3MDSA

Maganese superoxide dismutase from thermus thermophilus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
203
structure length
203
Chain Sequence
PYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Manganese superoxide dismutase from Thermus thermophilus. A structural model refined at 1.8 A resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 72
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3mdsA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3mdsA02
1I0HA 1EN4A 1XDCA 1P7GA 4C7UA 3OT7A 1WB8A 5AG2A 1MMMA 1PL4A 3BFRA 1AVMA 1XILA 4JZ2A 1GN6A 3TJTA 3AK2A 4X9QA 1N0JA 4JZGA 3C3TA 1GN2A 1IDSA 3CEIA 1IX9A 1I08A 4YIOA 1MA1A 1XREA 2QKCA 3LSUA 2ADQB 4JYYA 1WB7A 1AR5A 3AK3A 1KKCA 3MDSA 1MSDA 1ZUQA 3AK1A 4BR6A 1PM9A 1LUWA 1IXBA 1EM1A 1AP6A 1GN3A 1BSMA 4F6EA 3DC6A 4E4EA 1JR9A 2QKAA 1MNGA 3IC9A 2CE4A 5A9GA 4GUNA 2CDYA 1ZSPA 1GN4A 3DC5A 2RCVA 1N0NA 3EVKA 1B06A 1JA8A 1ZTEA 2P4KA 1EN6A 1D5NA 3KKYA 1LUVA 1ZLZA 3C3SA 1AP5A 1VARA 3K9SA 4FFKA 3QVNA 1Y67A 2GDSA 3RN4A 1SZXA 1QNMA 1XUQA 1AR4A 1EN5A 2AW9A 1BS3A 1VEWA 1BT8A 2ADPA 4YIPA
chains in the Genus database with same CATH superfamily
3FKSG 5FLXN 2IH1C 1D5AA 1OZ0A 3ZHQA 2AZ0A 2W0XA 2QJ1A 1R73A 5CB4A 1BCCH 2AXTZ 3UO2A 2IW5A 5E79Z 3T1CA 5JJNB 2LGWA 1M56C 3GWKC 3AK2A 3OR7C 2ZCEA 3OUFA 3QG5A 1M57C 4UUJC 2DYRB 1IJGA 4KXRA 4JI7O 3KG2A 3CC2V 4PDMA 4X1YB 1K5QA 1SETA 2QE7G 2HEPA 4R8CA 2JVDA 4H13B 2JGDA 4MS2A 4EB6A 4LF7O 4TQDA 4LFCB 2ZIMA 3CHXA 4GX5A 1LUWA 3BRCA 4QE7A 4QNHB 2PZSA 1HR0B 2KG7B 4HYOA 3AG3C 1KC8W 1N32O 1SQBH 4JYCA 4DUZO 3EXAA 1Q6UA 2EILB 5IYDO 4HAMA 5KA6A 1ZL8B 2HLDG 1R3KC 3B09A 1SQGA 1KP3A 1VQ4V 4LFBO 4WBNB 1W0JG 1AR1B 1PV0A 3AEIA 4QPJA 4O2BA 1VF6A 3THOA 1JX9A 4YJ3A 1Z2GA 1PNMA 1JJOA 2XHBA 5B1BB 1US6A 1O9GA 1Y76B 4IIJB 2HKOA 3L71H 3E8BA 1XMQB 4JI4O 1WP7A 2A9HA 2NN4A 2VS0A 2UXXA 3STZC 4MVRA 4YHHB 4I5SA 5J2UB 1MMMA 3M8AA 5JVDB 4PELA 3CCMV 4CS2A 2HVJC 3QNEA 1F51A 2Y69B 5LXTA 2PY5A 4JI5B 3M7MX 1W59A 3FYEB 5JJEB 3CD6V 5B1OA 4FFBB 3JD2A 2IJIA 1SS3A 1OCZC 3T4DA 2A7WA 2YIDA 3D3IA 1CEZA 3AG2B 3TXSA 3P32A 1JQ0A 1DGSA 1D2DA 4H44B 3CRAA 3RVZA 3P3NA 2M7WA 3CCQV 1K3EA 4MT8A 4FLTA 4QPKA 2YXHA 4H0LB 4E4EA 4ASUG 4ZKIA 4MVZA 4D7SA 5BMVB 5B5EZ 4LF4B 1R3IC 1IZ3A 1QCEA 2OWOA 2CAZC 1JA8A 2F66C 3T4ZA 4F4LA 1SQPH 5LMNB 3BABA 3D3QA 1AP5A 4MTFA 3ETGA 2E5LB 1XNRB 3AG1C 4CBCA 2WAMA 4GCZA 1JJ2U 1SZXA 4NKGB 4UB6Z 3B2EE 4EEQA 3N2KA 3JAKB 3CCUV 2YUAA 4U3JA 3ASOC 5CBHA 2G38A 3E8GA 2P5OA 3L72H 3RFRA 4NVPA 5L3EA 1JVMA 4LFAO 4B7EA 1BQZA 2Q4PA 5LBQA 5B1AC 3JD1A 4JYBA 2WA3A 1V54C 2GV9A 3SGIA 5AG2A 1URFA 4K3AA 3IAYA 4B3TO 5GW7A 3ETDA 3JARB 1KMIZ 3CCLV 2LW7A 4JI2B 4AQYB 4O4IA 2WWWA 1N0JA 4P2ZA 4J7JA 2RDCA 1XNQB 2FL4A 1HNWO 2W6IG 2QKSA 1IDSA 1DF4A 1TVKA 2P90A 4FLXA 3ZBHA 2ZXWC 2Y0PA 4GKJO 1L8DA 3OTOB 4GKKB 3O9OA 3VQWA 1NTKH 1XREA 4TV8B 5JJJB 3JASA 2P7TC 2Q7HA 2Q6AA 2YIBA 3ZIAG 4WFFA 1BL8A 2WLIB 4DV6O 1F4MA 3MAQA 3C90A 3K3WA 1FJGB 1U96A 4O4HB 4RAIA 3CSXA 3K5OA 3B40A 1HNXB 5FNVA 3G67A 4O4LA 3VQYA 1U97A 1GN4A 1FFXB 5IWAB 5KMGB 5KHHA 4Z1MG 1K92A 4DR1O 4K8ZA 4BAYA 4E2LA 2WLLA 2CUGA 4DK0A 4RQEA 3J81N 1VQMV 3G6BA 3L9DA 2UU9O 1KYOF 3WU2Z 5JH7B 2A06H 4LFCO 1H2LA 2Z3YA 1CXZB 1HR0O 2EBOA 4W4LA 4NXNB 1K5SA 4B7KA 2GBOA 2UUCB 4Q6GA 3ABLC 1PNKA 3H1IH 3RGBA 2DWDC 2PYJA 3IGAC 1JFFB 1YCIA 1WLEA 1JCHA 1N36B 3ASNB 3ABKB 5DM6V 2BOBC 3F5WC 1VIBA 5B3SC 1JOYA 4ICGA 4ZI7B 5LYJB 2JGUA 4JI7B 2QM4A 2QWPB 3B8MA 3C3TA 2LO1A 4YY3O 3CPWU 4EFBA 2RJZA 1L1FA 1YIJV 5CMUA 3P3PA 3JCZA 1YJWV 5JQGA 4PA3A 2QGNA 2KB1A 2JDIG 3BAAA 4YJ2A 4I50A 2YXYA 1XHZA 3EHBB 1XBLA 2P06A 3D8CA 1J95A 1EFRG 3RWRD 2W6JG 4FLWA 4JTCB 2WLKA 5EC1C 1R6TA 1QVFU 4MVSA 2OIEA 5LMUB 3JATA 1K9MW 4LNUB 1SF9A 3CRCA 1H38A 1GMGA 4LFBB 1PP9H 4MSWC 2ZINA 5LHHA 3ZRXA 2D2CB 4DO2A 2CTRA 2BTQA 5FPRA 3OFNG 1OCCC 3BPZA 4ZBMA 3I55V 2HHHB 1MOFA 2QWNB 1SZTA 4TQFA 4HNAB 3LDEA 2QSAA 2DMXA 2W0FC 4XDJA 1NVPD 2ITDC 4LF4O 2YC0A 2AHYA 1HDJA 2RMKB 3JYCA 2XAJA 1P7GA 1F23A 2GUZA 5LMNO 2K1EA 3T2MA 1PD3A 3SJAC 4CS3A 2AGAA 2PTMA 2E5LO 2YXLA 1RM1C 1XNRO 3HKBA 2ZKOA 3HKEA 3AG7A 3FD9A 2X0LA 2PI5A 3TETA 4HZ3A 1M5IA 3H1JH 