3MDSA

Maganese superoxide dismutase from thermus thermophilus
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
203
structure length
203
Chain Sequence
b'PYPFKLPDLGYPYEALEPHIDAKTMEIHHQKHHGAYVTNLNAALEKYPYLHGVEVEVLLRHLAALPQDIQTAVRNNGGGHLNHSLFWRLLTPGGAKEPVGELKKAIDEQFGGFQALKEKLTQAAMGRFGSGWAWLVKDPFGKLHVLSTPNQDNPVMEGFTPIVGIDVWEHAYYLKYQNRRADYLQAIWNVLNWDVAEEFFKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Manganese superoxide dismutase from Thermus thermophilus. A structural model refined at 1.8 A resolution.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase(superoxide acceptor)
total genus 72
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1993-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3mdsA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3mdsA02
4JZ2A 2AW9A 1XUQA 1AR5A 3TJTA 1P7GA 1WB7A 1PM9A 1I08A 2CDYA 3DC5A 4FFKA 3CEIA 4GUNA 1VARA 2GDSA 3K9SA 1ZSPA 4E4EA 3AK1A 4C7UA 1GN3A 1IXBA 3BFRA 1IDSA 1MNGA 4F6EA 1AVMA 1KKCA 3MDSA 5AG2A 4JZGA 3C3TA 4X9QA 3AK2A 2ADQB 1BS3A 1AP6A 1BT8A 1N0NA 2QKCA 3QVNA 1ZUQA 1QNMA 4YIPA 2RCVA 1JR9A 3RN4A 1I0HA 3DC6A 3EVKA 1GN4A 2QKAA 1BSMA 1IX9A 3KKYA 1EM1A 1ZTEA 3OT7A 2P4KA 1JA8A 1SZXA 1XDCA 3LSUA 1XREA 3IC9A 1N0JA 1WB8A 1MMMA 1Y67A 1AR4A 3AK3A 1GN6A 5A9GA 4JYYA 4BR6A 1MA1A 1XILA 4YIOA 1GN2A 3C3SA 1EN4A 1LUWA 1LUVA 1B06A 1EN5A 1MSDA 1VEWA 2CE4A 1ZLZA 2ADPA 1AP5A 1EN6A 1PL4A 1D5NA
chains in the Genus database with same CATH superfamily
2ZCEA 2WLMA 2E5LB 2AW9A 3FB8C 4JASA 1YTFB 2L35A 2LW7A 1H2KA 4FK5C 1ZL8B 2ARHA 2HHHO 3RT3C 4I55A 4X66O 4JI5O 4AQYB 4OGQB 1K3EA 2NR5A 1VQNV 2ZIMA 4I4TA 4TUYA 3STLC 1KU9A 2QWOB 4DV3O 1CP9A 1NR7A 5KA5A 5B1OA 2E75B 2DYRB 2XAQA 4O4IB 2UXDO 2GV9A 4FLYA 4FLWA 3L75H 4DR4O 1VQ5V 3B8NA 5L3FA 1TAEA 3CCVV 3K03A 5CBFA 4GKJB 3CXCU 4JI0B 2YXHA 3I56V 4X1IB 1AP6A 3TGUH 3STZC 4CH3A 1OCCC 1BHBA 4YIPA 4O2BB 1JPXA 3ABLB 3WG7B 2LFSA 2ZR3A 1JR9A 1N34O 5IJ0A 1WP7A 1Y6XA 4R6ZA 1E79G 1DF4A 3OR7C 1IXMA 1VF7A 4DO2A 1N0JA 3OTOO 4KXRA 1VMGA 2Q7EA 4DV5O 3HKCB 2IJKA 2PGGA 4PI0A 4GT1A 1JCHA 5BR8B 3B40A 1JJ2U 3ZRWA 1L8DA 1Z5VA 2IU3A 3E89A 4DK0A 1IBLB 3R65A 3Q4HB 3CRCA 3IFXA 2FKXA 2PI5A 4LFCB 1YXBA 2EZPA 3L73H 4F6RB 1MSDA 2JGUA 4B3RO 2UUCO 4P9PA 3CCJV 1G4YB 3PN1A 4X88A 4DW0A 4BAYA 2IH3C 3WU2Z 1YJNV 3CCEV 2F4VB 4XDKA 4NXMO 5KHIA 1I94B 3WB2A 4HNAB 2FTKA 4I7ZB 5LP6A 1M90W 1S5JA 1YHQV 1HDJA 3KZIZ 2CDYA 2YSUB 2UXBO 3HB3B 5BZBA 2BTQB 3D3QA 4I9WA 2CUGA 1IBKB 3ZN0A 1XL4A 2EILC 3CRMA 2X6CA 1Y76A 5LXTA 3QNEA 4JGSA 2WA4A 4C7UA 4PDRA 1VQ7V 4LBEC 1S77D 2BSKB 4KL1A 1Q5OA 1BE3H 3ABUA 2EX3A 1M56C 1W0JG 1YSCA 5GONB 2XUMA 1HNXB 2WLIA 5B1AC 3C3TA 4NTXA 4OX9B 3MD0A 5FLXN 1O9HA 2P22C 4LF8B 3K57A 2WLNA 3H01A 4E2LA 1A32A 4QPKA 1Y74A 1H8EG 4I55B 2HLDG 5IYCO 2KSDA 1HNZO 1ZX3A 2P5OA 4K0KB 5B1BC 3K3WA 2JK5C 2M6YA 3AG3B 2C2AA 2K1EA 4B08A 1J95A 2FB5A 4JI4B 1QHTA 2PTMA 1YTFD 1FOUA 5CA1B 2CH7A 3K59A 1GN2A 4L87A 1LUVA 4MW8A 2WAMA 4NVPA 2ZNJA 1Q3EA 2EIMB 3F7YC 2JIZG 2ZXWB 1NS1A 4O2AB 4OPAA 2A9HA 2L6LA 2P67A 4JYBA 1N32B 2ZKOA 3CCSV 1E1QG 2P4VA 2ZR2A 4MVMA 2R72A 2AZ0A 3T1HB 2F4VO 2LFRA 1SETA 4MVRA 4XDJA 3M7MX 1Q8IA 4KHPB 3SR2C 1JFFA 1H2GA 4GX2A 3CPWU 1IZ3A 4JI3B 3ETDA 4DR2B 3ZRWB 1M93A 4X65B 2H8PC 2N04A 1HNWB 3JSNA 3JCZA 1Z5WA 2GTSA 2YUAA 3W7WA 4TQDA 1QR9A 5GTIZ 1KQSU 4JI6B 3ASOC 4RQEA 3HKDB 1WA8A 4N21A 1VQ9V 1YIJV 2WSSG 1MNGA 5IWAO 3OD4A 4WFGA 1FKAO 5EYPB 3QTCA 4CS2A 4PELA 2ADQB 1R6KA 2W0FC 4CS3A 1IVSA 1ZUQA 3WFVA 5LP6B 3OMAB 1VQLV 1HNXO 1JMKC 2DE0X 1YJ9V 3AG1B 4JI1B 5EBWC 2HFEC 2OIEA 2YEVA 4MVQA 4PV1B 1BCCH 4EEQA 1BQZA 2WA3A 2P06A 2R9RB 1G1XB 1L0NH 5CBGA 5LYJB 1TGOA 3I5DA 1FAFA 4K0KO 2XOKG 5DECA 5H9CA 2OIGA 2ZINA 4LFAO 4BW5A 1I5XA 1P7BA 1YCIA 2ZDIA 3BRCA 5IYZA 1SS3A 3N2KB 4WFEA 4W4LA 1TVKA 2JGDA 4TT3G 1K97A 4TV9A 2ILMA 1OV9A 4LF7B 1VQKV 3CC2V 4PHZA 1OZ0A 3C90A 4DV2O 3E22B 4JZ2A 3UCSC 3SJAC 4EFBA 1RPOA 1P7GA 3JD3A 4PA9A 4DV6O 3TK1A 1M9NA 1QLEB 3X2QB 4B3SO 3ZMUA 2E3CA 3RGBA 4JI3O 4DR7O 2UXCB 4K8XA 4RAIA 3G80A 1WPXA 1VQ8V 2Z5UA 3E83A 1IXBA 2DQ3A 1K7DA 5FL7G 1LR1A 1Q7YW 1R6TA 4JZGA 1Q81W 1PP9H 3O9OA 1KC8W 3K08A 1F23A 4YHHB 2E76B 1SQPH 3AG2B 4ZI7A 4O4JA 3FFQA 2P4KA 