3MDSA

Maganese superoxide dismutase from thermus thermophilus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
203
structure length
203
Chain Sequence
b'PYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Manganese superoxide dismutase from Thermus thermophilus. A structural model refined at 1.8 A resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 72
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3mdsA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3mdsA02
1MA1A 2AW9A 3K9SA 3AK3A 4FFKA 1GN6A 1WB7A 1AR4A 1Y67A 1I08A 1PL4A 3LSUA 1ZLZA 2CE4A 1AP6A 1AP5A 5A9GA 1I0HA 4YIOA 4BR6A 3AK2A 1PM9A 4E4EA 1EN6A 1JA8A 1GN4A 4C7UA 1KKCA 3C3SA 3QVNA 2RCVA 1LUWA 2QKAA 4X9QA 1XILA 1XREA 2ADQB 3EVKA 4JYYA 1SZXA 2CDYA 3DC5A 1VEWA 1BSMA 3BFRA 2QKCA 2P4KA 1BS3A 1MSDA 1GN3A 4JZGA 3TJTA 1EN4A 3OT7A 1WB8A 1AR5A 3AK1A 1XUQA 1XDCA 1BT8A 3KKYA 1N0JA 3CEIA 1AVMA 1ZUQA 1P7GA 3IC9A 1IX9A 1N0NA 1ZTEA 5AG2A 1ZSPA 1VARA 4YIPA 1JR9A 4F6EA 4GUNA 1IDSA 1EN5A 3DC6A 1MNGA 1IXBA 2GDSA 1B06A 1EM1A 3MDSA 3RN4A 1MMMA 1D5NA 1LUVA 3C3TA 1GN2A 4JZ2A 1QNMA 2ADPA
chains in the Genus database with same CATH superfamily
1AI6A 5FNVA 2PGGA 2UU9O 2KSDA 4LF5O 5BMVB 1NS1A 5B66Z 4HAMA 1SC5B 5KX5A 5LYJB 4JI0B 2IJHA 2PUSA 4BIZA 4B3SB 2GSMB 3L75H 5H9CA 2ZT9B 4KHPO 3AK2A 4DR2B 2WSSG 1AI4A 3BAAA 1LNQA 3GWKC 3CRCA 4J10A 5B5EZ 5LP6B 3OR7C 1KU9A 1H2GA 3AG4C 2DMXA 4OXSA 2B1IA 3EVKA 2ZM6O 2A0LA 2YXLA 2JK5C 4LFBO 3H1IH 2YEVA 2V4DA 3CB2A 3TJTA 3KG2A 3KCYA 1K7DA 4RQFA 4JI1B 3VQXA 2GTSA 4FLYA 4YJ3B 3WG7B 1JJOA 3UM7A 4JI7B 3OEEG 5BY1A 1YTFB 4DV3B 1WP8A 2R70A 3W7SA 4QNHB 2PF4E 1I94O 1OCOB 2WLHA 1MOFA 2M7WA 1M57C 2JJ2G 3UKMA 1VQ7V 1XNRB 4RWUA 2AZ2A 3CMAV 4K8ZA 2R9IA 2IW5A 1M4UA 3ZBHA 2GUZB 1G6UA 5J9PC 1Y6XA 2UUBB 1EN5A 4LP8A 1MNGA 4MTXA 2WLLA 5IYDO 1YEWA 1US6A 4MSWC 4EB6A 3RN4A 1MMMA 4BW9A 2L6LA 1E1RG 3JAKB 1Z5VA 3K0DA 3J81N 3N27A 5KHIA 1QNMA 3G6BA 3A0HZ 5J2TA 4LCUC 4LF9O 4GX0A 2FB5A 1GH6A 3BA9A 4PDVA 4MTOA 1VQ8V 2DQ3A 4AILC 2GTAA 2RJZA 4JI8O 5BR8B 4ZBMA 3OD4A 4I4TB 2RNBA 3DXRA 3W7XA 2B9ZA 3E8FA 3JD1A 3CCVV 1JNBA 5K1PA 1JX9A 3BA8A 2ZR3A 1QBZA 4JI2O 4H13B 3SYQA 2P67A 3SPIA 1IURA 4I55A 5C93A 4JF3A 4H0LB 3ZX6A 3A0BZ 1VQNV 4PDMA 2OYQA 4NVPA 4NXNB 4X1IB 4FVMA 1SZXA 4Q6GA 2YDEA 2WA3A 1E1QG 2R72A 1GM7A 3FD9A 1NBMG 1COWG 1Q3EA 1VQ5V 3JSLA 1WB8A 4IGGA 3D36C 1RP3B 1B04A 2A7WA 3ZEDA 2BSKA 1E79G 5FLXN 1SETA 4DW0A 4RUEA 4JI3O 1XL4A 5LMUO 3O65A 1N33O 1KB9F 4WFAV 2OTLV 2Z0AA 3T2MA 3DGEA 3BY6A 3D3IA 1SF9A 2HVJC 4DR6B 2HKOA 4DK0A 3Q4HB 4XDJA 2X6CA 4X8AA 3FFQA 4PHZA 3ABLB 1XNQO 1BGYH 3K9AA 2Q6AA 2UXNA 1QHTA 2QTOA 4TV8A 2GDSA 3CHXA 1YSCA 4JAVA 2UUAB 3E22A 5H2FZ 1FOUA 2JIZG 1PL0A 5EIBD 3K9SA 1XMQO 1HR0O 4WFBV 4O4IA 1KECA 1CPYA 4AQYO 1DTOA 1OHHG 2QWRB 3K0GA 4UB6Z 1SRYA 1FFXA 1SA0A 3CMEV 4MVMA 4XDLA 3L70H 1J5EO 1QR8A 4I9WA 3H01A 4H37A 4GX5A 3WB1A 2FKXA 1RSOA 3K06A 1XILA 2DW4A 4JAAA 5EBWC 4ZKIA 4X66B 3N2KA 3RYCA 4JYYA 5IJ9A 1OCRB 3NXSA 3K5LA 1WNSA 1K5QA 2QWOB 3AG3B 4ZI7A 4K3AA 3GWOA 1FD9A 2B5UA 4RQEA 1R6KA 1JFFA 3AK1A 3ZHTA 2HLDG 1SQFA 2JDIG 5LP6C 4DR7B 1FAFA 1ZTEA 5AG2A 4NXMO 2IU0A 3ZIAG 5IWAB 2PZSA 4X89A 2R9RB 2IH3C 1HNXB 1PV0A 2PYJA 5FNVB 3B40A 4UCVA 4RUFA 3CC7V 4IIJA 5B3SC 5ITZA 2YIAA 3DC6A 3WFVA 4DV5O 5KX5B 4HNAA 3BPZA 4X64O 3MDSA 3BCCH 1D5NA 3T4ZA 4FPPA 2XTAA 4FJCC 3HKDA 3WG7C 4CS2A 3RGBA 1XI1A 2A3QA 1OCOC 5IT9N 3L71H 4CH5A 3CP1A 4DR4O 1Q7YW 3AK3A 3ETQA 3CPWU 1VQ4V 4LF4B 4OX9O 3VBBA 1PL4A 2DJVA 3JD0A 4FLXA 4D6TH 2YEVB 3ZHSA 1EFRG 3P30A 4NKGB 3AG4B 4JI4B 4GCZA 2XT9A 5EBLC 3SDLA 3L72H 4U3JA 2N04A 2UXDO 2Y48A 3T1HO 1OCCB 2ZE7A 1K9MW 1OJHA 1XREA 2ADQB 3ZHUA 3SJCC 2RMKB 1YI2V 1H5WA 4JTAB 3SJQC 4B3RO 1BS3A 4PI0A 5LMNB 4I0XA 4MS2A 2YC0A 4JYBA 4CC6A 4DV2B 3OT7A 2F4VO 2QM4A 1XUQA 2FMLA 4DUYB 3SYPA 4UFZA 1CP9A 2QEXV 1AVMA 1MZFA 2GV9A 1Y4MA 2KKWA 2XOKG 2WLLB 4K35A 1PPJH 4EB6B 1DLBA 2YUAA 2FYUH 1YIJV 2HHHB 1S76D 2LQTA 1NR1A 4MVRA 5J2TB 1QR9A 1QVFU 2YSUB 1IDSA 2P5OA 2Q67A 4LWSA 4B7KA 4DV4B 4LFAB 5IE9A 4A5UB 3TETA 4X1KA 2G38A 4Z2WA 3DXRB 4G2KA 1FS0G 2P7TC 3IJ4A 5CBFA 4UXNA 3W7TA 3CX5F 2YS8A 2Q69A 3HKBA 3IAYA 4LF6O 4FLTA 