1FXKA 4DV2B 1LR1A 5L3GA 1Q86W 4TOIA 1AI4A 1NTZH 3JALA 5H9CA 2Q9LA 5LXTB 2EIKB 4O4JB 4JV5O 3M99B 1M9NA 1NTMH 1PKXA 3F5TA 5LOVB 1XOUA 3D36C 1KQSU 3ABUA 2OCCB 3N2GA 5EZYA 5IJ9A 2BE3A 4TV9A 1YXBA 3JSNA 1YSCA 1V55B 1BE3H 2EULA 4GYCB 1S3JA 4JI2O 5EIBC 2LW1A 4AQYO 1TUBA 3BY6A 1IXMA 5C8YA 2QWRB 4XDKA 1AI6A 2IJKA 1XNQO 1VF7A 4F6EA 2GHYA 3ABTA 1G6UA 3K5NA 3RYIB 5TISZ 4WFEA 4LWSB 2CE4A 2ETNA 2R9IA 1GTOA 2UXNA 4OGQB 2F23A 1W2BU 3OTOO 5LGUA 3IJ4A 3ZMVA 3JD0A 3J7AU 1I5XA 3AG3B 1EN6A 2B1IA 3CCSV 1DLBA 3X2QC 2E74B 4FZ0A 3ML0A 2UUAB 1OHHG 1FAFA 2CGNA 4LFAB 1I94O 1HW7A 5IY5C 3QO7A 2ITCC 3HKCA 2DWEC 5IWAO 2EINB 1KP2A 3UO3A 1I0HA 3ZMZA 3FB8C 3FFQA 4TSFG 4B3TB 4RWUA 1IBKO 3OGIB 1MABG 4D6TH 2YEVA 4U3JB 1DF5A 1RP3B 4OPHA 2A3QA 4KL1A 2Q0OC 1E1QG 1AVMA 3K79A 4NXNO 4X9QA 1WA8A 1P84F 4JI0B 2RQ6A 4BWAA 1AJNA 2UUCO 4JZGA 1GN2A 4P9PA 2XUMA 5KHJA 2QR4A 3SPCA 2CTPA 4WF9V 3D36A 4O4IB 4ZIBA 1H2GA 2MW2B 4DV6B 1N36O 3ZRSA 4X1KA 4LH7A 4O2AA 2EJ7A 5CA0A 4F6RA 5IE9A 4I0XA 1YF2A 1S5LZ 3AK3A 3QTCA 5D5QA 1N4CA 5GONB 4DR2B 5IDJA 3S3WA 4H37A 3CRRA 1GN3A 3JASB 3JD3A 3BEHA 2PI4A 2UUBO 2Q69A 1JPXA 1K4DC 1QR9A 4JI8B 4DR1B 5KUKA 2H3OA 1N0NA 1NR1A 4L8JA 2UU9B 1D5NA 2ZT9B 4ZOLA 1SESA 5FNVB 4FVMA 5CA1A 1NR7A 3HR0A 4NTXA 2NR5A 1S5HC 1W0KG 4G2KA 1R1BA 1TA8A 3G6EV 5CA3A 1PNLA 4FM2A 4BW5A 4KP4A 1HP8A 1SQFA 3WG7B 2WLLB 2OT5A 3DXRA 3K06A 3OEEG 5LMUO 4DV4O 3BCCH 3VQXA 2AW9A 3OW2U 4LBEC 2JJ1G 2XAHA 2ADPA 4YIPA 1Q8IA 3RYHA 4DR7O 1THZA 3CP1A 1SA0B 4IT5A 4JASA 5C93A 3RYCA 1PL4A 3ZMSA 1SC5B 2C2AA 1MSWD 3BFRA 2HHHO 1QLEB 2KKWA 2ZR3A 1WPXA 1NH2D 4CC5A 2F43G 4X1IB 4YY3B 2QWOB 2R9RB 3Q4HA 4PA9A 1G1XB 3W7XA 1QBZA 2BTOA 4IYHA 1IBMB 4KHPB 4H33A 2ZE8A 5IYZA 3JAMN 1PPJH 1AILA 4J42A 1XQ8A 1F4NA 1R3JC 4K35A 3CCEV 3J80N 3ZRWB 2DYSB 3U0ZA 3OM3B 4DRXA 1Y74A 1PM9A 1XL6A 5J2TB 3CJHA 1AJPA 4DV2O 1EBOA 2JJ2G 3LUTB 4YJ2B 4JI1O 3W7SA 3H1HH 5LP6C 1MNGA 4HBNA 3JCUZ 1SQQH 2JEXA 4PI0A 4AILC 1FOUA 4LF9B 1YTFD 1RSOB 3IC7A 1YEWA 3EVKA 3ZEDA 4BIOA 4I9WA 3ZMTA 3E22B 4X20A 3SPJA 5BR8O 4OPAA 5EBMC 3T1HO 1VQKV 1OCRB 2QEXV 1OJHA 1SQXH 4JGSA 4RQFA 1I5YA 3GWOA 1VQOV 2CTQA 1YI2V 3OMNB 4L87A 1AR4A 5ITZA 2XNDG 3UKMA 2EIMB 3H9VA 4G27B 4W4KA 5BZBA 2R72A 1AI5A 1MZFA 2YI9A 4XDLA 4K0KB 1H5WA 2PF4E 3OR6C 1ROPA 4LCUC 1IVSA 3SJQC 2A79B 3CXHF 2XAFA 1WB8A 3ABLB 3SYCA 4I55A 2NLJC 3WFVA 5L3BA 2V7QG 4X62B 4JYAB 1WP8A 4I4TA 4EKWA 2UUAO 3RYFB 4UCTA 2ZNIA 2YIBD 4MVUA 2VWJA 2F1MA 2EILC 4JV5B 1QVGU 1EZVH 5KHGA 2UXDO 2LGQA 1Y6XA 3LDCA 4I9QA 3HKBB 4PDLA 3HKEB 4JI6O 1MZEA 2B5UA 2X6CA 2DQ3A 3B8NA 5EC2C 1FXKB 3GB7C 5GTIZ 3AG4B 3SJCC 5BY1A 5H2FZ 2BOCC 2BSKA 1GM8A 3F7YC 1VQLV 1AR5A 2WLNA 4ABMA 4FM1A 1S76D 3U11A 1NZ6A 4FJCC 2HJFC 1K97A 5B1BC 4JI0O 2PYLA 4JPRA 4FIPC 2IJJA 5LP6A 3UT5A 1NVPB 4DR6O 4TV9B 2QKAA 3EFFK 4PHZA 3BA8A 4U7NA 4GUNA 4LR3A 3RW0A 2Q5ZA 1ZTEA 2P4KA 3RBZA 1VQ8V 4NTYA 2Y69C 5FPOA 4DXWA 1Q82W 5LHGA 2L35A 4P30A 2DOSA 3MHHC 2ZM6B 3JSLA 1NBMG 2IU0A 2ZE6A 4DR2O 1Y67A 3JAWB 1WN7A 4X1YA 4ZHQB 1I94B 4R50A 4FLYA 1VQ6V 2ODMA 2HR3A 4FPPA 5KHKA 1EZJA 1OCCB 1S5JA 4MVQA 4JI8O 3ZHSA 1UFIA 3HPLC 4LF8O 1S0VA 1IBKB 3APOA 3AG2C 1XDCA 1Q7YW 5CBGA 4B3MB 4MVMA 2XAGA 4TWKA 4I7ZB 1ZX3A 3CRQA 3FAVB 3OEHG 2UXBB 2KG7A 1GK9A 4DR3O 3K04A 4UFZA 2PGGA 1GN6A 3CYOA 3OE7G 1OV9A 4RO2A 5DEDA 1OCOB 4X66B 3ABMB 4U7OA 4PD4F 2HG5C 4WBNA 1FPOA 2YDEA 4WFBV 1Z5WA 2Y48A 2QM7A 1O9HA 3AK1A 4LF5B 4CZZA 1IXBA 5BXZA 1KD1W 5CB4B 3BA9A 4X1KB 2UUBB 4TT3G 1BSMA 1B3QA 2DN9A 1RPOA 5CA0B 4F6RB 1IBMO 4KHPO 3LSQA 5J2UA 2RCVA 3E8FA 3OAAG 4N21A 1Y66A 2LP7A 1DTOA 1H8EG 1S72V 1Q6HA 5LA6A 3ZJZA 3ETEA 5IYCO 2HVKC 3L74H 4IHJA 5DN6G 3ZHUA 2VWKA 3G80A 3WB2A 3U10A 2JGDB 4UCSA 3CMAV 4DV4B 4A5UB 4ZOLB 4EB6B 3L70H 4MTXA 2XTAA 3IFXA 1QNMA 4PI2A 4DR5O 2QWQB 4X64O 4LF9O 1BT8A 4DR7B 2IH3C 3SYAA 1BQ0A 1ORQC 3VQVA 2RNBA 5JWPA 2WLHA 5IY5B 3K0DA 1L0LH 4XBFA 4DW0A 4X65B 2LFRA 4AHCA 1B04A 1CP9A 2IU3A 2EIJB 5DECA 1M1KW 1XILA 4FLVA 1Q3EA 3ZRVA 2FYUH 5BMVA 3E86A 2VQEB 4IYIA 1FXVA 2LFSA 2HP8A 1VQNV 3OMIB 4O2BB 5IYBO 4YJ3B 4RUFA 3P30A 1MG1A 4K0KO 2Q68A 4X8AA 1I08A 4RUEA 4MW8A 2LJ2A 3UQ8A 3ZN0A 2BCCH 4GX1A 4X62O 4JYAO 3OUSA 4P9OA 4CH4A 