3MDYB

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
molecule keywords Bone morphogenetic protein receptor type-1B
total genus 27
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3mdyB00
3FAPA 3IKGA 4JFLA 3H9RB 3UQBA 3O5QA 3UI5A 1KT1A 3TDBA 2KR7A 1P5QA 3KABA 4J4NA 1EYMA 5HKGA 1FKFA 2XPAA 4TW8A 2XP4A 4DRNA 4TNSA 2FKEA 2MLZA 2ZQSA 4DZ3A 1W26A 2DG9A 3KAHA 5HW8A 1R9HA 1QPLA 2AWGA 3JYJA 1PINA 1J4HA 2XP8A 1ZK6A 1BL4A 1Q1CA 4JFMA 1FKLA 4W9PA 5J6EA 1FJDA 2RUQA 3KACA 2MF9A 3IK8A 4DIPA 1FKIA 1JVWA 3O5MA 4JFIA 2N87A 2ZR5A 5DITA 4DRMA 5HTGA 1FKKA 2KI3A 3RFWA 4TW6A 2PV1A 4W9QA 4ODNA 4JFJA 1JNSA 2PPPA 4DH0A 1J6YA 2Q5AA 1JNTA 2DG4A 2RSEA 3NI6A 2VN1A 4U84A 2VCDA 4J4OA 5GPGA 3PRBA 4DRJA 2LJ4A 1FAPA 1FKTA 5DIUA 1J4IA 3NRKA 1Q6HA 1Y0OA 2F4EA 1FKHA 4LAVA 4W9OA 1PBKA 4FAPA 4ODKA 3TCZA 3O5FA 4DZ2A 1FKGA 5HUAA 2MNTA 2RUCA 4ODLA 2MLYA 1D7IA 4IPXA 1YATA 4O2TA 4QT3A 1L1PA 3CGNA 1HXVA 1Q6IA 3O5OA 1BKFA 2XP7A 2RQSA 3PA7A 2MPHA 2M1IA 3OOBA 4C02B 1NSGA 5I98A 2M2AA 4DROA 4ODQA 2M08A 1QZ2A 2KFWA 3UQAA 1NMWA 4DRIA 4DT4A 4BF8A 2PPOA 3B7XA 2DG3A 2PV3A 2Y78A 4FN2A 4TW7A 3KAIA 4TX0A 4JYSA 1EQ3A 1QPFA 1YW5A 2F2DA 1FKSA 1F8AB 4NNRA 3KADA 1D6OA 2UZ5A 1T11A 1U79A 2XP6A 4DRQA 3EY6A 3O5LA 2FAPA 5HWCA 1M5YA 2XPBA 4ODOA 2JZVA 2OFNA 3JXVA 2XP9A 4DRPA 1TCOC 4G2PA 2MLXA 2LKNA 4GGQA 5DIVA 3O5RA 4G50A 3RGCA 2KE0A 1FKBA 1ZCNA 2PV2A 3VAWA 4U85A 5BXJA 2LGOA 1Q6UA 5HW7A 3KAFA 3WH0A 1FKRA 3GPKA 2KO7A 3KCEA 1C9HA 2XP3A 5HT1A 4DRKA 2ZR4A 2ZR6A 2ITKA 2IF4A 1KT0A 2KGJA 1FKJA 3MDYB 4DRHA 3O5EA 3O5KA 5HWBA 4ODMA 3O5PA 1A7XA 3CGMA 1NMVA 3I6CA 3IKDA 4TYOA 1FD9A 4QT2A 2ZQTA 4ITZA 3TC5A 3KAGA 3KZ7A 1J4RA 4JFKA 4LAWA 1D7JA 2D9FA 2PPNA 3O5JA 4GIVA 3UI4A 3UQIA 2RURA 4QIBA 3O5IA 4N19A 4ODPA 2K8IA 1N1AA 3UF8A 3ODKA 4IQ2A 2XP5A 5HW6A 3O5GA 1D7HA 2ZQUA 3LUOA 4MSPA 4U86A 2PBCA 2RUDA 3O5DA 1B6CA 1FKDA 2L2SA 3UI6A 4MGVA 4LAXA 3JYMA 4LAYA 5B8IC 3PRDA 4R0XA 5D75A 1ROUA 1F40A 1ROTA 2LPVA 4IQCA 2ZQVA 3NTPA 4ODRA 2F21A 3IHZA
chains in the Genus database with same CATH superfamily