1YCIA 4I55B 4J41A 2F43G 1ZX3A 2UU9B 3RYIA 1VIBA 2WLIA 4LF5B 5J2UB 1GO3F 4B3TB 1XMOO 5A9GA 2P22C 5GTHZ 1OCZC 5DM6V 5EK0A 4PDLA 1EN6A 1PNMA 3QTCA 4LBEC 2Q5ZA 5CB4A 5KHJA 4KHPB 2YICA 4LFCO 3CCJV 1H2LA 3G80A 1VQKV 1PKXA 4LH7A 1NTZH 1JOYA 5CMUA 1HNZO 1GK9A 3THOA 1SQGA 2BSKB 5IYZA 2F1MA 3HKEA 4L8JA 5E79Z 2IJIA 2QKCA 2ZE6A 2VQEO 1B6QA 2ZM6B 2XHBA 4JYAO 2N74A 2Q7HA 4LFBB 1QVGU 1BE3H 1FKAO 1BHBA 2IH1C 2DOSA 4J7JA 1NVPD 3VQWA 3E8BA 2ZXWC 1N34O 1BT8A 4DUZO 3SYAA 4B3MO 4FLWA 3IC9A 4BWAA 3AG1C 1NQTA 4TV8B 2D3OW 3OMAB 1S3JA 2YIDA 1PNKA 4MTFA 4D7SA 1K3EA 1XOUA 4ZIBA 4X65O 3OW2U 1I94B 3E22B 3SPJA 5H6QA 1TUBA 4Z1MG 1HW7A 2QWQB 2KG7B 2QTSA 4H33A 4FIPC 2ODMA 4JI6O 2HP8A 4O4IB 1UJWB 2Y69B 1B06A 5FPRA 4MTGA 1FJGO 2JJ1G 3HB3B 1FFXB 1SA0B 1Y74A 1GN2A 5BXZA 4CC5A 1NT2B 2HFEC 1TAEA 2AW9A 3TXQA 4AI8A 3ZMTA 4LF7O 3ASNB 1S77D 3EHBB 1RSOB 2AXTZ 4LF9B 4UUJC 5KUMA 3JD2A 3SJAC 4QE7A 3RYCB 3ZMVA 3E86A 1ZLZA 5IJ9B 1I0HA 2ZQMA 1B3QA 1VP7A 2EIJC 4ZI7B 4JI8B 3OMIB 4LH6A 4ABMA 4CH4A 3QVNA 4FLVA 3SR2C 4ZOLA 2N05A 4BW5A 1M5IA 3L74H 4X9QA 1JFFB 5FL7G 5KAFZ 4JI2B 4X88A 3HKCA 5DN6G 2QJ1A 3L9DA 3F5WC 2Q4PA 2ZR2A 4MVZA 4DV0O 3C90A 3ZN1A 1MSDA 3CWBH 3ZRXA 2X0LA 4HBNA 1SQQH 2QDOA 3P32A 2W0XA 3SJBC 4DW1A 1EZVH 1VQLV 1Q90D 5JVDA 4IIJB 5ITZB 4XBFA 2Z3YA 1IX9A 5L3GA 1OCCC 5LHHA 4HNAB 2JGDA 3BRCA 1ZSPA 3HKDB 3ZHVA 4JI3B 1Y76A 1TA8A 1A32A 2Q73A 5LMUB 2NN4A 5F2VO 5B3SB 1N33B 2L35A 1O9GA 4U7NA 4J9ZB 2HR3A 1N36O 1JR9A 1OZ0A 2E5LO 4R8CA 4UB8Z 5LL6Y 1S5LZ 4JI5O 2XAJA 1IXBA 3STLC 3MAQA 1XNQB 2P06A 3QF7A 3TXSA 3N2GA 1TVKA 1FXHA 2ATKC 1IBKO 1P84F 4U3JB 3CXHF 1WB7A 5CBGA 1HR0B 4GZRB 1K4DC 4P9OA 3ZMZA 3ZRVA 4FM0A 2CGNA 4K8XA 4AQYB 1JA8A 4I0XB 2P90A 4H44B 1VF6C 2RCVA 1YF2A 4JPRA 1LUWA 1J5EB 4Z1VA 3E2EA 2EIKB 2YI9A 4NB5A 3A2FA 2OCCC 1AILA 3H1JH 3T1CA 2UXCO 3DC5A 1VF6A 1ZL8A 4BAYA 2ZNIA 2H8PC 2IBZH 1M93A 3P3NA 1KQSU 1WPXA 3BABA 2E74B 5E1AC 4OGQB 3CCUV 2LP7A 2CAZC 1K8AW 1IVSA 1MG1A 1H8EG 4LWSB 1DF4A 5J2UA 2Q7EA 3RT3C 4YY3O 3OEHG 4I7ZB 4R7CA 4X1KB 4IT5A 3OM3B 1I5XA 1L1FA 4UCSA 4DV7O 4NXMB 3HKBB 4F6EA 3CYOA 2ITCC 5EYPA 2ITDC 3RYIB 1G8MA 2WLIB 1EM1A 3ETEA 1W0KG 4DV5B 5GONA 3R65A 3T4DA 1GRJA 4X64B 3E8GA 5LBQA 5B1OA 5EBMC 4J9YB 5CB4B 4J42A 2PI5A 1Q82W 2QSAA 4FFKA 1OCZB 2Y0PA 5IYZB 5EIBC 4DR4B 1R3KC 1AP6A 1AP5A 3JATA 1PD3A 2VWJA 3W7WA 4YIOA 3HKEB 1K34A 4F6RA 3LSSA 3LNMB 2BOBC 4OX9B 4UV8A 5L3FA 1RPRA 2Y69C 3T1YO 3K5MA 4JI7O 4PA9A 4G28B 4NTYA 4B08A 4DR3O 1NTKH 1NVPB 4AHCA 1FFTB 1FXVA 2KG7A 2UXDB 4GKKO 2UUCO 3T1HB 2MW2B 5GW7A 2A79B 4DK1A 1VEWA 3ASNC 3B8MA 1TUEB 5C8YA 1NH2D 4P2ZA 3W7UA 2ZXWB 4DRXA 3RYHA 4JZGA 2IJJA 4B3RB 3ETDA 5HFMA 2F23A 1GM8A 2KQXA 3QO5A 3AG2C 4TQFA 4GKJO 3X2QC 5IDJA 3AG1B 3FYIB 2R9AA 1IJGA 2EINB 3A0RA 1TUBB 3FAVA 5LGNA 1X59A 4QIWF 2F4VB 1N32O 2GHYA 3G67A 1JQ0A 2HG5C 3MHHC 2K9PA 3CRRA 3QO8A 1Y74B 2A06H 4O4LA 2VQFB 2DYSB 3FB7C 3E8HA 1AI5A 2DQ0A 1KD1W 3HPLC 2YIBD 2YIBA 3CS5A 3QNEA 2XAQA 2LFSA 4W4KA 1XHXA 3OTOO 3RYFA 1H8HG 2CH7A 1W2BU 3VQVA 3G71V 3R66A 3K59A 1SQXH 1U97A 1T5EA 4JZ2A 1S5HC 3P3PA 4ZOLB 4NXNO 4RO2A 3PN1A 3OE7G 4DV1O 2XAFA 3K03A 4LF6B 2EIJB 3HKCB 1M9NA 1JJ2U 1H2KA 1HWYA 2LO1A 2BCCH 5L3BA 3U0ZA 5JJEB 1XMOB 1P4RA 3UCSC 2JGUA 4I50A 1K92A 1MSWD 1FXKC 4CS3A 4LFCB 2EIMB 1SQVH 5KUKA 5JVDB 2EILB 3IGAC 3ABTA 1Q6UA 5IYBO 1HNZB 3ZHRA 4WF9V 4PD4F 4N23A 1FXKA 1VF7A 2JGDB 1XHZA 1P7BA 4JAUA 1YJ9V 1Y76B 2VQEB 4JYAB 2BE3A 5CA0A 4UCTA 1PP9H 4HYOA 3B77A 5IJ0A 1N34B 1R3LC 4DUZB 1AI7A 5LA6A 4B3MB 2EIKC 3N2GB 1TVKB 3ZJZA 5JCOC 5JH7A 3CCSV 4PDRA 3IFXA 3SYCA 4X65B 4DXWA 5LHIA 4ICGA 1BL8A 4X1YA 1R1BA 1IXMA 1VMGA 4U3FH 4I9QA 5JCOA 5KHHA 4X20A 5KMGA 2Q7GA 3CRMA 4JI6B 4DR1O 3JD4A 1JPXA 4TV9A 4K0KO 3ICXA 4EKWA 1RPOA 2CTRA 2M6YA 1Z2GA 1KYOF 2V1DA 1GN6A 4LF7B 5L3DA 3E35A 1Y67A 3I55V 3OGCC 5L3CA 1YXBA 4J80A 3E89A 2GBOA 2AHYA 1ZL8B 1EBOA 3RFRA 2ZD9A 1ROPA 2D2CB 3O9OA 1AJNA 4FFBA 3B2EE 2OCCB 2XUMA 2LGWA 3JAMN 1RM1C 3H1KH 4OPAA 4QE9A 3ZRSA 2QGNA 5GTIZ 4O2AA 5B1AC 1Q6IA 1YJNV 3CCRV 1BSMA 3HR0A 3JASA 2ZDIC 2YXHA 2LFRA 1BQZA 2ILMA 1YVWA 3MHSC 1BCCH 3OGIB 4DV0B 2UXXA 1S72V 2BTQA 1UFIA 2OCHA 2ZDIA 1IBMO 1WP7A 4LNUA 3CEIA 3ABMB 