA 3TX8A 1ULRA 3RB3A 3I0RA 3CCTA 3T19A 3QNWB 4DSIA 4NL5A 3OVBA 4QW9A 1SUQA 1NCLA 3PFOA 2DB1A 4MIAA 5F0WA 3QT7A 4C3MA 1RTDA 3MZIA 2V4JA 1XMQJ 4OYAA 5D4OA 2M5YA 1HBUA 2K1RA 3PRBA 1QM9A 1REVA 3DGPA 2ZVIA 2HHVA 4X65F 4DR2J 3C14A 4AL6A 4DUTA 2BJ9A 1IKWA 5D0GA 2HWTA 2KVQE 5KFNA 2B4VA 3C15B 1PJ6A 1VGYA 2V67A 3TJAA 2E1CA 3QT8A 4XIUA 2GVDB 3V81A 1N5TA 1FRIA 1ELOA 1ICEB 3BGLA 3LP2A 4LRFA 3KUHA 4U6PA 3UD4P 2CVIA 2FTRA 1CS4B 4NCBA 3M1VB 4EEYA 3VAFA 3QT5A 4I2PA 5L39A 4P72A 2WW8A 1TUGB 1GQEA 2BRLA 4WFNQ 5I42A 1W25A 2H4WB 2EK1A 3QZ8A 2BANA 1CQMA 1XR6A 2CWXA 1HL6A 2H1YA 3UDLA 5J1EB 2DT9A 4CH1A 1KHWA 1HBMB 2KYXA 3SXLA 2ZM6J 1R8BA 2M4MA 1JLQB 3C46A 1R89A 3NS6A 3FZ2A 2MXYA 3DLGB 2MJNA 4KQZA 3SCJE 3W62A 5JXSA 4UUWA 4NLUA 2EFPA 3EWGA 4IFYB 1MMDA 1PJ5A 3ISNC 3CJ8A 4Z2XA 4ZN1A 4ECQA 4ID5A 4OJ1A 2Y3YA 4O3RA 3PTWA 4ICLB 2XO6A 2ZZMA 2IDLA 4KB7A 5KG5A 1MU2A 1QY7A 4ED2A 3G8QA 4ZVSB 1NHKL 4KV8A 4KR0B 5GAEI 2RIJA 1EETB 4O3QA 1YX2A 2HVEA 4IDKA 4BHQA 2WRMA 3PR5B 5CAAA 2GC8A 2B5JB 2J0QD 2EFOA 3CD0A 1VQ9S 1OJ4A 2OD6A 1RT1B 4BWJA 3A1YG 3OXGA 2FVQA 4ZMMA 4X62J 2HKEA 2V8VA 3I5CA 4NXNJ 4W98A 1KR4A 3HFVA 3QWPA 5D8HB 1K1SA 1S1TB 2LQ8A 2P8IA 3DMJA 5J2NA 3GMGA 3TA2A 3DI6B 3HK2A 2AX0A 2DNMA 2YWFA 4ZIVA 1VQ4S 2B7CB 1U1NA 3MCOA 3P45B 1WDTA 3HT0A 1G2EA 1T9TA 4ANCA 3OXFA 5DLFA 3PR4A 3OJUA 4DL5A 3NMRA 2ZC3A 2MDAA 3GJQB 3V4MA 5J2MB 1I6JA 4K4WA 4GO5X 5LJ5Y 4DN0A 3QGGA 5E3AA 4ZVHA 4PCQA 4DV7F 3HFZB 2D3ZA 2HFSA 1IBCB 1IBLJ 2D74B 5C25A 2MGZA 3NMAA 2M7SA 2AYGA 4F8RA 2YKNA 3W61A 4PEOA 2RNEA 5F8IA 1X9SA 3R9LA 4IH5A 1PG5B 4G6VB 4M8LA 4DQSA 4NXNF 4WE1A 1Y4ZB 3DLEA 3K5LA 4PPDA 4DSEA 2CVEA 2G13A 2IHR1 5DG8A 2XGQA 2GVDA 3FNNA 3HDSA 3GLJA 1KFSA 2KDOA 3WX8A 1DFDA 1N32J 4LFBJ 2NUHA 3L7OA 2ZJQQ 4RW7B 5HAOA 3ENWA 3M8QB 4KO0A 4YB1P 1HHSA 1ZM3A 5HI7A 3IBWA 3TAQA 2KHCA 2J0WA 3C66A 1KEKA 1ZPWX 2CZ4A 2Y9HA 3V4IB 2EEYA 1S1UA 3D5MA 3RB6A 1K1QA 3PJ9A 1M90T 5D0RA 1Q8IA 2GAGC 5ETKA 4ZCIA 2ATLA 3MM7A 1TVRA 1O8BA 2ZD1A 3UR3C 2FIUA 4LVNP 4ZA1A 3CC4S 4JV5J 8AT1B 2DGSA 1EKRA 5HMWA 4FXWA 3IM9A 4YS2A 2VODA 2W01A 2AJ4A 1T02A 2V34A 2VU5A 3OTOJ 3MUMP 4N8OA 3WBZA 4LF9F 2JNJA 4QU6A 1S1VB 2F9JA 1HA1A 2VKRA 3PYDA 4I68A 3HJVA 4QQBA 3OUYB 2GA7A 3AD7C 1XEZA 1IJEB 3M8QA 1HR0J 4ZPBA 3RR7A 1Y5NB 5L8RC 1N36F 4TU8A 3MMCB 1JK9B 3GFHA 2VFSA 2XMMA 4LFAF 2ZVSA 1G4CA 5MLCV 1NKEA 2QEXS 2Q1LA 5CQGA 4PXDA 5D6GA 2POKA 1RBOB 3FCHA 2RS2A 3UCUP 1GXUA 1H0HB 1RISA 1OWXA 3Q8VA 1D09B 1M0SA 3E51A 3BQ0A 2C3OA 1UP1A 4OYZA 3S8SA 3SDEA 1KFDA 2E1MC 5D0EA 3HO1A 1NBEB 2ALYB 2QA1A 3ZTSA 1SBRA 1VLYA 1CS4A 2I5JA 4Q5VA 