2ZE7A 4PJ0Z 3AG4B 5K1XA 1SQQH 1OCOC 1FS0G 3L74H 3KDRA 2F43G 3AK3A 3P30A 1WA8B 5LGUA 4Q6GA 2Y0IA 4JI7O 2X7RB 4DV1O 2QTSA 2A0LA 4R50A 3RW0A 4X64O 4D6TH 4HBNA 2BOCC 2PUSA 5HFLA 2A3QA 2F1MA 3N2GA 3RYFA 1UFIA 1SA0A 3ETEA 1XOUA 1H2NA 1SQGA 3ZJZA 4JYAB 2CTWA 2HJFC 4LF7O 2EIKC 2DYSC 4X1YB 4TSFG 3JD2A 4DR6O 4X20A 3HKEA 4DXWA 3JAWA 4UCRA 1O9GA 1GRJA 2ETNA 3K5LA 5E1AC 3G6BA 2P90A 1X59A 3OR6C 2DW4A 4MVSA 3VQYA 2PYJA 1QCEA 3PJSK 4NTWA 5HFMA 5TISZ 1TVKB 2JGDB 4RUFA 1JNBA 1Q6UA 3H9VA 4TV9B 2CTQA 4DV0O 2EINB 4H33A 3B09A 2Q7GA 4Z1MG 2NN4A 4LF4O 1V55B 4EB6A 1RP3B 2XAFA 4QNHB 3F5WC 1BS3A 3QVNA 1URFA 4JF3A 4PA6A 4PDMA 3CD6V 1F4NA 3CCMV 1NQTA 3M8AA 4LWSB 3DC6A 3LUTB 4LF9B 4UXNA 5JJNB 4RUEA 4DR5B 4YHHO 1N36O 4FZ1A 2X6AA 3ZHRA 2KG7A 5L3EA 3JYCA 3JARB 2DJVA 1VF6C 2P6JA 3OMNB 1OCZC 2Q69A 3VBBA 2IM9A 1FYJA 2CTPA 3B8MA 4UB6Z 5J2UA 1EN4A 2VQFB 4G28B 4JI2B 1S76D 4DYLA 3ETQA 1HR0O 4AILC 1XL6A 1FPOA 1F51A 1AJNA 3U10A 3RYCB 4LFBB 4ZI7B 2V1DA 2Y69B 4O4JB 5K1PA 4K8ZA 3D36C 3SYPA 4NR1A 5CMUA 2LW1A 1SERA 4UVAA 1AR5A 5KMGA 1XHXA 1PM9A 1RM1C 3DC5A 4FFKA 1CPYA 3K0DA 3L9DA 2Q0AA 2DWDC 5LMUB 3JATA 3K9SA 2PF4E 2EIJB 4E4EA 2LP7A 4UCSA 1DK1A 4X62O 4WFHA 3OEHG 1MG1A 2QA4V 5FPRA 1FXKA 3E8HA 1IDSA 2LGQA 3OAAG 4FLVA 2OCCB 5GW7A 4X9QA 1H38A 4J10A 1AI6A 4GKKB 3JASB 4R7CA 1K73W 4X20B 3ZX6A 4ZOLA 3HKEB 3MAQA 3JAWB 4FM0A 1BZKA 1H2MA 1I0HA 4O4LA 3ASNC 1GK9A 4FLZA 5JQGA 3CE2A 1Q6IA 4UCOA 2Z0AA 2UUBO 3LSUA 4ZKIA 4WFFA 4YY3B 4UCVA 5LA6B 2ZM6O 2ZT9B 2Q0OC 1YVWA 1Y67A 4ASUG 1WAZA 3RYHB 1TUBB 4IL6Z 1Y66A 1M5IA 1AI5A 3TCUA 3OUFA 3GWOA 4I5SA 2DYRC 3IGAC 3ZBHA 4YIOA 2ZE8A 5EC1C 4GYCB 5CN0A 1VEWA 2QKSA 5IDJA 4MT8A 1ZLZA 2UXNA 2ITCC 2WLKA 2OYQA 4DV7B 3HKBA 2RNBA 2UUAB 4DV4B 2HJDA 1N33B 4J7KA 1T5EA 3A0RA 1CEZA 1MSWD 2DOSA 2QDOA 2UXXA 3CJHA 4NTYA 3ABLC 3WG7C 5C93A 1HP8A 2BOBC 1H8HG 4W4KA 1I08A 3CP1A 4X1KA 3GWKC 3S3WA 2ZD9A 4ICGA 4XDLA 3R66A 4CC5A 1W0KG 1Q43A 2H3OA 2YIBD 4DK1A 1OJHA 4DR1B 3K5NA 4MTFA 4X89A 2Q7HA 4UCTA 4DUYO 2VQEO 4UCUA 4D7TA 3SJCC 3SJQC 2VS0A 3RVZA 1R3JC 4J7ZA 4LH7A 2E5LO 5H6QA 1S72V 1XNQB 2EILB 3M99B 5IY5B 2N74A 3AEIA 4AQYO 2H94A 3OE7G 1QQCA 2WLHA 3CS5A 4LCUC 2AGAA 2ZNIA 3BCCH 1SESA 1ZTEA 1FXHA 3BPZA 4FFBB 3ZS8C 4I50A 3QO7A 3VQVA 2WLLA 2VWKA 1BL8A 5KUMA 4FLTA 1D2DA 4GKJO 4JTAB 1FXKB 2MW2B 4FVMA 4JI0O 2B1IA 1ROPA 2RN9A 1VIBA 5BY1A 4R8CA 1LUWA 4I4TB 3E8FA 4TUYB 1NVPD 5EZYA 4BW9A 3K04A 5LL6Y 5JCOA 2QWNB 1BQ0A 1L0LH 1YZBA 2RMKB 3ABMB 4O4LB 1AP5A 3CRQA 5JQGB 1XMQB 4UUJC 3EFFK 4YJ3A 1VQ4V 3U11A 4F4LA 1DGSA 2UUAO 4IIJA 5BR8O 2F23A 1K34A 4CH4A 5LOVA 3OFNG 4FIPC 3FKSG 1IBLO 1N8RW 1BHAA 4LFCO 1VARA 3FB5C 4WFBV 2GDSA 5IJ0B 1QLNA 2HEPA 4N23A 2R70A 2QSAA 2F95B 4J9YB 1GM8A 2JJ1G 3AG3C 3T4ZA 3S3XA 1GM7A 1GN3A 3ZN1A 2QM8A 1Q86W 1DTOA 4YJ2A 1I94O 1JJOA 3HKBB 2NNUA 3UO3A 1NZ6A 5EBLC 4I0XA 2EIMC 1N0NA 1BT8A 4FMTA 1LNQA 2ZXWC 1U97A 1R6NA 1N4CA 1H5WA 4A5UB 4B3MB 1IBKO 3LSQA 1K8AW 1EBOA 5IJ9A 3OGIB 4J11A 1QR8A 1IBMB 2IU0A 4CC6A 1WB8A 1MMMA 3TETA 1GKFA 5EIBC 1Z2GA 1Q82W 4OX9O 4LR3A 3KCXA 4XBFA 2JRIA 4LF8O 3W7XA 3VQXA 1PV0A 3J81N 2B9ZA 3JALA 1JX9A 4JPRA 3SPIA 3QF7A 4JAUA 2HG5C 4K35A 1V9PA 2PZSA 1Y76B 3AG7A 5LXTB 2JEUA 1V54B 5FPOA 1GAXA 5J2TA 4MVUA 2CK3G 2B1GA 1AJPA 2YI8A 2Y4UA 5LP6C 1DLBA 2VWJA 1KP2A 2WLIB 2NLJC 4B7EA 5JVDA 5FNVA 4JI4O 4Z2WA 4GCZA 3AG1C 1XEQA 1SRYA 4GLXA 1MABG 2OCHA 1PD3A 1Y74B 3GVMA 2PY5A 3T4DA 2YXYA 3SDLA 1N32O 3MHHC 4JYCA 3BFRA 3N27A 1SQVH 4PDVA 5B3SB 4ZIBA 4YJ3B 3T1HO 3E8GA 1ZWIC 4KHPO 1RSOA 4OPHA 1AROP 2CH7B 3BEHA 1QNMA 1R3LC 1OCRB 4DR2O 5ITZA 4X65O 1F4MA 1YITV 1YF2A 1VF6A 5H6RA 3EVKA 1M57B 4JV5B 1HNWO 4IGGA 1S3JA 2QTOA 4ZHQA 3JSLA 3K79A 1S5HC 3JD1A 4MSWC 2Q67A 3K5MA 4JI6O 3UKMA 4LH6A 3FD9A 4HAMA 3LDEA 3FAVA 2HVJC 1QLEC 3X2QC 1GM9A 2JEXA 1BMFG 3A0HZ 1JFFB 3D36A 1MA1A 1QBZA 4I0XB 4LNUA 3CCRV 2A06H 1SQFA 5D5PA 1OCOB 3C3SA 3H1JH 1EN5A 4AI8A 4U3JA 1R1BA 4CH5A 2Y0PA 1NU1H 5KHHA 2AHYA 5KHKA 3NR7A 4JI1O 1D5AA 2XNDG 3FB7C 5LGNA 2ZE5A 2ZQMA 3ZHSA 4LF5B 1FFXA 5LHGA 3OTFA 3RWRD 4NYKA 4PD4F 1WB7A 3AG2C 2PI4A 2JS3A 5EIBD 1J5EB 5KAFZ 3CB2A 2X6BA 3AG4C 2W6JG 4B3TB 2EBOA 2YEVB 1ZSPA 5LHIA 1MZEA 4IT5A 3L70H 5J2TB 2F93B 3APOA 4G27B 3FB6C 4MTOA 1QVFU 