3AROA 3O5QA 3KABA 5HKGA 2DSZA 4TW8A 3ALGA 2XP4A 2FKEA 2DG9A 4NSBA 4PTMA 5HW8A 1R9HA 2AWGA 1LG2A 3JYJA 4JFMA 3KACA 4DIPA 3O5MA 5DITA 2G41A 4DWSD 1IX5A 4Q22A 4W9QA 4JFJA 3CHEA 2PPPA 4DH0A 2Q5AA 4HBEA 2VN1A 2VCDA 2LJ4A 1FKTA 1EDQA 3BMBA 5DIUA 1Y0OA 4DWSA 1X6LA 4ODKA 4DZ2A 1OWQA 2DT0A 3ARSA 2MNTA 4LGXA 3ARTA 1YATA 4O2TA 1BKFA 2XP7A 1FFQA 4QZVB 2A3CA 4ODQA 3B8SA 4DRIA 4DT4A 3B7XA 1GOIA 4KR0B 4TW7A 2Y78A 4TX0A 1QPFA 4AY1A 1LL4A 3KADA 2UZ5A 3CH9A 1X6NA 2OFNA 1JNEA 3RGCA 1FKBA 2DT3A 2LGOA 1D2KA 2PN0A 1Q6UA 5DF0A 3GPKA 4Z2HA 3WD0A 2XP3A 5HT1A 2ZR6A 1ZBCA 2A3EA 1WAWA 1HJWA 1A7XA 1HKIA 1GPFA 1NMVA 4TYOA 4QT2A 3ARQA 2ZQTA 4Q7NA 4UDMA 3KAGA 3WQWA 1D7JA 2PPNA 3O5JA 1EIBA 4QIBA 3PR9A 1KFWA 4MSPA 2YBUA 3G6LA 3O5DA 2G8ZA 2FDMA 2L2SA 1HJXA 3UI6A 5B8IC 4R0XA 1ZU8A 4IQCA 2ZQVA 3NTPA 4DRMA 2F21A 1K9TA 1W1TA 1VF8A 3WKZA 4JFLA 1JCHB 1NH6A 1KT1A 4ZS6A 4MTVA 3TDBA 4W5UA 1P5QA 1FKFA 4XAKA 4TNSA 3WD3A 3RMEA 1E6RA 3EIPA 4WIWA 2XP8A 1BL4A 4W9PA 1FKLA 2MF9A 3ARVA 5DO2A 2DSWA 1EHNA 3RM4A 1FKKA 2DSUA 2WLYA 1NWSA 2OLHA 2DG4A 2WLZA 4DRJA 3PRBA 3WD2A 2F4EA 3AS1A 4W9OA 5HUAA 1XRVA 3AS2A 3CZ8A 2MLYA 1O6IA 1L1PA 3FXYA 3O5OA 1OGGA 5GQBA 1ITXA 2MPHA 3OOBA 4WK9A 4C02B 2M2AA 4DROA 1HKJA 1WB0A 2M08A 1QZ2A 1W9PA 2KFWA 4BF8A 1UR9A 3KAIA 4S3JA 4Z2LA 1FKSA 4ML4A 1F8AB 3GTYX 1D6OA 4NZCA 1T11A 2XP6A 3O5LA 2JZVA 4DRPA 1TCOC 4G2PA 2A3AA 2LKNA 4GGQA 5DIVA 3O5RA 4G50A 3RM9A 3QOKA 2PV2A 3ARUA 2B31A 3WH0A 3CHFA 1C9HA 2ZR4A 2IF4A 4ODMA 3CGMA 1RD6A 1GUVA 5JH8A 3KZ7A 3UI4A 2RURA 1SYTA 2K8IA 3W4RA 2AOSA 1HJVA 1ZBVA 2XP5A 3WL1A 5HW6A 3O5GA 3AQUA 2ZQUA 4U86A 3LUOA 1E6ZA 2RUDA 4MNKA 1B6CA 4L3NA 3BXWA 4ZPVR 3CHCA 4LAXA 4LAYA 1LL6A 2EULA 3IHZA 2IUZA 3H9RB 4HARA 3UI5A 1WNOA 1EYMA 4P8UA 2XPAA 3ARRA 4DRNA 4DZ3A 1J4HA 2F23A 5J6EA 2RUQA 4WKHA 3IK8A 1ZB5A 5HTGA 3ARWA 2DPEA 1ZBKA 1NWUA 4MNLA 1E15A 1J6YA 1JNTA 1W9VA 2RSEA 3WQVA 4MNMA 5GPGA 4J4OA 1FAPA 2QF8A 4ZPWR 1J4IA 3NRKA 1FKHA 4LAVA 1PBKA 4FAPA 1HKMA 3O5FA 1FKGA 2RUCA 4ODLA 3CGNA 1Q6IA 3ARYA 5HBFA 