3I56V 4W4LA 5EYPB 1HP8A 2Y0IA 4OPHA 2DWDC 2ZKOA 1ZAUA 1KKDA 1I7FA 2MK3A 5GONB 2WA4A 2WLMA 1D2DA 4B7EA 2IJKA 1KP2A 3SGIA 2QE7G 2HJFC 1N36B 3LDCA 2E5LB 1GKFA 5K1XA 4IYIA 4J7ZA 1NZ6A 4JI5B 1IBLO 3K79A 2EINC 3JATB 2LGQA 2Q8VA 4UCUA 4F6RB 4R50A 2JS5A 3SPHA 1H38A 3RW0A 4O4JA 2PY5A 2ZINA 3RVYA 1MA1A 3LDDA 1HNWO 4ZHQA 4CH6A 2UXBO 1O9HA 2BTOA 4DR5O 1IBKB 1GM9A 1AR4A 3RVZA 4LF8O 2DYSC 1AROP 4L87A 1BZKA 4BR6A 2BOCC 4NTWA 3BHPA 5C8YB 1NH2B 2EBOA 1GAXA 3C3SA 4DRXB 3RYHB 4YXWG 3QO7A 2K1EA 2LW7A 1DK1A 1ENVA 4IHJA 4PA6A 2RN9A 3FB5C 1V54B 3FAVB 1XL6A 2IM9A 4PA7A 3AG2B 3X2QB 3SPGA 2UXCB 3CSXA 3JSNA 2XASA 3TK1A 5JWPA 1KBHA 1KUQA 1YITV 4MVOA 4O4LB 1WAZA 4CH3A 3CCQV 5JJNB 5CN0A 4O4HA 4PELA 5IY5C 4MVQA 1XDCA 4TUYA 1CXZB 1ZUQA 1QLNA 5EC2C 1URFA 1N0NA 2EIMC 3RYFB 1U96A 1GMGA 2CH7B 2EILC 4PA4A 2QKSA 4YY3B 1Q86W 3ZS8C 4X62O 3J80N 4YIPA 4FK5C 3KZIZ 4J11A 1XQ8A 4GUNA 4G27B 4B3TO 2YXYA 3JAWA 1THZA 4YJ2A 2WLNA 4FLZA 5JJJB 4DV7B 5EC1C 2LW1A 2Q0AA 4UCOA 3CRAA 2PTMA 3C3TA 1WPBA 3TCUA 3AEIA 4O2BA 4FMTA 1F4MA 1AJQA 3ASOC 3U10A 2H94A 3VOUA 5JQGA 3BEHA 4I50B 2WWWA 3JD3A 1YJWV 4TSFG 3UT5A 3U11A 1I08A 4JASA 2EULA 2IU3A 2ZE8A 3APQA 1X4TA 3ETGA 2X6BA 3OTFA 4J7KA 1HDJA 1F51A 4CZZA 1FXKB 1GN4A 3CD6V 3ZMSA 5KLVH 4IYHA 4DV6O 1D5AA 1ORQC 1Z5WA 5CA0B 2VWKA 3ZCCA 3T1YB 2AZ0A 4DR3B 3OUFA 4JTDB 3K3WA 1XMQB 5IJ0B 2CDYA 2DYRC 3EFFK 3ZRWA 5LOVA 4GKKB 2UUCB 5LA6B 1WA8A 1M56B 3WU2Z 1EN4A 4YHHO 3S3WA 1LR1A 5FPOA 1BQ0A 1SKVA 3CRQA 5JH7B 3CCLV 1L8DA 3G6EV 2JS3A 4JYCA 2OIEA 5B1BC 4DYLA 2QM7A 4EFBA 1N0JA 4GKJB 2QA4V 2FTKA 4X1YB 3WB2A 2QWNB 3JCUZ 4U7OA 4JV5O 4QJFB 2ETNA 3RBZA 1DF5A 4JGSA 1N32B 3PJSK 3K08A 4X20B 5KMGB 1SQPH 2F93B 1VARA 4TV9B 2NNUA 3CC4V 1FPOA 4NR1A 5LGTA 1H2NA 5HFLA 1K97A 2XAHA 1S5JA 3JARA 3DTUB 3UQ8A 3OMNB 3OUSA 2AGAA 1YDXA 3ABMC 1F23A 3OFNG 3OTOB 4XDKA 1W0JG 4FFBB 2P6JA 3CE2A 2DE0X 4JI0O 3CCMV 4KUMA 3CXCU 1KP3A 1Q5OA 4B3SO 4PI2A 5KA5A 3ZMUA 1SQBH 4DR2O 4O2AB 3J7AU 2CE4A 2AHZA 4DV1B 1V55C 1RM1B 3JASB 2JEXA 3A8TA 2CTQA 2FL4A 3OR6C 3JCZA 5EZYA 2QWPB 1CEZA 5KHGA 5B1AB 2BTQB 2OTJV 1N8RW 3G4SV 1QLEB 2CK3G 3F7VC 4LNUB 4P9PA 4WCEV 1N4CA 4JTCB 4PJ0Z 4KFMA 3D36A 3BFRA 5CA1A 2PI4A 3MD0A 2ZIMA 1G4YB 2CTPA 3ABKC 4JI1O 3AG7A 2CGOA 1BMFG 5LHGA 3QG5A 4DV3O 4PA3A 1H2SB 4MW8A 1KC8W 3FB6C 1SERA 1NJIW 3JALA 1XNRO 4N21A 3DSQA 1K5SA 2A9HA 2Q9LA 1GTOA 1V54C 2WLKA 2KB1A 1JCHA 5LXTA 4O4JB 2UUBO 4TWKA 5DECA 4MVUA 5KA6A 4ZHQB 2OT5A 4P30A 1G1XB 2W6IG 2WAMA 2NR5A 4DR1B 1TGOA 4WBNA 4K0KB 3CJHA 5BR8O 2JVDA 3VQYA 4IHJB 4HZ3A 2E3CA 5H5NA 3LSUA 5KHKA 1M1KW 1Y66A 2PYLA 2WPDG 1VQMV 2NLJC 1NR7A 3CC2V 1MABG 5BMVA 1AB3A 3E83A 2EZPA 2EX3A 1QQCA 4QPKA 4O4HB 3WB0A 5LYJA 1YZBA 4GX1A 4TUYB 4BIOA 1M90W 2HJDA 1SS3A 1AR1B 1VQOV 3SYOA 2E76B 3K58A 5IY5B 1J95A 3LDEA 3S3XA 4QGPA 1AR5A 5LP6A 2Y4UA 1R6TA 1Q43A 3D3QA 3KKYA 4I5SA 1L0NH 3JAWB 2DN9A 4YJ2B 3UO3A 1IBMB 4EEQA 4CBCA 4DR6O 4FZ0A 3FX7A 3H1LH 5LGUA 4EFEA 2ARHA 4O2BB 4LC1A 2CTWA 1R73A 2JRIA 4YJ3A 5JQGB 5CBHA 4MVSA 1YTFD 4F4LA 4WFHA 3KDRA 1M56C 4FM1A 3F7YC 2UUAO 3B09A 3FKSG 5D5PA 1NTMH 3ASOB 2XAGA 2RDCA 3UT5B 2H3OA 1XBLA 3APOA 4E2LA 1NI8A 1QU7A 1I5YA 1BHAA 3BVOA 2JEUA 3JYCA 4R6ZA 1IBLB 2GUZA 4UCRA 3M99B 5B1NA 4PV1B 3ABUA 2X7RB 1HNWB 5H6RA 2W0FC 1XEQA 1WJZA 3K57A 4DO2A 2UXBB 4NTXA 4GYCB 2EJ7A 4DR5B 3JAKA 3ZRWB 1W59A 4LF8B 3LUTB 5LOVB 1PM9A 3F5TA 3LSQA 4C7UA 1F4NA 1FJGB 1WA8B 4LR3A 4ASUG 4X66O 3FYEB 4KXRA 2DYRB 2QKAA 1V9PA 1M57B 1H2MA 2Z5UA 3GVMA 1JMKC 1JVMA 4I4TA 4TQDA 2VQFO 4Q20A 5B1BB 2YI8A 1PNLA 1GN3A 1WN7A 2QR4A 2Q68A 3K5NA 1Q81W 3GB7C 2Q0OC 3M7MX 2QM8A 4WFFA 1R3IC 1UPGA 4X1IA 4DR7O 2EZOA 1F7YA 1P7GA 3UO2A 2HEPA 2Y4TA 4NYKA 3JARB 1NU1H 5IWAO 2VS0A 1K73W 1QLEC 1HNXO 4KP4A 1RFYA 3SPCA 2DWEC 5D5QA 1K33A 1OV9A 5IYCO 3RWRD 4MT8A 3L73H 4X62B 1S0VA 2OIGA 5DEDA 2V7QG 2F95B 2P4VA 1LUVA 1IZ3A 1QCEA 1Q8IA 1NKDA 3ABLC 3KCXA 2VRZA 3STZC 3I5DA 1R3JC 1SESA 1Q6HA 3Q4HA 3ZN0A 5EZYB 3FB8C 4LF4O 3CCEV 2ZIOA 3D8CA 5CA3A 1V55B 2E75B 3ZHQA 5BZBA 3TGUH 1VQ9V 1VF5B 1YHQV 4JI4O 5CA1B 4WFEA 4E4EA 2O57A 1KKCA 4IL6Z 1SZTA 5L3EA 2X6AA 3H9VA 1R6NA 4FZ1A 4GLXA 4FM2A 3NR7A 4RAIA 4DV6B 4WFGA 2W6JG 1AJPA 3ABKB 2CUGA 5LMNO 1KMIZ 3JALB 3H1HH 1MZEA 2P4KA 4DV2O 4BIUA 1VQ6V 3LNNA 4UVCA 2HVKC 1OCRC 4DUYO 3ML0A 2ZNJA 5LXTB 3AG3C 5TISZ 4UV9A 4FLUA 4YHHB 1K4CC 4UVBA 1ZWIC 1FYJA 1VQPV 2RQ6A 2HHHO 4KL1A 4GX2A 2F66C 4JV5B 1EZJA 1DGSA 2ZCEA 4UVAA 3B8NA 4GT1A 2XNDG 4MW3A 5KAIZ 1P49A 3EXAA 3OAAG 4TOIA 3K04A 4WBNB 3B4SA 4DV4O 3IC7A 4CS4A 5A2QN 3M8AA 2OWOA 4LFAO 3CJHB 3N2KB 2C2AA 2EJRA 1WLEA 3K5OA 4QPJA 1L0LH 4D7TA 2WLJA 2LJ2A 4TT3G 2B1GA 2ZE5A 2ADPA