4X88A 3JAKA 1B6QA 2X7RB 3G4SV 4JI1B 4CH6A 2Q67A 4J7ZA 1M56B 1M57B 5A9GA 4DRXB 2A0LA 3A0HZ 2CH7A 1Q6IA 3ASNC 3ABKC 3JARA 5K1XA 3E2EA 5BR8B 4R6ZA 4GLXA 3T1HB 1ZLZA 3I5DA 4DV5O 1P7BA 3UM7A 3QO8A 3CXCU 3R66A 3K9SA 1HNZB 3F7VC 3L73H 1NH2B 3CRMA 3CS5A 1H8HG 4JAUA 1K73W 2JS5A 4LH6A 4TV8A 5F2VO 4OXSA 1XMOB 4UCUA 3FB7C 1GO3F 1LNQA 2X6AA 3STLC 1GKFA 2WLIA 2YSUB 3SYOA 4MW3A 1NU1H 2V4DA 1ZAUA 4J9YB 1YHQV 4Z1VA 3E8HA 2ZM6O 3KZIZ 2QM8A 4UB8Z 4QE9A 2WA4A 2R9AA 3T1YB 2M6YA 4UXNA 4DV1B 3TCUA 2UXDB 2F93B 3LSSA 1BZKA 1FFXA 1VQPV 5EIBD 4I55B 1S77D 2JK5C 4JI6B 1M4UA 3CEIA 1YTFB 2ATKC 4WCEV 3N2KB 3A0RA 4UCVA 4B3MO 5JH7A 1FYJA 5H6RA 4FLZA 1XL4A 2P4VA 1NT2B 2UXBO 1N34B 4X89A 3OTFA 4K8XA 3K58A 4DR6B 2E76B 3A0BZ 2V1DA 3FB6C 1GM7A 5B1NA 2F95B 1JR9A 1JFFA 4X66O 1K8AW 4OX9O 5EK0A 1H2SB 4IL6Z 3SPIA 2DW4A 2CK3G 2ZQMA 1TVKB 2OYQA 2F4VB 1OCZB 2JEUA 4ZI7A 5LYJA 3C3SA 2JRIA 1JMKC 2YIAA 1COWG 3HKDA 4LF5O 1HWYA 1NJIW 5L3DA 1X4TA 3APQA 2EIKC 4LF8B 2FKXA 1Q5OA 1Q81W 4DV7B 2PUSA 1IURA 4LP8A 1R6KA 4B3RB 1R3LC 2OCCC 3GVMA 3K5LA 4O4LB 1V55C 2EZPA 2ZDIC 4DR3B 3OGCC 3DGEA 2E3CA 1BHBA 3OD4A 3SYQA 2N04A 5K1PA 4LNUA 4QIWF 4CH5A 3ICXA 3N27A 3PJSK 3AG1B 4NR1A 3E35A 1UJWB 3H1KH 4D7TA 3R65A 5EBWC 1GRJA 3ASOB 1QQCA 4IGGA 2QDOA 4UV8A 2QKCA 4FZ1A 4X65O 3LSUA 4PV1B 5B1AB 1FFTB 4HNAA 1V54B 3H1LH 3UCSC 2XT9A 4BR6A 2Q7GA 1AI7A 1TUEB 5LGNA 2VQFB 1K7DA 3K57A 3K08A 2R70A 5D5PA 2OTLV 1EM1A 1Y4MA 2VQEO 4DUYO 5IT9N 1V9PA 1KKDA 2EINC 3E83A 5KX5A 2JS3A 4DYLA 4PDVA 2EX3A 1N33B 2CDYA 1ZSPA 1VMGA 4FLUA 2JIZG 4DK1A 2IM9A 4UVBA 2ZXWB 5L3CA 1SRYA 1J5EB 1DK1A 5JQGB 4QJFB 3LDDA 1VF5B 2FTKA 2O57A 4LF6O 1M93A 2GDSA 1IBLB 1K33A 4I50B 4LC1A 2B9ZA 4O4JA 4J9ZB 4JTDB 5LA6B 4DR5B 5EYPA 4X64B 3E89A 5LOVA 2CTWA 4IHJB 2GTSA 4MVOA 3A2FA 4BW9A 3JATB 1KB9F 3KCYA 1EN4A 1TAEA 2ZDIA 1YJNV 3W7TA 1SKVA 4Z2WA 4GT1A 1SERA 2UXCO 2WLMA 2DYRC 3ZCCA 1HNZO 1VQ5V 4Q20A 2CGOA 3RYIA 2BTQB 4LWSA 3CC4V 3ZHTA 4QGPA 5A2QN 2XOKG 1VQ7V 2N05A 3CE2A 1XMOO 2QTSA 1XI1A 1WJZA 2RN9A 1N8RW 1GAXA 1Q43A 2ZR2A 1IX9A 3L75H 1XEQA 1GH6A 3KDRA 5JCOC 2GTAA 3O65A 2XAQA 4PA7A 1VP7A 4PDRA 2P67A 2XASA 5CN0A 1WB7A 3CCJV 1H2NA 5KUMA 2GUZB 3WG7C 3WB0A 3T1YO 3FB5C 4WFAV 5B3SB 4DV1O 2E75B 1Q90D 3W7WA 4MTGA 3K9AA 4TUYA 4U3FH 2H94A 4WFGA 5IJ0A 4DV5B 3JALB 3KKYA 2AHZA 3DSQA 4GZRB 1KBHA 1QLEC 3CX5F 2EZOA 1N34O 2CH7B 4EFEA 3N2GB 2DQ0A 5EZYB 3SJBC 5IJ9B 2Y4TA 2HFEC 1YDXA 1TUBB 5C8YB 2Q8VA 2Q73A 2WPDG 4DV3B 1VEWA 1UPGA 3H01A 1KU9A 3ETQA 2F4VO 2DYSC 3A8TA 1CPYA 1G4YB 2Z5UA 5GONA 2ZIOA 2KQXA 4JTAB 2QA4V 2OTJV 1NKDA 2KSDA 3SPHA 2L6LA 4UCRA 3CB2A 4JZ2A 2Y4UA 4B3SB 4CC6A 4DV7O 4NXMB 4PA4A 3QO5A 4B3RO 4DV0B 2OCHA 4JI3B 4UVCA 5JCOA 4G28B 4YIOA 3S3XA 4J80A 3LNMB 1E1RG 3HKCB 1OCRC 5EBLC 3TXQA 1M90W 1ZUQA 4DR4B 3K0GA 4GX2A 2ZNJA 1ZL8A 2YEVB 3K03A 4UV9A 4AI8A 1SQVH 2Z0AA 1RM1B 2QTOA 1YZBA 2EIMC 4OX9B 2P22C 1H2MA 1WAZA 4J41A 3WB1A 1WA8B 1SA0A 5KA5A 3DC5A 1K34A 2WSSG 1NI8A 3K59A 2ILMA 4J7KA 4X1IA 4DW1A 5GTHZ 1Y76A 4IIJA 1VARA 5LL6Y 5E1AC 2AZ2A 4FFKA 3SPGA 2VRZA 1K4CC 5KAIZ 2VQFO 4O2AB 3CC7V 3VOUA 1NQTA 4I0XB 3RN4A 1G8MA 3TK1A 1JNBA 5FL7G 5JVDA 2Q0AA 1PL0A 2ZE5A 2IBZH 1N33O 3HKDB 4PA6A 1FKAO 1FXKC 3CCRV 3I56V 3AG4C 3ZRWA 1XMQO 3BHPA 3ZMUA 5J2TA 1J5EO 4J10A 2YICA 1F7YA 4JAVA 4FK5C 4FFBA 2GSMB 4LF7B 4YHHO 1KECA 5CA1B 1TGOA 1IBLO 3X2QB 4FM0A 5L3FA 4JI5O 2Q7EA 1RSOA 1N32B 1QU7A 3ZS8C 4DUZB 3E22A 5KAFZ 2K9PA 4BIUA 3DXRB 1ENVA 3CWBH 1E79G 1R6NA 3SDLA 2FB5A 1P4RA 3SR2C 4JYYA 3B77A 5H6QA 3RVYA 1KKCA 3RYHB 2H8PC 4GX0A 1MSDA 1WPBA 4DUYB 3PN1A 1NS1A 3RYCB 1AB3A 5H5NA 1RPRA 1I7FA 3DC6A 3JD4A 2ZE7A 3Q4HB 4JI4B 1B06A 4FMTA 2MK3A 1FS0G 4WFHA 3BVOA 3RT3C 3RYFA 3KCXA 3ZN1A 5IYZB 5KX5B 5LHIA 4BIZA 4LF6B 4J11A 2WLJA 4JF3A 3QVNA 5HFLA 1BMFG 2IJHA 1OCOC 3ABMC 4CH3A 1BGYH 1Y74B 2DJVA 1EN5A 1H2KA 4CS4A 3CJHB 5CBFA 3NXSA 1BS3A 3TGUH 4YXWG 3MHSC 3QF7A 1YJ9V 3NR7A 4KFMA 1BHAA 4C7UA 3OT7A 2UXCB 3ZHRA 5EYPB 1X59A 2OIGA 5LGTA 1YVWA 4X20B 3TJTA 1YITV 2FMLA 2DE0X 4UCOA 4PJ0Z 1ZWIC 3MD0A 1P49A 4UVAA 3W7UA 4DV3O 1GM9A 1AROP 4O4HA 1QLNA 3OMAB 3VBBA 1MA1A 3FYIB 5ITZB 4MTOA 3LNNA 2D3OW 4GKKO 4B08A 5KLVH 3JAWA 2ADQB 4ZHQA 3K5MA 3ZX6A 3MDSA 4JAAA 5HFMA 1Z5VA 5KMGA 1FXHA 4R7CA 4B3SO 1AP6A 1XHXA 1FJGO 3ZHVA 4I4TB 1KUQA 1QHTA 4NXMO 3IC9A 1HNXO 1T5EA 1A32A 2LQTA 3SYPA 5J9PC 4DV0O 4JI3O 3FAVA 2P6JA 3CCVV 2YI8A 1AJQA 1WNSA 2HJDA 2NNUA 1QR8A 4N23A 1RFYA 1LUVA 2EIJC 4TUYB 5KHIA 2B1GA 1FD9A 3B4SA 5IJ0B 3HB3B 4DR4O 3DTUB 2BSKB 2X6BA 1VF6C 3FX7A 2ZD9A 3CMEV 1VQ9V 2N74A 4KUMA 4NB5A 1XUQA 5B66Z 1HNWB 4NYKA 2Y0IA 1L0NH 2ARHA 3G71V 2YS8A 5LP6B 3UT5B 4NTWA 4GKJB 2EJRA