2M1IA 1NSGA 3UQAA 1NMWA 4FN2A 1EQ3A 1HXVA 2PV3A 4WKFA 3CHDA 4R5EA 4NNRA 1E6NA 1U79A 3EY6A 5DEZA 2FAPA 2XPBA 3JXVA 2MLXA 1UR8A 3PRAA 3OA5A 4IT4A 3B9AA 2O92A 3B9EA 3KAFA 2KO7A 3KCEA 3G6MA 4DRKA 2KGJA 4DRHA 3MDYB 3O5EA 1W1PA 3O5PA 3I6CA 4ITZA 1W1VA 1OGBA 4JFKA 4LAWA 3UQIA 1GRJA 4HBOA 3O5IA 4N19A 1N1AA 3ODKA 3ARZA 1LL7A 4KQZA 1FKDA 1TFVA 3WIJA 5D75A 1ROUA 3FAPA 3IKGA 3AS0A 2ESCA 3UQBA 4ZPTR 2KR7A 4J4NA 1XHGA 1NWRA 3AS3A 1H0GA 1LQ0A 2MLZA 2ZQSA 1E6PA 1H0IA 1W26A 3KAHA 1QPLA 1ZL1A 1PINA 4MAVA 1ZK6A 2YBTA 1Q1CA 4IT6A 1FJDA 3ALFA 1FKIA 1JVWA 4JFIA 4MPKA 2N87A 2ZR5A 4Z2GA 2KI3A 3RFWA 3WL0A 1E9LA 4TW6A 2PV1A 4ODNA 1JNSA 3NI6A 4U84A 4URIA 1W9UA 4S3KA 2O9OA 5GPRA 1Q6HA 3GU0A 4DWSC 3TCZA 2PI6A 1ZBWA 1SR0A 1D7IA 4IPXA 4QT3A 2DT2A 2RQSA 3PA7A 4P8XA 5I98A 3ARXA 3RM8A 1LJYA 2PPOA 4MNJA 2DG3A 1HKKA 1CTNA 4JYSA 1YW5A 2P4VA 2F2DA 2WK2A 3FY1A 2WM0A 2A3BA 3ARPA 4DRQA 4WJXA 5HWCA 1M5YA 4ODOA 2XP9A 3B9DA 2KE0A 1ZCNA 3VAWA 5BXJA 4U85A 2DSVA 4P8VA 5HW7A 2B5UB 2DT1A 1E44A 1FKRA 2ITKA 1KT0A 1FKJA 4L72B 1NWTA 3O5KA 5HWBA 3WD4A 4DWSB 3TC5A 3IKDA 1FD9A 1J4RA 2D9FA 1W1YA 4GIVA 4Z2KA 4P8WA 4ODPA 3UF8A 4IQ2A 1JNDA 1D7HA 2ETNA 4WKAA 2PBCA 1LG1A 3WD1A 4Z2IA 4MGVA 3JYMA 3PRDA 1F40A 1ROTA 2LPVA 4Z2JA 4ODRA 1FFRA
chains in the Genus database with same CATH topology
3AROA 3O5QA 3KABA 5HKGA 2DSZA 4TW8A 3ALGA 2XP4A 2FKEA 2DG9A 4NSBA 4PTMA 5HW8A 1R9HA 2AWGA 1LG2A 3JYJA 4JFMA 3KACA 4DIPA 3O5MA 5DITA 2G41A 4DWSD 1IX5A 4Q22A 4W9QA 4JFJA 3CHEA 2PPPA 4DH0A 2Q5AA 4HBEA 2VN1A 2VCDA 2LJ4A 1FKTA 1EDQA 5DIUA 1Y0OA 4DWSA 1X6LA 4ODKA 4DZ2A 1OWQA 2DT0A 3ARSA 2MNTA 4LGXA 3ARTA 1YATA 4O2TA 1BKFA 2XP7A 1FFQA 4QZVB 2A3CA 4ODQA 3B8SA 4DRIA 4DT4A 3B7XA 1GOIA 4KR0B 4TW7A 2Y78A 4TX0A 1QPFA 4AY1A 1LL4A 3KADA 2UZ5A 3CH9A 1X6NA 2OFNA 1JNEA 3RGCA 1FKBA 2DT3A 2LGOA 1D2KA 1Q6UA 5DF0A 3GPKA 4Z2HA 3WD0A 2XP3A 5HT1A 2ZR6A 1ZBCA 2A3EA 1WAWA 1HJWA 1A7XA 1HKIA 1GPFA 1NMVA 4TYOA 4QT2A 3ARQA 2ZQTA 4Q7NA 3KAGA 3WQWA 1D7JA 2PPNA 3O5JA 1EIBA 4QIBA 3PR9A 1KFWA 4MSPA 2YBUA 