2FY1A 1GAOA 4ZJOA 4V19J 1N5VA 3O3LA 2DGOA 2KO1A 3CMAS 2Q6BA 2PEHA 1HQUB 3KG4A 5CZVA 3MMCA 2NPFA 2VFTA 1WC0A 4CWBA 3T3FA 4A4JA 1JLQA 3N0VA 1KTQA 3AQPA 1HNIA 1QLNA 4ID8A 1GT8A 3H5XA 4DXLA 4LF1A 5C42B 3MEGA 1HIYA 2C3PA 3A3PB 7AT1B 3X1LB 1NSAA 4ZVOB 3BR8A 2IY5B 1XBWA 3SDEB 3KOAA 2QMXA 4PG4A 1NK6A 1YRTA 4L73A 4BLGA 2HGNA 4ID5B 1TMJA 3TI0A 4HT7A 4UOCA 4LF6F 2DNRA 1FK9B 1U6FA 1F5CA 2HS0A 3ILIA 3JYTA 4QR2A 2MMYA 2IPOB 4JI2F 4XPCA 4DV1J 4TY9A 5CHCB 3ZZYA 4KRWA 1FD8A 4QU7A 3HPOA 5IC4B 3OL6A 4DV2J 2Y1LB 2G1HA 2E5GA 3W1YC 1TKZB 1Q8KA 2YNIB 5DQIA 1IXKA 3GE9A 5K14B 2CXEA 2JC0A 4NLQA 1FXDA 1F5AA 2V9WA 2AZ3A 4UY8T 2QT7A 2MZRA 3KG0A 3EJMA 2DGQA 2UXCF 4WE1B 1B70B 5JMNA 1X0FA 3CC7S 2RAQA 2AT1B 4ILRA 3CDEA 3G71S 1PIEA 2W9CA 2CJXB 3IAM9 1JLAB 5D15A 1H7WA 2EWHA 3D3CJ 2MQMA 1Q8LA 2ZOMA 3CJ4A 4MIBA 1SKUB 1QAYA 2CJ9A 1AT1B 5KG6A 4MAKA 4PXEA 4RU2A 4JI1F 2GW8A 4CYUA 4NEYA 2KHDA 3PJWA 5LSLA 4N5SA 2DRBA 3OLAA 4QIVA 2GZOA 4WZMA 2E9TA 4NRUA 3QZ7A 4P2MA 4O4GA 4G1IA 1VIXA 4DQIA 2HGMA 2OGUA 3Q8UA 1SCJB 4JI6F 4HACA 2KYZA 4KHRA 5KFHA 1S1TA 3THTA 2FJAB 3MUVP 2IM0A 4F67A 2KT3A 1JMTA 3BS9A 3FSXA 4F36A 1UFLA 1C0TA 2RS8A 3C14B 3R6LB 4ZVUB 2VFUA 5L1KA 4ECYA 1NK5A 5F8NA 1P27B 1RT1A 1Y3KA 4F26A 1JLFA 3HM9A 1TL7B 1U02A 2GIQA 4ZHRB 4U95A 4OJHA 3TEHB 2KL8A 5LMNF 4RNOA 1C1CA 4U67Q 3BN7A 1VK8A 3G9CA 1DTTB 2X7IA 3DOMA 4LR7A 2HFUA 1N5YA 4IUFA 2AJQA 5F8JA 2JVOA 3OL9A 3FC9A 4B17A 4ZK7M 2V8GA 3KLGB 3OVSA 2PI5A 4U9RA 2XCPA 1JJ2R 2R7UA 3CEDA 3ETOA 5B08A 5ETNA 4DL6A 2CAJA 4Z37A 1XWLA 2C1EB 2BJDA 5KG0A 5H9FJ 4HHHA 3CIMA 2C2DA 2IYIA 3M8RA 3HF5A 1TK5A 2E29A 1RAOA 1AA1B 2CG8A 2CQIA 3NNHA 3LPYA 2UV8A 2EC2A 1K9MT 3KK2B 4J7CA 2Q3PA 2YKMA 2QLFB 2VOOA 4NYPA 4MK8A 1N56A 3P6YC 3M9NB 4GKKF 1RP5A 1MU2B 3V6HA 1UEUA 1IR1A 2RRNA 1J27A 3FUYA 1Z1ZA 5CH7B 3TVKA 5KG7A 3CDUA 2YH0A 4OI6A 2ZKTA 4OZ5A 3V6DB 1T03B 2XEXA 4F0HA 1RAEB 3LP2B 1WHYA 2HHPA 4MFBA 4DU8A 1X31C 2XWYA 2XG8A 3AJDA 1AB8A 3D6TB 4PG5A 3KK3A 4C48A 3J7AN 4BDPA 2QX0A 3GIIA 5FDLB 3MM8A 2B43A 2M2BA 2X51A 3D67A 4Z7YA 5HBMA 2IJFA 5DGBA 3OW2R 2BQUA 2W7AA 2JEJA 4MIWA 1HBUB 1SC1B 2K1RB 3DGPB 4RUBA 4ZN3A 1NB2A 3MCMA 4QJVA 4RJVA 3MR3A 2ADBA 3CCJS 2HBQB 4BS2A 2LQ5A 4JI7F 1HHTP 3R6GB 1RTIA 2BABA 3TQEA 1MROB 2Y1RI 1F2GA 3ILJA 2NSBA 4IH6A 2M8HA 1MMNA 2CUYA 4Q8EA 4QIGA 3A8EA 2ALZA 1RT6A 1YZ6A 3JB9k 1T05B 2L9WA 2YKOA 1VBYA 4EGLA 1K73T 1DTQB 3TZZA 2B7BB 3CJ2A 5GAGI 2R8KA 3V5RA 1OY9A 4IO9Q 3FDSA 4JBCA 3IR5B 2W8KA 2LCWA 4NCGB 4R0EA 4USHA 2CPEA 2B56A 3CDWA 2RU3A 1T05A 1DZ5A 1CULB 3K89A 2FVPA 5A8KA 3UDCA 5A0YB 2LXIA 2VBWA 