4YXWG 4KFMA 1ZL8A 5L3DA 1NR1A 2Q73A 1NTMH 2QKCA 1GO3F 4J7JA 4UFZA 5IYZB 4MVOA 3H1IH 3ABKB 1KP3A 4LF6B 4IHJA 3ZMVA 1JOYA 1GH6A 4OXSA 2R9AA 1EM1A 3FYIB 1JA8A 1SZXA 3CXHF 3CMAV 2UXCO 4H13B 3J80N 1F7YA 1IJGA 2OTJV 1SQXH 1MZFA 3I55V 1VP7A 4GX1A 1B3QA 2HHHB 3LDDA 2GTAA 5LBQA 4X66B 4X1IA 4JI5B 1K4DC 2O57A 3ZRXA 1RSOB 2FYUH 4DV3B 5KHGA 2UXDB 3E86A 2EINC 2IJHA 3E35A 4WBNA 2EJRA 3L71H 1UJWB 1PL4A 2DN9A 3WB1A 4DR4B 2QWPB 1V55C 4DUZB 5JWPA 4LP8A 4QIWF 3ZCCA 2R9IA 3JD0A 1SZTA 2Q6AA 4JI8B 4RWUA 1YI2V 3D8CA 1KYOF 2RQ6A 5H5NA 1WJZA 4B7KA 1KUQA 4H0LB 1SF9A 3DGEA 4P2ZA 4GZRB 3Q4HA 4UB8Z 1N34B 3CCQV 4F6RA 2ZE6A 1NI8A 1VQ6V 3BHPA 1VQPV 2XAHA 5CA3A 3GB7C 4DV5B 4JYAO 4RQFA 4WCEV 1WPBA 4HNAA 2ODMA 5E79Z 3JAKA 1ENVA 1W2BU 2Z3YA 1XQ8A 3BABA 1FFXB 1GMGA 1WNSA 2AZ2A 4JAVA 2KKWA 2Y69C 2LQTA 3RN4A 1IURA 4B3RB 3A0BZ 2UUCB 3N2GB 3RYFB 5KUKA 1SA0B 1XREA 3D3IA 4L8JA 4NXMB 1AJQA 4BIZA 2BSKA 3ETGA 4KP4A 1VQMV 1R3IC 2QR4A 1ORQC 3IJ4A 2B5UA 3DXRA 3SYAA 5GONA 5IE9A 1GN6A 4JYYA 2A7WA 4PDLA 2AHZA 5C8YA 4NB5A 2UXBB 2FL4A 4FLXA 2EIJC 1TUEB 3P3NA 4LF9O 3SJBC 2KB1A 1OCCB 4CZZA 1NH2B 3UT5A 4IHJB 3RFRA 2KQXA 4DR5O 2OCCC 2HVKC 3ZHTA 2V4DA 5KX5A 3LNMB 2FMLA 3H1HH 1PNKA 4DUZO 4EB6B 3CRRA 3TJTA 4AHCA 4JI8O 4DR3B 3T1CA 5CA1A 1EZVH 1HW7A 2VQFO 4JI2O 4GUNA 5KLVH 3OM3B 2LO1A 2IJIA 3BA8A 1P49A 1HNZB 5BMVA 4LFBO 4O2AA 4UVCA 3EXAA 4UV8A 3CRAA 4WBNB 5DEDA 1U96A 2XAGA 2EZOA 2XHBA 2KG7B 5IYDO 1KKDA 4MTXA 4F6EA 2WWWA 5BXZA 4J41A 5L3GA 4FJCC 4FM1A 1P84F 3QO5A 4TWKA 5J2UB 2RCVA 4NXNB 3UM7A 2QJ1A 4O4HA 2DWEC 2YXLA 4HZ3A 1IX9A 4JTDB 3OEEG 3OT7A 5LMUO 3CX5F 3RVYA 1M4UA 2OTLV 4DW1A 3UQ8A 2YS8A 4FPPA 1XBLA 2OWOA 3E2EA 5JJEB 3HKDA 5DN6G 2HP8A 5JH7A 1PPJH 1XI1A 1PNMA 5KMGB 5EYPA 3B4SA 5L3BA 3SPCA 5A9GA 1YDXA 4DRXA 4GKKO 1XILA 3JAKB 4BWAA 2M7WA 1M56B 2GUZA 4MVZA 5B1AB 3ZEDA 2DQ0A 1NKDA 3L72H 1B04A 1QVGU 3JATB 2CE4A 2RDCA 3QG5A 2ADPA 3OW2U 1EN6A 1JQ0A 1W59A 2XTAA 4YY3O 4U7NA 4UV9A 5LYJA 5IY5C 5H2FZ 4MTGA 3KCYA 1PNLA 5IWAB 1QU7A 4J80A 3KG2A 5B1BB 1KBHA 3G4SV 3DXRB 2IW5A 3IAYA 3K5OA 4U7OA 4ZOLB 5LMNB 1WLEA 3SGIA 3A2FA 3N2KA 4JAAA 2P7TC 4ABMA 4DR3O 2UU9B 5C8YB 1SC5B 4KUMA 4FZ0A 4U3FH 2ZIOA 2JJ2G 4TQFA 2GSMB 1KMIZ 3AK1A 2F66C 1SQBH 3BY6A 3G67A 3ZHVA 2V7QG 4CS4A 3UT5B 1FXKC 3G71V 4DV7O 1I7FA 2RJZA 4DV4O 1N33O 3E8BA 1VF5B 3E22A 3T1YB 5KX5B 3G6EV 4LFAB 2XT9A 1KKCA 1KB9F 3JD4A 4LC1A 3ABMC 2YIAA 3CMEV 3SPJA 3WB0A 3B2EE 2QKAA 2YIDA 4DR1O 5IT9N 3SYQA 4NXNO 4H44B 1NH2D 3IC9A 5CA0A 2Q8VA 1HWYA 4D7SA 2ATKC 2OT5A 2BCCH 5CBHA 5BMVB 4DV2B 2X0LA 3U0ZA 3CJHB 1Q90D 1AR4A 1YEWA 3ASOB 1AB3A 4JTCB 1XNQO 4DV6B 4HYOA 4Q20A 4CH6A 1AILA 2BE3A 4X1KB 4B3SB 1US6A 1RFYA 3TXSA 1H2SB 3VOUA 3H1LH 3FX7A 1X4TA 3IC7A 4DR7B 1K92A 4O4HB 3K58A 4CBCA 3P32A 1D5NA 1ZAUA 1JVMA 2IH1C 4WF9V 1XUQA 1H2LA 2E74B 2D2CB 5JH7B 1K5QA 1WP8A 4H37A 4GX5A 5EBMC 1K33A 4DRXB 5LHHA 1S5LZ 1NBMG 2GUZB 5LMNO 2YICA 1AI4A 2UU9O 2QGNA 4I50B 2WLLB 3BAAA 1GTOA 1R3KC 2YI9A 1XMQO 2Q4PA 3J7AU 2D3OW 5KAIZ 2VRZA 1AVMA 3OGCC 4X1YA 3MDSA 4JI7B 4DV1B 1FFTB 4BIUA 3T1YO 2LJ2A 1XNRB 5KHJA 1B6QA 4J9ZB 3HPLC 5EZYB 1V54C 4PA3A 4IYIA 1K9MW 4X64B 3JAMN 4G2KA 5IYBO 4EFEA 3LNNA 2LGWA 1K5SA 1NJIW 2EJ7A 1RPRA 2Y48A 4MS2A 2GBOA 1COWG 1PL0A 5A2QN 2Q9LA 4TV8A 1KD1W 4RO2A 3DSQA 3F5TA 4P9OA 4DR6B 4IIJB 1I5YA 1PKXA 3RYIA 5LOVB 3ZIAG 4BR6A 1TA8A 3BVOA 2ITDC 1G6UA 5B66Z 5JCOC 2YIBA 4LWSA 5B1NA 4B3MO 3UO2A 2CGNA 5B3SC 3ML0A 3CSXA 3RBZA 4QPJA 1SKVA 2QE7G 2YC0A 1IBMO 4DV0B 4PA7A 4YJ2B 5EC2C 2WPDG 3CWBH 5CA0B 3F7VC 4LF4B 1OCRC 1EZJA 3JARA 3QO8A 1M57C 1R73A 4QE9A 5DM6V 2CGOA 1E1RG 2HKOA 2PYLA 2QWQB 3W7SA 3CEIA 3K06A 3ZRVA 5IJ9B 3K0GA 5CB4A 4WFAV 3RYCA 1N36B 3ZRSA 2Q68A 2IJJA 3CCLV 5AG2A 5GTHZ 3AK2A 2JS5A 1G8MA 4PA4A 2QEXV 2WLJA 2EIKB 2DYSB 5B5EZ 3JALB 5LGTA 2GHYA 3W7TA 1HR0B 2JVDA 1GN4A 1XNRO 1XMOB 4J42A 3SYOA 1XDCA 3ZMTA 2QWRB 1FJGB 3A8TA 3SPHA 5L3CA 2CAZC 1S0VA 1BGYH 2IBZH 5JVDB 5FNVB 3LDCA 3MHSC 3SYCA 5KA6A 1FD9A 3JASA 3OUSA 4O4IA 2XASA 3ZMZA 4UVBA 1B06A 3ABTA 1Q6HA 3EHBB 4JV5O 1P4RA 3W7UA 2CTRA 4K3AA 4X62B 2HR3A 2QM7A 5LA6A 3FYEB 2XAJA 2ZDIC 2AXTZ 3OMIB 1NTZH 2W0XA 1TUBA 3ABKC 4PI2A 3RYHA 4MW3A 1AR1B 1M1KW 4O2BA 4TV8B 3THOA 3DTUB 4IYHA 1WN7A 