3G6LA 3O5DA 2G8ZA 2FDMA 2L2SA 1HJXA 3UI6A 5B8IC 4R0XA 1ZU8A 4IQCA 2ZQVA 3NTPA 4DRMA 2F21A 1K9TA 1W1TA 1VF8A 3WKZA 4JFLA 1NH6A 1KT1A 4ZS6A 4MTVA 3TDBA 4W5UA 1P5QA 1FKFA 4XAKA 4TNSA 3WD3A 3RMEA 1E6RA 4WIWA 2XP8A 1BL4A 4W9PA 1FKLA 2MF9A 3ARVA 5DO2A 2DSWA 1EHNA 3RM4A 1FKKA 2DSUA 2WLYA 1NWSA 2OLHA 2DG4A 2WLZA 4DRJA 3PRBA 3WD2A 2F4EA 3AS1A 4W9OA 5HUAA 1XRVA 3AS2A 3CZ8A 2MLYA 1O6IA 1L1PA 3FXYA 3O5OA 1OGGA 5GQBA 1ITXA 2MPHA 3OOBA 4WK9A 4C02B 2M2AA 4DROA 1HKJA 1WB0A 2M08A 1QZ2A 1W9PA 2KFWA 4BF8A 1UR9A 3KAIA 4S3JA 4Z2LA 1FKSA 4ML4A 1F8AB 1D6OA 4NZCA 1T11A 2XP6A 3O5LA 2JZVA 4DRPA 1TCOC 4G2PA 2A3AA 2LKNA 4GGQA 5DIVA 3O5RA 4G50A 3RM9A 3QOKA 2PV2A 3ARUA 2B31A 3WH0A 3CHFA 1C9HA 2ZR4A 2IF4A 4ODMA 3CGMA 1RD6A 1GUVA 5JH8A 3KZ7A 3UI4A 2RURA 1SYTA 2K8IA 3W4RA 2AOSA 1HJVA 1ZBVA 2XP5A 3WL1A 5HW6A 3O5GA 3AQUA 2ZQUA 4U86A 3LUOA 1E6ZA 2RUDA 4MNKA 1B6CA 4L3NA 3BXWA 4ZPVR 3CHCA 4LAXA 4LAYA 1LL6A 3IHZA 2IUZA 3H9RB 4HARA 3UI5A 1WNOA 1EYMA 4P8UA 2XPAA 3ARRA 4DRNA 4DZ3A 1J4HA 5J6EA 2RUQA 4WKHA 3IK8A 1ZB5A 5HTGA 3ARWA 2DPEA 1ZBKA 1NWUA 4MNLA 1E15A 1J6YA 1JNTA 1W9VA 2RSEA 3WQVA 4MNMA 5GPGA 4J4OA 1FAPA 2QF8A 4ZPWR 1J4IA 3NRKA 1FKHA 4LAVA 1PBKA 4FAPA 1HKMA 3O5FA 1FKGA 2RUCA 4ODLA 3CGNA 1Q6IA 3ARYA 5HBFA 2M1IA 1NSGA 3UQAA 1NMWA 4FN2A 1EQ3A 1HXVA 2PV3A 4WKFA 3CHDA 4R5EA 4NNRA 1E6NA 1U79A 3EY6A 5DEZA 2FAPA 2XPBA 3JXVA 2MLXA 1UR8A 3PRAA 3OA5A 4IT4A 3B9AA 2O92A 3B9EA 3KAFA 2KO7A 3KCEA 3G6MA 4DRKA 2KGJA 4DRHA 3MDYB 3O5EA 1W1PA 3O5PA 3I6CA 4ITZA 1W1VA 1OGBA 4JFKA 4LAWA 3UQIA 4HBOA 3O5IA 4N19A 1N1AA 3ODKA 3ARZA 1LL7A 4KQZA 1FKDA 1TFVA 3WIJA 5D75A 1ROUA 3FAPA 3IKGA 3AS0A 2ESCA 3UQBA 4ZPTR 2KR7A 4J4NA 1XHGA 1NWRA 3AS3A 1H0GA 1LQ0A 2MLZA 2ZQSA 1E6PA 1H0IA 1W26A 3KAHA 1QPLA 1ZL1A 1PINA 4MAVA 1ZK6A 2YBTA 1Q1CA 4IT6A 1FJDA 3ALFA 1FKIA 1JVWA 4JFIA 4MPKA 2N87A 2ZR5A 4Z2GA 2KI3A 3RFWA 3WL0A 1E9LA 4TW6A 2PV1A 4ODNA 1JNSA 3NI6A 4U84A 4URIA 1W9UA 4S3KA 2O9OA 5GPRA 1Q6HA 4DWSC 3TCZA 2PI6A 1ZBWA 1SR0A 1D7IA 4IPXA 4QT3A 2DT2A 2RQSA 3PA7A 4P8XA 5I98A 3ARXA 