3KLFA 1JLEA 2FJXA 4JI3F 4LFCJ 2DY9A 2H5EA 1ZAXA 2A2CA 2GVZB 4FZVA 4ECRA 4HH0A 1FFGB 2FJWA 4ZLLA 4AXIA 1FA0A 5KT2A 4ED8A 2HHWA 3W8GA 1B0TA 1UVJA 2W2OP 4ILLA 3C6TA 4C2MA 1U7LA 3Q89A 3NBPB 4GVBB 1SJ1A 4LRBA 3MEGB 4USTA 5RUBA 4UW2A 2VC0A 4ED1A 2CJQA 2BR0A 1VJQA 1HQEA 2CQCA 4IH7A 1QTMA 4URSA 4JI1J 2ABYA 3SMZA 4X2BA 2IRUA 4Q43A 4QCLA 4X65J 2VB6A 1EKSA 2WVCA 1OQ6A 2Z2MA 3BGOP 1M5PC 1HNXJ 1VQNS 3OTOF 1KLMB 4C11B 1IJFB 2BZ2A 3B6BA 2J6UA 4LSNB 1LOUA 2BANB 1M1HA 5KFSA 2MZTA 4NA1A 4B9UA 1MWYA 2EKYA 3KJVA 4K4SA 3JQKA 3MM9A 2OMOA 4P6QA 4LT6A 1VR6A 3KK2A 3AT1B 4BC9A 1VQ6S 1KLMA 1CC7A 3KLEA 4KKOA 2DPJA 4B3TF 3GP9A 5HJYA 1KKHA 5D4NA 3TOQA 2IA6A 4EBCA 1FJ7A 3F56A 2XO7A 5ETMA 2JHEA 4WWSA 1WI6A 2CNNB 2VH7A 1C2PA 2ZBRA 3DOLA 3D2WA 5JUMA 4Y28C 2F4FA 2DGTA 2IDEA 3IWXA 4I6YA 4M63A 4USIA 5C2GA 2QGFB 5I3QA 2BEFA 3HMJG 5CCLA 2ZE2A 2B3TB 2P9EA 2RT3A 3P5TL 4PG7A 2N4DA 3TP2A 4DX5A 4YHHF 2Y0BB 3R1HA 3MR5A 1EQ0A 2QLJB 1UA0A 5KFYA 5JVHQ 4WK3A 4Y2AA 3BGRA 2LDIA 3HD1A 5CYQB 3MR6A 1UWBA 1T3OA 3LW5C 1FI4A 3SIPB 2ZE2B 4J90A 2KH9A 3W65A 3ET6A 5KTQA 5CYMA 4KFBA 1VHFA 4XTTA 2W7OA 4QPXA 1BXNA 4DCPB 2FZGB 4K4TA 1WDDA 2U1AA 4XAKA 2J6TA 1SH3A 2WOMB 3B82A 4DR1J 4LMZA 2UUWA 1W7WA 2H5JB 5CCMA 2WBMA 1L3UA 4NCAA 3Q8SB 1S6UA 2C2MB 3CJ3A 2NYHA 2VD3A 1EP4B 4CQ1A 4RR5A 3RJMB 4FVMA 1YZ7A 3TUZC 4ZVTB 1VBZA 1JXEA 3Q23A 3NGRA 2P5VA 1Q16B 2G0IA 4USWA 1XTZA 2DNPA 3D3BJ 1H2UX 2B4PA 1VDHA 3MOJB 1FERA 1HARA 2A6MA 1YKWA 3QSYB 3GFYA 2DHAA 1JLCB 1KRPA 4XPEA 4WFAQ 1S7HA 2KT5A 5AXMA 1MMLA 5FLXU 1HR0F 1VQ5S 1VS3A 2CQGA 3HLUA 3TEGA 3MMBB 1QAJA 4KSEB 2ZJRQ 4K7QA 4DPYA 1WTBA 5E41A 2JFKA 1FVSA 4K4XA 3QGIA 2W25A 2ZBPA 2XNQA 4TU7A 1HPZA 3BKTA 2F5GA 4RUAA 3FBBA 3NEKA 4NYZA 2ZOGA 2DGVA 3OSNA 2OSRA 1PSDA 2GHPA 3E2EA 3KHGA 3UD3P 1Q86T 4FS1A 2QJ3A 2Z4PA 4C6AA 1FK9A 2XGPA 3CIZA 4ED5A 1FXRA 3OSPA 1ZTWA 1IKYA 2H54B 5GMDA 2ZBIA 3UO0A 3L95X 4K4UA 2LU1A 2GNKA 2DH8A 3M05A 1HD1A 3RBEA 2MKIA 4MMOA 4FBUA 3NG8A 3KLIA 1Q78A 3FQLA 5A6WA 4DR2F 1X4AA 3RRHA 5C42A 2MQLA 3DM2A 3TJ9A 2M0GB 2F7VA 2V94A 4RX6A 3JAMY 4MJKA 1YK9A 1UFWA 4IR1A 2A3JA 4LRAA 4UOFA 3VQSA 4MKVA 1UCNA 4NZ0A 4R25A 1XMOJ 3IC1A 3VAMA 3M6WA 4DR5J 4ILMA 2DH7A 4H4MB 1AXQA 1QD1A 3R5GA 1CQNA 2XS2A 1IKXA 1PJ7A 3EVOA 1JLAA 4ZJLA 4O44B 1ZAVA 1R0AA 3SCKE 3R2CJ 1B4SA 5KFOA 3Q2SC 1Y9OA 1CJUB 5KG3A 1NU4A 3FQKA 2FLOA 2FZKB 2YNHB 4KC5A 2K7KA 1VQOS 2CNOB 4CT9A 2YWWA 2HQGA 4OZNA 1RWKB 3CF5Q 2W2NP 4ECTA 1NK7A 2RKIB 4E2FB 2D3UA 2XYGB 3O6QA 1WEZA 2E66A 3GSDA 5HK4A 3ILOA 1C4CA 2GO9A 4MKAA 3TUJC 3KMQA 1JKHA 4NLOA 4TY8A 2IVYA 2OPQB 1IQTA 4RW7A 