3MD3A

Crystal structure of the first two rrm domains of yeast poly(u) binding protein (pub1)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
166
structure length
165
Chain Sequence
RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear and cytoplasmic polyadenylated RNA-binding protein P
publication title Crystal Structure of the First Two RRM Domains of Yeast Poly(U) Binding Protein (Pub1)
rcsb
molecule tags Rna binding protein
total genus 33
structure length 165
sequence length 166
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3md3A02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3md3A01
2RUGA 1VC0A 4RU2A 3Q2TC 1U6BA 2LA6A 1OIAA 2RQCA 3CF5Q 4W90B 4LJMA 1IQTA 2MKIA 2M4MA 1YITS 2OSRA 4LIRA 3MUTP 2DNLA 3L3CA 1YHQS 2VODA 1U1RA 5LXYA 2MSTA 3G8SA 3G8TA 1JJHA 4CH1A 1H6KX 4ZKAA 2ZJQQ 2MGZB 1U1PA 2UP1A 1XN9A 2M8DB 1HL6A 2CPYA 1RK8A 2CQ2A 3CC4S 2CPZA 4OZ1A 2U2FA 5CA5A 4IOCQ 1KQSR 2KM8C 4BS2A 1S72S 5LSLA 2HGNA 1YTYA 2FC9A 3J7ZT 2VONA 2X1AA 2KRBA 1RKJA 1VQNS 2CQPA 3VAMA 2CJKA 2KYXA 4Y00A 2DHXA 1FO1A 5GAGU 1U1QA 3MD3A 1X4CA 3IRWP 3UCZP 1VBYA 1M1KT 1VQ9S 5BJRA 1H2VZ 3BS9A 2WBRA 2DNMA 2DH9A 3CCQS 1VQ7S 2MZJA 4TLQA 1FJEB 2N3LA 3CULA 3MXHP 1X4DA 2MQPA 1CVJA 2KVIA 3S6EA 1WG4A 3SMZA 2EK6A 2CPHA 4TU8A 2DIUA 5D78A 3ULHA 3S7RA 3Q2SC 1N88A 3VAFA 2DNRA 2FHOB 1X4FA 4WF9Q 3H2UB 2CPXA 2XB2D 2E5GA 4WFNQ 5JVHQ 3FEYB 2MZRA 1YI2S 3HI9A 3MUMP 1R8HA 2HYIB 1OO0B 1WG1A 2KHCA 1VQ8S 1URNA 4ERDA 5IM0B 2HVZA 3TYTA 3HHNB 2A3JA 3VAIA 2G4BA 2MSSA 3EGZA 2SXLA 3K0JA 4F02A 1DZ5A 2BZ2A 2XNQA 3MI7X 2JX2A 1YJNS 2I38A 2JVRA 5IM0A 1YJ9S 2MQNA 3CXCR 1JMTA 2NLWA 3U1LA 1WEYA 5FJ4A 5EN1A 1FHTA 3D2WA 3FEXB 1HA1A 2RT3A 2KXNB 2RRAA 2DH7A 1N8RT 2HGLA 2LEBA 3JB9k 4QU6A 3DLLQ 2B0GA 2OTJS 2M8HA 2MYFA 2MB0B 4YOEA 2DGVA 2N82B 3V4MA 3G9CA 5DDPC 3G4SS 1VQPS 2CPJA 2CQ4A 2MMYA 3BO4A 1X4GA 5DDOC 1P1TA 2MY8A 1G2EA 3PIOQ 4YUDA 2RRBA 2KN4A 1H2UX 2JRSA 4YB1P 3CCSS 1YWXA 5HL7Q 2D9OA 5LJ3Y 2CQDA 4WFBQ 3RW7A 2EVZA 3CCUS 5D77A 1N52B 2MKSA 2CQ0A 2DO4A 2E44A 1P27B 2MJUA 2MKCA 5HO4A 2CQIA 1X4HA 1H2TZ 2E5HA 3SDEB 1U1KA 2MZTA 2NZ4A 2MZQA 1L3KA 3VAGA 1KOOA 2ZJPQ 1U1MA 3I55S 1U2FA 2M7SA 5DETA 2YH1A 3CCJS 1FXLA 2F9DA 3R1LA 3UCGA 2CPEA 3CCES 3SDEA 1NJIT 3CCVS 1VBXA 1PO6A 1DBDA 4IUFA 2DNHA 2DNQA 3B4DA 4A8XA 3MD1A 1VBZA 2YKAA 3S8SA 4Y0FA 1WEZA 2DNNA 4M5DB 5DDRC 4V19X 5H1SV 1U1NA 2DNPA 3CC2S 2J76E 3R1HA 2Q79A 3SXLA 2KFYA 3ZZZA 1KD1T 3G6ES 3UWTA 3THTA 2MQLA 2DNYA 2ZJRQ 4IOAQ 1WEXA 3PIPQ 2MPUA 1R8PA 3VAHA 3CCLS 4F25A 2DHSA 2E5IA 2HZCA 5GADU 2KXHA 4WFAQ 2CPFA 4FXVA 1QVGR 2CPDA 2HGMA 2D3OR 2N7CA 5MLCV 5DM6Q 2LQ5A 2DO0A 2X1FA 3TP2A 2MQMA 2M88A 5IFMA 2LECA 3NNCA 4CH0S 2F9JA 2MY7A 2AYBA 1O0PA 1D9AA 1ZZFA 5LJ5Y 2MJNA 2LXIA 2O3DA 2RS2A 2XS2A 2M0GB 1UW4A 4C7QA 3BO3A 2J8AA 5DM7Q 2MQOA 1VQ5S 1PGZA 2MKJA 4Z2XA 1M5KC 5JVGQ 1K73T 3CCRS 1QVFR 1X5OA 2M52A 1N54B 1VC6A 1X5SA 5GAHU 1WHVA 4CIOA 4QPTA 3ZZYA 2JWNA 2CQ1A 3NS5A 5CYJA 2DGUA 1Q86T 1FJ7A 2ADBA 3RW6A 5DDQC 2DNKA 1K9MT 1U6FA 3VF0B 2MKKA 2EK1A 2GO9A 2K8GA 2LMIA 2I2YA 1X4EA 2VOOA 4WCEQ 1KOHA 3EX7B 2G1DA 3MURP 1UAWA 4QU7A 2LA4A 3MUVP 1AUDA 2K3KA 1Q82T 3G71S 2M70A 2V94A 2DB1A 2FPHX 2L41A 4PR6A 1X4BA 3CUNA 2RNEA 2QEXS 2KM8B 3IWNC 1VC5A 3UD3P 2AD9A 3LQVA 3BO2A 3CMAS 3I56S 2DISA 2DGTA 1VQ6S 5LXRA 2DGQA 2L08A 2DNGA 3CC7S 4C0OC 1QM9A 1X5PA 1WI8A 2X1BA 3DXBA 4TU7A 3MDFA 3CMES 2AYMA 4WIIA 3VAJA 4WKRA 2LEAA 1M5PC 1FT8A 3OW2R 2GHPA 1SJQA 5GVQA 2E5JA 2LXUA 1X5TA 1B7FA 4UY8T 2BOPA 1WWHA 1WHWA 1VQOS 4QQBA 2F3JA 2KG0A 2XS7A 3P5TL 1M5VC 3UCUP 2FY1A 5CXTA 2M9KA 3CD6S 2CQCA 2RVJA 2DGSA 1JJ2R 1SXLA 2J0SD 1WG5A 2YWKA 3TO8A 3R27A 1WELA 3LPYA 1S79A 1X4AA 3U1MA 2N3OA 2MGZA 3NNAA 2M2BA 2L9WA 3CCMS 1F9FA 5ITHA 2DH8A 2U1AA 1DHMA 2G0CA 2CQ3A 2DITA 1VQKS 2DIVA 1KC8T 1U1OA 2XS5A 2AYGA 1SJ4P 4PRFA 4FXWA 2LKZA 4LMZA 1OPIA 3NMRA 4TU9A 1WF1A 3CTRA 4PKDB 1UP1A 2MHNA 2KXFA 1SJFA 2OTLS 2DGWA 2MZ1A 3US5A 2DGOA 5IQQA 3BEGB 1NU4A 4CQ1A 1D8ZA 2DNZA 1FNXH 2OJ3A 2DHAA 1UFWA 3EGNA 3P6YC 4ED5A 1VQLS 1M90T 3G96A 2OIHA 1ZH5A 2MQQA 1ZZNA 1WHXA 2YH0A 2CQGA 3MOJB 2DHGA 1Q7YT 2KRRA 1NO8A 1X0FA 2RU3A 2MKHA 2YTCA 3N9UC 3VALA 2AYEA 1DRZA 2PE8A 2MZSA 3NNHA 2D9PA 2RS8A 1WF2A 2KU7A 4EGLA 2ADCA 2KT5A 4OZ0A 4F26A 2QA4S 3VAKA 2XSFA 1VQ4S 1HD1A 3P49B 1Q81T 1M5OC 1WF0A 4IO9Q 1A9NB 2XNRA 2KH9A 1SJ3P 2MXYA 1SJRA 2QFJA 2DGXA 3UE2A 2J0QD 1JJ4A 2DNOA 2LYVA 4W92B 3J7YU 3NS6A 5GMKa 1VQMS 2ERRA 1BY9A 2FC8A 3H2VE 1WTBA 3S01A 3P3DA 1WI6A 2PEHA 2LCWA 1W2BR 4J5OA 3THPA 1K8AT 2JVOA 1HD0A 1A7GE 3B4MA 2RQ4A 5LSOA 1FJCA 1YIJS 2OSQA 1OWXA 2KI2A 2CPIA 3UD4P 2VOPA 4P6QA 5GAEU 1U1LA 4U67Q 4UQTA 2CQBA 2KG1A 1YJWS 2CQHA 4C4WA 1WHYA 2DK2A 3CPWR 2X1GA
chains in the Genus database with same CATH superfamily