chains in the Genus database with same CATH topology
1MA1A 2AW9A 3K9SA 3AK3A 4FFKA 1GN6A 1WB7A 1AR4A 1Y67A 1I08A 1PL4A 3LSUA 1ZLZA 2CE4A 1AP6A 1AP5A 5A9GA 1I0HA 4YIOA 4BR6A 3AK2A 1PM9A 4E4EA 1EN6A 1JA8A 1GN4A 4C7UA 1KKCA 3C3SA 3QVNA 2RCVA 1LUWA 2QKAA 4X9QA 1XILA 1XREA 2ADQB 3EVKA 4JYYA 1SZXA 2CDYA 3DC5A 1VEWA 1BSMA 3BFRA 2QKCA 2P4KA 1BS3A 1MSDA 1GN3A 4JZGA 3TJTA 1EN4A 3OT7A 1WB8A 1AR5A 3AK1A 1XUQA 1XDCA 1BT8A 3KKYA 1N0JA 3CEIA 1AVMA 1ZUQA 1P7GA 3IC9A 1IX9A 1N0NA 1ZTEA 5AG2A 1ZSPA 1VARA 4YIPA 1JR9A 4F6EA 4GUNA 1IDSA 1EN5A 3KDRA 3DC6A 1MNGA 1IXBA 2GDSA 1B06A 1EM1A 3MDSA 3RN4A 1MMMA 1D5NA 1LUVA 3C3TA 1GN2A 4JZ2A 1QNMA 2ADPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MA1 A;  2AW9 A;  3K9S A;  3AK3 A;  4FFK A;  1GN6 A;  1WB7 A;  1AR4 A;  1Y67 A;  1I08 A;  1PL4 A;  3LSU A;  1ZLZ A;  2CE4 A;  1AP6 A;  1AP5 A;  5A9G A;  1I0H A;  4YIO A;  4BR6 A;  3AK2 A;  1PM9 A;  4E4E A;  1EN6 A;  1JA8 A;  1GN4 A;  4C7U A;  1KKC A;  3C3S A;  3QVN A;  2RCV A;  1LUW A;  2QKA A;  4X9Q A;  1XIL A;  1XRE A;  2ADQ B;  3EVK A;  4JYY A;  1SZX A;  2CDY A;  3DC5 A;  1VEW A;  1BSM A;  3BFR A;  2QKC A;  2P4K A;  1BS3 A;  1MSD A;  1GN3 A;  4JZG A;  3TJT A;  1EN4 A;  3OT7 A;  1WB8 A;  1AR5 A;  3AK1 A;  1XUQ A;  1XDC A;  1BT8 A;  3KKY A;  1N0J A;  3CEI A;  1AVM A;  1ZUQ A;  1P7G A;  3IC9 A;  1IX9 A;  1N0N A;  1ZTE A;  5AG2 A;  1ZSP A;  1VAR A;  4YIP A;  1JR9 A;  4F6E A;  4GUN A;  1IDS A;  1EN5 A;  3DC6 A;  1MNG A;  1IXB A;  2GDS A;  1B06 A;  1EM1 A;  3MDS A;  3RN4 A;  1MMM A;  1D5N A;  1LUV A;  3C3T A;  1GN2 A;  4JZ2 A;  1QNM A;  2ADP A; 
#chains in the Genus database with same CATH topology
 1AI6 A;  5FNV A;  2PGG A;  2UU9 O;  2KSD A;  4LF5 O;  5BMV B;  1NS1 A;  5B66 Z;  4HAM A;  1SC5 B;  5KX5 A;  5LYJ B;  4JI0 B;  2IJH A;  2PUS A;  4BIZ A;  4B3S B;  2GSM B;  3L75 H;  5H9C A;  2ZT9 B;  4KHP O;  3AK2 A;  4DR2 B;  2WSS G;  1AI4 A;  3BAA A;  1LNQ A;  3GWK C;  3CRC A;  4J10 A;  5B5E Z;  5LP6 B;  3OR7 C;  1KU9 A;  1H2G A;  3AG4 C;  2DMX A;  4OXS A;  2B1I A;  3EVK A;  2ZM6 O;  2A0L A;  2YXL A;  2JK5 C;  4LFB O;  3H1I H;  2YEV A;  2V4D A;  3CB2 A;  3TJT A;  3KG2 A;  3KCY A;  1K7D A;  4RQF A;  4JI1 B;  3VQX A;  2GTS A;  4FLY A;  4YJ3 B;  3WG7 B;  1JJO A;  3UM7 A;  4JI7 B;  3OEE G;  5BY1 A;  1YTF B;  4DV3 B;  1WP8 A;  2R70 A;  3W7S A;  4QNH B;  2PF4 E;  1I94 O;  1OCO B;  2WLH A;  1MOF A;  2M7W A;  1M57 C;  2JJ2 G;  3UKM A;  1VQ7 V;  1XNR B;  4RWU A;  2AZ2 A;  3CMA V;  4K8Z A;  2R9I A;  2IW5 A;  1M4U A;  3ZBH A;  2GUZ B;  1G6U A;  5J9P C;  1Y6X A;  2UUB B;  1EN5 A;  4LP8 A;  1MNG A;  4MTX A;  2WLL A;  5IYD O;  1YEW A;  1US6 A;  4MSW C;  4EB6 A;  3RN4 A;  1MMM A;  4BW9 A;  2L6L A;  1E1R G;  3JAK B;  1Z5V A;  3K0D A;  3J81 N;  3N27 A;  5KHI A;  1QNM A;  3G6B A;  3A0H Z;  5J2T A;  4LCU C;  4LF9 O;  4GX0 A;  2FB5 A;  1GH6 A;  3BA9 A;  4PDV A;  4MTO A;  1VQ8 V;  2DQ3 A;  4AIL C;  2GTA A;  2RJZ A;  4JI8 O;  5BR8 B;  4ZBM A;  3OD4 A;  4I4T B;  2RNB A;  3DXR A;  3W7X A;  2B9Z A;  3E8F A;  3JD1 A;  3CCV V;  1JNB A;  5K1P A;  1JX9 A;  3BA8 A;  2ZR3 A;  1QBZ A;  4JI2 O;  4H13 B;  3SYQ A;  2P67 A;  3SPI A;  1IUR A;  4I55 A;  5C93 A;  4JF3 A;  4H0L B;  3ZX6 A;  3A0B Z;  1VQN V;  4PDM A;  2OYQ A;  4NVP A;  4NXN B;  4X1I B;  4FVM A;  1SZX A;  4Q6G A;  2YDE A;  2WA3 A;  1E1Q G;  2R72 A;  1GM7 A;  3FD9 A;  1NBM G;  1COW G;  1Q3E A;  1VQ5 V;  3JSL A;  1WB8 A;  4IGG A;  3D36 C;  1RP3 B;  1B04 A;  2A7W A;  3ZED A;  2BSK A;  1E79 G;  5FLX N;  1SET A;  4DW0 A;  4RUE A;  4JI3 O;  1XL4 A;  5LMU O;  3O65 A;  1N33 O;  1KB9 F;  4WFA V;  2OTL V;  2Z0A A;  3T2M A;  3DGE A;  3BY6 A;  3D3I A;  