1JIHA 2B0GA 4X62F 1S0OA 4DEZA 3RAMA 3CJ5A 1UZDA 1RAGB 1UPMB 2ZZTA 3FCWA 5B0FA 2ZD1B 2QG9B 2GVZA 2CPDA 3B4MA 1PBUA 3BSAA 1NNDA 3HVWA 4DPOA 2NXCA 3NGTA 3TZYA 3OHBA 4PRFA 3BR9A 4YDDB 5GADI 2MQNA 1S97A 1N5YB 3GWCA 4USUA 2AP6A 1RHJB 1OQ3A 5EHHA 2JEIA 4JI0F 3FJ2A 1L5UA 1U49A 1VHIA 2RH3A 4P71A 4JI6J 2RQKA 4ELTA 4HLBA 2M3DA 2BQ3A 2IM3A 1OYEA 3MM6B 2GJIA 1VQSA 5SUHA 1MWZA 4ZPTR 3VGTA 3B54A 4U7CA 5BR8F 1CJKB 3G4SS 1UJ6A 1HW8A 2KI2A 2OH2A 1C0TB 1FT8A 1ZM4A 2WSFC 4NLRA 2AJ0A 3JAMU 3R5AA 2YNGB 3AXMA 4G1QB 4KKOB 5E3QA 5EX0A 3W2WB 3T9NA 4LSLB 4AD6A 4V19X 2IC3A 2OPRB 1PKUA 1KQGB 2YX4A 3IFEA 2PD1A 2ZC4A 1FRKA 1Y5LB 3DYAA 3M6XA 1ZAWA 2M88A 3G86A 3MF5A 2YKNB 2ROPA 3H2UB 3DOMB 2LQBA 2GAHC 2QN6B 3W2WA 5BR8J 2R8IA 3KLVA 5J1NA 4H4MA 1FWKA 1S6PA 3C2PA 3NGUA 2EW9A 1TU0B 3LQVA 3N01A 1UVKA 1RTHA 4KGXB 4MKBA 2MQPA 2LU2A 2HBRB 3MGJA 1VCTA 1KP6A 1WSVA 1RT7A 3I5BA 2FGCA 4F50A 2KFNA 1HBOB 3K8VA 3Q86A 4WTYA 2QA2A 3IS9B 1R43A 2BOAA 2N3LA 4M5GA 1A6LA 4TYBA 4U96A 2QLXA 3VWSA 4RO0A 4ZVFA 5E3CA 5IOLA 1MN9A 1QSLA 5A2QU 1UAWA 1RWMB 4IG0A 3C16B 4HR2A 2FJVA 2A1BA 1F3FA 4L6V3 1UKUA 1RLCL 3PACA 3G87A 3H98A 4JI2J 2XTJP 4CLUA 4KTQA 3D0HE 3AY0A 3D1OA 2Z30B 4KHMA 1X4HA 2QO3A 4OFZA 1DQAA 4OX8A 5L9XA 1FRJA 1F9EB 1HWUA 2HFOA 3NAIA 5GAHI 5HO4A 3PVXA 4E8UA 1HI0P 3DOKB 4DR7F 4LQ9A 4FDFA 1EHWA 1N5SA 3I9ZA 4L3KA 1S1VA 1UJ5A 2DEJA 1S10A 1S0MA 3PYFA 2VC1A 1RTDB 4FVCA 3H5UA 4ECWA 1YWXA 4O3NA 4ZIWA 2LDYA 4KGMA 5DZ7A 4EFAC 4WFYA 1Q7YT 5BYRA 2W4CA 3DGVA 4BCAA 1RHUB 2N4CA 2PA8D 3ZNJ1 4F4AA 2ZUAA 1U2RA 4F25A 3HKZD 3JSBA 4ENOA 2A18A 2C2RA 3UDEA 2OPPB 1HNVA 3MD1A 4X66F 2VDIA 5E0OA 2V4QA 4DR4J 1V3ZA 4I67A 3ZO7A 3IRXB 4WP9A 1S1XA 2XQCA 3IAS9 1TMMA 2XHWA 1Q0NA 1RWVB 4J9MA 1U47A 1M5HA 2VHGA 5K5MA 4P2SA 2CIMA 3UWTA 1AZSB 3HSJA 4L76A 1HD0A 3IO1A 2DNKA 1LWXA 2JLGA 3FEZA 2E5LJ 3QJLA 1FHTA 1UTAA 4DU7A 3DRSB 4FNIA 4FYWB 2V4RA 1J5OA 4EYIB 4A8WA 4HL9A 3TA0A 2UUCJ 1KS2A 1N36J 4LSNA 3QSIA 3GG1A 4LF5J 3UVJA 3A8KA 1VRQC 3R7SB 5LT5A 4CO0A 4LFCF 2AEJA 2CJYB 2OPSB 3FFIB 2CRLA 3AHPA 5D0HA 3HHLC 2N82B 2VQEJ 2VPZB 1KVKA 4Q8FA 4WZQA 2J6SA 3J7A1 1CG2A 4CLTA 3MR7A 1NJYA 2E5HA 1HI8A 2DNGA 2RILA 4X4RA 2GO8A 1S6PB 2EFNA 1KHVA 3K7RA 4KAIA 1T9WA 2P6TA 2RHQB 1C4AA 4ZPVR 3X3UA 2OP5A 4DJBA 4DR6F 3OPKA 3L9ZA 2A6OA 3PEHA 2VBXA 1QUVA 2I5JB 2EG2A 3J7YI 1QVGR 4NI2B 4DR3F 3V6KA 5IQ6A 3NCQA 2OPRA 5G4DA 3SCIE 1CSJA 3GJSB 1JQGA 4ZLPA 1N0UA 3G82B 2QL7B 3PY8A 4B9VA 4DV6F 3W3SA 1S9FA 2RF2B 1ZTTA 2EI5A 4DCJB 2DGWA 3BBCA 1L3TA 2XMWA 3MEDA 4UOHA 2OIHA 2EFQA 3JQMA 3OLBA 1GTHA 3KUGA 3CJTA 3I87A 1RACB 4ETZA 