3RM8A 1LJYA 2PPOA 4MNJA 2DG3A 1HKKA 1CTNA 4JYSA 1YW5A 2F2DA 2WK2A 3FY1A 2WM0A 2A3BA 3ARPA 4DRQA 4WJXA 5HWCA 1M5YA 4ODOA 2XP9A 3B9DA 2KE0A 1ZCNA 3VAWA 5BXJA 4U85A 2DSVA 4P8VA 5HW7A 2DT1A 1FKRA 2ITKA 1KT0A 1FKJA 4L72B 1NWTA 3O5KA 5HWBA 3WD4A 4DWSB 3TC5A 3IKDA 1FD9A 1J4RA 2D9FA 1W1YA 4GIVA 4Z2KA 4P8WA 4ODPA 3UF8A 4IQ2A 1JNDA 1D7HA 4WKAA 2PBCA 1LG1A 3WD1A 4Z2IA 4MGVA 3JYMA 3PRDA 1F40A 1ROTA 2LPVA 4Z2JA 4ODRA 1FFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP A;  3IKG A;  4JFL A;  3H9R B;  3UQB A;  3O5Q A;  3UI5 A;  1KT1 A;  3TDB A;  2KR7 A;  1P5Q A;  3KAB A;  4J4N A;  1EYM A;  5HKG A;  1FKF A;  2XPA A;  4TW8 A;  2XP4 A;  4DRN A;  4TNS A;  2FKE A;  2MLZ A;  2ZQS A;  4DZ3 A;  1W26 A;  2DG9 A;  3KAH A;  5HW8 A;  1R9H A;  1QPL A;  2AWG A;  3JYJ A;  1PIN A;  1J4H A;  2XP8 A;  1ZK6 A;  1BL4 A;  1Q1C A;  4JFM A;  1FKL A;  4W9P A;  5J6E A;  1FJD A;  2RUQ A;  3KAC A;  2MF9 A;  3IK8 A;  4DIP A;  1FKI A;  1JVW A;  3O5M A;  4JFI A;  2N87 A;  2ZR5 A;  5DIT A;  4DRM A;  5HTG A;  1FKK A;  2KI3 A;  3RFW A;  4TW6 A;  2PV1 A;  4W9Q A;  4ODN A;  4JFJ A;  1JNS A;  2PPP A;  4DH0 A;  1J6Y A;  2Q5A A;  1JNT A;  2DG4 A;  2RSE A;  3NI6 A;  2VN1 A;  4U84 A;  2VCD A;  4J4O A;  5GPG A;  3PRB A;  4DRJ A;  2LJ4 A;  1FAP A;  1FKT A;  5DIU A;  1J4I A;  3NRK A;  1Q6H A;  1Y0O A;  2F4E A;  1FKH A;  4LAV A;  4W9O A;  1PBK A;  4FAP A;  4ODK A;  3TCZ A;  3O5F A;  4DZ2 A;  1FKG A;  5HUA A;  2MNT A;  2RUC A;  4ODL A;  2MLY A;  1D7I A;  4IPX A;  1YAT A;  4O2T A;  4QT3 A;  1L1P A;  3CGN A;  1HXV A;  1Q6I A;  3O5O A;  1BKF A;  2XP7 A;  2RQS A;  3PA7 A;  2MPH A;  2M1I A;  3OOB A;  4C02 B;  1NSG A;  5I98 A;  2M2A A;  4DRO A;  4ODQ A;  2M08 A;  1QZ2 A;  2KFW A;  3UQA A;  1NMW A;  4DRI A;  4DT4 A;  4BF8 A;  2PPO A;  3B7X A;  2DG3 A;  2PV3 A;  2Y78 A;  4FN2 A;  4TW7 A;  3KAI A;  4TX0 A;  4JYS A;  1EQ3 A;  1QPF A;  1YW5 A;  2F2D A;  1FKS A;  1F8A B;  4NNR A;  3KAD A;  1D6O A;  2UZ5 A;  1T11 A;  1U79 A;  2XP6 A;  4DRQ A;  3EY6 A;  3O5L A;  