1SF9 A;  2HVJ C;  4DR6 B;  2HKO A;  4DK0 A;  3Q4H B;  4XDJ A;  2X6C A;  4X8A A;  3FFQ A;  4PHZ A;  3ABL B;  1XNQ O;  1BGY H;  3K9A A;  2Q6A A;  2UXN A;  1QHT A;  2QTO A;  4TV8 A;  2GDS A;  3CHX A;  1YSC A;  4JAV A;  2UUA B;  3E22 A;  5H2F Z;  1FOU A;  2JIZ G;  1PL0 A;  5EIB D;  3K9S A;  1XMQ O;  1HR0 O;  4WFB V;  4O4I A;  1KEC A;  1CPY A;  4AQY O;  1DTO A;  1OHH G;  2QWR B;  3K0G A;  4UB6 Z;  1SRY A;  1FFX A;  1SA0 A;  3CME V;  4MVM A;  4XDL A;  3L70 H;  1J5E O;  1QR8 A;  4I9W A;  3H01 A;  4H37 A;  4GX5 A;  3WB1 A;  2FKX A;  1RSO A;  3K06 A;  1XIL A;  2DW4 A;  4JAA A;  5EBW C;  4ZKI A;  4X66 B;  3N2K A;  3RYC A;  4JYY A;  5IJ9 A;  1OCR B;  3NXS A;  3K5L A;  1WNS A;  1K5Q A;  2QWO B;  3AG3 B;  4ZI7 A;  4K3A A;  3GWO A;  1FD9 A;  2B5U A;  4RQE A;  1R6K A;  1JFF A;  3AK1 A;  3ZHT A;  2HLD G;  1SQF A;  2JDI G;  5LP6 C;  4DR7 B;  1FAF A;  1ZTE A;  5AG2 A;  4NXM O;  2IU0 A;  3ZIA G;  5IWA B;  2PZS A;  4X89 A;  2R9R B;  2IH3 C;  1HNX B;  1PV0 A;  2PYJ A;  5FNV B;  3B40 A;  4UCV A;  4RUF A;  3CC7 V;  4IIJ A;  5B3S C;  5ITZ A;  2YIA A;  3DC6 A;  3WFV A;  4DV5 O;  5KX5 B;  4HNA A;  3BPZ A;  4X64 O;  3MDS A;  3BCC H;  1D5N A;  3T4Z A;  4FPP A;  2XTA A;  4FJC C;  3HKD A;  3WG7 C;  4CS2 A;  3RGB A;  1XI1 A;  2A3Q A;  1OCO C;  5IT9 N;  3L71 H;  4CH5 A;  3CP1 A;  4DR4 O;  1Q7Y W;  3AK3 A;  3ETQ A;  3CPW U;  1VQ4 V;  4LF4 B;  4OX9 O;  3VBB A;  1PL4 A;  2DJV A;  3JD0 A;  4FLX A;  4D6T H;  2YEV B;  3ZHS A;  1EFR G;  3P30 A;  4NKG B;  3AG4 B;  4JI4 B;  4GCZ A;  2XT9 A;  5EBL C;  3SDL A;  3L72 H;  4U3J A;  2N04 A;  2UXD O;  2Y48 A;  3T1H O;  1OCC B;  2ZE7 A;  1K9M W;  1OJH A;  1XRE A;  2ADQ B;  3ZHU A;  3SJC C;  2RMK B;  1YI2 V;  1H5W A;  4JTA B;  3SJQ C;  4B3R O;  1BS3 A;  4PI0 A;  5LMN B;  4I0X A;  4MS2 A;  2YC0 A;  4JYB A;  4CC6 A;  4DV2 B;  3OT7 A;  2F4V O;  2QM4 A;  1XUQ A;  2FML A;  4DUY B;  3SYP A;  4UFZ A;  1CP9 A;  2QEX V;  1AVM A;  1MZF A;  2GV9 A;  1Y4M A;  2KKW A;  2XOK G;  2WLL B;  4K35 A;  1PPJ H;  4EB6 B;  1DLB A;  2YUA A;  2FYU H;  1YIJ V;  2HHH B;  1S76 D;  2LQT A;  1NR1 A;  4MVR A;  5J2T B;  1QR9 A;  1QVF U;  2YSU B;  1IDS A;  2P5O A;  2Q67 A;  4LWS A;  4B7K A;  4DV4 B;  4LFA B;  5IE9 A;  4A5U B;  3TET A;  4X1K A;  2G38 A;  4Z2W A;  3DXR B;  4G2K A;  1FS0 G;  2P7T C;  3IJ4 A;  5CBF A;  4UXN A;  3W7T A;  3CX5 F;  2YS8 A;  2Q69 A;  3HKB A;  3IAY A;  4LF6 O;  4FLT A;  1YCI A;  4I55 B;  4J41 A;  2F43 G;  1ZX3 A;  2UU9 B;  3RYI A;  1VIB A;  2WLI A;  4LF5 B;  5J2U B;  1GO3 F;  4B3T B;  1XMO O;  5A9G A;  2P22 C;  5GTH Z;  1OCZ C;  5DM6 V;  5EK0 A;  4PDL A;  1EN6 A;  1PNM A;  3QTC A;  4LBE C;  2Q5Z A;  5CB4 A;  5KHJ A;  4KHP B;  2YIC A;  4LFC O;  3CCJ V;  1H2L A;  3G80 A;  1VQK V;  1PKX A;  4LH7 A;  1NTZ H;  1JOY A;  5CMU A;  1HNZ O;  1GK9 A;  3THO A;  1SQG A;  2BSK B;  5IYZ A;  2F1M A;  3HKE A;  4L8J A;  5E79 Z;  2IJI A;  2QKC A;  2ZE6 A;  2VQE O;  1B6Q A;  2ZM6 B;  2XHB A;  4JYA O;  2N74 A;  2Q7H A;  4LFB B;  1QVG U;  1BE3 H;  1FKA O;  1BHB A;  2IH1 C;  2DOS A;  4J7J A;  1NVP D;  3VQW A;  3E8B A;  2ZXW C;  1N34 O;  1BT8 A;  4DUZ O;  3SYA A;  4B3M O;  4FLW A;  3IC9 A;  4BWA A;  3AG1 C;  1NQT A;  4TV8 B;  2D3O W;  3OMA B;  1S3J A;  2YID A;  1PNK A;  4MTF A;  4D7S A;  1K3E A;  1XOU A;  4ZIB A;  4X65 O;  3OW2 U;  1I94 B;  3E22 B;  3SPJ A;  5H6Q A;  1TUB A;  4Z1M G;  1HW7 A;  2QWQ B;  2KG7 B;  2QTS A;  4H33 A;  4FIP C;  2ODM A;  4JI6 O;  2HP8 A;  4O4I B;  1UJW B;  2Y69 B;  1B06 A;  5FPR A;  4MTG A;  1FJG O;  2JJ1 G;  3HB3 B;  1FFX B;  1SA0 B;  1Y74 A;  1GN2 A;  5BXZ A;  4CC5 A;  1NT2 B;  2HFE C;  1TAE A;  2AW9 A;  3TXQ A;  4AI8 A;  3ZMT A;  4LF7 O;  3ASN B;  1S77 D;  3EHB B;  1RSO B;  2AXT Z;  4LF9 B;  4UUJ C;  5KUM A;  3JD2 A;  3SJA C;  4QE7 A;  3RYC B;  3ZMV A;  3E86 A;  1ZLZ A;  5IJ9 B;  1I0H A;  2ZQM A;  1B3Q A;  1VP7 A;  2EIJ C;  4ZI7 B;  4JI8 B;  3OMI B;  4LH6 A;  4ABM A;  4CH4 A;  3QVN A;  4FLV A;  3SR2 C;  4ZOL A;  2N05 A;  4BW5 A;  1M5I A;  3L74 H;  4X9Q A;  1JFF B;  5FL7 G;  5KAF Z;  4JI2 B;  4X88 A;  3HKC A;  5DN6 G;  2QJ1 A;  3L9D A;  3F5W C;  