3AA8A 3KHHA 1S77D 4EO6A 2QMWA 4KO0B 2B9EA 3OVAA 5KFGA 2GQQA 2BJEA 3BV8A 4OHXA 4USKA 2B4OA 2NXEA 1S9EB 1X7VA 1VRTA 4KE5A 1RADB 5C24A 5HLFA 1P1TA 4PQUA 4A8XA 2VQFJ 4YY3J 3LGHA 4BC7A 3IG1B 4WXWA 3RZAA 4ES3A 3QRPA 1VI7A 3IA0A 1YJUA 3OBIA 3CCMS 3LO3A 2D3O1 2CADA 3KXDA 1NH8A 1JNZB 3M8ZA 4ZPAA 2B9WA 1K0TA 4PZVA 1S79A 2HZAA 1XMBA 3CCWA 4QBUA 4B3MJ 5J2QB 3J81j 4XDDA 3WZ0A 4NPOA 4WPAA 3LGMA 1UVNA 2XLKA 1LNQA 3AD9C 3PW0A 2GIFA 3IRXA 1VC5A 3H20A 2GX8A 3OFHA 4NOHA 4WFZA 5LXYA 3MFHA 5FLXY 2YWHA 5DO2A 3TW0A 4RW9A 1HI1A 2LXFA 4DUZJ 2V8PA 1S48A 4LRDA 1FKPB 3ZTPA 2YKMB 2OFHX 3WIVA 2VIHA 3IR6B 3ZZPA 1WI8A 1FJGJ 4KGZB 2C2OB 5IM0A 3H25A 1KWMA 3J7ZT 2E9ZA 3FZBA 1WORA 3SV3A 3VZIA 1WEXA 4RBUA 5J1PA 1S4EA 1I5OB 2DTJA 4ZP7A 5I3UB 4JV1A 3QRRA 1S1XB 2ZH3A 4I6AA 3LP0B 1I94F 3LPEA 2CNLB 2G0JA 3D0IE 3LGNA 4GRSA 4QIFA 4M94A 1FCAA 4K4VA 4DPUA 5HATA 1TR0A 3P96A 5EWEA 4QIEA 1S12A 1ZA1B 3GG0A 4IRDA 5G0RA 2XWXA 4ZPWR 4PPZA 4RPFA 4O0NA 1G6BA 2Q6CA 3D28A 2KJWA 4DV3J 1S1UB 2UUBF 2KZMA 2V9KA 3GB0A 4DI6A 4NEZA 4TNOA 4ELVA 1FFSB 2BE7D 3N6MA 4RL1A 5ETOA 1Q5YA 1RJJA 4C0OC 3DXBA 3G6YA 2AD9A 5JJBA 1HWLA 2O66A 3DC2A 3MECA 4B3RF 4X4UA 4I2QB 4Q0BA 2ZNYA 3R7BB 3RAXA 3EGWB 1FE4A 2M52A 2HG4A 3BYPA 3LOUA 4U8VA 2JEFA 4OI2A 4DLGA 4LFAJ 2EC0A 3R3TA 2PT0A 2KFZA 3PYGA 3CCES 1TV6A 3QO9A 1RKJA 2CPFA 3R5CA 5DG9A 3I96A 4IG0B 1RHQB 3IBFB 4UY85 1CJUA 2JFDA 2MY8A 2O1PA 2MTLA 3W5YA 2N3OA 3PV8A 3AB2B 4NA3A 4OIXA 1HNZJ 2UUTA 4WFBQ 2MJUA 4UT4A 2AYMA 4C7QA 3N5BA 3C6TB 2FHMA 1XMOF 1DTQA 5K9FA 4J5OA 1NDLA 4N47A 1HKAA 5EUHA 3W2VA 3VAHA 2JDJA 3T1YF 3DYAB 2VUGA 3ZZZA 5B0AA 2CQ1A 2GGPA 2O67A 4Q2MA 2D7SA 4QWAA 3CCUS 5A0YA 1Q79A 2OO4A 1WKKA 4Q45A 3BJYA 1T0TV 1IBLF 2YNIA 3EZUA 1SJFA 1N34F 2AV5A 1SVDA 3CJ0A 5KT5A 3M2UB 1TKTA 4OHZA 4UZCA 1A7GE 4YR0A 1TL3A 3CCQS 1XNQJ 1KN6A 4C8ZA 3ISND 1D3WA 4P7TA 2OAUA 4TY8B 1T7PA 2I0XA 1VJWA 3T1HF 2B6AB 2R7TA 3IBCB 3N5FA 1D8YA 2YNFB 2VQFF 3PW2A 3LA0A 2KM8B 4F0KA 1SL1A 1G1XA 2HVIA 5K8MA 1R27B 2WAQD 4B3OA 2G1DA 3NL0A 4F3MA 3DFEA 3A3OB 2UVWA 2MZJA 4KHPJ 1DBDA 2RMLA 1BLUA 1TL4A 2HHHF 4GO7X 2LMIA 4ZP8A 2OKQA 5D4PA 1OY8A 3CMQA 1WKLA 4O44A 3SSRA 4DZ6A 5EDWA 1S57A 5HL7Q 3QAEA 4ZPCA 3UN5A 3CWJA 2KRRA 1NMEB 5EX3A 1NO8A 4ZKAA 4EBEA 2NR0A 1NRKA 1YDLA 3MMAB 4WKYA 3VF0B 1CJTA 2Z2LA 4USJC 1G3OA 1S0NA 1TFWA 4W90B 2BX6A 4W92B 1UVMA 4NLSA 1RU2A 2HQ3A 3VR1A 1IKVA 1VQYA 1I3OB 1YBTA 2R3VA 2X1AA 2WOMA 1SQFA 3JXOA 4ZPDA 1X8DA 3IGNA 3EGZA 1XK8A 3L3CA 4IOAQ 1JJHA 5D78A 4DV5F 2BKNA 4BBYA 2NUUG 4JI4J 5DDPC 4PYAA 1Q1KA 1CVJA 4WU3A 5DZ6A 3MAAB 2XYHB 2YKQA 4CO1A 1VBKA 