chains in the Genus database with same CATH topology
1I0HA 1EN4A 1XDCA 1P7GA 4C7UA 3OT7A 1WB8A 5AG2A 1MMMA 1PL4A 3BFRA 1AVMA 1XILA 4JZ2A 1GN6A 3TJTA 3AK2A 4X9QA 1N0JA 4JZGA 3C3TA 1GN2A 1IDSA 3CEIA 1IX9A 1I08A 3KDRA 4YIOA 1MA1A 1XREA 2QKCA 3LSUA 2ADQB 4JYYA 1WB7A 1AR5A 3AK3A 1KKCA 3MDSA 1MSDA 1ZUQA 3AK1A 4BR6A 1PM9A 1LUWA 1IXBA 1EM1A 1AP6A 1GN3A 1BSMA 4F6EA 3DC6A 4E4EA 1JR9A 2QKAA 1MNGA 3IC9A 2CE4A 5A9GA 4GUNA 2CDYA 1ZSPA 1GN4A 3DC5A 2RCVA 1N0NA 3EVKA 1B06A 1JA8A 1ZTEA 2P4KA 1EN6A 1D5NA 3KKYA 1LUVA 1ZLZA 3C3SA 1AP5A 1VARA 3K9SA 4FFKA 3QVNA 1Y67A 2GDSA 3RN4A 1SZXA 1QNMA 1XUQA 1AR4A 1EN5A 2AW9A 1BS3A 1VEWA 1BT8A 2ADPA 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0H A;  1EN4 A;  1XDC A;  1P7G A;  4C7U A;  3OT7 A;  1WB8 A;  5AG2 A;  1MMM A;  1PL4 A;  3BFR A;  1AVM A;  1XIL A;  4JZ2 A;  1GN6 A;  3TJT A;  3AK2 A;  4X9Q A;  1N0J A;  4JZG A;  3C3T A;  1GN2 A;  1IDS A;  3CEI A;  1IX9 A;  1I08 A;  4YIO A;  1MA1 A;  1XRE A;  2QKC A;  3LSU A;  2ADQ B;  4JYY A;  1WB7 A;  1AR5 A;  3AK3 A;  1KKC A;  3MDS A;  1MSD A;  1ZUQ A;  3AK1 A;  4BR6 A;  1PM9 A;  1LUW A;  1IXB A;  1EM1 A;  1AP6 A;  1GN3 A;  1BSM A;  4F6E A;  3DC6 A;  4E4E A;  1JR9 A;  2QKA A;  1MNG A;  3IC9 A;  2CE4 A;  5A9G A;  4GUN A;  2CDY A;  1ZSP A;  1GN4 A;  3DC5 A;  2RCV A;  1N0N A;  3EVK A;  1B06 A;  1JA8 A;  1ZTE A;  2P4K A;  1EN6 A;  1D5N A;  3KKY A;  1LUV A;  1ZLZ A;  3C3S A;  1AP5 A;  1VAR A;  3K9S A;  4FFK A;  3QVN A;  1Y67 A;  2GDS A;  3RN4 A;  1SZX A;  1QNM A;  1XUQ A;  1AR4 A;  1EN5 A;  2AW9 A;  1BS3 A;  1VEW A;  1BT8 A;  2ADP A;  4YIP A; 
#chains in the Genus database with same CATH topology
 3FKS G;  5FLX N;  2IH1 C;  1D5A A;  1OZ0 A;  3ZHQ A;  2AZ0 A;  2W0X A;  2QJ1 A;  1R73 A;  5CB4 A;  1BCC H;  2AXT Z;  3UO2 A;  2IW5 A;  5E79 Z;  3T1C A;  5JJN B;  2LGW A;  1M56 C;  3GWK C;  3AK2 A;  3OR7 C;  2ZCE A;  3OUF A;  3QG5 A;  1M57 C;  4UUJ C;  2DYR B;  1IJG A;  4KXR A;  4JI7 O;  3KG2 A;  3CC2 V;  4PDM A;  4X1Y B;  1K5Q A;  1SET A;  2QE7 G;  2HEP A;  4R8C A;  2JVD A;  4H13 B;  2JGD A;  4MS2 A;  4EB6 A;  4LF7 O;  4TQD A;  4LFC B;  2ZIM A;  3CHX A;  4GX5 A;  1LUW A;  3BRC A;  4QE7 A;  4QNH B;  2PZS A;  1HR0 B;  2KG7 B;  4HYO A;  3AG3 C;  1KC8 W;  1N32 O;  1SQB H;  4JYC A;  4DUZ O;  3EXA A;  1Q6U A;  2EIL B;  5IYD O;  4HAM A;  5KA6 A;  1ZL8 B;  2HLD G;  1R3K C;  3B09 A;  1SQG A;  1KP3 A;  1VQ4 V;  4LFB O;  4WBN B;  1W0J G;  1AR1 B;  1PV0 A;  3AEI A;  4QPJ A;  4O2B A;  1VF6 A;  3THO A;  1JX9 A;  4YJ3 A;  1Z2G A;  1PNM A;  1JJO A;  2XHB A;  5B1B B;  1US6 A;  1O9G A;  1Y76 B;  4IIJ B;  2HKO A;  3L71 H;  3E8B A;  1XMQ B;  4JI4 O;  1WP7 A;  2A9H A;  2NN4 A;  2VS0 A;  2UXX A;  3STZ C;  4MVR A;  4YHH B;  4I5S A;  5J2U B;  1MMM A;  3M8A A;  5JVD B;  4PEL A;  3CCM V;  4CS2 A;  2HVJ C;  3QNE A;  1F51 A;  2Y69 B;  5LXT A;  2PY5 A;  4JI5 B;  3M7M X;  1W59 A;  3FYE B;  5JJE B;  3CD6 V;  5B1O A;  4FFB B;  3JD2 A;  2IJI A;  1SS3 A;  1OCZ C;  3T4D A;  2A7W A;  2YID A;  3D3I A;  1CEZ A;  3AG2 B;  3TXS A;  3P32 A;  1JQ0 A;  1DGS A;  1D2D A;  4H44 B;  3CRA A;  3RVZ A;  3P3N A;  2M7W A;  3CCQ V;  1K3E A;  4MT8 A;  4FLT A;  4QPK A;  2YXH A;  4H0L B;  4E4E A;  4ASU G;  4ZKI A;  4MVZ A;  4D7S A;  5BMV B;  5B5E Z;  4LF4 B;  1R3I C;  1IZ3 A;  1QCE A;  2OWO A;  2CAZ C;  1JA8 A;  2F66 C;  3T4Z A;  4F4L A;  1SQP H;  5LMN B;  3BAB A;  3D3Q A;  1AP5 A;  4MTF A;  3ETG A;  2E5L B;  1XNR B;  3AG1 C;  4CBC A;  2WAM A;  4GCZ A;  1JJ2 U;  1SZX A;  4NKG B;  4UB6 Z;  3B2E E;  4EEQ A;  3N2K A;  3JAK B;  3CCU V;  2YUA A;  4U3J A;  3ASO C;  5CBH A;  2G38 A;  3E8G A;  2P5O A;  3L72 H;  3RFR A;  4NVP A;  