4DL7A 1P9QC 2FLPA 1OIAA 4UUWA 5KG5A 3KNGA 2IM0A 4GC6A 4G1QB 1KHVA 1Q8LA 3ISND 2K3IA 2C28A 1XN9A 1V3ZA 5CA5A 4QBUA 1FK9B 2HGNA 3W8PA 3I0SA 3J7ZT 2W8LA 3BQ0A 2KYXA 3C6TB 4J9VA 3HZEA 1M1KT 1NAQA 1FJEB 4KE5A 3M7VA 4AL6A 3GIKA 1F9HA 5J2NB 1UEVA 3SMZA 4YEAA 4PWWA 3S7RA 1ITPA 1TV6B 3OSPA 4KGKA 1YI2S 2HWTA 4WFXA 4DV0F 2Z2YB 1HIYA 4NA1A 2A3JA 4B9TA 1HNVA 2CG8A 4USHA 2ZHAA 3A8KA 2RHSB 2I38A 4NCAA 1TL7A 4I64A 2V4QA 3DLEA 3V6DA 1NRKA 4F4KA 3M30B 3M6VA 3D2WA 1HA1A 4OHVA 4PWDA 2OTJS 3CJ2A 2NQPA 2RIJA 2ZH9A 2KZZA 4ZPWR 4DR2F 1YWXA 5DG8A 4F36A 4RL1A 2UXCF 3RR7A 2CQ0A 3I96A 2RJZA 1N33F 3CJ3A 3UVJB 2FLOA 4DL2A 3M9OB 4MKBA 2M7SA 3QGGA 3CCJS 2AHOB 4I1TA 2E7XA 1TL5A 1UETA 3KLFA 2Z57B 2E1PA 2XO6A 3MD1A 2WOMB 1SJ1A 3DCAA 4ES3A 2V68A 1T9UA 3SSSA 3R9LA 5H1SV 3M2UA 3ZTQA 1RAOA 4EFAC 3Q89A 4URQU 2V50A 2R42A 1VOMA 2DVIA 4NLGA 4RWXA 3VZHA 2CKWA 3ILLA 1DY3A 1UW9A 3VAHA 1UVJA 5L1IA 3KLGA 3K5PA 2B9YA 4LFBJ 1LK5A 1T9XA 2QLJB 3DLJA 1HNVB 4WTYA 1GMVA 1MMNA 4CTAA 4UOGA 3HFKA 1HNXF 3PYGA 5LJ5Y 3WX8A 1TL7B 1S5ZA 3IGNA 1EHWA 2J9CA 1HQ2A 1VQ5S 1WJ9A 1T8EA 1ZBTA 2E66A 4ZVHA 1XWLA 3CCWA 1SCJB 4CIOA 1CLFA 2AMCB 4ZP7A 4I6AA 4ZPTR 5HLFA 2P5VA 2JHEA 2C3OA 2VOOA 2FIUA 3CCZA 1V9OA 2K3KA 3G71S 1GXUA 2R9LA 3GV5B 4USUA 2KO1A 1WTFA 3DHWC 4JI1J 3MR6A 1F3VA 1JXVA 2KL8A 5HROA 1NJZA 1Z2ZA 1L3VA 3M2UB 4MJKA 4L73A 5AXLA 3KTQA 5HVFA 3OW2R 3CSKA 2MLYA 2E5JA 1B7FA 1X5TA 2BQ3A 3L9ZA 3CIZA 2F3JA 2HRYA 3W63A 2V63A 3GYGA 3LA0A 3CD6S 2HQIA 5KFRA 1R27B 3N6LA 4ED6A 1XERA 2WTFA 3ZZOA 3K5NA 1X4AA 2GVDA 3NNAA 1Y9OA 3FBBA 3R2DJ 1D09B 4O4GA 4LF2A 4YR0A 2IBKA 2W9CB 1U1OA 1CJTB 4A47A 1PBUA 4CO3A 4HEA9 4C8LA 1WC0A 2OHDA 1PC5A 2JEIA 4KV8B 2BANA 2COLA 3VR1A 2FDNA 4CM2A 1W26A 1RUSA 1D8ZA 2QYCA 3HZGA 5KFJA 1ZZNA 4ZVUB 5HVGA 3MOJB 5HLFB 1S6PA 4U7UK 2FJVA 1N5SA 3F73A 1RWPB 1CPZA 4OZ0A 3HT3A 2QLWA 4ZCKA 4NLDA 4KIAA 2HAIA 3AAWB 1SC1B 2RDJA 4PUOB 3MR2A 2BR0A 1JXLA 3BB5A 3NS6A 4N41A 4EZ6A 5HROB 2VQFJ 2JFDA 3B4MA 2EC2A 1YIJS 2NXUA 2CQHA 2ASDA 1WHYA 3AT1B 2XMAA 3CJ8A 1SBRA 4DN9A 3HPOA 2YX4A 4ZHRB 1IQTA 3C66A 3DMJA 1VFJA 1FFWB 3OL8A 1IR1A 1JIHA 3R3TA 2GVDB 1U1PA 3T1YJ 5EUHA 1KVJA 1YBUA 4O4GB 1E6VA 3R2CJ 1SC6A 2R7OA 4RW4B 1RWVB 2PIIA 3ETMA 2BACA 2GQCA 2D3UA 4CT9A 4FNIA 1MROA 4NPOA 4OI6A 1N6QA 3RBEA 2HFZA 2HNDB 3D6TB 2ZM6J 3NCRA 4N76A 5KT6A 2HHUA 4BCAA 4R5PA 3TAMA 2NXJA 1S6PB 3RG6A 1N88A 4I7FA 4ZVEA 3J81j 1SUQB 2XB2D 2EC0A 2EBGA 2X3GA 3PO5A 2YWWA 2VL1A 2WSFC 4B17A 4DOZA 3VTIA 2BMBA 5CH7B 5BYRA 1P8GA 1DZ5A 2Y1RI 1YJ9S 1XTZA 4C0BA 4ZLNA 2CA9A 4HT5A 3DLLQ 2PFFB 2MB0B 3FQLA 2CQ4A 5KFSA 4KHMA 5DDOC 2M3DA 4DUYF 1C1CB 2X3DA 4X2BA 2BJEA 3PRVA 5F3TA 3FQKA 2MKSA 3FSXA 1RT3B 3MR5A 2MJUA 3TAPA 2XMUA 2FLLA 3EM1A 3FBEA 3NEKA 1P6TA 1TUVA 1NPKA 2QL7B 2E1CA 1IWGA 3DOKB 1KSPA 3AD8C 2ZC3A 3BREA 1LFPA 4IDKA 3W2VA 5AJ3F 1Q5VA 3FZ2A 4HACA 1QE1A 1LNQA 1MROB 1S10A 3AOBA 1N6QB 3H5SA 1NJWA 3TAMB 3D0IE 3T1HJ 4I7FB 2LXFA 1EETA 1NK4A 1GEHA 1KRPA 4LSLB 1D9AA 3OTOF 2BOAA 4OX9F 1RWNB 4JYAF 1RTDA 4C8MA 5CZVA 1RACB 4Z7YA 2ZOGA 4RNOA 5GAHU 4DJBA 1WUUA 3TJ8A 4RU9A 2V0NA 4LFAJ 2R2TA 3D1OA 2J6TA 1VK8A 3FSIA 5IT0A 2EEYA 3VQTA 1RT4A 1NK8A 1KOHA 4ANEA 2XEXA 1AUDA 4P7VA 3O3LA 4LF4J 4XK8C 2ZE2A 2NXNA 2IHR1 5C7PA 1O6XA 2E5LJ 1REGX 2RD5C 3J7YI 1G3OA 3GG0A 2GAGC 3MEDA 1QE1B 5T7LB 1EIYB 4FP9A 2EFQA 2FQQB 4DLEA 2IM1A 3NKYA 3NP5A 1GX6A 1IBMJ 1CC8A 2V2KA 5KT3A 4C98A 4DR7J 1IBKF 2F4VF 2E7VA 2J6SA 3I5BA 5CCMA 1VLYA 3TUIC 3NY0A 1WELA 1S79A 3AB4B 4B9LA 1TK0A 1FFSB 3SYZA 3RJMB 1VQKS 2G1HA 4LMZA 5CYMA 1RTDB 2G13A 1B0PA 3AOAA 3EDQB 3A13A 1QAYA 1NKCA 1ZS6A 4N47A 1YKWA 2ROPA 1AFIA 4LF5F 2UUWA 2OJ3A 3D7SB 4ED5A 1PCAA 3G96A 2OIHA 1VI7A 1WHXA 1B4SA 1GXLA 2J7KA 3QJPA 1WDTA 1YZ7A 1KN6A 1RT4B 4EGLA 1VS3A 5L9XA 3VAKA 2H4YB 1DAXA 3IRXB 1EZZB 3KG4A 2YNFA 1ZM4A 1UCNA 3UE2A 2JC0A 4W92B 3D4JA 2ZC4A 4FPRA 1XR7A 4IR9A 2LU1A 3M4XA 3CJSA 3GMGA 1TKXA 1K8AT 2I6WA 2WSCC 2GVZB 2HRTA 2UUCJ 3MPDA 3WIVA 3CD7A 1U1LA 5A8WA 2CQBA 5KFIA 3MPYA 4ZN1A 3NCPA 2W9AA 4W90B 2VFRA 2A6OA 1SKRA 1C0TB 4LIRA 3E01A 3CMQA 2IVMA 2BX6A 3CIMA 4UW2A 4LVOP 4ICLB 4FBUA 4F0HA 4C3LA 4DQQA 5HATA 3PVXA 6FDRA 3CC4S 4LF9J 2VA3A 2UXDF 4C3MA 4O44A 4NRUA 4BS2A 1V3SA 3N01A 5CYMB 1YTYA 4L3KA 4K2XA 1QY7A 2C2KB 3OR2A 3DRYA 4X4OA 3EGVA 1RTJA 1HLWA 5BJRA 3OTCA 2DNMA 3W60A 2DH9A 4TLQA 3OTDA 2AGOA 1X4DA 4X62F 5U47A 3RRHA 4DV5F 1UJ4A 1UEKA 1XJWB 2V2VA 1E6YA 3M8RA 3F44A 3JQKA 1QSYA 2H48B 5A0YB 1RTHB 3BPSP 3HT0A 2BJ3A 3PHEA 4ILLA 4JP8A 2P6SA 3OR1A 1F5BA 1B99A 4U7CA 2BJ8A 3RR8A 5KFWA 2UU9J 3ZTSA 2JVRA 5IM0A 2MQNA 1NKEA 2UUAF 3IS9A 3GFHA 4DR3J 2KXNB 2DH7A 2FJXA 1FJGF 1TKXB 5H9FK 3DRXA 4LF8F 3BO4A 5A8WB 1Q0NA 2MLZA 4ZJLA 2W2PP 2XG8A 5G4DA 2Q43A 1UMJA 3P45B 5K8MA 3E01B 4JI5F 2VH7A 2E44A 4E8UA 4RW8A 2XMWA 4ZCMA 4ECTA 1BLUA 2MZQA 4DF4A 4RNNA 3SV4A 4LVNP 2QN6B 3R1LA 3UCGA 4O44B 4WP8A 3V6JA 1H7WA 4L76A 4MIAA 1U0HA 3C19A 4O3NA 4GKJF 4A8XA 1VBZA 3RB4A 4M5DB 4PG6A 4V19X 2XZWA 3TZWA 1LQ9A 1MMDA 5KFKA 1RTZA 3HHLD 3SXLA 3OFEA 1UPMB 2RSQA 3DRRA 1U6ZA 4EU0A 3EPIA 1HW8A 4N8NA 3KUEA 4I68A 3KLEA 3HHLA 2HHXA 4NI2A 3DDNA 3PNIA 2DR5A 4ZVGA 3QGPA 3MEEB 4DL4A 4F3QA 3ENWA 2DO0A 2J8SA 1O0PA 4G6VB 4C7QA 4B9UA 4DPYA 2CWKA 1LFWA 4M5MA 3M9MB 3C2PA 3ONQA 1N54B 2XYHB 5B0CA 2AGPA 4K4WA 4QWDA 1RAJA 2V5HG 1FJ7A 2LQBA 4KSEB 3MTJA 2GO9A 5BXIA 2LMIA 3QFHA 4OJ3A 4KAIA 1YG0A 1VK3A 3OTEA 5EDWA 2VDHA 2YY3A 3H40A 1UTAA 2B43A 3IAS9 1U2CA 2QEXS 3BDEA 1YJTA 4F3OA 2D3ZA 1NZ8A 2XTJP 4H4MB 2YNHA 1WDDA 2BA9A 3MPVA 3OJSA 2ZBIA 2NZCA 4JI2J 3FFIA 3IGVA 1X5PA 2ZUGA 