2Q4P A;  2ZR2 A;  4MVZ A;  4DV0 O;  3C90 A;  3ZN1 A;  1MSD A;  3CWB H;  3ZRX A;  2X0L A;  4HBN A;  1SQQ H;  2QDO A;  3P32 A;  2W0X A;  3SJB C;  4DW1 A;  1EZV H;  1VQL V;  1Q90 D;  5JVD A;  4IIJ B;  5ITZ B;  4XBF A;  2Z3Y A;  1IX9 A;  5L3G A;  1OCC C;  5LHH A;  4HNA B;  2JGD A;  3BRC A;  1ZSP A;  3HKD B;  3ZHV A;  4JI3 B;  1Y76 A;  1TA8 A;  1A32 A;  2Q73 A;  5LMU B;  2NN4 A;  5F2V O;  5B3S B;  1N33 B;  2L35 A;  1O9G A;  4U7N A;  4J9Z B;  2HR3 A;  1N36 O;  1JR9 A;  1OZ0 A;  2E5L O;  4R8C A;  4UB8 Z;  5LL6 Y;  1S5L Z;  4JI5 O;  2XAJ A;  1IXB A;  3STL C;  3MAQ A;  1XNQ B;  2P06 A;  3QF7 A;  3TXS A;  3N2G A;  1TVK A;  1FXH A;  2ATK C;  1IBK O;  1P84 F;  4U3J B;  3CXH F;  1WB7 A;  5CBG A;  1HR0 B;  4GZR B;  1K4D C;  4P9O A;  3ZMZ A;  3ZRV A;  4FM0 A;  2CGN A;  4K8X A;  4AQY B;  1JA8 A;  4I0X B;  2P90 A;  4H44 B;  1VF6 C;  2RCV A;  1YF2 A;  4JPR A;  1LUW A;  1J5E B;  4Z1V A;  3E2E A;  2EIK B;  2YI9 A;  4NB5 A;  3A2F A;  2OCC C;  1AIL A;  3H1J H;  3T1C A;  2UXC O;  3DC5 A;  1VF6 A;  1ZL8 A;  4BAY A;  2ZNI A;  2H8P C;  2IBZ H;  1M93 A;  3P3N A;  1KQS U;  1WPX A;  3BAB A;  2E74 B;  5E1A C;  4OGQ B;  3CCU V;  2LP7 A;  2CAZ C;  1K8A W;  1IVS A;  1MG1 A;  1H8E G;  4LWS B;  1DF4 A;  5J2U A;  2Q7E A;  3RT3 C;  4YY3 O;  3OEH G;  4I7Z B;  4R7C A;  4X1K B;  4IT5 A;  3OM3 B;  1I5X A;  1L1F A;  4UCS A;  4DV7 O;  4NXM B;  3HKB B;  4F6E A;  3CYO A;  2ITC C;  5EYP A;  2ITD C;  3RYI B;  1G8M A;  2WLI B;  1EM1 A;  3ETE A;  1W0K G;  4DV5 B;  5GON A;  3R65 A;  3T4D A;  1GRJ A;  4X64 B;  3E8G A;  5LBQ A;  5B1O A;  5EBM C;  4J9Y B;  5CB4 B;  4J42 A;  2PI5 A;  1Q82 W;  2QSA A;  4FFK A;  1OCZ B;  2Y0P A;  5IYZ B;  5EIB C;  4DR4 B;  1R3K C;  1AP6 A;  1AP5 A;  3JAT A;  1PD3 A;  2VWJ A;  3W7W A;  4YIO A;  3HKE B;  1K34 A;  4F6R A;  3LSS A;  3LNM B;  2BOB C;  4OX9 B;  4UV8 A;  5L3F A;  1RPR A;  2Y69 C;  3T1Y O;  3K5M A;  4JI7 O;  4PA9 A;  4G28 B;  4NTY A;  4B08 A;  4DR3 O;  1NTK H;  1NVP B;  4AHC A;  1FFT B;  1FXV A;  2KG7 A;  2UXD B;  4GKK O;  2UUC O;  3T1H B;  2MW2 B;  5GW7 A;  2A79 B;  4DK1 A;  1VEW A;  3ASN C;  3B8M A;  1TUE B;  5C8Y A;  1NH2 D;  4P2Z A;  3W7U A;  2ZXW B;  4DRX A;  3RYH A;  4JZG A;  2IJJ A;  4B3R B;  3ETD A;  5HFM A;  2F23 A;  1GM8 A;  2KQX A;  3QO5 A;  3AG2 C;  4TQF A;  4GKJ O;  3X2Q C;  5IDJ A;  3AG1 B;  3FYI B;  2R9A A;  1IJG A;  2EIN B;  3A0R A;  1TUB B;  3FAV A;  5LGN A;  1X59 A;  4QIW F;  2F4V B;  1N32 O;  2GHY A;  3G67 A;  1JQ0 A;  2HG5 C;  3MHH C;  2K9P A;  3CRR A;  3QO8 A;  1Y74 B;  2A06 H;  4O4L A;  2VQF B;  2DYS B;  3FB7 C;  3E8H A;  1AI5 A;  2DQ0 A;  1KD1 W;  3HPL C;  2YIB D;  2YIB A;  3CS5 A;  3QNE A;  2XAQ A;  2LFS A;  4W4K A;  1XHX A;  3OTO O;  3RYF A;  1H8H G;  2CH7 A;  1W2B U;  3VQV A;  3G71 V;  3R66 A;  3K59 A;  1SQX H;  1U97 A;  1T5E A;  4JZ2 A;  1S5H C;  3P3P A;  4ZOL B;  4NXN O;  4RO2 A;  3PN1 A;  3OE7 G;  4DV1 O;  2XAF A;  3K03 A;  4LF6 B;  2EIJ B;  3HKC B;  1M9N A;  1JJ2 U;  1H2K A;  1HWY A;  2LO1 A;  2BCC H;  5L3B A;  3U0Z A;  5JJE B;  1XMO B;  1P4R A;  3UCS C;  2JGU A;  4I50 A;  1K92 A;  1MSW D;  1FXK C;  4CS3 A;  4LFC B;  2EIM B;  1SQV H;  5KUK A;  5JVD B;  2EIL B;  3IGA C;  3ABT A;  1Q6U A;  5IYB O;  1HNZ B;  3ZHR A;  4WF9 V;  4PD4 F;  4N23 A;  1FXK A;  1VF7 A;  2JGD B;  1XHZ A;  1P7B A;  4JAU A;  1YJ9 V;  1Y76 B;  2VQE B;  4JYA B;  2BE3 A;  5CA0 A;  4UCT A;  1PP9 H;  4HYO A;  3B77 A;  5IJ0 A;  1N34 B;  1R3L C;  4DUZ B;  1AI7 A;  5LA6 A;  4B3M B;  2EIK C;  3N2G B;  1TVK B;  3ZJZ A;  5JCO C;  5JH7 A;  3CCS V;  4PDR A;  3IFX A;  3SYC A;  4X65 B;  4DXW A;  5LHI A;  4ICG A;  1BL8 A;  4X1Y A;  1R1B A;  1IXM A;  1VMG A;  4U3F H;  4I9Q A;  5JCO A;  5KHH A;  4X20 A;  5KMG A;  2Q7G A;  3CRM A;  4JI6 B;  4DR1 O;  3JD4 A;  1JPX A;  4TV9 A;  4K0K O;  3ICX A;  4EKW A;  1RPO A;  2CTR A;  2M6Y A;  1Z2G A;  1KYO F;  2V1D A;  1GN6 A;  4LF7 B;  5L3D A;  3E35 A;  1Y67 A;  3I55 V;  3OGC C;  5L3C A;  1YXB A;  4J80 A;  3E89 A;  2GBO A;  2AHY A;  1ZL8 B;  1EBO A;  3RFR A;  2ZD9 A;  1ROP A;  2D2C B;  3O9O A;  1AJN A;  4FFB A;  3B2E E;  2OCC B;  2XUM A;  