5L3E A;  1JVM A;  4LFA O;  4B7E A;  1BQZ A;  2Q4P A;  5LBQ A;  5B1A C;  3JD1 A;  4JYB A;  2WA3 A;  1V54 C;  2GV9 A;  3SGI A;  5AG2 A;  1URF A;  4K3A A;  3IAY A;  4B3T O;  5GW7 A;  3ETD A;  3JAR B;  1KMI Z;  3CCL V;  2LW7 A;  4JI2 B;  4AQY B;  4O4I A;  2WWW A;  1N0J A;  4P2Z A;  4J7J A;  2RDC A;  1XNQ B;  2FL4 A;  1HNW O;  2W6I G;  2QKS A;  1IDS A;  1DF4 A;  1TVK A;  2P90 A;  4FLX A;  3ZBH A;  2ZXW C;  2Y0P A;  4GKJ O;  1L8D A;  3OTO B;  4GKK B;  3O9O A;  3VQW A;  1NTK H;  1XRE A;  4TV8 B;  5JJJ B;  3JAS A;  2P7T C;  2Q7H A;  2Q6A A;  2YIB A;  3ZIA G;  4WFF A;  1BL8 A;  2WLI B;  4DV6 O;  1F4M A;  3MAQ A;  3C90 A;  3K3W A;  1FJG B;  1U96 A;  4O4H B;  4RAI A;  3CSX A;  3K5O A;  3B40 A;  1HNX B;  5FNV A;  3G67 A;  4O4L A;  3VQY A;  1U97 A;  1GN4 A;  1FFX B;  5IWA B;  5KMG B;  5KHH A;  4Z1M G;  1K92 A;  4DR1 O;  4K8Z A;  4BAY A;  4E2L A;  2WLL A;  2CUG A;  4DK0 A;  4RQE A;  3J81 N;  1VQM V;  3G6B A;  3L9D A;  2UU9 O;  1KYO F;  3WU2 Z;  5JH7 B;  2A06 H;  4LFC O;  1H2L A;  2Z3Y A;  1CXZ B;  1HR0 O;  2EBO A;  4W4L A;  4NXN B;  1K5S A;  4B7K A;  2GBO A;  2UUC B;  4Q6G A;  3ABL C;  1PNK A;  3H1I H;  3RGB A;  2DWD C;  2PYJ A;  3IGA C;  1JFF B;  1YCI A;  1WLE A;  1JCH A;  1N36 B;  3ASN B;  3ABK B;  5DM6 V;  2BOB C;  3F5W C;  1VIB A;  5B3S C;  1JOY A;  4ICG A;  4ZI7 B;  5LYJ B;  2JGU A;  4JI7 B;  2QM4 A;  2QWP B;  3B8M A;  3C3T A;  2LO1 A;  4YY3 O;  3CPW U;  4EFB A;  2RJZ A;  1L1F A;  1YIJ V;  5CMU A;  3P3P A;  3JCZ A;  1YJW V;  5JQG A;  4PA3 A;  2QGN A;  2KB1 A;  2JDI G;  3BAA A;  4YJ2 A;  4I50 A;  2YXY A;  1XHZ A;  3EHB B;  1XBL A;  2P06 A;  3D8C A;  1J95 A;  1EFR G;  3RWR D;  2W6J G;  4FLW A;  4JTC B;  2WLK A;  5EC1 C;  1R6T A;  1QVF U;  4MVS A;  2OIE A;  5LMU B;  3JAT A;  1K9M W;  4LNU B;  1SF9 A;  3CRC A;  1H38 A;  1GMG A;  4LFB B;  1PP9 H;  4MSW C;  2ZIN A;  5LHH A;  3ZRX A;  2D2C B;  4DO2 A;  2CTR A;  2BTQ A;  5FPR A;  3OFN G;  1OCC C;  3BPZ A;  4ZBM A;  3I55 V;  2HHH B;  1MOF A;  2QWN B;  1SZT A;  4TQF A;  4HNA B;  3LDE A;  2QSA A;  2DMX A;  2W0F C;  4XDJ A;  1NVP D;  2ITD C;  4LF4 O;  2YC0 A;  2AHY A;  1HDJ A;  2RMK B;  3JYC A;  2XAJ A;  1P7G A;  1F23 A;  2GUZ A;  5LMN O;  2K1E A;  3T2M A;  1PD3 A;  3SJA C;  4CS3 A;  2AGA A;  2PTM A;  2E5L O;  2YXL A;  1RM1 C;  1XNR O;  3HKB A;  2ZKO A;  3HKE A;  3AG7 A;  3FD9 A;  2X0L A;  2PI5 A;  3TET A;  4HZ3 A;  1M5I A;  3H1J H;  1FXK A;  4DV2 B;  1LR1 A;  5L3G A;  1Q86 W;  4TOI A;  1AI4 A;  1NTZ H;  3JAL A;  5H9C A;  2Q9L A;  5LXT B;  2EIK B;  4O4J B;  4JV5 O;  3M99 B;  1M9N A;  1NTM H;  1PKX A;  3F5T A;  5LOV B;  1XOU A;  3D36 C;  1KQS U;  3ABU A;  2OCC B;  3N2G A;  5EZY A;  5IJ9 A;  2BE3 A;  4TV9 A;  1YXB A;  3JSN A;  1YSC A;  1V55 B;  1BE3 H;  2EUL A;  4GYC B;  1S3J A;  4JI2 O;  5EIB C;  2LW1 A;  4AQY O;  1TUB A;  3BY6 A;  1IXM A;  5C8Y A;  2QWR B;  4XDK A;  1AI6 A;  2IJK A;  1XNQ O;  1VF7 A;  4F6E A;  2GHY A;  3ABT A;  1G6U A;  3K5N A;  3RYI B;  5TIS Z;  4WFE A;  4LWS B;  2CE4 A;  2ETN A;  2R9I A;  1GTO A;  2UXN A;  4OGQ B;  2F23 A;  1W2B U;  3OTO O;  5LGU A;  3IJ4 A;  3ZMV A;  3JD0 A;  3J7A U;  1I5X A;  3AG3 B;  1EN6 A;  2B1I A;  3CCS V;  1DLB A;  3X2Q C;  2E74 B;  4FZ0 A;  3ML0 A;  2UUA B;  1OHH G;  1FAF A;  2CGN A;  4LFA B;  1I94 O;  1HW7 A;  5IY5 C;  3QO7 A;  2ITC C;  3HKC A;  2DWE C;  5IWA O;  2EIN B;  1KP2 A;  3UO3 A;  1I0H A;  3ZMZ A;  3FB8 C;  3FFQ A;  4TSF G;  4B3T B;  4RWU A;  1IBK O;  3OGI B;  1MAB G;  4D6T H;  2YEV A;  4U3J B;  1DF5 A;  1RP3 B;  4OPH A;  2A3Q A;  4KL1 A;  2Q0O C;  1E1Q G;  1AVM A;  3K79 A;  4NXN O;  4X9Q A;  1WA8 A;  1P84 F;  4JI0 B;  2RQ6 A;  4BWA A;  1AJN A;  2UUC O;  4JZG A;  1GN2 A;  4P9P A;  2XUM A;  5KHJ A;  2QR4 A;  3SPC A;  2CTP A;  4WF9 V;  3D36 A;  4O4I B;  4ZIB A;  1H2G A;  2MW2 B;  4DV6 B;  1N36 O;  3ZRS A;  4X1K A;  4LH7 A;  4O2A A;  2EJ7 A;  5CA0 A;  4F6R A;  5IE9 A;  4I0X A;  1YF2 A;  1S5L Z;  3AK3 A;  3QTC A;  5D5Q A;  1N4C A;  5GON B;  4DR2 B;  5IDJ A;  3S3W A;  4H37 A;  3CRR A;  1GN3 A;  3JAS B;  3JD3 A;  3BEH A;  2PI4 A;  2UUB O;  2Q69 A;  1JPX A;  1K4D