4HKQA 1WNEA 2QLXA 2QT7A 1QD1A 4O3OA 2LXUA 2XGQA 2FY1A 1PYSB 3KLEB 2CQCA 3PHTA 4OMFG 1KVKA 4C8YA 2YWKA 4WE1B 3RB6A 1FRMA 2HHQA 3TARA 1HWUA 5DQGA 3NXZA 1Y0HA 4TU9A 1J5OB 1S6OA 1TK8A 4PKDB 2V8DA 4X84A 2EKYA 1LWEA 1J5EF 2OGUA 2DCLA 4NXMJ 3FDSA 3TRGA 2J5AA 3M8WA 1FNXH 1VQLS 2IRYA 3RB3A 2HQCA 3GIMA 4L3NA 4C8OA 3ISZA 2AYEA 4A8SA 5DGAA 1WF2A 3C6UB 4DR5J 2B4PA 1YGYA 1M5OC 3BQ1A 2BXJA 5KG3A 2DGXA 1XNQF 2YNHB 2KKHA 3TZZA 1K1QA 1CG2A 1WI6A 2IRXA 3OHAA 2UV8A 5LSOA 5E41A 9ATCB 3ENAA 2GIQA 4CYUA 3ZXWA 1PAUB 2DK2A 2VB6A 4U8YA 2GIRA 1KP6A 1X60A 4NXNF 3T5LA 1Y4ZB 4A8MP 2MSTA 4PG7A 1C4AA 1J2VA 4MFBB 3MR3A 1GAOA 4FZVA 2OUGA 1KQSR 4A46A 3BR9A 3DLGB 1OQ3A 2G2OA 7AT1B 1RKJA 2HWHA 2B7BB 2CJKA 1LWEB 1R43A 2DHXA 1REVA 4DWIA 2P6TA 4L72B 2W2OP 2QG9B 1Q7LB 4YMEA 1NK6A 2MZJA 1RZMA 2EBEA 1AT1B 3MXHP 5BR8F 2MQPA 3V81A 4DF8A 3TEGA 3UN3A 2HNYB 4YY3F 2BQUA 4OX6A 3KUGA 1XMOF 2OP5A 1MMLA 3FZBA 1FRXA 5HBMA 2HYIB 4ERDA 1URNA 1Z4UA 1KR4A 4XPCA 5CABA 5DGBA 3WC0A 2BZ2A 3ITHB 3GV7B 4OHYA 2XMJA 2MQ8A 3MEKA 5F8JA 2BKPA 2ZBRA 4NEYA 2HGLA 2ZHBA 3JB9k 2LDYA 4OYOA 5K8NA 2M8HA 2BBEA 3DC2A 3V4IA 4FYVB 4TQRA 3IWLA 1FWPA 3IM8A 3LP1A 4L74A 1GMWD 3EMTA 3EZUA 2H54B 5ETSA 1JKHB 2HVEA 5HO4A 2CQIA 3TI0A 2OI2A 3CNQP 4Q45A 2KTQA 4F4XA 4JV5J 4OYZA 1YRXA 2ATLA 4OZ5A 1REVB 3B4DA 2YKNB 3Q8RB 1TK5A 1T9YA 4EEYA 3DM2A 4P9SA 2PO4A 4K4TA 2WVFA 2W4DA 4Q44A 3DKDA 1AA1B 4DPWA 1DLOB 1UA1A 2RQKA 4LBHA 1HBMA 1S6UA 4DV2J 5A8RB 4TKTA 1RHUB 5K14A 1F2GA 1R8PA 3LTOA 3SSRA 4CH7A 5HBMB 1FRJA 1S6QA 2FJDB 5DM6Q 4ES2A 3TP2A 2YXLA 2AYBA 4ED8A 1UW4A 2AJ2A 1RSCA 1GK8A 2MKJA 2IC3A 4I2PB 2M52A 3JSMB 3TZYA 2FUG9 1M5SA 3J7Z5 3SEOA 4WFZA 4EZ9A 1S1UB 1S1WA 1U49A 2PFDA 2DGUA 4LBPA 3TX0A 1SQEA 2JLGA 1K9MT 2K8GA 2M5YA 3L7PA 4RW7A 1TUGB 2HQFA 2VG7A 2HHTA 3GJQB 4NYOA 1PYTA 2JOQA 3GR0A 2JEGA 3GJRB 3FCWA 1TFYA 4LF7J 4NLSA 3OV7A 3ZZ0A 2DGQA 2VD3A 3DM2B 3A8IA 4USTA 3THVA 5JMNA 1D1UA 2NXCA 4WKRA 2LEAA 1JNZB 1T0TV 3DLHA 4ZPBA 1HBMB 2QL9B 1R0AA 2ZWOA 4WZQA 1S9GA 3R5AA 4M94A 4UOHA 2FVRA 2J0SD 4CM0A 4CO5A 3IBFB 3QRRA 2VUGA 2C2NA 5ITHA 3IBWA 2WCXA 3D28A 3HSDA 4J37A 5M2RA 3K7RA 3AOCA 2XS5A 2JFKA 3OUYA 2HVHA 4JI3J 1DQAA 5SZTA 1M5HA 2IM2A 5GAGI 3KLVA 3DRPB 4DR4J 2PEBA 3KG0A 4F4YA 2A1BA 1S1WB 2YH0A 5BYSA 5EWEA 4NASA 2AEJA 4CP5A 1DRZA 4NRTA 1CC7A 4NCBA 2ROEA 1VQ4S 1RADB 4DCPB 1VIOA 4DSLA 2VBZA 1S1VA 4M5KA 1SJRA 2QFJA 2CNKB 3DHXA 3PEJA 3MWBA 1RQ0A 3AA9A 2ERRA 3JSYA 4V19J 4EYHB 3AFGA 4KFBA 1SIZA 4DQSA 1RXOB 5GAEU 5D0RA 4K8RA 2W4CA 4KKOB 1FNMA 5AXKA 5LMUJ 2QA1A 1SQFA 2B8PA 1R0AB 2AV5A 2EXUA 4NLTA 5IWAJ 2RF2B 4HT7A 1JJHA 1C0UA 4U96A 5KFUA 1H6KX 3CCTA 5DZ7A 1H0HB 3WIUA 3DGVA 2KM8C 3PW5A 1EJ7L 3IC1A 4QR1A 2QO3A 1RDRA 2X1AA 4QJVA 2WVBA 1U26A 3HD1A 4Y00A 3DDKA 4LFBF 3C15A 2MHEA 3GR1A 4J9RA 5HMYA 5B0DA 4QYZJ 1NDCA 3F41A 2PI4A 3AD9C 3DOMA 1RAGB 5B09A 3MUMP 4F0MA 3IM9A 3RAQA 5AE3A 2F1FA 1S12A 4O4RA 5IT9U 1JLBB 4ZJQA 3DGPA 2YKMA 1WEYA 5FJ4A 3AD7C 2D69A 2QFIA 1TZ0A 3PZPA 4AUKA 4KYZA 3ZZRA 4MH8A 1RTIA 5KFVA 3AODA 4DR1J 2VICA 3ZNJ1 4JI1F 2R2RA 3ZO7A 4LR8A 2BKOA 3RW7A 2GFFA 4ZIVA 4I2QA 1C1BA 2V69A 3M8PA 2E5HA 3K8VA 4B08A 4DUTA 2YPYA 4NA3A 5DETA 4UQGA 2HVDA 5L1KA 2QSFA 4LRBA 2B56A 3CCVS 3JYTA 1PG5B 3U27A 3CO0P 2FB0A 1NMEB 2V9WA 4ED4A 1H74A 3CC2S 1Q8IA 3PRDA 3VGVA 3DOLA 4OX8A 1BWVA 3JAMU 2ZJRQ 4TVAB 5KFGA 1M1GA 5I42B 1SKWA 1FVSA 3D3CJ 5J1EA 1H7XA 4R25A 4HHUA 3TVKA 3QATA 5HJXA 2YKMB 3H4BA 4MIWA 1IBLJ 2BRLA 3HMJG 5DM7Q 5JVGQ 1K73T 2P9GA 2VDIA 1X5OA 5D4NA 1OY6A 2ZNZA 2IJFA 1X5SA 1RHMB 5KFPA 3OXGA 4DSKA 2ATCB 2VQFF 3GIIA 4WIQA 4I2QB 3BSOA 2VPZB 2LA4A 1BHNA 2VKRA 1UVMA 4P52A 2DB1A 4PG5A 3SQGA 1GTHA 1U24A 3OBIA 2IY5B 3I0RA 3LQVA 5C42B 3JYTB 1JNRB 3HP6A 4WXWA 1GQEA 4K4VA 1K47A 1NLKL 3T1YF 1IXKA 4P71A 4FKYA 2CNLB 1R7IA 1Y7PA 3KHHA 3CC7S 1SKSA 5J2MA 3UR0A 2GJ2A 1YLXA 4DUZJ 1SJQA 4C97A 4UY8T 4F4WA 1VMBA 2DKOB 3CJKA 4N77A 2DGSA 4GVBA 4Q2MA 3TO8A 2ZM6F 4ENOA 2EFGA 4CLFA 3ZTPA 2HMIA 4X4NA 3D6MB 2JC1A 2AZ3A 4DCJB 4P2FA 3BSNA 1N5TA 2CJXB 2KXFA 2HFOA 5L46A 5GMDA 1FKOB 3GU0A 5K9FA 1Y5IB 2HW3A 4OI0A 1D9FA 4F50A 5CYQA 1RE1B 1X0FA 2YTCA 2DRAA 2KU7A 1CS4A 1IN0A 2XYPB 1NCLA 2LQJA 3QRPA 4IO9Q 2XNRA 3K8WA 4Y6IA 3O8WA 5F8HA 2DNOA 2PN6A 1N0VC 4XDCA 1VQMS 4JI7J 3MMAA 5EHHA 2FC8A 1WTBA 1UEUA 2IJRA 4BBYA 4J5OA 1HBOB 3DLBA 2EFVA 3GWCA 2R7VA 1YX2A 5J2MB 3EGWB 3GIJA 5FDLB 4K4UA 2I5JB 2I1RA 4RPFA 1V5VA 4DS4A 5C2GA 4GVBB 2GIFA 3Q0AA 2ZH7A 3NGTA 3JTNA 3G6VA 1HL6A 2CPYA 3NGUA 1TL4A 3QRQA 4MYTA 3T1HF 4NMXA 3W2WB 2LDIA 1NKBA 3RAMA 2KRBA 1J27A 3EZ5A 3PDNA 2LLZA 3N6NA 4GRSA 2DRDA 2N3LA 2YNIA 3BF4A 1WG4A 5CYQB 5HP1A 2H9ZA 2MKYA 1M1HA 2ZH2A 2QYGA 3HI9A 3T1AA 5KFZA 2JL9A 2ZZTA 1IR2A 3LGMA 4LFAF 4NLWA 3SCIE 2K7JA 2XLJA 1B64A 2Q6BA 2ROGA 3G6XA 3MM6B 5IV4A 5D0EA 1QAJA 5DLGA 2E9TA 1FHTA 3QIPB 4LF4F 3VGTA 2I9SA 2GA7A 2WB1D 4ECRA 2ZKTA 1VQPS 4M8LA 2E5LF 4I0WA 1JLEA 2GNKA 1F60B 1VJQA 1RAHB 2VPYB 2CAJA 3U7JA 3MAAA 3V5RA 4DV7J 1SB6A 3RAXA 5FLXY 3QO9A 1IBMF 4TYBA 2BQRA 3FRYA 2BKNA 4HLBA 4ZN3A 5K8PA 1RAFB 3EXYA 3LOUA 3GCXP 4DR7F 1G1XA 4Q8FA 4CNZA 3SDEA 2Z8QA 1ZTTA 3HCXA 4ZP9A 4FF1A 3W62A 4F67A 1WEZA 2OEMA 5J2PA 1KFSA 3W5ZA 2N7YA 