1U1MA 1PCAA 4QYRA 4C8LA 1F9FA 5SZTA 3TZXA 4N41A 4FPRA 3KLHA 2HBYB 4OZJA 2AEFA 3PO5A 4DG1B 3K5NA 3C3LA 4MKYA 2E1PA 2OMLA 1UVIA 4RBTA 2LKZA 1LWCB 1PILA 2ACMA 2OTJS 1DARA 1H73A 3U02A 1P1LA 3T1YJ 1WTFA 2M9KA 4TVAB 1VBXA 4W4MA 1TL7A 3UDVA 4ZHRA 3EVMA 3OR1B 2BACA 2HPUA 2BYCA 1S49A 3CE8A 4I4BA 1FRLA 3TANA 2WZ1A 3DU6A 1VQLS 2HQIA 4CM0A 1HWIA 3D6FB 4DPWA 3MURP 1KDNA 1WHXA 1U0SA 1XMQF 2LA6A 1FDNA 4IR9A 2ZWOA 3FEYB 5E7OB 1U0HA 4QW8A 1SIWB 3E01A 3ILLA 2CPHA 1ZM2A 2MQOA 3P49B 1RTZA 3GCXP 2ZWPA 2Z56B 2Z8QA 3BBBA 1GFWB 1X4FA 2OFGX 2OELA 4KIAA 2HVZA 4HEA9 4OYBA 4Q44A 2COLA 4ER8A 2UUAF 3SI8A 1LWFB 5ADZA 3CO9A 1P9QC 1X60A 2ZFHA 5GMEA 4DV2F 1DY3A 2CPJA 4A8QA 4DQPA 3UCGA 2OPQA 2PC6A 5E3RA 4KY3A 3OFFA 4EUVA 1U2FA 2GJFA 3M9MB 3G8SA 1KC8T 3MAQA 4LF6J 3KYLA 2HEKA 2W24A 4HHJA 5I4MA 3KUEA 2VG7B 4F02A 2FLLA 5LMNJ 3VVUA 4AT1B 1FRXA 3Q8YA 2NCKL 5KFTA 4OZLA 1SUQB 3Q8RB 2RD5C 1MNEA 3EPGA 1FO1A 2J7UA 5HP1A 3TAMB 3T5LA 5DGAA 2FLNA 1IQZA 5DM7Q 1CJTB 3NGDA 1RA6A 3KNAA 2RRBA 3A12A 3KJNB 1CULA 3DRRA 4OV1A 1NZAA 1KLNA 3OL7A 4LF8J 4HYKA 1BQMB 4JP8A 4RW4B 3KHLA 1GEHA 4PWDB 3M8SA 2P2CB 5KFXA 3VAJA 5J2QA 3KDNA 1M5VC 3A8IA 1OSCA 5LL6d 4IOCQ 3GV5B 4AQYF 4J9NA 3M2UA 4Q2LA 3CW2C 3FSYA 3NY0A 3Q83A 5KFZA 4DQRA 1YHQS 2ROGA 1HBNA 3PJXA 4ZITA 1JJCB 3MXHP 1BWEA 3MUTP 1U6BA 1KBRA 2DHXA 4J37A 4DPTA 2CPZA 1FNOA 1WF2A 5K20B 2N7CA 3C19A 3BPSP 1VRUA 3OTCA 5IFMA 3UR0A 4DG1A 4AYBD 2Q43A 5KFPA 5LMUF 2CPXA 5J2NB 2BVZA 3KJFB 1R3NA 4IO1A 4NWBA 2AGPA 4YB6A 3S7RA 2PA3A 2PMWA 5E33A 4OYOA 2VBZA 1RZMA 3OTDA 3MEKA 3J80Y 2WONB 5FDLA 3CO0P 3TA1A 1FKOB 1TQLA 1WELA 4DMZA 4FBTA 3H2LA 3J81Y 3W9JA 4X84A 4YFUA 3BKUA 3CGIA 3OTBA 2ADCA 1LQ9A 5J2MA 2HZCA 3HHNB 3I4HX 5EN1A 4FYYB 2E7WA 1FEEA 2BKPA 2W2PP 3K8WA 3E3XA 2PN6A 3U7JA 1JJ4A 3UVJB 4ED4A 3HZGA 1W2IA 4CO5A 4ZCMA 4CIOA 5KFCA 3CXCR 4DL7A 2QMUB 3LALA 3EYZA 3BBFA 1NH7A 1WNEA 4DR5F 3DLJA 2ZH5A 3K58A 3RB0A 3CUNA 4YP3A 4LF7F 1WC5A 3RW7A 3HULA 5KFLA 2E5IA 4D3HA 4PABA 1RWOB 1U8WA 5IS2A 3MPUB 1RT5A 3EGNA 3M4XA 3UD5A 1SKSA 5IZHA 3RTVA 3THPA 1U1RA 3BO2A 3S01A 3GIKA 1OS5A 4FF2A 1XNRF 4J9LA 5DDQC 2R2TA 1FRMA 3AQOA 3PM9A 2JRSA 2XSJB 4IFVB 5HMYA 2CQHA 5I42B 2DKOB 4KH0B 4ECSA 2OSQA 1U4BA 3M9OB 1B7FA 2YH1A 3MI7X 2JLEA 4N76A 1Y7PA 2AW0A 4PG8A 4CH0S 3O5TB 4XK8C 1I1GA 3RU0A 1OPIA 2V2KA 3NGKA 4I0WA 1UVLA 4ED0A 2XBPA 1RAIB 4X4PA 1HFEL 4A48A 1VMBA 3CCZA 4CO2A 1RWUA 2DNZA 3BGFA 4OQJA 5AJ3F 5H9EK 4OJGA 1RLDA 4CYUB 4IRKA 2IMOA 2R8HA 4KJIA 3CDBA 3GTYX 1JLBA 1U2CA 1VIOA 3T6JA 2AQ4A 2RQCA 2DXEA 1HBMA 2FPHX 1Y0HA 1IM6A 1WUUA 4PG6A 5KOXA 4HVZA 1TK8A 1XR7A 2XB2D 2C2ZB 5KFUA 2XLIA 5T14A 3PHEA 4PWWA 1UEVA 4H4OB 4C97A 3SSQA 2FHOB 4CLKA 4TQSA 4N56A 2QLWA 2VONA 2MQQA 1FTRA 3CSKA 3DLLQ 1T9UA 2CG4A 3HXMA 4RKUC 1TP7A 4UQTA 3VAGA 1GX6A 3WX4A 4M5LA 2V0NA 2PEBA 4H4OA 2AMCB 3T1AA 2FJEB 2OTLS 2V2ZA 2KZZA 3AD8C 4AL7A 4OLPA 1SJRA 3POTA 2XC9A 3HT3A 2W8LA 1RYRA 4C9DA 1NSKL 2MKYA 1MWQA 2VDHA 2OEMA 2IYGA 1FFWB 2I1RA