4NKGB 4QE7A 3RYIB 5ITZB 3VQWA 3H1KH 4TOIA 1OCZB 1FXVA 1L1FA 1DF5A 4ZHQB 2UUBB 3CYOA 4FM2A 3CC7V 4ZBMA 3HKCA 2ZM6B 5D5QA 5F2VO 3FAVB 2W6IG 4LF5O 4QGPA 1XHZA 4EKWA 1THZA 3BA9A 2A79B 3CHXA 4LNUB 4P30A 2YDEA 2G38A 1J5EO 2MK3A 4X8AA 4U3JB 1RM1B 1BSMA 3KKYA 2EULA 4GX0A 3OTOB 1KECA 4B3TO 3ZHUA 4BIOA 1EFRG 1YJWV 3TXQA 1MOFA 3T2MA 4FLUA 3K9AA 1AI7A 3CCUV 1XMOO 3ZHQA 5CB4B 3SPGA 4I9QA 1NT2B 4Z1VA 2BTOA 3JCUZ 1Y4MA 2JDIG 2DMXA 2QM4A 1K4CC 2K9PA 3LSSA 4QJFB 1OHHG 1FJGO 1VQOV 3HR0A 2BTQA 1CXZB 3APQA 2N05A 4LF6O 1NVPB 5EK0A 1NTKH 1UPGA 2Y4TA 3O65A 2Q5ZA 3NXSA 3P3PA 3CC4V 3B77A 3ZMSA 4DUYB 2VQEB 4FFBA 5JJJB 3ASNB 3ICXA 5J9PC
chains in the Genus database with same CATH topology
4JZ2A 2AW9A 1XUQA 1AR5A 3TJTA 1P7GA 1WB7A 1PM9A 1I08A 2CDYA 3DC5A 4FFKA 3CEIA 4GUNA 1VARA 2GDSA 3K9SA 1ZSPA 4E4EA 3AK1A 4C7UA 1GN3A 1IXBA 3BFRA 1IDSA 1MNGA 4F6EA 1AVMA 1KKCA 3MDSA 5AG2A 4JZGA 3C3TA 4X9QA 3AK2A 2ADQB 1BS3A 1AP6A 1BT8A 1N0NA 2QKCA 3QVNA 1ZUQA 1QNMA 4YIPA 2RCVA 1JR9A 3RN4A 1I0HA 3DC6A 3EVKA 1GN4A 2QKAA 1BSMA 1IX9A 3KKYA 1EM1A 1ZTEA 3OT7A 2P4KA 1JA8A 1SZXA 1XDCA 3LSUA 1XREA 3IC9A 1N0JA 1WB8A 1MMMA 3KDRA 1Y67A 1AR4A 3AK3A 1GN6A 5A9GA 4JYYA 4BR6A 1MA1A 1XILA 4YIOA 1GN2A 3C3SA 1EN4A 1LUWA 1LUVA 1B06A 1EN5A 1MSDA 1VEWA 2CE4A 1ZLZA 2ADPA 1AP5A 1EN6A 1PL4A 1D5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ2 A;  2AW9 A;  1XUQ A;  1AR5 A;  3TJT A;  1P7G A;  1WB7 A;  1PM9 A;  1I08 A;  2CDY A;  3DC5 A;  4FFK A;  3CEI A;  4GUN A;  1VAR A;  2GDS A;  3K9S A;  1ZSP A;  4E4E A;  3AK1 A;  4C7U A;  1GN3 A;  1IXB A;  3BFR A;  1IDS A;  1MNG A;  4F6E A;  1AVM A;  1KKC A;  3MDS A;  5AG2 A;  4JZG A;  3C3T A;  4X9Q A;  3AK2 A;  2ADQ B;  1BS3 A;  1AP6 A;  1BT8 A;  1N0N A;  2QKC A;  3QVN A;  1ZUQ A;  1QNM A;  4YIP A;  2RCV A;  1JR9 A;  3RN4 A;  1I0H A;  3DC6 A;  3EVK A;  1GN4 A;  2QKA A;  1BSM A;  1IX9 A;  3KKY A;  1EM1 A;  1ZTE A;  3OT7 A;  2P4K A;  1JA8 A;  1SZX A;  1XDC A;  3LSU A;  1XRE A;  3IC9 A;  1N0J A;  1WB8 A;  1MMM A;  1Y67 A;  1AR4 A;  3AK3 A;  1GN6 A;  5A9G A;  4JYY A;  4BR6 A;  1MA1 A;  1XIL A;  4YIO A;  1GN2 A;  3C3S A;  1EN4 A;  1LUW A;  1LUV A;  1B06 A;  1EN5 A;  1MSD A;  1VEW A;  2CE4 A;  1ZLZ A;  2ADP A;  1AP5 A;  1EN6 A;  1PL4 A;  1D5N A; 
#chains in the Genus database with same CATH topology
 2ZCE A;  2WLM A;  2E5L B;  2AW9 A;  3FB8 C;  4JAS A;  1YTF B;  2L35 A;  2LW7 A;  1H2K A;  4FK5 C;  1ZL8 B;  2ARH A;  2HHH O;  3RT3 C;  4I55 A;  4X66 O;  4JI5 O;  4AQY B;  4OGQ B;  1K3E A;  2NR5 A;  1VQN V;  2ZIM A;  4I4T A;  4TUY A;  3STL C;  1KU9 A;  2QWO B;  4DV3 O;  1CP9 A;  1NR7 A;  5KA5 A;  5B1O A;  2E75 B;  2DYR B;  2XAQ A;  4O4I B;  2UXD O;  2GV9 A;  4FLY A;  4FLW A;  3L75 H;  4DR4 O;  1VQ5 V;  3B8N A;  5L3F A;  1TAE A;  3CCV V;  3K03 A;  5CBF A;  4GKJ B;  3CXC U;  4JI0 B;  2YXH A;  3I56 V;  4X1I B;  1AP6 A;  3TGU H;  3STZ C;  4CH3 A;  1OCC C;  1BHB A;  4YIP A;  4O2B B;  1JPX A;  3ABL B;  3WG7 B;  2LFS A;  2ZR3 A;  1JR9 A;  1N34 O;  5IJ0 A;  1WP7 A;  1Y6X A;  4R6Z A;  1E79 G;  1DF4 A;  3OR7 C;  1IXM A;  1VF7 A;  4DO2 A;  1N0J A;  3OTO O;  4KXR A;  1VMG A;  2Q7E A;  4DV5 O;  3HKC B;  2IJK A;  2PGG A;  4PI0 A;  4GT1 A;  1JCH A;  5BR8 B;  3B40 A;  1JJ2 U;  3ZRW A;  1L8D A;  1Z5V A;  2IU3 A;  3E89 A;  4DK0 A;  1IBL B;  3R65 A;  3Q4H B;  3CRC A;  3IFX A;  2FKX A;  2PI5 A;  4LFC B;  1YXB A;  2EZP A;  3L73 H;  4F6R B;  1MSD A;  2JGU A;  4B3R O;  2UUC O;  4P9P A;  3CCJ V;  1G4Y B;  3PN1 A;  4X88 A;  4DW0 A;  4BAY A;  2IH3 C;  3WU2 Z;  1YJN V;  3CCE V;  2F4V B;  4XDK A;  4NXM O;  5KHI A;  1I94 B;  3WB2 A;  4HNA B;  2FTK A;  4I7Z B;  5LP6 A;  1M90 W;  1S5J A;  1YHQ V;  1HDJ A;  3KZI Z;  2CDY A;  2YSU B;  2UXB O;  3HB3 B;  5BZB A;  2BTQ B;  3D3Q A;  4I9W A;  2CUG A;  1IBK B;  3ZN0 A;  1XL4 A;  2EIL C;  3CRM A;  2X6C A;  1Y76 A;  5LXT A;  3QNE A;  4JGS A;  2WA4 A;  4C7U A;  4PDR A;  1VQ7 V;  4LBE C;  1S77 D;  2BSK B;  4KL1 A;  1Q5O A;  1BE3 H;  3ABU A;  2EX3 A;  1M56 C;  1W0J G;  1YSC A;  5GON B;  2XUM A;  1HNX B;  2WLI A;  5B1A C;  3C3T A;  4NTX A;  4OX9 B;  3MD0 A;  5FLX N;  1O9H A;  2P22 C;  4LF8 B;  3K57 A;  2WLN A;  3H01 