1SL1A 3MPUB 3AH6A 4LRFA 1FWLA 2IDEA 1X8DA 3UWTA 3QWUA 2DNYA 2QC3A 5HP1B 4Y34A 2FYXA 2P9CA 1D3WA 1O5JA 2C1EB 2H5EA 5MLCV 5IFMA 1OS5A 3M6UA 1I3OB 2ZFHA 4AFFA 3P8BB 2DT9A 3G2XA 3RYLA 1PGZA 1M5KC 4LF6J 2XSJB 1KHWA 1DQ8A 4AQYJ 3H5XA 1JLEB 4LQ9A 1IKWA 1AYEA 2FD2A 2J9DE 3MAAB 5HQ8A 3RW6A 1T05A 3OTBA 5KFAA 2ZZMA 4OI2A 3QO9B 1N48A 2UUCF 4J9KA 1HBNA 2R8IA 1MN9A 3BJYA 2M70A 4QIFA 2FPHX 4ANDA 3RBZA 3QJJA 1CJUB 2VV5A 2Y1JA 1V6HA 2HQDA 3PCOB 3TA1A 2VFSA 3PR5B 2P9EA 1NEEA 4IFYA 5J2PB 1XR6A 2DXDA 2J9EA 3PJXA 4IFVB 3JQJA 4LF9F 4TU7A 1K1SA 4HI2A 2HIQA 2H65B 2HURA 4UOFA 4J9UE 1FA0A 1R0CB 2B5JA 4QQBA 1FKAF 3P5TL 3EDRB 1H3DA 5I4MA 3W9IA 4CO0A 2RVJA 1HI0P 4YN3B 4LIWA 3LPYA 5E33A 2IVYA 2NUHA 3HLUA 2AJQA 1DHMA 1CULA 4ECYA 4FYDA 2ZUAA 3H98A 2AYGA 1SV5A 4RBVA 1WF1A 4NL5A 3CJ5A 2UVUA 4RUHA 1UJ5A 2JH3A 3EGNA 4CLSA 3TA2A 2UU9F 4OI1A 4DR3F 2JLFA 1WOSA 2LEPA 1RHJB 1T05B 4K59A 2A2CA 2D9PA 5IS2A 5HJYA 2ADCA 1B0VA 2QA4S 4PQUA 1IJEB 3E8OA 2H51B 3U02A 2C3UA 2DTJA 2IDLA 5KOWA 2YX7A 4JV1A 1VRTB 2OO4A 1S57A 2FGCA 1HQUB 4CLZA 5THWA 3B78A 4IFYB 2CDRB 2W25A 1EB0A 3BGLA 3W7BA 2HNZB 1T03A 2BE7D 1QSSA 2R7SA 3KDOA 2JNJA 4I56A 5LM7E 3DLKA 3R6GB 3VGUA 1FDNA 1KS2A 2UUBJ 4ZVSB 8ATCB 3K57A 2ZWPA 1U6BA 3RTVA 4LJMA 4DPXA 2VODA 1U1RA 4KO0A 4BWMA 5E3CA 5DLFA 3FUYA 2IPOB 2GW8A 2HHSA 1CULB 4PPZA 2U2FA 4Z7CA 3LP2A 4TQSA 2FC9A 3HVTA 4ZDNA 1HHSA 3SFUA 3D54A 4O0NA 4TLRA 1MWQA 1OY8A 3MD3A 3IRWP 3UI3A 1H2VZ 3CCQS 1VRUA 1JLFB 2WONB 3A8JA 4IH5A 3UQSA 4PWUA 2R4FA 5E3QA 3NGKA 5HK4A 4ECWA 4HTIA 3VAFA 5IXUA 3B54A 4OHZA 4PQUB 2XI3A 4JI8J 3MZIA 4RW6A 1OO0B 4USJC 3OQ2A 2VQEJ 1XK8A 2Z0GA 2CVIA 4ECSA 1NM2A 2XNQA 1JK9B 4B3MJ 1T11A 1XMQJ 3HFZB 4M5GA 4NLYA 1IKXA 2VIHA 2R7UA 1T03B 2QV6A 4PABA 5L38A 5DDPC 3DLKB 4Q5VA 2VFVA 3TOQA 3M8YA 1X0PA 5AXNA 4YDXA 4JI2F 3FJ2A 2EFPA 4PPDA 3OT9A 1X4HA 5K20B 3UR3C 1R31A 3HSZA 1U2FA 3MMBB 4CI0B 5C2CA 1JB0C 5GMEA 2IA0A 3CCES 2K7KA 3DDIA 4ZLJA 1OJ4A 4B9VA 3KLIA 5T41A 2QX0A 4X4PA 2EG1A 1Y3KA 2DNNA 4RBUA 3LAMA 3TVYA 3PV8A 2DNPA 1DJ0A 3HVAA 2Q79A 2V4JA 2KFYA 1BC6A 4K4ZA 4Q43A 2A6MA 4USVA 2HKEA 4NXMF 1F9EB 1OQ6A 2E5IA 4DQRA 2HK3A 4NYZA 4J9PA 1HWLA 5A76A 4NCGA 3ZFVA 3M6XA 5KT5A 5JUMA 2EG2A 4NLXA 1NPRA 3TX8A 4DX8H 2W2NP 3PYFA 1OY9A 3MECA 4DR5F 4F2SA 4YB5A 3A1YG 1IKXB 1U48A 3TUPA 4Z2XA 4LT6A 3M9NB 2C2MB 4DPOA 1FERA 4LQ3A 4QPTA 4ZVFA 1HWKA 4EWTA 1NHUA 2ZH3A 2YNGA 5DDQC 5B0AA 2BJ1A 4QR2A 3M6WA 1PYOB 3N0VA 1Q82T 4X4RA 4K50A 3LGNA 1C4CA 2RNEA 2W2QP 3D6FB 1LOUA 2BRKA 5EGYA 4XO0A 2XCAA 4DZ6A 3I4PA 4DL0C 1UWAA 4P72A 3HO1A 1HPZA 5HQLA 1KQGB 2IVFB 2W01A 3MDFA 2FGOA 2DY9A 1PBAA 3BH7B 2V4JB 2ZEJA 4DV4J 3W66A 1WHWA 3KJVB 1FXRA 1F5CA 1N5VA 2ACYA 3GCWP 4ED1A 3JTPA 3VZIA 4NX9A 3M2VA 4WBFA 1AXQA 4YR2A 1KC8T 2B4UA 3MECB 1KLMA 1SQGA 1IM4A 1UP1A 3MAQA 1VDHA 1YRTA 3CJ0A 4X4TA 2DGWA 4ZPDA 1PJ5A 4CQ1A 2B4VA 4DFJA 2V8GA 2HQ3A 2EPIA 1M90T 1HNZJ 5CD4H 4C0HA 3VALA 3P4UB 3BR8A 2KFZA 4PXDA 2RILA 2EFNA 4ZPCA 5L39A 2PA8D 1R8AA 1RAEB 3MTKA 2XO7A 1A9NB 4LR7A 4ED0A 2QGFB 1FEEA 3MM7A 4HR2A 5BYQA 2LYVA 2L9NA 3IA0A 1DTTB 1IKYB 2EFOA 2PEHA 2LCWA 3THPA 3AXKA 2AP6A 4JV5F 2HZVA 4QWAA 2DPIA 3UD4P 4FYXB 1I1GA 1N4LA 1F1BB 2CNOB 1YJWS 2OPSA 4C4WA 4J9LA 3CPWR 3HKWA 3GFXA 3Q2TC 2R8GA 3N5FA 4IYQA 2GHVC 2UP1A 3I0SB 3M2VB 4IRDA 2BE9B 1LWXA 4DV2F 2W4PA 4N5SA 4YB6A 5KFLA 1VRQC 2NSCA 3G8QA 2CQPA 4USMA 1RHQB 1FO1A 2XI2A 4X64F 3UCZP 2WBRA 1VQ7S 4A4JA 1NK0A 2BVZA 7FD1A 1YRUA 5KG7A 4DBQA 3LANA 1S9FA 1WG1A 2JDJA 3NBPA 2B3TB 3DLEB 3V6DB 4XPEA 2X51A 2YBVA 4PEOA 4F7VA 4F02A 4PWDB 4IR1A 1YJNS 2XY7A 4FS2A 4WTOB 2PGCA 2ILYA 4QU6A 1FRKA 2AEMA 5DQHA 2B0GA 1FD2A 2HQGA 2N82B 3G9CA 5GAHI 4FPIA 1BUXA 1IR0A 1LK7A 3PIOQ 2OPSB 3QAEA 3M2RA 4LF7F 3UDLA 2BW2A 2CQDA 5IZHA 4WFBQ 2C2ZB 3D5MA 1EKRA 4RZRA 1BQMA 3MCSA 3BDPA 2HEKA 4KRWA 2MZTA 3KLFB 1KQFB 1S49A 3LWLA 4OZNA 3A3OB 2HBYB 2YKAA 3S8SA 1U47A 3Q8SB 4GC7A 3HJFA 3KK1A 2GZOA 5IT4A 1U25A 1QDUB 1PAEX 4JI0J 4JI3F 1NB2A 3KLGB 5J1NA 3SZ2A 3KHLA 2ZH4A 1TVRA 1KTQA 4OI4A 3PTWA 3PIPQ 1NDLA 4CTAB 4MT1A 4DR4F 5GADU 4J90A 3TZXA 2CPDA 3NBPB 2ALYB 2R7RA 1KNZA 1ZM3A 2FVQA 1YVFA 2R8HA 4ZPVR 2F9JA 3H20A 3C46A 2GGPA 2BM0A 3FCHA 2CYYA 2BE2A 4C3KA 2XMVA 1XR5A 3GQCA 3IN5A 3M32A 1TKZA 5F8IA 2ADBA 3GE9A 2AU0A 1RB0A 3QPIA 1SH0A 5AE1A 1FTCA 1UAWA 4K0KJ 4QU7A 4PXBA 1EX8A 4F2RA 5LMUF 3BSAA 3J81U 1P1LA 1ZPWX 3QIDA 2KM8B 2OPRA 2AD9A 3JTOA 1VBKA 3R5GA 2OFHX 5IWAF 3FMBA 5H9EJ 3N4WA 5LXRA 1RT5A 4D3GA 2HBZB 3M8SA 4WU2A 4USWA 5D0GA 3HK2A 3ZZTA 3OXFA 2AYMA 5KG6A 4OV1A 2DY1A 4CLWA 2YKPA 4OZ3A 3GONA 2CJAA 1Q1KA 3D0HE 3GILA 3SCJE 1PJ7A 5B7WA 2KG0A 1TVRB 2J0WA 2OPPA 4FNHA 3KK3A 4LUBA 1JJ2R 4B3SJ 1TAUA 1MWZA 1LKZA 3C14A 3EVWA 2BANB 1BQXA 2OPQA 2GGPB 2MHNA 4F3MA 4DU8A 4IQMA 4OYAA 2Z56B 2O01C 1R0BG 4R8UA 4URGA 3BEGB 2DNZA 1UFWA 4B9NA 4DEZA 1TKZB 2Y3YA 4DS5A 2VJUA 1FFGB 2MKHA 2QLBB 2XC9A 1F3FA 3OL9A 4IG3A 4LF1A 2ZVSA 1QSLA 1MU2A 2HK2A 3TA0A 4DR1F 4U7UD 2HFNA 5ETOA 2DCUB 1QTNB 2XLIA 2J0QD 1R8CA 5F3ZA 1FJGJ 4ELVA 3AJDA 3DFEA 2ZITA 1BY9A 1RT5B 3S01A 4LREA 1A7GE 3H59A 1QUPA 2RKIA 3DMJB 3JSRA 4ECVA 4UZCA 3OFHA 2IMWP 2X1GA 1GNKA 2HVIA 2DEIA 2MKIA 2FJAB 3L3CA 1S77D 4L75A 