2LGW A;  3JAM N;  1RM1 C;  3H1K H;  4OPA A;  4QE9 A;  3ZRS A;  2QGN A;  5GTI Z;  4O2A A;  5B1A C;  1Q6I A;  1YJN V;  3CCR V;  1BSM A;  3HR0 A;  3JAS A;  2ZDI C;  2YXH A;  2LFR A;  1BQZ A;  2ILM A;  1YVW A;  3MHS C;  1BCC H;  3OGI B;  4DV0 B;  2UXX A;  1S72 V;  2BTQ A;  1UFI A;  2OCH A;  2ZDI A;  1IBM O;  1WP7 A;  4LNU A;  3CEI A;  3ABM B;  3I56 V;  4W4L A;  5EYP B;  1HP8 A;  2Y0I A;  4OPH A;  2DWD C;  2ZKO A;  1ZAU A;  1KKD A;  1I7F A;  2MK3 A;  5GON B;  2WA4 A;  2WLM A;  1D2D A;  4B7E A;  2IJK A;  1KP2 A;  3SGI A;  2QE7 G;  2HJF C;  1N36 B;  3LDC A;  2E5L B;  1GKF A;  5K1X A;  4IYI A;  4J7Z A;  1NZ6 A;  4JI5 B;  1IBL O;  3K79 A;  2EIN C;  3JAT B;  2LGQ A;  2Q8V A;  4UCU A;  4F6R B;  4R50 A;  2JS5 A;  3SPH A;  1H38 A;  3RW0 A;  4O4J A;  2PY5 A;  2ZIN A;  3RVY A;  1MA1 A;  3LDD A;  1HNW O;  4ZHQ A;  4CH6 A;  2UXB O;  1O9H A;  2BTO A;  4DR5 O;  1IBK B;  1GM9 A;  1AR4 A;  3RVZ A;  4LF8 O;  2DYS C;  1ARO P;  4L87 A;  1BZK A;  4BR6 A;  2BOC C;  4NTW A;  3BHP A;  5C8Y B;  1NH2 B;  2EBO A;  1GAX A;  3C3S A;  4DRX B;  3RYH B;  4YXW G;  3QO7 A;  2K1E A;  2LW7 A;  1DK1 A;  1ENV A;  4IHJ A;  4PA6 A;  2RN9 A;  3FB5 C;  1V54 B;  3FAV B;  1XL6 A;  2IM9 A;  4PA7 A;  3AG2 B;  3X2Q B;  3SPG A;  2UXC B;  3CSX A;  3JSN A;  2XAS A;  3TK1 A;  5JWP A;  1KBH A;  1KUQ A;  1YIT V;  4MVO A;  4O4L B;  1WAZ A;  4CH3 A;  3CCQ V;  5JJN B;  5CN0 A;  4O4H A;  4PEL A;  5IY5 C;  4MVQ A;  1XDC A;  4TUY A;  1CXZ B;  1ZUQ A;  1QLN A;  5EC2 C;  1URF A;  1N0N A;  2EIM C;  3RYF B;  1U96 A;  1GMG A;  2CH7 B;  2EIL C;  4PA4 A;  2QKS A;  4YY3 B;  1Q86 W;  3ZS8 C;  4X62 O;  3J80 N;  4YIP A;  4FK5 C;  3KZI Z;  4J11 A;  1XQ8 A;  4GUN A;  4G27 B;  4B3T O;  2YXY A;  3JAW A;  1THZ A;  4YJ2 A;  2WLN A;  4FLZ A;  5JJJ B;  4DV7 B;  5EC1 C;  2LW1 A;  2Q0A A;  4UCO A;  3CRA A;  2PTM A;  3C3T A;  1WPB A;  3TCU A;  3AEI A;  4O2B A;  4FMT A;  1F4M A;  1AJQ A;  3ASO C;  3U10 A;  2H94 A;  3VOU A;  5JQG A;  3BEH A;  4I50 B;  2WWW A;  3JD3 A;  1YJW V;  4TSF G;  3UT5 A;  3U11 A;  1I08 A;  4JAS A;  2EUL A;  2IU3 A;  2ZE8 A;  3APQ A;  1X4T A;  3ETG A;  2X6B A;  3OTF A;  4J7K A;  1HDJ A;  1F51 A;  4CZZ A;  1FXK B;  1GN4 A;  3CD6 V;  3ZMS A;  5KLV H;  4IYH A;  4DV6 O;  1D5A A;  1ORQ C;  1Z5W A;  5CA0 B;  2VWK A;  3ZCC A;  3T1Y B;  2AZ0 A;  4DR3 B;  3OUF A;  4JTD B;  3K3W A;  1XMQ B;  5IJ0 B;  2CDY A;  2DYR C;  3EFF K;  3ZRW A;  5LOV A;  4GKK B;  2UUC B;  5LA6 B;  1WA8 A;  1M56 B;  3WU2 Z;  1EN4 A;  4YHH O;  3S3W A;  1LR1 A;  5FPO A;  1BQ0 A;  1SKV A;  3CRQ A;  5JH7 B;  3CCL V;  1L8D A;  3G6E V;  2JS3 A;  4JYC A;  2OIE A;  5B1B C;  4DYL A;  2QM7 A;  4EFB A;  1N0J A;  4GKJ B;  2QA4 V;  2FTK A;  4X1Y B;  3WB2 A;  2QWN B;  3JCU Z;  4U7O A;  4JV5 O;  4QJF B;  2ETN A;  3RBZ A;  1DF5 A;  4JGS A;  1N32 B;  3PJS K;  3K08 A;  4X20 B;  5KMG B;  1SQP H;  2F93 B;  1VAR A;  4TV9 B;  2NNU A;  3CC4 V;  1FPO A;  4NR1 A;  5LGT A;  1H2N A;  5HFL A;  1K97 A;  2XAH A;  1S5J A;  3JAR A;  3DTU B;  3UQ8 A;  3OMN B;  3OUS A;  2AGA A;  1YDX A;  3ABM C;  1F23 A;  3OFN G;  3OTO B;  4XDK A;  1W0J G;  4FFB B;  2P6J A;  3CE2 A;  2DE0 X;  4JI0 O;  3CCM V;  4KUM A;  3CXC U;  1KP3 A;  1Q5O A;  4B3S O;  4PI2 A;  5KA5 A;  3ZMU A;  1SQB H;  4DR2 O;  4O2A B;  3J7A U;  2CE4 A;  2AHZ A;  4DV1 B;  1V55 C;  1RM1 B;  3JAS B;  2JEX A;  3A8T A;  2CTQ A;  2FL4 A;  3OR6 C;  3JCZ A;  5EZY A;  2QWP B;  1CEZ A;  5KHG A;  5B1A B;  2BTQ B;  2OTJ V;  1N8R W;  3G4S V;  1QLE B;  2CK3 G;  3F7V C;  4LNU B;  4P9P A;  4WCE V;  1N4C A;  4JTC B;  4PJ0 Z;  4KFM A;  3D36 A;  3BFR A;  5CA1 A;  2PI4 A;  3MD0 A;  2ZIM A;  1G4Y B;  2CTP A;  3ABK C;  4JI1 O;  3AG7 A;  2CGO A;  1BMF G;  5LHG A;  3QG5 A;  4DV3 O;  4PA3 A;  1H2S B;  4MW8 A;  1KC8 W;  3FB6 C;  1SER A;  1NJI W;  3JAL A;  1XNR O;  4N21 A;  3DSQ A;  1K5S A;  2A9H A;  2Q9L A;  1GTO A;  1V54 C;  2WLK A;  2KB1 A;  1JCH A;  5LXT A;  4O4J B;  2UUB O;  4TWK A;  5DEC A;  4MVU A;  5KA6 A;  4ZHQ B;  2OT5 A;  4P30 A;  1G1X B;  2W6I G;  2WAM A;  2NR5 A;  4DR1 B;  1TGO A;  4WBN A;  4K0K B;  3CJH A;  5BR8 O;  2JVD A;  3VQY A;  