chains in the Genus database with same CATH topology
2HMIA 1AROP 3VAKA 1WG4A 4DV3F 2K7JA 3TO8A 2UU9F 3B78A 4F4KA 2XY7A 2YY3A 1RT2A 4MFBB 2C3UA 1QE1B 1LXNA 2VG7A 1J5EF 2DGXA 3FRYA 4H4KC 2D9PA 1HWJA 1R8CA 5KFAA 1IKYB 2DCUB 5C25B 5LJ3Y 1RT7B 2KB2A 1TL5A 3O8WA 3CCSS 4DFJA 4QZVB 2W4PA 4MTPA 2WCXA 4IG3B 1A9NB 3FRZA 3HHLB 4IKAA 4Y2CA 1HMVB 1FJEB 1TL1A 2CQDA 2MKHA 2WHOA 3M32A 4ATNA 2NLWA 2UP1A 2QYCA 3D54A 2Q66A 4C11A 3BF4A 3KWMA 4DX8H 3M30A 1UL3A 3M6VA 1UMJA 3MTKA 4XDCA 4DS5A 2IVFB 3QLHB 3WC0A 3C8YA 2VPYB 4I7FB 4B3OB 1QSYA 1AW0A 3UFCX 4FNHA 4MK7A 2RF2A 3IR7B 3O2IA 4J9OA 3FFIA 3PFEA 4M1KA 3DRRB 3JTPA 2HFNA 1YG0A 1YITS 1G7CB 5E3PA 2XCAA 2J7KA 1OPZA 5KG1A 2F40A 3DRPB 1WEYA 2YNFA 3Q8QB 2GFFA 2WSEC 4YB7A 3ISZA 3MPYA 4NCGA 4YDXA 3C6UB 4NX9A 3PIPQ 1R0AB 1W2BR 2F8HA 1Q82T 3ITHB 4YQWA 1TKZA 4GC6A 5DQGA 2VG5A 2RUGA 1S9GA 3HZEA 5CA5A 4C8KA 1GXTA 2VKZG 3T9ZA 2D1CA 1HW9A 2ZBCA 2F1FA 2J9DA 2AYEA 2VL1A 3BDPA 1KNZA 1RTIB 4OMFG 4C8YA 1Y00A 2QRRA 5KFFA 4R0JA 4QWCA 3DDKA 4EU0A 2FGOA 1LWEA 1LXJA 1HYSB 2XMTA 3CCVS 5GAGU 2DR8A 2WB4A 4TKTA 2GV1A 2B9YA 3SCLE 3I31A 2ZH1A 2RDIA 3OR1A 1HQUA 4AL5A 5JVGQ 2BRKA 3G6ES 4M5DA 2VOPA 2QFJA 4QWDA 2Y1JA 4ZP9A 3KK1B 4EZ9A 2FVSA 2A2DA 4Y2MA 1YBAA 3UQSA 1N6QB 1TUVA 3CTRA 4RW6A 2MB0B 2DJWA 2ILZA 1HMVA 5F8MA 1URNA 1VC0A 5DS7A 3MR2A 4KHPF 4JYAF 2AU0A 3IS9A 1L3SA 3BSNA 2MKJA 4DR1F 4EBDA 3CULA 1HQEB 3ULHA 3DXSX 3I5AA 2FDNA 2Q79A 2EVZA 2YTCA 1VQ7S 4R5PA 2ZITA 3N6LA 1Z2LA 5DDRC 1SJ4P 3CPWR 3EZ5A 2LA4A 2X3GA 5I3PA 2ZH6A 3OFEA 4NLTA 4J9PA 4YB5A 2QSWA 3EPIA 1D0EA 1QE1A 4YR2A 3EUNA 4NMLA 1L3VA 4FS2A 1DQ9A 5FJ4A 2KRBA 3JSRA 3CC2S 2DNQA 1U1PA 2XSFA 2RQ4A 4WF9Q 3N28A 4RNNA 2ASJA 4RW8A 4YMEA 3C6UA 5B0BA 2VA2A 4K5SA 1IN0A 3BN4A 3FGVA 2DVIA 1S72S 1URRA 3NLCA 1EP4A 4FF1A 4OX7A 2I2YA 2HIQA 3H8YA 4ZS6A 5L1JA 2XMJA 3N79A 3UE2A 1J2VA 2BQRA 4GKJF 4WKRA 3U1MA 2RDJA 1N52B 2W9BA 1QAIA 4QR1A 2NXUA 5HQ8A 5CYMB 2J9DE 2ASDA 4KFBB 2UUCF 4Y65A 5FIIA 2R7SA 1NHUA 3MM5B 2DR5A 4ED7A 1XR5A 3U1NA 1NHVA 1HNXF 2DIUA 1O5JA 3PDNA 2EFVA 1NKBA 3G96A 2JOQA 1H38A 4C8OA 5B7WA 2QA4S 1JLGB 5CXTA 1Q53A 1HWKA 2QZ8A 3LUYA 4ES2A 2C28A 2MSSA 1S6OA 4F3OA 1Q7LB 2ZH8A 3LWLA 3HVTA 4PKDB 2UVUA 1TKXA 