3KK3B 1AB8A 3D9BA 5LXYA 3D0GE 1E6VB 4I6YA 2WSEC 4MTPA 2WBMA 2WZ1A 3H0PA 5LSLA 5KFOA 4GKKJ 3VAMA 5KFXA 4WKYA 4R5PB 1YBTA 4R8UB 3BYPA 4QW8A 4CO2A 5KOXA 3OVSA 1RCXB 2CUYA 4U95A 4LSNA 2YPZA 1IBLF 4DSIA 1FEHA 4TU8A 4ZLLA 3ADAC 4ZVTB 3EICA 2CPXA 3W64A 5JVHQ 3TJAA 1ZM9A 4PYDA 4UY85 1RA6A 2KHCA 4HHHA 2BJ7A 2G4BA 2CJBA 3NCQA 5MAOA 4Q8EA 2BJ9A 3O2IA 4C8ZA 1H72C 4B3OA 2IJNA 3FEXB 3NGRA 4U9RA 1V5IB 1FKPA 4O0IA 3V4MA 2BV3A 1GTEA 3G4SS 1RT6A 1YBAA 1X4GA 2POKA 3AY0A 3M8ZA 1G2EA 2GCFA 2GJIA 2ACMA 2JRSA 4JI4J 4AE5A 3HX9A 3PJ9A 3GJSB 4W98A 4IQXA 3M8QA 3MM9A 1AZSA 2CJ9A 4C11A 1EQ0A 2IMOA 4IDKB 1QLNA 3W2VB 4DUZF 4RUBA 5D0HA 5KG1A 4HACB 1RT1A 3QT8A 4RKUC 2W24A 4AYBD 1U4BA 4YB7A 1DBDA 1L3TA 4IUFA 2R7WA 4PCQA 4U6PA 3T5KA 3R5JB 1T95A 2QA2A 4RBTA 1URRA 1OPZA 4IRCA 1UVIA 3GYXB 3AQPA 2RQMA 1EETB 2I8EA 4LSNB 5C24A 4BDPA 3OHBA 2NS1B 5ETLA 2DHSA 4LBIA 1QVGR 3J7AN 1ZETA 1QJHA 1VHFA 3DI6A 2CFXA 2VJVA 2KT3A 2XS2A 4B3OB 3BO3A 5F41A 1KFDA 4IG0A 1ZPVA 1FKPB 1JLAA 2AEFA 2WVCA 3IMQJ 1KONA 4JI7F 4B3RJ 3WBZA 4UTGA 1FI4A 1HARA 2VPXB 3SCKE 5E2QA 3E51A 2ZE2B 2G1DA 4C11B 2VFTA 3NGSA 1RT2A 1XBWA 2AJFE 3MEDB 1FE4A 3L09A 1KLNA 2HS0A 3KXDA 1JLQA 3R8YA 3LWMA 5LMNJ 4O3SA 2XWYA 3IAM9 2Y1LB 4Z37A 3TAQA 4CLKA 3RZAA 2GV1A 4RLEA 3ELHA 3EUNA 2P2CB 2F7VA 4JB8B 4LSZB 1W25A 1M5VC 5CXTA 1D9DA 5IQ6A 1Q53A 2EI5A 3CCMS 2DH8A 3DI6B 4ZS6A 2DIVA 1N32J 5EWFA 1I94J 4A8YA 3NMAA 2R2SA 4IG0B 3KMSA 2VA2A 3QT7A 3UO0A 1T7PA 1VJWA 4YY3J 1X9WA 2V2ZA 3GP9A 1NO8A 5IC6B 2DR7A 2G0JA 2YNFB 4EO8A 3L95X 1U2RA 1CJVA 1HD1A 1Q81T 1WF0A 4Y28C 1WSRA 4M5JA 3IFEA 1ULRA 3K89A 4IO1A 4DV7F 2Y8WA 1VIXA 1KVIA 5LSRA 1G6BA 3BGFA 2MTLA 2AWZA 4IKAA 4ZMMA 2FZCB 2J9DA 4TYAA 3FCVA 4A8OA 2F8MA 3G87A 1NH8A 2NCKL 5ETQA 3JSBA 3DNCA 1YITS 2ZNYA 1AW0A 4A48A 4DN0A 5LL6d 2B9EA 3Q8PB 2AF6A 4G1QA 3BM7A 1S48A 5J1PA 1RT7A 3OR2B 3NWRA 5IT9Y 3HVWA 1RTJB 3BN4A 2KHDA 5ETRA 5G0RA 4DFPA 4CZCA 1ZA2B 1FK9A 2WVDA 1NSKL 4ANCA 4QIGA 3E2EA 5JXSA 2BW7A 3CULA 2N4CA 3KKFA 1E6YB 1HR0J 3C6TA 2FVSA 4DPUA 3S6EA 1Y10A 2ABYA 1TP7A 5B0BA 5F8GA 1X4FA 4LF6F 5C5JA 2HS3A 3OR1B 1S97A 2XMKA 4AQYF 1N56A 1TV6A 4ZJOA 5IM0B 3W8GA 1UA0A 3IS9B 3VAIA 1S1TA 4ZITA 2A2DA 4ED7A 4YR3A 1YJVA 2CRLA 5KAKA 5E3PA 1RWWB 1S7HA 2CJYB 1N8RT 2LQ8A 1NJYA 2QA4G 3CDUA 5B08A 3OFGA 1A6LA 5E7OB 4YUDA 3HSJA 4ID5A 1S99A 3JAMY 4RW8B 1DTQA 1S4FA 3QZ7A 3LW5C 2DO4A 1L3SA 2DEJA 3RRGA 2HHHJ 3T5HA 2ZZNA 4F0KA 2ZJPQ 1U1MA 4O3QA 1RT7B 4E2FB 1U0HB 4ER8A 2XZDB 2CWXA 3KHRA 3SV3A 3UVJA 4A8FA 1L5UA 5G0RB 2Q3PA 2JZ5A 1FX4A 4S0MA 3GZ7A 3I5CA 5DDRC 3DRRB 1EARA 3CW2C 3HHLB 2WOMA 2UXBJ 4NI2B 2YWEA 3G6ES 4DXLA 4DFKA 1UKUA 1RGVA 2VFUA 4OZLA 5KG4A 1MW7A 4YDDB 2D7SA 4DLGA 4J7CA 2HZCA 2XLKA 3QSIA 3PJWA 4CO1A 4C8NA 4IH7A 1BE4A 1S1TB 3AB2B 2WB4A 3CDBA 2ZDPA 4DG1A 3QMQA 4QW9A 2RE1A 2J8AA 3OFFA 1HWJA 3MAHA 1VYAA 2JJ4D 2KJVA 1JLCA 4M5LA 4CRJA 2F40A 4KGXB 4ID5B 4WXOA 1DTQB 3D66A 4ZLPA 1SH2A 2Q66A 3VF0B 1XNRJ 2EK1A 2HSEB 3VHQA 2ZKUA 3MURP 2RRNA 1G4CA 3KLHA 5L1JA 3MUVP 3PYDA 4KY3A 2UUBF 3IWNC 4X4SA 1HMVA 2XYGB 3CGIA 3FFIB 1ROFA 1LW0A 4DPTA 4RJVA 4ELTA 2N4DA 1VQ6S 4NA2A 3I4HX 1QUVA 1RU2A 1NH7A 2Z58B 5GAEI 1YZ6A 3OXLA 2BEFA 1ZTWA 3WQPA 4Y2CA 4UT4A 3NL0A 1JWWA 2FHJD 2BOPA 6FD1A 3NAIA 1UPPA 4OHXA 1RYSA 3BBBA 2FHJA 4TY9A 3TQEA 4KHPJ 1WG5A 3MPWA 2N3OA 3H4DA 2I0XA 4YS2A 5F0UA 4K5RA 4WU3A 2G0CA 2GHWA 2V2QA 5HN0A 5FLXU 4G65A 4DG1B 4RUAA 4PRFA 4K4SA 3I9ZA 2H1YA 5KFYA 5HVHA 4FS1A 4M5HA 4JI8F 2W9CA 1S0MA 2VQEF 1CJTA 4QOTA 2ZH6A 4F4AA 1RLCL 1SPBP 2DGOA 1JLCB 1RISA 3P6YC 5KFTA 1HNWJ 2FZGB 1X9MA 4KV8A 4B3MF 4OX7A 1XMQF 3WC2A 2RU3A 3IR6B 4M5IA 1RWKB 4FN5A 3KLHB 2W1BA 1FE0A 3QJLA 4H4KA 2MXYA 3CO9A 2VF3A 1HMVB 5DO2A 2QMWA 1LW0B 3NAHA 2HIYA 4PUOA 3KDNA 3TNVA 4CYUB 4KJIA 5T14A 2HFSA 4RNHA 4PAAA 2GS8A 3ICLA 2UVRA 3L7UA 3F0NA 4X65J 3MFIA 1FWKA 5KFHA 1NDKA 2E1MC 3CDEA 1VC0A 3KJQB 1GMWA 1NBEB 1CQMA 1VR6A 3BGUA 1U45A 4WP9A 4EBDA 3EZOA 3G8TA 4OI3A 4ZHRA 3PX0A 4JI6J 4ZVQB 3QNWB 3HHDA 3C8YA 4OLPA 4IOCQ 3TQ1A 1F6TA 5HMZA 1S72S 1NHKL 4HHJA 3I82A 1Q16B 5CAAA 1VQNS 2V9KA 4DX6A 4ITSA 3V81B 1T9WA 4RW4A 4ES1A 3FSYA 1B3TA 2OFGX 4GO7X 4BHQA 4LFCJ 3ISNC 2EK6A 2CPHA 4LRAA 4CLPA 2HNDA 3ULHA 2IFXA 2DNRA 3H2UB 3PM9A 3V6KA 3LF0A 3B6BA 3CB4A 4P10A 4P7TA 2L9DA 1VQ8S 2ZOFA 2V34A 1SUQA 5A2QU 4Y2KA 4CNYA 1F0XA 2GMHA 1T9VA 3HM9A 4E0DA 2UUTA 4OL8A 3V4IB 3QYYA 2WW4A 3LP1B 4JOUA 3HHEA 4YOEA 4CLUA 2ZBPA 4HTJA 3KNAA 1TL3A 4D3HA 2KN4A 4RWWA 5E5NA 4HDHA 2EVZA 1C1CA 3CJ4A 4OQJA 2JEJA 1AFJA 4NZ0A 2AW0A 3KYLA 3Q8QB 1XMBA 2G2YA 2YWHA 2C3MA 1U1KA 3HDSA 3J80U 4DV4F 2AJ4A 3AJ2A 1RT3A 3KWMA 3PX6A 1VLOA 1QAXA 3DOKA 3TVZA 1JJCB 5E0OA 4AD6A 1FDAA 4RX6A 2FHMA 5K14B 1PIEA 5AXMA 4NLQA 4IOBA 1S59A 3EXCX 2Z4PA 4RUCA 1S6QB 2OMOA 3X3UA 1XQIA 2FY8A 4M63A 4KB7A 2D3OR 1HNZF 3KK2A 1D0EA 4G1IA 4B02A 2FVCA 2IC3B 2LXIA 2A0FB 4LSLA 2MQOA 1TMMA 1WC6A 3LP0A 3A4TA 2ZD1A 3W9HA 2IYGA 1QAIA 2HG4A 1WHVA 1TL3B 1FCAA 4ZVPB 1NK7A 2CQ1A 3UW1A 2HHPA 4RW7B 2DXFA 1HBUA 2F5GA 2RUSA 2VG7B 3FEZA 3UN2A 2KFNA 5ETPA 3T19A 4DQPA 1UL3A 3IBCB 2LP4A 3PW4A 2V94A 3RRKA 3NLCA 3H42A 4QPXA 4XAKA 2RDDA 4X66J 2H3EB 4MAKA 1CSJA 1GXTA 2BYCA 3N79A 1UFKA 3BPDA 3BSCA 2XY6A 2LFVA 2K1RA 3CT9A 2L08A 4HYKA 4PYAA 1I6JA 3MM5A 3DXBA 1S9GB 1ZM2A 3CMES 3NOCA 5T7LA 4O3PA 4G3IA 2GHPA 1UZDA 1WWHA 3NG8A 3Q86A 3EVMA 1DURA 3P96A 4F8RA 2MEWA 1HWIA 5ETVA 3CJRA 4QYZK 4CT8A 3BZQA 5HMXA 3CDWA 3U1MA 3OUYB 1OSDA 2XM3A 2U1AA 4B3TJ 4UF4A 3KK2B 4DDFA 5DQIA 2ZH8A 3MCNA 4DQIA 2XMTA 4C9DA 4U8VA 1S0VA 3CTRA 1EP4A 3LP0B 1ZAWA 1SJFA 4OV6A 4Y2AA 1H98A 2ZD1B 3GYNA 3POTA 1N36J 4NLRA 4OZ2A 5DRKA 2DRBA 2VG6A 1ZH5A 3I32A 2YQ0A 1HBUB 3FNNA 5ETNA 2VBXA 3Q8YA 3IR5B 5KFDA 3NNHA 1S1VB 3RBXA 3WX4A 1R3NA 5A6WA 4Q2LA 2XSFA 1SI9A 4C2MA 1RBAA 3E3XA 3V6HA 2ZH5A 2GAHC 4KFBB 5CHCB 3IRXA 3LO3A 4MKVA 2KDOA 3QT6A 1NK5A 5D8HB 5D4LA 1I5OB 2K1RB 2F8HA 4QWEA 1TKTA 2UZAA 3MM5B 3T3FA 2OSQA 3X1LB 2P8IA 2CPIA 4P75A 4ZK7M 4UQTA 2GVZA 2HWIA 3C16A 8RUCA 4RU2A 3HXMA 1C0UB 1IVZA 4ID8A 4C48A 2XQCA 1MLAA 2C2OB 3QWPA 4MYUA 2W7PA 3KFWX 5K8OA 1C0TA 3PY8A 4WFYA 1EQMA 4JI0F 2D74B 3CE8A 4ICLA 4OZ1A 4ZOSA 3T9NA 1WOPA 3WZ0A 4N56A 3C15B 2VONA 1F5AA 2FJEB 5L9NA 1EP4B 1U1QA 1X31C 3POTB 3TEHB 2HLTA 3MMCA 1YJ7A 2LVWA 5L1LA 3L4BC 3AJ1A 2KVIA 2VG6B 3DOMB 1T3NA 2PDAA 3BBCA 1RJJA 2Y1IA 2XMMA 1N5QA 5D78A 1NK9A 2FLNA 3LGHA 4OHWA 5HMWA 4OYWA 2RU9A 4WFNQ 3FEYB 1R8HA 4YP3A 4Q0BA 2HVZA 3DGPB 1GT8A 3HHNB 2RAQA 2F4FA 3FC9A 5A0YA 2XZTB 1RTHA 3NRBA 5L8RC 1RTIB 2DJWA 3AXMA 4MKYA 4ZP6A 4K0KF 2ZVIA 4KH0B 4KC5A 1TKTB 5KT4A 5AE2A 4CWBA 4I69A 2GX8A 5I3UA 1H2UX 1C1BB 3C16B 3CCSS 3W1YC 3M8PB 3PACA 5LJ3Y 2YWGA 1GH8A 4DHVA 1RP5A 1UVKA 3HKZD 3T5JA 5SUHA 1Y3JA 2W9BA 1TAQA 4YQWA 4K4XA 5F8NA 4KGVB 3I55S 3NWGA 1NUEA 3HSGA 4B3SF 3GTYX 4MK9A 2DNQA 3TUZC 3DOLB 4LRDA 2AX0A 4BC9A 3OPKA 1S7IA 1PILA 3MMCB 2QLFB 4P2SA 4M5DA 2R3VA 3ZZZA 1IBCB 5J1EB 4ZA1A 4M1KA 4K2JA 1JXEA 3J7A1 4KBIA 3UNYA 4Q0BB 1TFWA 4ILRA 2BDPA 3H8YA 4K4YA 5LT5A 1HFEL 5I3QA 3UPFA 4OJ1A 3HVRA 3JXOA 3MEEA 2J0XA 2FJBB 1UVLA 5KG2A 3W9JA 1AROP 2D41A 4DL6A 4M5NA 4AL7A 1QVFR 2QJ3A 3GFZA 4DV1J 1UWBA 4KHRA 1VQYA 5I3UB 4X4UA 4QCLA 2IYIA 4YFUA 4DMZA 2ZHOA 4OJGA 2QRRA 4DFMA 1Q8BA 4ZIWA 3SQGB 2W9BB 2Q6CA 3I0RB 3ZTOA 3NGDA 2D3O1 4WPAA 2IRUA 2L41A 3Q8VA 4MK8A 3Q8UA 4EYIB 4XDDA 1N34J 3FMWA 3O5TB 1TU0B 2XULA 4DR6J 3AHPA 3NOGA 3R5CA 2B8QA 2DISA 5H9FJ 4EBEA 3PFOA 4H4MA 2WRMA 2CXEA 3RGIA 3CJKB 2HFVA 3AA8A 4EUVA 1SL2A 4GKKF 3UCUP 4J9MA 3TJ9A 1F2HA 4C6AA 2HMIB 1B7YB 3R27A 5B0EA 3PKYA 2L9WA 4CLTA 3K5MA 2R7XA 4WE1A 3OVBA 2KVQE 1SC4B 3QGIA 4PG4A 2KJWA 2L3MA 4DV3J 4HVZA 1U7LA 1J5OA 4N7TA 4DV6J 1NU4A 3BYRA 1RBLA 1HYSA 2DHAA 1UWBB 3FBCA 3CD0A 4OZJA 9RUBA 2MQQA 1HI1A 1CS4B 4F04B 2DHGA 1Q7YT 5ADZA 2EWHA 2VU5A 2NSBA 2Q1LA 2PE8A 2MZSA 1FTRA 4MK7A 3VGSA 4A8WA 2XWXA 4R0JA 4FVCA 3C6UA 4JI4F 3MMAB 3A12A 4EK2A 4WZMA 3J7YU 1C2PA 4WYWA 3MM8A 4RR5A 1M0SA 2AX1A 3GB0A 4MIBA 2PMHA 3D1QA 1O8BA 3C3LA 1FJCA 2W2MP 1GFWB 1NDPA 2KG1A 4DSFA 3W65A 2RUGA 1WC4A 2RQCA 2Z2ZA 4ELUA 1YHQS 2WAQD 4ECUA 4YHHJ 1RK8A 2G2ZA 2XY5A 1HHQA 4IH6A 3D3BJ 4MFBA 2YNIB 2O5DA 5DS7A 1KQKA 3DLGA 1VBYA 5KT2A 1KKHA 3KUHA 4MMOA 3UN5A 1HYSB 4RNFA 3N6MA 4ECQA 2IA6A 2Y0SD 1IUJA 5JJBA 2DIUA 3LPEA 4WJBA 2HNYA 4QYRA 2HAFA 4QWBA 4B3RF 2QSWA 2SXLA 2F8EX 4DCOB 3LH2S 3WDOA 2R7TA 4AXJA 3MM8B 2RT3A 3N28A 4ECZA 3ZZPA 2HS4A 3ITHA 2LEBA 2GQ2A 2DGVA 1TR0A 1Q79A 3HJVA 1KWMA 2HFUA 2OEJA 3D68A 4YB1P 1W2IA 1FF2A 5LMNF 3CCUS 2DPJA 1N52B 1H2TZ 3SDEB 2FVPA 3VAGA 3MFHA 1JKHA 2YH1A 2RB7A 2K06A 4B9MA 1Q8KA 2DYAA 3HD2A 1PO6A 2HZAA 5E3AA 2C3PA 4EI2A 4OYXA 5ETKA 3TUJC 1RU1A 3R1HA 2YKNA 1N32F 5D15A 2QL5B 3ET6A 3QSYB 4O3RA 1I94F 4NYPA 3SBMA 2ZBCA 1T94A 3I9V9 4FDFA 3WHIA 1UZHA 4IOAQ 1WEXA 3MR7A 3QT5A 3QBCA 3VVTA 4EO6A 2MPUA 4USIA 3CCLS 3NS7B 1DLOA 3HHKA 4WFAQ 3MCMA 4FXVA 4LR9A 5A8RA 3J81Y 2HGMA 4I67A 2N7CA 4NLUA 3PRBA 4CH0S 3QAUA 2GJFA 5HQMA 2O3DA 3BGOP 3H2LA 3R7BB 2G0IA 5D3GA 3OJUA 2WK4A 1IKWB 3MMJA 3HHLC 4DV0J 2KZMA 1LW2A 1TELA 5KFBA 1Q78A 2RH3A 2E1AA 3NS5A 4I2PA 4NMLA 3JSMA 1HBNB 2APOA 1S1UA 2NR0A 5KFEA 1FDDA 2NREA 2E29A 3ILIA 2AJ1A 1S76D 1RAAB 3R7SB 2DR8A 1CJKA 4DR2J 3K59A 3D67A 2OMLA 2B4OA 3ENVA 4OYBA 2UXCJ 2DNGA 1FVQA 2B5JB 1N33J 2X1BA 1WACA 3GFYA 3RB0A 3PR4A 2BM1A 3ET6B 4CDIA 1FT8A 3F56A 5GVQA 2NXEA 3QZ8A 3VWSA 3QQCD 1CQNA 2VC1A 4ALZA 2ALZA 1X7VA 2MGZA 3PW0A 1HR0F 1SV5B 4KH1B 5A8KA 3K2YA 4FXWA 4X64J 3CJTA 3VQSA 5ETMA 5D3GB 1MWYA 3FGVA 2YVSA 2YQ1A 3EWGA 2PMZD 4PZVA 2FTRA 4P74A 4N8OA 1LW2B 1PJ6A 5F0WA 1NPPA 3T41A 4EBCA 3IO1A 4K7QA 3DRPA 2ASLA 1HNXJ 4GMKA 5FD1A 1PSDA 4F26A 3OLBA 1RAIB 4NWBA 5KFNA 3PFEA 3P49B 4H4OA 1Q4RA 3U1NA 4OYIA 1Y5NB 4H54A 2JSXA 3R5BA 1CJKB 4NZ7A 2HHHF 3H2VE 2DR9A 2VG5A 4IRKA 2JVOA 2UVVA 3K17A 4NLVA 2KI2A 1NB7A 4KO0B 1NJXA 2CZ4A 1RLDA 3G86A 2BUNA 2M4MA 2HBQB 2OSRA 1AUSL 2DNLA 2AZ1A 1FNOA 1YDLA 4KKOA 2FHKA 3LP2B 3BKUA 4ZKAA 2MGZB 2RDIA 4DZDA 7FDRA 2UXBF 1HQEA 2CQ2A 3SI8A 3HVTB 2RF2A 3BKTA 1TMJA 3Q24A 1VCTA 5CCLA 3GJTB 4OYMA 5A8KB 2B6AA 2IAJA 5M2PA 2Z30B 2ZDOA 1CBKA 1ZAVA 1RBOB 1VRUB 1JX4A 5F8LA 3BS9A 1S1XA 4ZCIA 4NEZA 5HSPA 2Z2MA 3B8HA 2J7UA 1EKSA 3QGHA 1DARA 3DU5A 5HAOA 4RW6B 2FHOB 4I4BA 5GADI 2GQQA 4H4OB 3R5DA 5D6GA 3O1LA 3TYTA 1KBRA 2KYZA 3K0JA 1XNRF 2V8HA 4Y65A 3EJMA 3U1LA 4DL3A 3DXSX 5EN1A 4X4QA 4Y2MA 3CDAA 2VG5B 2C3YA 3KJFB 2Y0BB 