C;  1QR9 A;  4JI8 B;  4DR1 B;  5KUK A;  2H3O A;  1N0N A;  1NR1 A;  4L8J A;  2UU9 B;  1D5N A;  2ZT9 B;  4ZOL A;  1SES A;  5FNV B;  4FVM A;  5CA1 A;  1NR7 A;  3HR0 A;  4NTX A;  2NR5 A;  1S5H C;  1W0K G;  4G2K A;  1R1B A;  1TA8 A;  3G6E V;  5CA3 A;  1PNL A;  4FM2 A;  4BW5 A;  4KP4 A;  1HP8 A;  1SQF A;  3WG7 B;  2WLL B;  2OT5 A;  3DXR A;  3K06 A;  3OEE G;  5LMU O;  4DV4 O;  3BCC H;  3VQX A;  2AW9 A;  3OW2 U;  4LBE C;  2JJ1 G;  2XAH A;  2ADP A;  4YIP A;  1Q8I A;  3RYH A;  4DR7 O;  1THZ A;  3CP1 A;  1SA0 B;  4IT5 A;  4JAS A;  5C93 A;  3RYC A;  1PL4 A;  3ZMS A;  1SC5 B;  2C2A A;  1MSW D;  3BFR A;  2HHH O;  1QLE B;  2KKW A;  2ZR3 A;  1WPX A;  1NH2 D;  4CC5 A;  2F43 G;  4X1I B;  4YY3 B;  2QWO B;  2R9R B;  3Q4H A;  4PA9 A;  1G1X B;  3W7X A;  1QBZ A;  2BTO A;  4IYH A;  1IBM B;  4KHP B;  4H33 A;  2ZE8 A;  5IYZ A;  3JAM N;  1PPJ H;  1AIL A;  4J42 A;  1XQ8 A;  1F4N A;  1R3J C;  4K35 A;  3CCE V;  3J80 N;  3ZRW B;  2DYS B;  3U0Z A;  3OM3 B;  4DRX A;  1Y74 A;  1PM9 A;  1XL6 A;  5J2T B;  3CJH A;  1AJP A;  4DV2 O;  1EBO A;  2JJ2 G;  3LUT B;  4YJ2 B;  4JI1 O;  3W7S A;  3H1H H;  5LP6 C;  1MNG A;  4HBN A;  3JCU Z;  1SQQ H;  2JEX A;  4PI0 A;  4AIL C;  1FOU A;  4LF9 B;  1YTF D;  1RSO B;  3IC7 A;  1YEW A;  3EVK A;  3ZED A;  4BIO A;  4I9W A;  3ZMT A;  3E22 B;  4X20 A;  3SPJ A;  5BR8 O;  4OPA A;  5EBM C;  3T1H O;  1VQK V;  1OCR B;  2QEX V;  1OJH A;  1SQX H;  4JGS A;  4RQF A;  1I5Y A;  3GWO A;  1VQO V;  2CTQ A;  1YI2 V;  3OMN B;  4L87 A;  1AR4 A;  5ITZ A;  2XND G;  3UKM A;  2EIM B;  3H9V A;  4G27 B;  4W4K A;  5BZB A;  2R72 A;  1AI5 A;  1MZF A;  2YI9 A;  4XDL A;  4K0K B;  1H5W A;  2PF4 E;  3OR6 C;  1ROP A;  4LCU C;  1IVS A;  3SJQ C;  2A79 B;  3CXH F;  2XAF A;  1WB8 A;  3ABL B;  3SYC A;  4I55 A;  2NLJ C;  3WFV A;  5L3B A;  2V7Q G;  4X62 B;  4JYA B;  1WP8 A;  4I4T A;  4EKW A;  2UUA O;  3RYF B;  4UCT A;  2ZNI A;  2YIB D;  4MVU A;  2VWJ A;  2F1M A;  2EIL C;  4JV5 B;  1QVG U;  1EZV H;  5KHG A;  2UXD O;  2LGQ A;  1Y6X A;  3LDC A;  4I9Q A;  3HKB B;  4PDL A;  3HKE B;  4JI6 O;  1MZE A;  2B5U A;  2X6C A;  2DQ3 A;  3B8N A;  5EC2 C;  1FXK B;  3GB7 C;  5GTI Z;  3AG4 B;  3SJC C;  5BY1 A;  5H2F Z;  2BOC C;  2BSK A;  1GM8 A;  3F7Y C;  1VQL V;  1AR5 A;  2WLN A;  4ABM A;  4FM1 A;  1S76 D;  3U11 A;  1NZ6 A;  4FJC C;  2HJF C;  1K97 A;  5B1B C;  4JI0 O;  2PYL A;  4JPR A;  4FIP C;  2IJJ A;  5LP6 A;  3UT5 A;  1NVP B;  4DR6 O;  4TV9 B;  2QKA A;  3EFF K;  4PHZ A;  3BA8 A;  4U7N A;  4GUN A;  4LR3 A;  3RW0 A;  2Q5Z A;  1ZTE A;  2P4K A;  3RBZ A;  1VQ8 V;  4NTY A;  2Y69 C;  5FPO A;  4DXW A;  1Q82 W;  5LHG A;  2L35 A;  4P30 A;  2DOS A;  3MHH C;  2ZM6 B;  3JSL A;  1NBM G;  2IU0 A;  2ZE6 A;  4DR2 O;  1Y67 A;  3JAW B;  1WN7 A;  4X1Y A;  4ZHQ B;  1I94 B;  4R50 A;  4FLY A;  1VQ6 V;  2ODM A;  2HR3 A;  4FPP A;  5KHK A;  1EZJ A;  1OCC B;  1S5J A;  4MVQ A;  4JI8 O;  3ZHS A;  1UFI A;  3HPL C;  4LF8 O;  1S0V A;  1IBK B;  3APO A;  3AG2 C;  1XDC A;  1Q7Y W;  5CBG A;  4B3M B;  4MVM A;  2XAG A;  4TWK A;  4I7Z B;  1ZX3 A;  3CRQ A;  3FAV B;  3OEH G;  2UXB B;  2KG7 A;  1GK9 A;  4DR3 O;  3K04 A;  4UFZ A;  2PGG A;  1GN6 A;  3CYO A;  3OE7 G;  1OV9 A;  4RO2 A;  5DED A;  1OCO B;  4X66 B;  3ABM B;  4U7O A;  4PD4 F;  2HG5 C;  4WBN A;  1FPO A;  2YDE A;  4WFB V;  1Z5W A;  2Y48 A;  2QM7 A;  1O9H A;  3AK1 A;  4LF5 B;  4CZZ A;  1IXB A;  5BXZ A;  1KD1 W;  5CB4 B;  3BA9 A;  4X1K B;  2UUB B;  4TT3 G;  1BSM A;  1B3Q A;  2DN9 A;  1RPO A;  5CA0 B;  4F6R B;  1IBM O;  4KHP O;  3LSQ A;  5J2U A;  2RCV A;  3E8F A;  3OAA G;  4N21 A;  1Y66 A;  2LP7 A;  1DTO A;  1H8E G;  1S72 V;  1Q6H A;  5LA6 A;  3ZJZ A;  3ETE A;  5IYC O;  2HVK C;  3L74 H;  4IHJ A;  5DN6 G;  3ZHU A;  2VWK A;  3G80 A;  3WB2 A;  3U10 A;  2JGD B;  4UCS A;  3CMA V;  4DV4 B;  4A5U B;  4ZOL B;  4EB6 B;  3L70 H;  4MTX A;  2XTA A;  3IFX A;  1QNM A;  4PI2 A;  4DR5 O;  2QWQ B;  4X64 O;  4LF9 O;  1BT8 A;  4DR7 B;  2IH3 C;  3SYA A;  1BQ0 A;  1ORQ C;  3VQV A;  2RNB A;  5JWP A;  2WLH A;  5IY5 B;  3K0D A;  1L0L H;  4XBF A;  4DW0 A;  4X65 B;  2LFR A;  4AHC A;  1B04 A;  1CP9 A;  2IU3 A;  2EIJ B;  5DEC A;  1M1K W;  1XIL A;  4FLV A;  1Q3E A;  3ZRV A;  2FYU H;  5BMV A;  3E86 A;  2VQE B;  4IYI A;  1FXV A;  2LFS A;  2HP8 A;  1VQN V;  3OMI B;  4O2B B;  5IYB O;  4YJ3 B;  4RUF A;  3P30 A;  1MG1 A;  4K0K O;  2Q68 A;  4X8A A;  1I08 A;  4RUE A;  4MW8 A;  2LJ2 A;  3UQ8 A;  3ZN0 A;  2BCC H;  4GX1 A;  4X62 O;  4JYA O;  3OUS A;  4P9O A;  4CH4 A;  4X88 A;  3JAK A;  1B6Q A;  2X7R B;  3G4S V;  4JI1 B;  4CH6 A;  2Q67 A;  4J7Z A;  1M56 B;  1M57 B;  5A9G A;  4DRX B;  2A0L A;  3A0H Z;  2CH7 A;  1Q6I A;  3ASN C;  3ABK C;  3JAR A;  5K1X A;  3E2E A;  5BR8 B;  4R6Z A;  4GLX A;  3T1H B;  1ZLZ A;  3I5D A;  4DV5 O;  1P7B A;  3UM7 A;  3QO8 A;  3CXC U;  3R66 A;  3K9S A;  1HNZ B;  3F7V C;  3L73 H;  1NH2 B;  3CRM A;  3CS5 A;  1H8H G;  4JAU A;  1K73 W;  2JS5 A;  4LH6 A;  4TV8 A;  5F2V O;  4OXS A;  1XMO B;  4UCU A;  3FB7 C;  1GO3 F;  1LNQ A;  2X6A A;  3STL C;  1GKF A;  2WLI A;  2YSU B;  3SYO A;  4MW3 A;  1NU1 H;  2V4D A;  1ZAU A;  4J9Y B;  1YHQ V;  4Z1V A;  3E8H A;  2ZM6 O;  3KZI Z;  2QM8 A;  4UB8 Z;  4QE9 A;  2WA4 A;  2R9A A;  3T1Y B;  2M6Y A;  4UXN A;  4DV1 B;  3TCU A;  2UXD B;  2F93 B;  3LSS A;  1BZK A;  1FFX A;  1VQP V;  5EIB D;  4I55 B;  1S77 D;  2JK5 C;  4JI6 B;  1M4U A;  3CEI A;  1YTF B;  2ATK C;  4WCE V;  3N2K B;  3A0R A;  4UCV A;  4B3M O;  5JH7 A;  1FYJ A;  5H6R A;  4FLZ A;  1XL4 A;  2P4V A;  1NT2 B;  2UXB O;  1N34 B;  4X89 A;  3OTF A;  4K8X A;  3K58 A;  4DR6 B;  2E76 B;  3A0B Z;  2V1D A;  3FB6 C;  1GM7 A;  5B1N A;  2F95 B;  1JR9 A;  1JFF A;  4X66 O;  1K8A W;  4OX9 O;  5EK0 A;  1H2S B;  4IL6 Z;  3SPI A;  2DW4 A;  2CK3 G;  2ZQM A;  1TVK B;  2OYQ A;  2F4V B;  1OCZ B;  2JEU A;  4ZI7 A;  5LYJ A;  3C3S A;  2JRI A;  1JMK C;  2YIA A;  1COW G;  3HKD A;  4LF5 O;  1HWY A;  1NJI W;  5L3D A;  1X4T A;  3APQ A;  2EIK C;  4LF8 B;  2FKX A;  1Q5O A;  1Q81 W;  4DV7 B;  2PUS A;  1IUR A;  4LP8 A;  1R6K A;  4B3R B;  1R3L C;  2OCC C;  3GVM A;  3K5L A;  4O4L B;  1V55 C;  2EZP A;  2ZDI C;  4DR3 B;  3OGC C;  3DGE A;  2E3C A;  1BHB A;  3OD4 A;  3SYQ A;  2N04 A;  5K1P A;  4LNU A;  4QIW F;  4CH5 A;  3ICX A;  3N27 A;  3PJS K;  3AG1 B;  4NR1 A;  3E35 A;  1UJW B;  3H1K H;  4D7T A;  3R65 A;  5EBW C;  1GRJ A;  3ASO B;  1QQC A;  4IGG A;  2QDO A;  4UV8 A;  2QKC A;  4FZ1 A;  4X65 O;  3LSU A;  4PV1 B;  5B1A B;  1FFT B;  4HNA A;  1V54 B;  3H1L H;  3UCS C;  2XT9 A;  4BR6 A;  2Q7G A;  1AI7 A;  1TUE B;  5LGN A;  2VQF B;  1K7D A;  3K57 A;  3K08 A;  2R70 A;  5D5P A;  2OTL V;  1EM1 A;  1Y4M A;  2VQE O;  4DUY O;  5IT9 N;  1V9P A;  1KKD A;  2EIN C;  3E83 A;  5KX5 A;  2JS3 A;  4DYL A;  4PDV A;  2EX3 A;  1N33 B;  2CDY A;  1ZSP A;  1VMG A;  4FLU A;  2JIZ G;  4DK1 A;  2IM9 A;  4UVB A;  2ZXW B;  5L3C A;  1SRY A;  1J5E B;  1DK1 A;  5JQG B;  4QJF B;  3LDD A;  1VF5 B;  2FTK A;  2O57 A;  4LF6 O;  1M93 A;  2GDS A;  1IBL B;  1K33 A;  4I50 B;  4LC1 A;  2B9Z A;  4O4J A;  4J9Z B;  4JTD B;  5LA6 B;  4DR5 B;  5EYP A;  4X64 B;  3E89 A;  5LOV A;  2CTW A;  4IHJ B;  2GTS A;  4MVO A;  3A2F A;  4BW9 A;  3JAT B;  1KB9 F;  3KCY A;  1EN4 A;  1TAE A;  2ZDI A;  1YJN V;  3W7T A;  1SKV A;  4Z2W A;  4GT1 A;  1SER A;  2UXC O;  2WLM A;  2DYR C;  3ZCC A;  1HNZ O;  1VQ5 V;  4Q20 A;  2CGO A;  3RYI A;  2BTQ B;  4LWS A;  3CC4 V;  3ZHT A;  4QGP A;  5A2Q N;  2XOK G;  1VQ7 V;  2N05 A;  3CE2 A;  1XMO O;  2QTS A;  1XI1 A;  1WJZ A;  2RN9 A;  1N8R W;  1GAX A;  1Q43 A;  2ZR2 A;  1IX9 A;  3L75 H;  1XEQ A;  1GH6 A;  3KDR A;  5JCO C;  2GTA A;  3O65 A;  2XAQ A;  4PA7 A;  1VP7 A;  4PDR A;  2P67 A;  2XAS A;  5CN0 A;  1WB7 A;  3CCJ V;  1H2N A;  5KUM A;  2GUZ B;  3WG7 C;  3WB0 A;  3T1Y O;  3FB5 C;  4WFA V;  5B3S B;  4DV1 O;  2E75 B;  1Q90 D;  3W7W A;  4MTG A;  3K9A A;  4TUY A;  4U3F H;  2H94 A;  4WFG A;  5IJ0 A;  4DV5 B;  3JAL B;  3KKY A;  2AHZ A;  3DSQ A;  4GZR B;  1KBH A;  1QLE C;  3CX5 F;  2EZO A;  1N34 O;  2CH7 B;  4EFE A;  3N2G B;  2DQ0 A;  5EZY B;  3SJB C;  5IJ9 B;  2Y4T A;  2HFE C;  1YDX A;  1TUB B;  5C8Y B;  2Q8V A;  2Q73 A;  2WPD G;  4DV3 B;  1VEW A;  1UPG A;  3H01 A;  1KU9 A;  3ETQ A;  2F4V O;  2DYS C;  3A8T A;  1CPY A;  1G4Y B;  2Z5U A;  