4IHJ B;  4HZ3 A;  2E3C A;  5H5N A;  3LSU A;  5KHK A;  1M1K W;  1Y66 A;  2PYL A;  2WPD G;  1VQM V;  2NLJ C;  1NR7 A;  3CC2 V;  1MAB G;  5BMV A;  1AB3 A;  3E83 A;  2EZP A;  2EX3 A;  1QQC A;  4QPK A;  4O4H B;  3WB0 A;  5LYJ A;  1YZB A;  4GX1 A;  4TUY B;  4BIO A;  1M90 W;  2HJD A;  1SS3 A;  1AR1 B;  1VQO V;  3SYO A;  2E76 B;  3K58 A;  5IY5 B;  1J95 A;  3LDE A;  3S3X A;  4QGP A;  1AR5 A;  5LP6 A;  2Y4U A;  1R6T A;  1Q43 A;  3D3Q A;  3KKY A;  4I5S A;  1L0N H;  3JAW B;  2DN9 A;  4YJ2 B;  3UO3 A;  1IBM B;  4EEQ A;  4CBC A;  4DR6 O;  4FZ0 A;  3FX7 A;  3H1L H;  5LGU A;  4EFE A;  2ARH A;  4O2B B;  4LC1 A;  2CTW A;  1R73 A;  2JRI A;  4YJ3 A;  5JQG B;  5CBH A;  4MVS A;  1YTF D;  4F4L A;  4WFH A;  3KDR A;  1M56 C;  4FM1 A;  3F7Y C;  2UUA O;  3B09 A;  3FKS G;  5D5P A;  1NTM H;  3ASO B;  2XAG A;  2RDC A;  3UT5 B;  2H3O A;  1XBL A;  3APO A;  4E2L A;  1NI8 A;  1QU7 A;  1I5Y A;  1BHA A;  3BVO A;  2JEU A;  3JYC A;  4R6Z A;  1IBL B;  2GUZ A;  4UCR A;  3M99 B;  5B1N A;  4PV1 B;  3ABU A;  2X7R B;  1HNW B;  5H6R A;  2W0F C;  1XEQ A;  1WJZ A;  3K57 A;  4DO2 A;  2UXB B;  4NTX A;  4GYC B;  2EJ7 A;  4DR5 B;  3JAK A;  3ZRW B;  1W59 A;  4LF8 B;  3LUT B;  5LOV B;  1PM9 A;  3F5T A;  3LSQ A;  4C7U A;  1F4N A;  1FJG B;  1WA8 B;  4LR3 A;  4ASU G;  4X66 O;  3FYE B;  4KXR A;  2DYR B;  2QKA A;  1V9P A;  1M57 B;  1H2M A;  2Z5U A;  3GVM A;  1JMK C;  1JVM A;  4I4T A;  4TQD A;  2VQF O;  4Q20 A;  5B1B B;  2YI8 A;  1PNL A;  1GN3 A;  1WN7 A;  2QR4 A;  2Q68 A;  3K5N A;  1Q81 W;  3GB7 C;  2Q0O C;  3M7M X;  2QM8 A;  4WFF A;  1R3I C;  1UPG A;  4X1I A;  4DR7 O;  2EZO A;  1F7Y A;  1P7G A;  3UO2 A;  2HEP A;  2Y4T A;  4NYK A;  3JAR B;  1NU1 H;  5IWA O;  2VS0 A;  1K73 W;  1QLE C;  1HNX O;  4KP4 A;  1RFY A;  3SPC A;  2DWE C;  5D5Q A;  1K33 A;  1OV9 A;  5IYC O;  3RWR D;  4MT8 A;  3L73 H;  4X62 B;  1S0V A;  2OIG A;  5DED A;  2V7Q G;  2F95 B;  2P4V A;  1LUV A;  1IZ3 A;  1QCE A;  1Q8I A;  1NKD A;  3ABL C;  3KCX A;  2VRZ A;  3STZ C;  3I5D A;  1R3J C;  1SES A;  1Q6H A;  3Q4H A;  3ZN0 A;  5EZY B;  3FB8 C;  4LF4 O;  3CCE V;  2ZIO A;  3D8C A;  5CA3 A;  1V55 B;  2E75 B;  3ZHQ A;  5BZB A;  3TGU H;  1VQ9 V;  1VF5 B;  1YHQ V;  4JI4 O;  5CA1 B;  4WFE A;  4E4E A;  2O57 A;  1KKC A;  4IL6 Z;  1SZT A;  5L3E A;  2X6A A;  3H9V A;  1R6N A;  4FZ1 A;  4GLX A;  4FM2 A;  3NR7 A;  4RAI A;  4DV6 B;  4WFG A;  2W6J G;  1AJP A;  3ABK B;  2CUG A;  5LMN O;  1KMI Z;  3JAL B;  3H1H H;  1MZE A;  2P4K A;  4DV2 O;  4BIU A;  1VQ6 V;  3LNN A;  4UVC A;  2HVK C;  1OCR C;  4DUY O;  3ML0 A;  2ZNJ A;  5LXT B;  3AG3 C;  5TIS Z;  4UV9 A;  4FLU A;  4YHH B;  1K4C C;  4UVB A;  1ZWI C;  1FYJ A;  1VQP V;  2RQ6 A;  2HHH O;  4KL1 A;  4GX2 A;  2F66 C;  4JV5 B;  1EZJ A;  1DGS A;  2ZCE A;  4UVA A;  3B8N A;  4GT1 A;  2XND G;  4MW3 A;  5KAI Z;  1P49 A;  3EXA A;  3OAA G;  4TOI A;  3K04 A;  4WBN B;  3B4S A;  4DV4 O;  3IC7 A;  4CS4 A;  5A2Q N;  3M8A A;  2OWO A;  4LFA O;  3CJH B;  3N2K B;  2C2A A;  2EJR A;  1WLE A;  3K5O A;  4QPJ A;  1L0L H;  4D7T A;  2WLJ A;  2LJ2 A;  4TT3 G;  2B1G A;  2ZE5 A;  2ADP A; 
#chains in the Genus database with same CATH homology
 1MA1 A;  2AW9 A;  3K9S A;  3AK3 A;  4FFK A;  1GN6 A;  1WB7 A;  1AR4 A;  1Y67 A;  1I08 A;  1PL4 A;  3LSU A;  1ZLZ A;  2CE4 A;  1AP6 A;  1AP5 A;  5A9G A;  1I0H A;  4YIO A;  4BR6 A;  3AK2 A;  1PM9 A;  4E4E A;  1EN6 A;  1JA8 A;  1GN4 A;  4C7U A;  1KKC A;  3C3S A;  3QVN A;  2RCV A;  1LUW A;  2QKA A;  4X9Q A;  1XIL A;  1XRE A;  2ADQ B;  3EVK A;  4JYY A;  1SZX A;  2CDY A;  3DC5 A;  1VEW A;  1BSM A;  3BFR A;  2QKC A;  2P4K A;  1BS3 A;  1MSD A;  1GN3 A;  4JZG A;  3TJT A;  1EN4 A;  3OT7 A;  1WB8 A;  1AR5 A;  3AK1 A;  1XUQ A;  1XDC A;  1BT8 A;  3KKY A;  1N0J A;  3CEI A;  1AVM A;  1ZUQ A;  1P7G A;  3IC9 A;  1IX9 A;  1N0N A;  1ZTE A;  5AG2 A;  1ZSP A;  1VAR A;  4YIP A;  1JR9 A;  4F6E A;  4GUN A;  1IDS A;  1EN5 A;  3KDR A;  3DC6 A;  1MNG A;  1IXB A;  2GDS A;  1B06 A;  1EM1 A;  3MDS A;  3RN4 A;  1MMM A;  1D5N A;  1LUV A;  3C3T A;  1GN2 A;  4JZ2 A;  1QNM A;  2ADP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...