A;  4E2L A;  1A32 A;  4QPK A;  1Y74 A;  1H8E G;  4I55 B;  2HLD G;  5IYC O;  2KSD A;  1HNZ O;  1ZX3 A;  2P5O A;  4K0K B;  5B1B C;  3K3W A;  2JK5 C;  2M6Y A;  3AG3 B;  2C2A A;  2K1E A;  4B08 A;  1J95 A;  2FB5 A;  4JI4 B;  1QHT A;  2PTM A;  1YTF D;  1FOU A;  5CA1 B;  2CH7 A;  3K59 A;  1GN2 A;  4L87 A;  1LUV A;  4MW8 A;  2WAM A;  4NVP A;  2ZNJ A;  1Q3E A;  2EIM B;  3F7Y C;  2JIZ G;  2ZXW B;  1NS1 A;  4O2A B;  4OPA A;  2A9H A;  2L6L A;  2P67 A;  4JYB A;  1N32 B;  2ZKO A;  3CCS V;  1E1Q G;  2P4V A;  2ZR2 A;  4MVM A;  2R72 A;  2AZ0 A;  3T1H B;  2F4V O;  2LFR A;  1SET A;  4MVR A;  4XDJ A;  3M7M X;  1Q8I A;  4KHP B;  3SR2 C;  1JFF A;  1H2G A;  4GX2 A;  3CPW U;  1IZ3 A;  4JI3 B;  3ETD A;  4DR2 B;  3ZRW B;  1M93 A;  4X65 B;  2H8P C;  2N04 A;  1HNW B;  3JSN A;  3JCZ A;  1Z5W A;  2GTS A;  2YUA A;  3W7W A;  4TQD A;  1QR9 A;  5GTI Z;  1KQS U;  4JI6 B;  3ASO C;  4RQE A;  3HKD B;  1WA8 A;  4N21 A;  1VQ9 V;  1YIJ V;  2WSS G;  1MNG A;  5IWA O;  3OD4 A;  4WFG A;  1FKA O;  5EYP B;  3QTC A;  4CS2 A;  4PEL A;  2ADQ B;  1R6K A;  2W0F C;  4CS3 A;  1IVS A;  1ZUQ A;  3WFV A;  5LP6 B;  3OMA B;  1VQL V;  1HNX O;  1JMK C;  2DE0 X;  1YJ9 V;  3AG1 B;  4JI1 B;  5EBW C;  2HFE C;  2OIE A;  2YEV A;  4MVQ A;  4PV1 B;  1BCC H;  4EEQ A;  1BQZ A;  2WA3 A;  2P06 A;  2R9R B;  1G1X B;  1L0N H;  5CBG A;  5LYJ B;  1TGO A;  3I5D A;  1FAF A;  4K0K O;  2XOK G;  5DEC A;  5H9C A;  2OIG A;  2ZIN A;  4LFA O;  4BW5 A;  1I5X A;  1P7B A;  1YCI A;  2ZDI A;  3BRC A;  5IYZ A;  1SS3 A;  3N2K B;  4WFE A;  4W4L A;  1TVK A;  2JGD A;  4TT3 G;  1K97 A;  4TV9 A;  2ILM A;  1OV9 A;  4LF7 B;  1VQK V;  3CC2 V;  4PHZ A;  1OZ0 A;  3C90 A;  4DV2 O;  3E22 B;  4JZ2 A;  3UCS C;  3SJA C;  4EFB A;  1RPO A;  1P7G A;  3JD3 A;  4PA9 A;  4DV6 O;  3TK1 A;  1M9N A;  1QLE B;  3X2Q B;  4B3S O;  3ZMU A;  2E3C A;  3RGB A;  4JI3 O;  4DR7 O;  2UXC B;  4K8X A;  4RAI A;  3G80 A;  1WPX A;  1VQ8 V;  2Z5U A;  3E83 A;  1IXB A;  2DQ3 A;  1K7D A;  5FL7 G;  1LR1 A;  1Q7Y W;  1R6T A;  4JZG A;  1Q81 W;  1PP9 H;  3O9O A;  1KC8 W;  3K08 A;  1F23 A;  4YHH B;  2E76 B;  1SQP H;  3AG2 B;  4ZI7 A;  4O4J A;  3FFQ A;  2P4K A;  2ZE7 A;  4PJ0 Z;  3AG4 B;  5K1X A;  1SQQ H;  1OCO C;  1FS0 G;  3L74 H;  3KDR A;  2F43 G;  3AK3 A;  3P30 A;  1WA8 B;  5LGU A;  4Q6G A;  2Y0I A;  4JI7 O;  2X7R B;  4DV1 O;  2QTS A;  2A0L A;  4R50 A;  3RW0 A;  4X64 O;  4D6T H;  4HBN A;  2BOC C;  2PUS A;  5HFL A;  2A3Q A;  2F1M A;  3N2G A;  3RYF A;  1UFI A;  1SA0 A;  3ETE A;  1XOU A;  1H2N A;  1SQG A;  3ZJZ A;  4JYA B;  2CTW A;  2HJF C;  4LF7 O;  2EIK C;  2DYS C;  4X1Y B;  4TSF G;  3JD2 A;  4DR6 O;  4X20 A;  3HKE A;  4DXW A;  3JAW A;  4UCR A;  1O9G A;  1GRJ A;  2ETN A;  3K5L A;  5E1A C;  3G6B A;  2P90 A;  1X59 A;  3OR6 C;  2DW4 A;  4MVS A;  3VQY A;  2PYJ A;  1QCE A;  3PJS K;  4NTW A;  5HFM A;  5TIS Z;  1TVK B;  2JGD B;  4RUF A;  1JNB A;  1Q6U A;  3H9V A;  4TV9 B;  2CTQ A;  4DV0 O;  2EIN B;  4H33 A;  3B09 A;  2Q7G A;  4Z1M G;  2NN4 A;  4LF4 O;  1V55 B;  4EB6 A;  1RP3 B;  2XAF A;  4QNH B;  3F5W C;  1BS3 A;  3QVN A;  1URF A;  4JF3 A;  4PA6 A;  4PDM A;  3CD6 V;  1F4N A;  3CCM V;  1NQT A;  3M8A A;  4LWS B;  3DC6 A;  3LUT B;  4LF9 B;  4UXN A;  5JJN B;  4RUE A;  4DR5 B;  4YHH O;  1N36 O;  4FZ1 A;  2X6A A;  3ZHR A;  2KG7 A;  5L3E A;  3JYC A;  3JAR B;  2DJV A;  1VF6 C;  2P6J A;  3OMN B;  1OCZ C;  2Q69 A;  3VBB A;  2IM9 A;  1FYJ A;  2CTP A;  3B8M A;  4UB6 Z;  5J2U A;  1EN4 A;  2VQF B;  4G28 B;  4JI2 B;  1S76 D;  4DYL A;  3ETQ A;  1HR0 O;  4AIL C;  1XL6 A;  1FPO A;  1F51 A;  1AJN A;  3U10 A;  3RYC B;  4LFB B;  4ZI7 B;  2V1D A;  2Y69 B;  4O4J B;  5K1P A;  4K8Z A;  3D36 C;  3SYP A;  4NR1 A;  5CMU A;  2LW1 A;  1SER A;  4UVA A;  1AR5 A;  5KMG A;  1XHX A;  1PM9 A;  1RM1 C;  3DC5 A;  4FFK A;  1CPY A;  3K0D A;  3L9D A;  2Q0A A;  2DWD C;  5LMU B;  3JAT A;  3K9S A;  2PF4 E;  2EIJ B;  4E4E A;  2LP7 A;  4UCS A;  1DK1 A;  4X62 O;  4WFH A;  3OEH G;  1MG1 A;  2QA4 V;  5FPR A;  1FXK A;  3E8H A;  1IDS A;  2LGQ A;  3OAA G;  4FLV A;  2OCC B;  5GW7 A;  4X9Q A;  1H38 A;  4J10 A;  1AI6 A;  4GKK B;  3JAS B;  4R7C A;  1K73 W;  4X20 B;  3ZX6 A;  4ZOL