3ETOA 1JLBA 3GLJA 2NYIA 2CPJA 4RW9A 1P1TA 3VV2B 4BLGA 3BBFA 1TL1A 2RRBA 1TTHB 5DZ6A 3EPGA 2AGQA 1KDNA 2BABA 3OSNA 1MN7A 3QFWA 4FYYB 2UV8G 3HFVA 4H4KC 1Q95G 2MKCA 4A8KA 1IQZA 2QZ8A 1D8YA 3BGRA 2NZ4A 1L3UA 1HQEB 3KLIB 3R6LB 2DHHA 5CQGA 2F9DA 2OELA 2CPEA 2WVEA 2B6AB 2IAJB 3T6JA 1VBXA 4KHPF 3DRSA 3SFGA 4Y0FA 5J2QA 2VZ9A 1S1XB 3K5LA 4TN2A 5FIIA 4WWSA 3IG1A 3PXGa 4OJHA 2Y8YA 3PO4A 2MQLA 2XCPA 4URSA 1MNEA 4NCGB 1RABB 3I87A 1WKJA 5EX0A 1HNWF 3VVUA 3MGJA 1FX2A 2DBBA 3ZTRA 5I42A 1LXNA 1ZZFA 1N0UA 4FVMA 2M0GB 4KT0C 1Y5LB 5D4PA 4B9SA 2KT2A 5DG7A 2J7WA 3VCDA 4PQAA 4NLOA 4HI1A 1S9EA 2YNGB 4P2XA 2LU2A 3OVAA 5M2UA 4RW9B 1YSJA 1SH3A 2R2UA 2PA3A 1R6YA 1TL1B 1LV5A 2IM3A 4AT1B 2OD4A 1YJRA 2MKKA 1X4EA 1UJ6A 4WCEQ 5F8MA 3EX7B 2NPFA 1IJFB 5ETTA 4OFZA 3BGRB 3EE3A 3KJNB 4J9SA 1TKDA 4X65F 2GMJA 1T3OA 1RHKB 3UDEA 1VC5A 4DUYJ 2CJQA 1HPZB 3BO2A 3CMAS 3LAKA 3DRSB 2DGTA 2OD6A 4ETXA 4ZVRB 4J9QA 2CIMA 4JI6F 5J2QB 1RYRA 5C42A 1WI8A 1TQLA 1SVDA 3IG1B 5I3PA 3KOAA 5DJBA 3UFCX 2IIHA 2X7IA 5AJ3J 3KMQA 2QMXA 2WW8A 1OSCA 1F9FA 4LFCF 1S0NA 3UDVA 2W8KA 1KLMB 3ZZUA 2ZBQA 3ZNUA 2LKZA 1OPIA 2OLWA 1OYEA 4AXIA 2OTLS 3TW0A 1OYDA 4FF3A 1S9EB 2MZ1A 3US5A 5IQQA 3K5OA 1FKOA 1VGYA 3ILJA 1RWMB 4Y2IA 4EMDA 3OL6A 2KRRA 4C8KA 1R6VA 4DX5A 1ICEB 3OTOJ 4OX9J 4JYAJ 1HNIA 3MM7B 1LWCA 3SQOP 1XIQA 2XHCA 1FD8A 2CG4A 4V1Ak 3R7NB 1RWUA 4R0EA 3H25A 1WSVA 1HD0A 2RQ4A 2FZKB 2C2EA 3L7OA 4KPYA 1JLGA 1HHTP 4KTQA 2V67A 4NOHA 4U67Q 3H7HB 1HBOA 3G6YA 3PEHA 1NXIA 3BV8A 1SL0A 5FDLA 3MUTP 2I5JA 4FKXA 2C2RA 3G8SA 1EAYC 2D1CA 5B0GA 4CH1A 4RNMA 2R8KA 3O44A 2M8DB 3Q23A 2J6UA 2CPZA 4DSJA 5IC4B 1K0VA 1I51B 2UVWA 4UZBA 3PW2A 1VISA 1IBKJ 5KT7A 2F4VJ 5GAGU 3W2WA 4A8QA 1X4CA 3JS9A 4Q7AA 5AT1B 4GVLA 1CVJA 1K44A 4PXEA 3GPAA 2Y9HA 1B70B 2HHWA 5K5MA 3I31A 1U8WA 3Q2SC 2HHVA 4BWJA 4ZP8A 1SC3B 1HNIB 2MZRA 3CEDA 1LWCB 1BXNA 4LF5J 4QIWD 2MSSA 3EGZA 2H4WB 4NE9C 4WP3A 2C42A 3GSIA 3MI7X 1T9TA 4XTTA 2JX2A 2V8PA 3CXCR 2NLWA 2RRAA 5H9EK 3M2RB 3MM6A 3CD5A 1NSQA 4QZVB 3HULA 1IKVA 4X66F 2MMYA 3QIPA 1JLGB 2MY8A 3EYZA 1KTVA 1BQMB 3V2UC 3I5AA 3T6BA 1DFDA 5D77A 4M95A 3GV8B 3PW7A 1MG7A 3A3NB 2A18A 4OIXA 3H5UA 2RHQB 1LEOA 1L3KA 1KOOA 1FXLA 5C25A 2VPWB 1NJIT 3T9ZA 1HI8A 3R97A 3KK1B 1VQSA 4QIVA 2F63A 4B3TF 2CNNB 2VASA 2EW9A 4TY8A 2F65A 3D6HB 2J76E 1IM6A 3IR7B 1W7WA 4FYWB 3M05A 1KD1T 2AJ0A 3THTA 6AT1B 2UXDJ 4X4VA 2G9OA 1SIWB 2XGPA 3W5XA 2VC0A 4F25A 1N36F 2CPFA 2E7WA 2R8JA 4WK3A 4DI6A 2R7QA 2X1FA 2BE2B 4X62J 2MY7A 4F4ZA 3SSQA 2GC8A 2RS2A 2NPIA 4DV5J 3UDCA 4O23A 4JBCA 4PG8A 3M32B 4NZ6A 2PC6A 3SIPB 3B82A 1IKVB 1ZA1B 1X9SA 5CYJA 2XSJA 4TNOA 2FJWA 2PSZA 2UUAJ 2HRUA 2OPRB 1NSPA 2V8VA 2ASYA 4KGMA 2OAUA 3S1TA 2ASJA 4LF8J 1X4BA 1FRIA 3CUNA 3UD3P 5C25B 4RO0A 2MLXA 1Z1ZA 3I56S 3N5BA 1CJUA 1NSAA 1FESA 2VBWA 2O1PA 2C22A 2QMUB 4JI5J 4J9NA 4C0OC 1QM9A 1S4EA 3A8EA 1YQHA 4TY8B 2IBOA 2OPPB 4WIIA 1XC9A 3VAJA 1M5PC 1WD6A 1UFLA 4IFVA 4USKA 3PYEA 1VQOS 2XS7A 2MDAA 3EVOA 3C14B 4ECXA 2B9XA 2QTWA 4HH0A 1SXLA 3ZC4A 3OD2A 3M1VA 1LWFA 4GKJJ 2M2BA 2PT0A 5KFFA 2OPQB 3CJQA 1PKUA 2JEFA 2C2DA 1BWEA 4ZPAA 2CQ3A 3FRZA 3HF5A 3GIRA 2W7OA 2EKNA 1U8SA 2V6AA 1NNDA 1BMQB 1BGXT 4MKAA 4E98A 1RHRB 4IG3B 3AQOA 1V3RA 2XHWA 1MU2B 2YWFA 5E3RA 4WYLA 1APSA 2L48A 4UOCA 2W7AA 1IWAA 3W5YA 4TXSA 1Z2LA 1JJ4A 2CADA 3P5BP 2O67A 2YKOA 5DG9A 4CLYA 3PX4A 2RKIB 1ELOA 3P3DA 5A6PA 1BD6A 1VRTA 1YK9A 1HQUA 1OWXA 4AL5A 4FF4A 2HNZA 3MEGA 2LA6A 2CZ9A 3CF5Q 2WHOA 2ZOMA 4KGZB 3W3SA 3UNGC 3Q22A 3H90A 4W4MA 1T02A 2A10A 3M1VB 1LWFB 2ZJQQ 2PD1A 1TUWA 2HPUA 5A2QY 1FDBA 4L6V3 2OEKA 3IXQA 2B51A 3OLAA 2Z2LA 1S0OA 4J91A 1N5YA 1HW9A 1VQ9S 5KFCA 3I6PA 4UUXA 3TWZA 3ENQA 2V4RA 5KFMA 5HANA 4NLPA 1JLFA 4WF9Q 2WONA 1SKUB 4DL5A 2E5GA 3MF5A 4DV1F 2AT1B 4J9OA 4HDGA 3J80Y 1J5EJ 2LQ9A 1U02A 2E9ZA 2ZH1A 2AKWB 3DN9A 1WC3A 4JUZA 1ZOTA 3FBFA 4K5SA 1FRHA 1RKIA 2XBPA 1JMTA 3BKFA 1RT6B 4OLOA 1YJUA 4PXCA 1RCOB 2H5JB 2MYFA 4KR0B 3BQ2A 3H5YA 2DXEA 1N34F 4QR0A 3M8QB 3MM9B 4DR6F 1AZSB 5HL7Q 2D9OA 3MEGB 2DR6A 2YKQA 1XNQJ 2OH2A 4P73A 4FBTA 1G7CB 1P27B 1RT1B 4ZVOB 2NUUG 4KPCA 3TR5A 4LRCA 1JQGA 3DYAA 1U09A 1LXJA 1Q5YA 1ZYQA 1CEZA 3LUYA 4BC7A 4KQZA 1UVNA 2DD8S 2KB2A 3G82A 1ZAXA 1FRLA 2GMLA 5B0FA 1RA7A 1KEKA 3GSDA 3MMBA 1Y11A 5F9LA 1WKLA 2DNHA 1U0SA 3RUBL 2B7CB 4P2MA 4NXNJ 4FXDA 1N5YB 5C24B 5HI7A 1U1NA 2K2PA 4ZCLA 2YQ3A 1GX5A 4JV2A 2BJDA 5CZXA 4Y3CA 4ATNA 1NHVA 4DV3F 1H73A 4DV6F 1RWXB 3FVYA 2KXHA 3DU6A 2B9WA 1R8BA 1QTMA 2LQ5A 1FXDA 2MQMA 4OYPA 2M88A 5F9NA 2LECA 3NNCA 5BR8J 2MJNA 1BQNA 5CD4A 1JLAB 3LALA 2PI5A 3MCOA 3IP0A 1XMOJ 3CCRS 2JLEA 3FKBA 3W61A 1VC6A 3BN7A 1Y00A 5EX3A 1H38A 3IWXA 5IOLA 1A0OB 3ZZYA 5RUBA 4ED2A 2JWNA 4DSEA 3PKMA 1OMSA 2AIRB 4I6WA 3RBDA 1Q86T 2CDQA 1P9YA 1GMUA 2DNKA 1U6FA 3UD5A 1RT2B 2CVEA 2I2YA 1WC5A 2O66A 3QLHA 5KTQA 4QIEA 3BH6B 3DYAB 3MHYA 2HLUA 4WK1A 1WORA 4PR6A 1HKAA 1JLQB 4DX7A 3PG9A 3G82B 1RWOB 8AT1B 4CCHA 1B0TA 2YX1A 2OKQA 5D4OA 1O51A 4ED3A 2AQ4A 4YHHF 1NZAA 3K58A 2HBRB 1WOOA 2QE5A 3KG1A 2E9RX 1VHIA 3TANA 1PC4A 5EWGA 2M9KA 3CWJA 4ILMA 4HL9A 3KJVA 5LOQA 2VKZG 2ILZA 3Q83A 3A3PB 2H5IB 1WKKA 3ILOA 2NYHA 2DITA 3JQMA 3SCLE 3MOZA 1SJ4P 1DQ9A 1BQNB 3NMRA 2VBYA 3CVKA 1WC1A 2E1RA 4CLLA 5J2NA 2CQGA 4QWCA 1K0TA 2GO8A 3N9UC 1CJVB 3O6QA 3RU0A 2RS8A 1MSWD 2KT5A 4DU7A 4G1PA 4HH1A 3OL7A 3QLHB 4XIUA 2KH9A 1SJ3P 2PMWA 1RI7A 1R89A 3FK4A 4ETZA 5GMKa 3KHGA 4FF2A 3M30A 4JV0A 2CZVC 5KFQA 1XEZA 3GG1A 1W2BR 3D1HA 2RMLA 5KG0A 2VHGA 4GO5X 1DTTA 4CO4A 1ACMB 2VOPA 2QIFA 1IKYA 4P6QA 5IV3A