5GON A;  2ZIO A;  2KQX A;  4JTA B;  2QA4 V;  2OTJ V;  1NKD A;  2KSD A;  3SPH A;  2L6L A;  4UCR A;  3CB2 A;  4JZ2 A;  2Y4U A;  4B3S B;  4CC6 A;  4DV7 O;  4NXM B;  4PA4 A;  3QO5 A;  4B3R O;  4DV0 B;  2OCH A;  4JI3 B;  4UVC A;  5JCO A;  4G28 B;  4YIO A;  3S3X A;  4J80 A;  3LNM B;  1E1R G;  3HKC B;  1OCR C;  5EBL C;  3TXQ A;  1M90 W;  1ZUQ A;  4DR4 B;  3K0G A;  4GX2 A;  2ZNJ A;  1ZL8 A;  2YEV B;  3K03 A;  4UV9 A;  4AI8 A;  1SQV H;  2Z0A A;  1RM1 B;  2QTO A;  1YZB A;  2EIM C;  4OX9 B;  2P22 C;  1H2M A;  1WAZ A;  4J41 A;  3WB1 A;  1WA8 B;  1SA0 A;  5KA5 A;  3DC5 A;  1K34 A;  2WSS G;  1NI8 A;  3K59 A;  2ILM A;  4J7K A;  4X1I A;  4DW1 A;  5GTH Z;  1Y76 A;  4IIJ A;  1VAR A;  5LL6 Y;  5E1A C;  2AZ2 A;  4FFK A;  3SPG A;  2VRZ A;  1K4C C;  5KAI Z;  2VQF O;  4O2A B;  3CC7 V;  3VOU A;  1NQT A;  4I0X B;  3RN4 A;  1G8M A;  3TK1 A;  1JNB A;  5FL7 G;  5JVD A;  2Q0A A;  1PL0 A;  2ZE5 A;  2IBZ H;  1N33 O;  3HKD B;  4PA6 A;  1FKA O;  1FXK C;  3CCR V;  3I56 V;  3AG4 C;  3ZRW A;  1XMQ O;  3BHP A;  3ZMU A;  5J2T A;  1J5E O;  4J10 A;  2YIC A;  1F7Y A;  4JAV A;  4FK5 C;  4FFB A;  2GSM B;  4LF7 B;  4YHH O;  1KEC A;  5CA1 B;  1TGO A;  1IBL O;  3X2Q B;  4FM0 A;  5L3F A;  4JI5 O;  2Q7E A;  1RSO A;  1N32 B;  1QU7 A;  3ZS8 C;  4DUZ B;  3E22 A;  5KAF Z;  2K9P A;  4BIU A;  3DXR B;  1ENV A;  3CWB H;  1E79 G;  1R6N A;  3SDL A;  2FB5 A;  1P4R A;  3SR2 C;  4JYY A;  3B77 A;  5H6Q A;  3RVY A;  1KKC A;  3RYH B;  2H8P C;  4GX0 A;  1MSD A;  1WPB A;  4DUY B;  3PN1 A;  1NS1 A;  3RYC B;  1AB3 A;  5H5N A;  1RPR A;  1I7F A;  3DC6 A;  3JD4 A;  2ZE7 A;  3Q4H B;  4JI4 B;  1B06 A;  4FMT A;  2MK3 A;  1FS0 G;  4WFH A;  3BVO A;  3RT3 C;  3RYF A;  3KCX A;  3ZN1 A;  5IYZ B;  5KX5 B;  5LHI A;  4BIZ A;  4LF6 B;  4J11 A;  2WLJ A;  4JF3 A;  3QVN A;  5HFL A;  1BMF G;  2IJH A;  1OCO C;  3ABM C;  4CH3 A;  1BGY H;  1Y74 B;  2DJV A;  1EN5 A;  1H2K A;  4CS4 A;  3CJH B;  5CBF A;  3NXS A;  1BS3 A;  3TGU H;  4YXW G;  3MHS C;  3QF7 A;  1YJ9 V;  3NR7 A;  4KFM A;  1BHA A;  4C7U A;  3OT7 A;  2UXC B;  3ZHR A;  5EYP B;  1X59 A;  2OIG A;  5LGT A;  1YVW A;  4X20 B;  3TJT A;  1YIT V;  2FML A;  2DE0 X;  4UCO A;  4PJ0 Z;  1ZWI C;  3MD0 A;  1P49 A;  4UVA A;  3W7U A;  4DV3 O;  1GM9 A;  1ARO P;  4O4H A;  1QLN A;  3OMA B;  3VBB A;  1MA1 A;  3FYI B;  5ITZ B;  4MTO A;  3LNN A;  2D3O W;  4GKK O;  4B08 A;  5KLV H;  3JAW A;  2ADQ B;  4ZHQ A;  3K5M A;  3ZX6 A;  3MDS A;  4JAA A;  5HFM A;  1Z5V A;  5KMG A;  1FXH A;  4R7C A;  4B3S O;  1AP6 A;  1XHX A;  1FJG O;  3ZHV A;  4I4T B;  1KUQ A;  1QHT A;  4NXM O;  3IC9 A;  1HNX O;  1T5E A;  1A32 A;  2LQT A;  3SYP A;  5J9P C;  4DV0 O;  4JI3 O;  3FAV A;  2P6J A;  3CCV V;  2YI8 A;  1AJQ A;  1WNS A;  2HJD A;  2NNU A;  1QR8 A;  4N23 A;  1RFY A;  1LUV A;  2EIJ C;  4TUY B;  5KHI A;  2B1G A;  1FD9 A;  3B4S A;  5IJ0 B;  3HB3 B;  4DR4 O;  3DTU B;  2BSK B;  2X6B A;  1VF6 C;  3FX7 A;  2ZD9 A;  3CME V;  1VQ9 V;  2N74 A;  4KUM A;  4NB5 A;  1XUQ A;  5B66 Z;  1HNW B;  4NYK A;  2Y0I A;  1L0N H;  2ARH A;  3G71 V;  2YS8 A;  5LP6 B;  3UT5 B;  4NTW A;  4GKJ B;  2EJR A; 
#chains in the Genus database with same CATH homology
 1I0H A;  1EN4 A;  1XDC A;  1P7G A;  4C7U A;  3OT7 A;  1WB8 A;  5AG2 A;  1MMM A;  1PL4 A;  3BFR A;  1AVM A;  1XIL A;  4JZ2 A;  1GN6 A;  3TJT A;  3AK2 A;  4X9Q A;  1N0J A;  4JZG A;  3C3T A;  1GN2 A;  1IDS A;  3CEI A;  1IX9 A;  1I08 A;  3KDR A;  4YIO A;  1MA1 A;  1XRE A;  2QKC A;  3LSU A;  2ADQ B;  4JYY A;  1WB7 A;  1AR5 A;  3AK3 A;  1KKC A;  3MDS A;  1MSD A;  1ZUQ A;  3AK1 A;  4BR6 A;  1PM9 A;  1LUW A;  1IXB A;  1EM1 A;  1AP6 A;  1GN3 A;  1BSM A;  4F6E A;  3DC6 A;  4E4E A;  1JR9 A;  2QKA A;  1MNG A;  3IC9 A;  2CE4 A;  5A9G A;  4GUN A;  2CDY A;  1ZSP A;  1GN4 A;  3DC5 A;  2RCV A;  1N0N A;  3EVK A;  1B06 A;  1JA8 A;  1ZTE A;  2P4K A;  1EN6 A;  1D5N A;  3KKY A;  1LUV A;  1ZLZ A;  3C3S A;  1AP5 A;  1VAR A;  3K9S A;  4FFK A;  3QVN A;  1Y67 A;  2GDS A;  3RN4 A;  1SZX A;  1QNM A;  1XUQ A;  1AR4 A;  1EN5 A;  2AW9 A;  1BS3 A;  1VEW A;  1BT8 A;  2ADP A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...