A;  3HKE B;  3MAQ A;  3JAW B;  4FM0 A;  1BZK A;  1H2M A;  1I0H A;  4O4L A;  3ASN C;  1GK9 A;  4FLZ A;  5JQG A;  3CE2 A;  1Q6I A;  4UCO A;  2Z0A A;  2UUB O;  3LSU A;  4ZKI A;  4WFF A;  4YY3 B;  4UCV A;  5LA6 B;  2ZM6 O;  2ZT9 B;  2Q0O C;  1YVW A;  1Y67 A;  4ASU G;  1WAZ A;  3RYH B;  1TUB B;  4IL6 Z;  1Y66 A;  1M5I A;  1AI5 A;  3TCU A;  3OUF A;  3GWO A;  4I5S A;  2DYR C;  3IGA C;  3ZBH A;  4YIO A;  2ZE8 A;  5EC1 C;  4GYC B;  5CN0 A;  1VEW A;  2QKS A;  5IDJ A;  4MT8 A;  1ZLZ A;  2UXN A;  2ITC C;  2WLK A;  2OYQ A;  4DV7 B;  3HKB A;  2RNB A;  2UUA B;  4DV4 B;  2HJD A;  1N33 B;  4J7K A;  1T5E A;  3A0R A;  1CEZ A;  1MSW D;  2DOS A;  2QDO A;  2UXX A;  3CJH A;  4NTY A;  3ABL C;  3WG7 C;  5C93 A;  1HP8 A;  2BOB C;  1H8H G;  4W4K A;  1I08 A;  3CP1 A;  4X1K A;  3GWK C;  3S3W A;  2ZD9 A;  4ICG A;  4XDL A;  3R66 A;  4CC5 A;  1W0K G;  1Q43 A;  2H3O A;  2YIB D;  4DK1 A;  1OJH A;  4DR1 B;  3K5N A;  4MTF A;  4X89 A;  2Q7H A;  4UCT A;  4DUY O;  2VQE O;  4UCU A;  4D7T A;  3SJC C;  3SJQ C;  2VS0 A;  3RVZ A;  1R3J C;  4J7Z A;  4LH7 A;  2E5L O;  5H6Q A;  1S72 V;  1XNQ B;  2EIL B;  3M99 B;  5IY5 B;  2N74 A;  3AEI A;  4AQY O;  2H94 A;  3OE7 G;  1QQC A;  2WLH A;  3CS5 A;  4LCU C;  2AGA A;  2ZNI A;  3BCC H;  1SES A;  1ZTE A;  1FXH A;  3BPZ A;  4FFB B;  3ZS8 C;  4I50 A;  3QO7 A;  3VQV A;  2WLL A;  2VWK A;  1BL8 A;  5KUM A;  4FLT A;  1D2D A;  4GKJ O;  4JTA B;  1FXK B;  2MW2 B;  4FVM A;  4JI0 O;  2B1I A;  1ROP A;  2RN9 A;  1VIB A;  5BY1 A;  4R8C A;  1LUW A;  4I4T B;  3E8F A;  4TUY B;  1NVP D;  5EZY A;  4BW9 A;  3K04 A;  5LL6 Y;  5JCO A;  2QWN B;  1BQ0 A;  1L0L H;  1YZB A;  2RMK B;  3ABM B;  4O4L B;  1AP5 A;  3CRQ A;  5JQG B;  1XMQ B;  4UUJ C;  3EFF K;  4YJ3 A;  1VQ4 V;  3U11 A;  4F4L A;  1DGS A;  2UUA O;  4IIJ A;  5BR8 O;  2F23 A;  1K34 A;  4CH4 A;  5LOV A;  3OFN G;  4FIP C;  3FKS G;  1IBL O;  1N8R W;  1BHA A;  4LFC O;  1VAR A;  3FB5 C;  4WFB V;  2GDS A;  5IJ0 B;  1QLN A;  2HEP A;  4N23 A;  2R70 A;  2QSA A;  2F95 B;  4J9Y B;  1GM8 A;  2JJ1 G;  3AG3 C;  3T4Z A;  3S3X A;  1GM7 A;  1GN3 A;  3ZN1 A;  2QM8 A;  1Q86 W;  1DTO A;  4YJ2 A;  1I94 O;  1JJO A;  3HKB B;  2NNU A;  3UO3 A;  1NZ6 A;  5EBL C;  4I0X A;  2EIM C;  1N0N A;  1BT8 A;  4FMT A;  1LNQ A;  2ZXW C;  1U97 A;  1R6N A;  1N4C A;  1H5W A;  4A5U B;  4B3M B;  1IBK O;  3LSQ A;  1K8A W;  1EBO A;  5IJ9 A;  3OGI B;  4J11 A;  1QR8 A;  1IBM B;  2IU0 A;  4CC6 A;  1WB8 A;  1MMM A;  3TET A;  1GKF A;  5EIB C;  1Z2G A;  1Q82 W;  4OX9 O;  4LR3 A;  3KCX A;  4XBF A;  2JRI A;  4LF8 O;  3W7X A;  3VQX A;  1PV0 A;  3J81 N;  2B9Z A;  3JAL A;  1JX9 A;  4JPR A;  3SPI A;  3QF7 A;  4JAU A;  2HG5 C;  4K35 A;  1V9P A;  2PZS A;  1Y76 B;  3AG7 A;  5LXT B;  2JEU A;  1V54 B;  5FPO A;  1GAX A;  5J2T A;  4MVU A;  2CK3 G;  2B1G A;  1AJP A;  2YI8 A;  2Y4U A;  5LP6 C;  1DLB A;  2VWJ A;  1KP2 A;  2WLI B;  2NLJ C;  4B7E A;  5JVD A;  5FNV A;  4JI4 O;  4Z2W A;  4GCZ A;  3AG1 C;  1XEQ A;  1SRY A;  4GLX A;  1MAB G;  2OCH A;  1PD3 A;  1Y74 B;  3GVM A;  2PY5 A;  3T4D A;  2YXY A;  3SDL A;  1N32 O;  3MHH C;  4JYC A;  3BFR A;  3N27 A;  1SQV H;  4PDV A;  5B3S B;  4ZIB A;  4YJ3 B;  3T1H O;  3E8G A;  1ZWI C;  4KHP O;  1RSO A;  4OPH A;  1ARO P;  2CH7 B;  3BEH A;  1QNM A;  1R3L C;  1OCR B;  4DR2 O;  5ITZ A;  4X65 O;  1F4M A;  1YIT V;  1YF2 A;  1VF6 A;  5H6R A;  3EVK A;  1M57 B;  4JV5 B;  1HNW O;  4IGG A;  1S3J A;  2QTO A;  4ZHQ A;  3JSL A;  3K79 A;  1S5H C;  3JD1 A;  4MSW C;  2Q67 A;  3K5M A;  4JI6 O;  3UKM A;  4LH6 A;  3FD9 A;  4HAM A;  3LDE A;  3FAV A;  2HVJ C;  1QLE C;  3X2Q C;  1GM9 A;  2JEX A;  1BMF G;  3A0H Z;  1JFF B;  3D36 A;  1MA1 A;  1QBZ A;  4I0X B;  4LNU A;  3CCR V;  2A06 H;  1SQF A;  5D5P A;  1OCO B;  3C3S A;  3H1J H;  1EN5 A;  4AI8 A;  4U3J A;  1R1B A;  4CH5 A;  2Y0P A;  1NU1 H;  5KHH A;  2AHY A;  5KHK A;  3NR7 A;  4JI1 O;  1D5A A;  2XND G;  3FB7 C;  5LGN A;  2ZE5 A;  2ZQM A;  3ZHS A;  4LF5 B;  1FFX A;  5LHG A;  3OTF A;  3RWR D;  4NYK A;  4PD4 F;  1WB7 A;  3AG2 C;  2PI4 A;  2JS3 A;  5EIB D;  1J5E B;  5KAF Z;  3CB2 A;  2X6B A;  3AG4 C;  2W6J G;  4B3T B;  2EBO A;  2YEV B;  1ZSP A;  5LHI A;  1MZE