chains in the Genus database with same CATH topology
2RUGA 4DL7A 1P9QC 2FLPA 2HVIA 2RQCA 1OIAA 1R0AB 2MKIA 4UUWA 2AV5A 5KG5A 3KNGA 4ELUA 2IM0A 2FJAB 3L3CA 1S77D 3KK3B 4GC6A 2WAQD 4G1QB 1KHVA 4NLTA 1Q8LA 1YHQS 4ECUA 5LXYA 2RF2B 3ISND 3D0GE 4HT7A 1JJHA 1C0UA 1E6VB 2K3IA 4I6YA 1H6KX 5KFUA 2C28A 3CCTA 1XN9A 1H0HB 1V3ZA 2WSEC 1RK8A 4MTPA 5CA5A 2KM8C 4QBUA 2XY5A 2WBMA 4IH6A 3PW5A 5LSLA 1FK9B 2HGNA 3I0SA 3IC1A 4QR1A 5KFOA 2QO3A 1RDRA 3J7ZT 4MFBA 2X1AA 4QJVA 3VAMA 2W8LA 2YNIB 3BQ0A 1U26A 2KYXA 2O5DA 5DS7A 4Y00A 3DDKA 3C6TB 1KQKA 3DLGA 5KFXA 4LFBF 2MHEA 4WKYA 4R5PB 1VBYA 5KT2A 3HZEA 1M1KT 1NAQA 3GR1A 4R8UB 4MMOA 1HYSB 4CO2A 4QW8A 5KOXA 1FJEB 4KE5A 3OVSA 4RNFA 4J9RA 4AL6A 3N6MA 5HMYA 3GIKA 4ECQA 5J2NB 4LSNA 5B0DA 2IA6A 1IBLF 1UEVA 2Y0SD 3SMZA 1IUJA 4DSIA 1FEHA 4TU8A 4YEAA 5JJBA 2DIUA 4QYZJ 3S7RA 1TV6B 3OSPA 3F41A 2PI4A 3DOMA 2CPXA 4KGKA 5JVHQ 5B09A 4WJBA 1YI2S 2HWTA 1ZM9A 2HNYA 4WFXA 4QYRA 4DV0F 3MUMP 4UY85 1RA6A 2KHCA 4QWBA 4NA1A 3RAQA 2A3JA 5AE3A 4B9TA 1HNVA 2G4BA 2CJBA 2F1FA 4B3RF 3NCQA 5MAOA 2QSWA 4USHA 4Q8EA 2SXLA 2F8EX 4O4RA 3LH2S 2ZHAA 3WDOA 3O2IA 2I38A 4C8ZA 1JLBB 2V4QA 4I64A 3DGPA 4NCAA 3DLEA 2YKMA 3V6DA 1NRKA 4F4KA 4B3OA 1WEYA 3M30B 4AXJA 2R7TA 5FJ4A 3M6VA 3MM8B 3D2WA 2IJNA 1HA1A 2RT3A 3FEXB 3N28A 4OHVA 4U9RA 3ZZPA 4ECZA 2HS4A 3ITHA 2LEBA 2GQ2A 1TZ0A 3PZPA 2IMWP 4PWDA 4AUKA 1FKPA 3ZZRA 3CJ2A 4O0IA 4MH8A 2OTJS 1RTIA 2DGVA 5KFVA 1TR0A 2NQPA 1Q79A 2RIJA 3V4MA 2BV3A 1GTEA 3G4SS 1RT6A 1YBAA 1X4GA 2POKA 3AY0A 2ZH9A 1G2EA 2KZZA 2GCFA 2GJIA 4ZPWR 2R2RA 2JRSA 4YB1P 4DR2F 4JI1F 1W2IA 1FF2A 1YWXA 4AE5A 3HX9A 5DG8A 3RW7A 5LMNF 3CCUS 2GFFA 2DPJA 1N52B 2UXCF 3RR7A 4IQXA 2CQ0A 3I96A 3M8QA 3MM9A 4I2QA 1C1BA 2CJ9A 2RJZA 1N33F 4C11A 3M8PA 3CJ3A 1H2TZ 2E5HA 3K8VA 3SDEB 4B08A 2IMOA 4IDKB 1QLNA 3W2VB 4DUZF 2FVPA 2FLOA 4DL2A 3VAGA 3M9OB 3MFHA 4MKBA 5KG1A 1JKHA 2M7SA 3QGGA 4NA3A 5DETA 3CCJS 4UQGA 2YH1A 2RB7A 1RT1A 4RKUC 5L1KA 4I1TA 2QSFA 4B9MA 2E7XA 1TL5A 2B56A 2W24A 3CCVS 1UETA 3JYTA 3KLFA 4AYBD 1PO6A 1U4BA 4YB7A 5E3AA 3U27A 1DBDA 1L3TA 4IUFA 2C3PA 2R7WA 2FB0A 3MD1A 4PCQA 4U6PA 2WOMB 1SJ1A 3DCAA 3T5KA 2V9WA 1T95A 2QA2A 4RBTA 4ES3A 1URRA 3TUJC 1OPZA 4IRCA 3SSSA 5H1SV 1UVIA 3M2UA 3GYXB 3AQPA 3CC2S 3R1HA 2YKNA 2RQMA 1N32F 1EETB 1Q8IA 2I8EA 4LSNB 1I94F 4O3RA 3PRDA 4NYPA 3DOLA 4EFAC 2ZBCA 4URQU 5C24A 1T94A 1VOMA 2DVIA 4OX8A 4RWXA 4BDPA 4NLGA 3I9V9 3VZHA 2CKWA 3OHBA 2ZJRQ 4IOAQ 1WEXA 5KFGA 4EO6A 2NS1B 2MPUA 4USIA 3VAHA 3CCLS 1UVJA 5L1IA 1DLOA 5I42B 3KLGA 2DHSA 3K5PA 1SKWA 3HHKA 4WFAQ 4FXVA 1QVGR 2B9YA 5A8RA 1LK5A 1ZETA 1FVSA 2HGMA 3J81Y 1QJHA 1VHFA 5J1EA 4I67A 3DLJA 2N7CA 3DI6A 1HNVB 4WTYA 4NLUA 1MMNA 4CTAA 3PRBA 1H7XA 4R25A 3HFKA 1HNXF 4CH0S 3TVKA 3QAUA 5LJ5Y 2CFXA 2KT3A 2O3DA 3IGNA 2XS2A 2YKMB 3H2LA 4B3OB 3H4BA 4MIWA 3BO3A 2BRLA 3HMJG 5DM7Q 5F41A 1KFDA 2J9CA 1VQ5S 5D3GA 1T8EA 4IG0A 1ZBTA 2E66A 3OJUA 4ZVHA 2WK4A 5JVGQ 1IKWB 3MMJA 1K73T 1ZPVA 2P9GA 1X5OA 1FKPB 3HHLC 5D4NA 2ZNZA 1XWLA 1JLAA 2IJFA 1X5SA 3CCWA 4CIOA 5KFPA 2KZMA 1LW2A 5KFBA 1CLFA 1Q78A 2RH3A 2E1AA 1KONA 3OXGA 3NS5A 4I2PA 4NMLA 4ZP7A 3JSMA 4DSKA 4JI7F 4I6AA 4ZPTR 5HLFA 3WBZA 1HBNB 2P5VA 1HARA 2VPXB 3SCKE 2JHEA 2C3OA 2VQFF 5E2QA 2APOA 3GIIA 3E51A 2ZE2B 2VOOA 1S1UA 2FIUA 4I2QB 2NR0A 3BSOA 2G1DA 3CCZA 2VPZB 4C11B 2VFTA 5KFEA 2LA4A 2VKRA 1UVMA 1V9OA 1FDDA 1RT2A 2K3KA 3G71S 1GXUA 2NREA 1XBWA 2DB1A 4PG5A 2E29A 3SQGA 1GTHA 1U24A 2AJ1A 3OBIA 2R9LA 2AJFE 3MEDB 3GV5B 1S76D 1FE4A 3L09A 3I0RA 3LQVA 2DR8A 2KO1A 1WTFA 1KLNA 5C42B 3DHWC 3JYTB 1JNRB 2HS0A 3HP6A 3K59A 4WXWA 3MR6A 2OMLA 1GQEA 4K4VA 1JLQA 2B4OA 3T1YF 3LWMA 3ENVA 5HROA 1IXKA 4O3SA 1NJZA 2XWYA 1R7IA 1Y7PA 1Z2ZA 1FVQA 2DNGA 3IAM9 3KHHA 3CC7S 1SKSA 1L3VA 2B5JB 3M2UB 4MJKA 5AXLA 4Z37A 3KTQA 2X1BA 5J2MA 3TAQA 1WACA 3UR0A 2GJ2A 3GFYA 3RZAA 3RB0A 3PR4A 2BM1A 2GV1A 1FT8A 3F56A 4RLEA 3OW2R 3CSKA 3EUNA 1SJQA 2E5JA 5GVQA 1B7FA 1X5TA 2F7VA 4C97A 4UY8T 4F4WA 2BQ3A 3CIZA 1VMBA 2F3JA 2HRYA 1W25A 3QZ8A 3VWSA 1M5VC 5CXTA 3CD6S 2HQIA 1CQNA 2VC1A 3CJKA 4ALZA 1D9DA 4N77A 2DGSA 5KFRA 5IQ6A 2ALZA 1R27B 1Q53A 3N6LA 4ED6A 2EI5A 1X7VA 1XERA 2WTFA 3ZZOA 4Q2MA 3TO8A 2ZM6F 3K5NA 1X4AA 2MGZA 3NNAA 1Y9OA 3PW0A 2EFGA 1SV5B 3CCMS 1HR0F 2DH8A 3DI6B 4O4GA 4ZS6A 2HMIA 4X4NA 4YR0A 2IBKA 2DIVA 2W9CB 1U1OA 2JC1A 4A47A 5A8KA 3K2YA 4FXWA 5EWFA 4CO3A 4HEA9 3BSNA 4A8YA 3VQSA 4C8LA 3NMAA 1N5TA 1PC5A 5D3GB 2JEIA 2R2SA 1MWYA 4IG0B 2KXFA 3KMSA 2HFOA 2VA2A 4KV8B 3FGVA 2BANA 2COLA 2YVSA 3VR1A 1FKOB 2FDNA 2PMZD 1T7PA 1VJWA 5K9FA 1D8ZA 2FTRA 1Y5IB 2QYCA 3HZGA 5KFJA 4N8OA 1LW2B 2HW3A 4OI0A 5F0WA 1D9FA 1X9WA 1ZZNA 3MOJB 4EBCA 3IO1A 4F50A 5HLFB 1NO8A 5CYQA 3DRPA 1X0FA 2ASLA 2YTCA 1S6PA 4U7UK 2DR7A 4GMKA 2FJVA 2DRAA 1N5SA 5FD1A 1PSDA 3F73A 2KU7A 1CPZA 2YNFB 4EO8A 4OZ0A 3HT3A 4F26A 3OLBA 1IN0A 3L95X 1U2R