2FD2A 1X9WA 2LYVA 1FDDA 4DSJA 4BWMA 1UA1A 1VC6A 4EZ6A 2RSQA 3CT9A 2VPWB 1H3DA 4TU9A 3OXLA 2HHTA 2CJKA 2LXUA 2RVJA 3PW7A 4K5RA 2YNGA 3OQ2A 4G1QA 2IAJB 2ZHAA 2IM2A 2GCFA 2BM0A 2DRAA 1AFJA 1IKXB 2FC9A 4NZ7A 5L1LA 5AE2A 3EXCX 3IXQA 3DLGA 1WD6A 4YR3A 2J7WA 2WB1D 1VRUB 2XY5A 2K3KA 4IDKB 1BQNB 5KT4A 3Q0AA 2GHWA 3I4PA 2LVWA 4B3MF 1DQ8A 4J9QA 5KFKA 3KMSA 3CMES 3IGVA 2DHGA 3KLIB 1TVRB 4CO4A 5KT7A 1MROA 1LW0B 1DJ0A 4TXSA 2GJ2A 2KJVA 3N9UC 2MZSA 2XS7A 2DD8S 4ECXA 1NB7A 2UVRA 4M95A 3LH2S 2RU9A 2PIIA 1R8AA 3HHEA 3MWBA 5E41A 3Q8PB 3ITHA 2NSCA 2FUG9 5KFVA 1ROFA 4CT8A 3RB0A 1MW7A 2HNZA 3POTB 3QAUA 4C8LA 4DSIA 4KGKA 2HNYB 4RUCA 1LWEB 4MK9A 2YKAA 3K5OA 4IOBA 3SSSA 1YJWS 1QJHA 2DITA 4F3QA 2KTQA 2PGCA 4PXCA 4OZ0A 3V6DA 1T03A 3GFXA 3OJSA 1YSJA 5K8NA 4WJBA 1IUJA 3DLHA 2YVSA 3HHKA 3CD6S 3LF0A 4DL2A 4DFPA 3F73A 2GHVC 1JKHB 4I7FA 1SH0A 2RB7A 1RGVA 3MM8B 4J9RA 4QR0A 1REVB 4B9NA 4R8UB 1FKPA 1LWFA 1X4CA 2B4UA 2DNLA 2CQ2A 2J8AA 4B9MA 1B0PA 4WYLA 3H4DA 3IRWP 3PEJA 1X5OA 4FYDA 2IJNA 1N6QA 1NK4A 1YIJS 1U1OA 1ZH5A 3M32B 5BYSA 3CCLS 3RBDA 4LF5F 5GAEU 4LFBF 2AWZA 4HH1A 1N32F 2MHNA 4R5PB 4GC7A 4FP9A 3SZ2A 2IBKA 4ZCLA 2QSFA 2L9NA 2R2SA 3PKMA 1FKOA 4DSFA 2FHJD 2DIVA 2SXLA 5B09A 3GIMA 2W9BB 3TARA 3AJ2A 2JZ5A 2BOPA 4ECUA 3GR1A 2CFXA 5LXRA 5CYQA 1Q8BA 2NS1B 2P9GA 4PQAA 4EWTA 2W9CB 2R9LA 3QIPA 3I82A 4FXDA 2HRUA 2I38A 1SQEA 4O4RA 5A2QY 4Y6IA 4K4ZA 3PRDA 2IBOA 5BYQA 1FXLA 1KQSR 2CZVC 2DISA 2JC1A 4ZCKA 1U48A 1QUPA 3NS5A 2CJAA 5U47A 1CEZA 2O01C 1LW2A 4HI2A 2GMLA 2IFXA 3UI3A 2JL9A 4TQRA 3GYXB 1FDAA 2EFGA 4U7UK 3DHXA 4CTAA 1L3KA 3OHAA 2W4DA 1LKZA 4YEAA 3KJVB 3OFGA 4YUDA 1LV5A 4MH8A 2C3MA 2MSTA 2YWGA 5GVQA 4UQGA 3HFKA 1FVQA 2UZAA 1PC5A 4ECZA 2ZHBA 1K8AT 3ENVA 3K5MA 3QYYA 2IRXA 4ZDNA 3I6PA 3RR8A 4QOTA 2DPIA 4NLYA 3RRGA 4OLOA 4A8OA 3CD7A 3NBPA 2KVIA 2EG1A 2HWIA 5KFBA 4LJMA 2LLZA 3G6VA 1H6KX 5HP1B 4DWIA 2CJBA 3DM2B 4WCEQ 3M6UA 3KK1A 1QVFR 1M5OC 1T8EA 2R2RA 2HS3A 4CI0B 1SKWA 5KFWA 2AF6A 2F4VF 1LK7A 2B6AA 4C8MA 3KHRA 5A6PA 1UETA 1DAXA 2KG0A 4K0KF 1MSWD 4WXOA 1WG1A 4OI4A 5IM0B 3SEOA 4B9LA 4L72B 4OI3A 3BGRB 2PDAA 3PO4A 3BQ2A 2VBYA 1N4LA 4NRTA 2G4BA 2GMHA 2KG1A 4HDGA 4PWUA 1FNXH 4Y3CA 5KFQA 2R4FA 3SFGA 2XSJA 1U6ZA 3VALA 2U2FA 4DF4A 3ICLA 4B02A 1U1KA 1S9GB 1YRUA 2GQ2A 2OLWA 3PX6A 2K8GA 4IQMA 1R6YA 1X4DA 3TRGA 5B0CA 2FJDB 5IQQA 3B8HA 3HHLD 1E6VA 2X1FA 3R1LA 3NCRA 2ZOFA 4K59A 1NJIT 3DDNA 2UV8G 1UJ4A 1H2TZ 1X4BA 1XERA 3MCSA 4DHVA 4C3KA 1JLEB 2CPIA 2EK6A 5HMXA 3MM7B 2FLPA 4DLEA 3QO9B 4WK1A 1F5BA 1FDBA 2DGUA 1T3NA 2LEBA 2IA0A 2D3OR 2CQPA 2JH3A 5F9NA 3QLHA