A;  4IT5 A;  3L70 H;  5J2T B;  2F93 B;  3APO A;  4G27 B;  3FB6 C;  4MTO A;  1QVF U;  4YXW G;  4KFM A;  1ZL8 A;  5L3D A;  1NR1 A;  2Q73 A;  1NTM H;  2QKC A;  1GO3 F;  4J7J A;  4UFZ A;  5IYZ B;  4MVO A;  3H1I H;  3ABK B;  1KP3 A;  4LF6 B;  4IHJ A;  3ZMV A;  1JOY A;  1GH6 A;  4OXS A;  2R9A A;  1EM1 A;  3FYI B;  1JA8 A;  1SZX A;  3CXH F;  3CMA V;  2UXC O;  4H13 B;  3J80 N;  1F7Y A;  1IJG A;  2OTJ V;  1SQX H;  1MZF A;  3I55 V;  1VP7 A;  4GX1 A;  1B3Q A;  2HHH B;  3LDD A;  2GTA A;  5LBQ A;  4X66 B;  4X1I A;  4JI5 B;  1K4D C;  2O57 A;  3ZRX A;  1RSO B;  2FYU H;  4DV3 B;  5KHG A;  2UXD B;  3E86 A;  2EIN C;  2IJH A;  3E35 A;  4WBN A;  2EJR A;  3L71 H;  1UJW B;  1PL4 A;  2DN9 A;  3WB1 A;  4DR4 B;  2QWP B;  1V55 C;  4DUZ B;  5JWP A;  4LP8 A;  4QIW F;  3ZCC A;  2R9I A;  3JD0 A;  1SZT A;  2Q6A A;  4JI8 B;  4RWU A;  1YI2 V;  3D8C A;  1KYO F;  2RQ6 A;  5H5N A;  1WJZ A;  4B7K A;  1KUQ A;  4H0L B;  1SF9 A;  3DGE A;  4P2Z A;  4GZR B;  3Q4H A;  4UB8 Z;  1N34 B;  3CCQ V;  4F6R A;  2ZE6 A;  1NI8 A;  1VQ6 V;  3BHP A;  1VQP V;  2XAH A;  5CA3 A;  3GB7 C;  4DV5 B;  4JYA O;  4RQF A;  4WCE V;  1WPB A;  4HNA A;  2ODM A;  5E79 Z;  3JAK A;  1ENV A;  1W2B U;  2Z3Y A;  1XQ8 A;  3BAB A;  1FFX B;  1GMG A;  1WNS A;  2AZ2 A;  4JAV A;  2KKW A;  2Y69 C;  2LQT A;  3RN4 A;  1IUR A;  4B3R B;  3A0B Z;  2UUC B;  3N2G B;  3RYF B;  5KUK A;  1SA0 B;  1XRE A;  3D3I A;  4L8J A;  4NXM B;  1AJQ A;  4BIZ A;  2BSK A;  3ETG A;  4KP4 A;  1VQM V;  1R3I C;  2QR4 A;  1ORQ C;  3IJ4 A;  2B5U A;  3DXR A;  3SYA A;  5GON A;  5IE9 A;  1GN6 A;  4JYY A;  2A7W A;  4PDL A;  2AHZ A;  5C8Y A;  4NB5 A;  2UXB B;  2FL4 A;  4FLX A;  2EIJ C;  1TUE B;  3P3N A;  4LF9 O;  3SJB C;  2KB1 A;  1OCC B;  4CZZ A;  1NH2 B;  3UT5 A;  4IHJ B;  3RFR A;  2KQX A;  4DR5 O;  2OCC C;  2HVK C;  3ZHT A;  2V4D A;  5KX5 A;  3LNM B;  2FML A;  3H1H H;  1PNK A;  4DUZ O;  4EB6 B;  3CRR A;  3TJT A;  4AHC A;  4JI8 O;  4DR3 B;  3T1C A;  5CA1 A;  1EZV H;  1HW7 A;  2VQF O;  4JI2 O;  4GUN A;  5KLV H;  3OM3 B;  2LO1 A;  2IJI A;  3BA8 A;  1P49 A;  1HNZ B;  5BMV A;  4LFB O;  4O2A A;  4UVC A;  3EXA A;  4UV8 A;  3CRA A;  4WBN B;  5DED A;  1U96 A;  2XAG A;  2EZO A;  2XHB A;  2KG7 B;  5IYD O;  1KKD A;  4MTX A;  4F6E A;  2WWW A;  5BXZ A;  4J41 A;  5L3G A;  4FJC C;  4FM1 A;  1P84 F;  3QO5 A;  4TWK A;  5J2U B;  2RCV A;  4NXN B;  3UM7 A;  2QJ1 A;  4O4H A;  2DWE C;  2YXL A;  4HZ3 A;  1IX9 A;  4JTD B;  3OEE G;  3OT7 A;  5LMU O;  3CX5 F;  3RVY A;  1M4U A;  2OTL V;  4DW1 A;  3UQ8 A;  2YS8 A;  4FPP A;  1XBL A;  2OWO A;  3E2E A;  5JJE B;  3HKD A;  5DN6 G;  2HP8 A;  5JH7 A;  1PPJ H;  1XI1 A;  1PNM A;  5KMG B;  5EYP A;  3B4S A;  5L3B A;  3SPC A;  5A9G A;  1YDX A;  4DRX A;  4GKK O;  1XIL A;  3JAK B;  4BWA A;  2M7W A;  1M56 B;  2GUZ A;  4MVZ A;  5B1A B;  3ZED A;  2DQ0 A;  1NKD A;  3L72 H;  1B04 A;  1QVG U;  3JAT B;  2CE4 A;  2RDC A;  3QG5 A;  2ADP A;  3OW2 U;  1EN6 A;  1JQ0 A;  1W59 A;  2XTA A;  4YY3 O;  4U7N A;  4UV9 A;  5LYJ A;  5IY5 C;  5H2F Z;  4MTG A;  3KCY A;  1PNL A;  5IWA B;  1QU7 A;  4J80 A;  3KG2 A;  5B1B B;  1KBH A;  3G4S V;  3DXR B;  2IW5 A;  3IAY A;  3K5O A;  4U7O A;  4ZOL B;  5LMN B;  1WLE A;  3SGI A;  3A2F A;  3N2K A;  4JAA A;  2P7T C;  4ABM A;  4DR3 O;  2UU9 B;  5C8Y B;  1SC5 B;  4KUM A;  4FZ0 A;  4U3F H;  2ZIO A;  2JJ2 G;  4TQF A;  2GSM B;  1KMI Z;  3AK1 A;  2F66 C;  1SQB H;  3BY6 A;  3G67 A;  3ZHV A;  2V7Q G;  4CS4 A;  3UT5 B;  1FXK C;  3G71 V;  4DV7 O;  1I7F A;  2RJZ A;  4DV4 O;  1N33 O;  3E8B A;  1VF5 B;  3E22 A;  3T1Y B;  5KX5 B;  3G6E V;  4LFA B;  2XT9 A;  1KKC A;  1KB9 F;  3JD4 A;  4LC1 A;  3ABM C;  2YIA A;  3CME V;  3SPJ A;  3WB0 A;  3B2E E;  2QKA A;  2YID A;  4DR1 O;  5IT9 N;  3SYQ A;  4NXN O;  4H44 B;  1NH2 D;  3IC9 A;  5CA0 A;  2Q8V A;  1HWY A;  4D7S A;  2ATK C;  2OT5 A;  2BCC H;  5CBH A;  5BMV B;  4DV2 B;  2X0L A;  3U0Z A;  3CJH B;  1Q90 D;  1AR4 A;  1YEW A;  3ASO B;  1AB3 A;  4JTC B;  1XNQ O;  4DV6 B;  4HYO A;  4Q20 A;  4CH6 A;  1AIL A;  2BE3 A;  4X1K B;  4B3S B;  1US6 A;  1RFY A;  3TXS A;  1H2S B;  3VOU A;  3H1L H;  3FX7 A;  1X4T A;  3IC7 A;  4DR7 B;  1K92 A;  4O4H B;  3K58 A;  4CBC A;  3P32 A;  1D5N A;  1ZAU A;  1JVM A;  2IH1 C;  4WF9 V;  1XUQ A;  1H2L A;  2E74 B;  2D2C B;  5JH7 B;  1K5Q A;  1WP8 A;  4H37 A;  4GX5 A;  5EBM C;  1K33 A;  4DRX B;  5LHH A;  1S5L Z;  1NBM G;  2GUZ B;  5LMN O;  2YIC A;  1AI4 A;  2UU9 O;  2QGN A;  4I50 B;  2WLL B;  3BAA A;  1GTO A;  1R3K C;  2YI9 A;  1XMQ O;  2Q4P A;  3J7A U;  2D3O W;  5KAI Z;  2VRZ A;  1AVM A;  3OGC C;  4X1Y A;  3MDS A;  4JI7 B;  4DV1 B;  1FFT B;  4BIU A;  3T1Y O;  2LJ2 A;  1XNR B;  5KHJ A;  1B6Q A;  4J9Z B;  3HPL C;  5EZY B;  1V54 C;  4PA3 A;  4IYI A;  1K9M W;  4X64 B;  3JAM N;  4G2K A;  5IYB O;  4EFE A;  3LNN A;  2LGW A;  1K5S A;  1NJI W;  2EJ7 A;  1RPR A;  2Y48 A;  4MS2 A;  2GBO A;  1COW G;  1PL0 A;  5A2Q N;  2Q9L A;  4TV8 A;  1KD1 W;  4RO2 A;  3DSQ A;  3F5T A;  4P9O A;  4DR6 B;  4IIJ B;  1I5Y A;  1PKX A;  3RYI A;  5LOV B;  3ZIA G;  4BR6 A;  1TA8 A;  3BVO A;  2ITD C;  1G6U A;  5B66 Z;  5JCO C;  2YIB A;  4LWS A;  5B1N A;  4B3M O;  3UO2 A;  2CGN A;  5B3S C;  3ML0 A;  3CSX A;  3RBZ A;  4QPJ A;  1SKV A;  2QE7 G;  2YC0 A;  1IBM O;  4DV0 B;  4PA7 A;  4YJ2 B;  5EC2 C;  2WPD G;  3CWB H;  5CA0 B;  3F7V C;  4LF4 B;  1OCR C;  1EZJ A;  3JAR A;  3QO8 A;  1M57 C;  1R73 A;  4QE9 A;  5DM6 V;  2CGO A;  1E1R G;  2HKO A;  2PYL A;  2QWQ B;  3W7S A;  3CEI A;  3K06 A;  3ZRV A;  5IJ9 B;  3K0G A;  5CB4 A;  4WFA V;  3RYC A;  1N36 B;  3ZRS A;  2Q68 A;  2IJJ A;  3CCL V;  5AG2 A;  5GTH Z;  3AK2 A;  2JS5 A;  1G8M A;  4PA4 A;  2QEX V;  2WLJ A;  2EIK B;  2DYS B;  5B5E Z;  3JAL B;  5LGT A;  2GHY A;  3W7T A;  1HR0 B;  2JVD A;  1GN4 A;  1XNR O;  1XMO B;  4J42 A;  3SYO A;  1XDC A;  3ZMT A;  2QWR B;  1FJG B;  3A8T A;  3SPH A;  5L3C A;  2CAZ C;  1S0V A;  1BGY H;  2IBZ H;  5JVD B;  5FNV B;  3LDC A;  3MHS C;  3SYC A;  5KA6 A;  1FD9 A;  3JAS A;  3OUS A;  4O4I A;  2XAS A;  3ZMZ A;  4UVB A;  1B06 A;  3ABT A;  1Q6H A;  3EHB B;  4JV5 O;  1P4R A;  3W7U A;  2CTR A;  4K3A A;  4X62 B;  2HR3 A;  2QM7 A;  5LA6 A;  3FYE B;  2XAJ A;  2ZDI C;  2AXT Z;  3OMI B;  1NTZ H;  2W0X A;  1TUB A;  3ABK C;  4PI2 A;  3RYH A;  4MW3 A;  1AR1 B;  1M1K W;  4O2B A;  4TV8 B;  3THO A;  3DTU B;  4IYH A;  1WN7 A;  4NKG B;  4QE7 A;  3RYI B;  5ITZ B;  3VQW A;  3H1K H;  4TOI A;  1OCZ B;  1FXV A;  1L1F A;  1DF5 A;  4ZHQ B;  2UUB B;  3CYO A;  4FM2 A;  3CC7 V;  4ZBM A;  3HKC A;  2ZM6 B;  5D5Q A;  5F2V O;  3FAV B;  2W6I G;  4LF5 O;  4QGP A;  1XHZ A;  4EKW A;  1THZ A;  3BA9 A;  2A79 B;  3CHX A;  4LNU B;  4P30 A;  2YDE A;  2G38 A;  1J5E O;  2MK3 A;  4X8A A;  4U3J B;  1RM1 B;  1BSM A;  3KKY A;  2EUL A;  4GX0 A;  3OTO B;  1KEC A;  4B3T O;  3ZHU A;  4BIO A;  1EFR G;  1YJW V;  3TXQ A;  1MOF A;  3T2M A;  4FLU A;  3K9A A;  1AI7 A;  3CCU V;  1XMO O;  3ZHQ A;  5CB4 B;  3SPG A;  4I9Q A;  1NT2 B;  4Z1V A;  2BTO A;  3JCU Z;  1Y4M A;  2JDI G;  2DMX A;  2QM4 A;  1K4C C;  2K9P A;  3LSS A;  4QJF B;  1OHH G;  1FJG O;  1VQO V;  3HR0 A;  2BTQ A;  1CXZ B;  3APQ A;  2N05 A;  4LF6 O;  1NVP B;  5EK0 A;  1NTK H;  1UPG A;  2Y4T A;  3O65 A;  2Q5Z A;  3NXS A;  3P3P A;  3CC4 V;  3B77 A;  3ZMS A;  4DUY B;  2VQE B;  4FFB A;  5JJJ B;  3ASN B;  3ICX A;  5J9P C; 
#chains in the Genus database with same CATH homology
 4JZ2 A;  2AW9 A;  1XUQ A;  1AR5 A;  3TJT A;  1P7G A;  1WB7 A;  1PM9 A;  1I08 A;  2CDY A;  3DC5 A;  4FFK A;  3CEI A;  4GUN A;  1VAR A;  2GDS A;  3K9S A;  1ZSP A;  4E4E A;  3AK1 A;  4C7U A;  1GN3 A;  1IXB A;  3BFR A;  1IDS A;  1MNG A;  4F6E A;  1AVM A;  1KKC A;  3MDS A;  5AG2 A;  4JZG A;  3C3T A;  4X9Q A;  3AK2 A;  2ADQ B;  1BS3 A;  1AP6 A;  1BT8 A;  1N0N A;  2QKC A;  3QVN A;  1ZUQ A;  1QNM A;  4YIP A;  2RCV A;  1JR9 A;  3RN4 A;  1I0H A;  3DC6 A;  3EVK A;  1GN4 A;  2QKA A;  1BSM A;  1IX9 A;  3KKY A;  1EM1 A;  1ZTE A;  3OT7 A;  2P4K A;  1JA8 A;  1SZX A;  1XDC A;  3LSU A;  1XRE A;  3IC9 A;  1N0J A;  1WB8 A;  1MMM A;  3KDR A;  1Y67 A;  1AR4 A;  3AK3 A;  1GN6 A;  5A9G A;  4JYY A;  4BR6 A;  1MA1 A;  1XIL A;  4YIO A;  1GN2 A;  3C3S A;  1EN4 A;  1LUW A;  1LUV A;  1B06 A;  1EN5 A;  1MSD A;  1VEW A;  2CE4 A;  1ZLZ A;  2ADP A;  1AP5 A;  1EN6 A;  1PL4 A;  1D5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...