2FAP A;  5HWC A;  1M5Y A;  2XPB A;  4ODO A;  2JZV A;  2OFN A;  3JXV A;  2XP9 A;  4DRP A;  1TCO C;  4G2P A;  2MLX A;  2LKN A;  4GGQ A;  5DIV A;  3O5R A;  4G50 A;  3RGC A;  2KE0 A;  1FKB A;  1ZCN A;  2PV2 A;  3VAW A;  4U85 A;  5BXJ A;  2LGO A;  1Q6U A;  5HW7 A;  3KAF A;  3WH0 A;  1FKR A;  3GPK A;  2KO7 A;  3KCE A;  1C9H A;  2XP3 A;  5HT1 A;  4DRK A;  2ZR4 A;  2ZR6 A;  2ITK A;  2IF4 A;  1KT0 A;  2KGJ A;  1FKJ A;  3MDY B;  4DRH A;  3O5E A;  3O5K A;  5HWB A;  4ODM A;  3O5P A;  1A7X A;  3CGM A;  1NMV A;  3I6C A;  3IKD A;  4TYO A;  1FD9 A;  4QT2 A;  2ZQT A;  4ITZ A;  3TC5 A;  3KAG A;  3KZ7 A;  1J4R A;  4JFK A;  4LAW A;  1D7J A;  2D9F A;  2PPN A;  3O5J A;  4GIV A;  3UI4 A;  3UQI A;  2RUR A;  4QIB A;  3O5I A;  4N19 A;  4ODP A;  2K8I A;  1N1A A;  3UF8 A;  3ODK A;  4IQ2 A;  2XP5 A;  5HW6 A;  3O5G A;  1D7H A;  2ZQU A;  3LUO A;  4MSP A;  4U86 A;  2PBC A;  2RUD A;  3O5D A;  1B6C A;  1FKD A;  2L2S A;  3UI6 A;  4MGV A;  4LAX A;  3JYM A;  4LAY A;  5B8I C;  3PRD A;  4R0X A;  5D75 A;  1ROU A;  1F40 A;  1ROT A;  2LPV A;  4IQC A;  2ZQV A;  3NTP A;  4ODR A;  2F21 A;  3IHZ A; 
#chains in the Genus database with same CATH topology
 3ARO A;  3O5Q A;  3KAB A;  5HKG A;  2DSZ A;  4TW8 A;  3ALG A;  2XP4 A;  2FKE A;  2DG9 A;  4NSB A;  4PTM A;  5HW8 A;  1R9H A;  2AWG A;  1LG2 A;  3JYJ A;  4JFM A;  3KAC A;  4DIP A;  3O5M A;  5DIT A;  2G41 A;  4DWS D;  1IX5 A;  4Q22 A;  4W9Q A;  4JFJ A;  3CHE A;  2PPP A;  4DH0 A;  2Q5A A;  4HBE A;  2VN1 A;  2VCD A;  2LJ4 A;  1FKT A;  1EDQ A;  3BMB A;  5DIU A;  1Y0O A;  4DWS A;  1X6L A;  4ODK A;  4DZ2 A;  1OWQ A;  2DT0 A;  3ARS A;  2MNT A;  4LGX A;  3ART A;  1YAT A;  4O2T A;  1BKF A;  2XP7 A;  1FFQ A;  4QZV B;  2A3C A;  4ODQ A;  3B8S A;  4DRI A;  4DT4 A;  3B7X A;  1GOI A;  4KR0 B;  4TW7 A;  2Y78 A;  4TX0 A;  1QPF A;  4AY1 A;  1LL4 A;  3KAD A;  2UZ5 A;  3CH9 A;  1X6N A;  2OFN A;  1JNE A;  3RGC A;  1FKB A;  2DT3 A;  2LGO A;  1D2K A;  2PN0 A;  1Q6U A;  5DF0 A;  3GPK A;  4Z2H A;  3WD0 A;  2XP3 A;  5HT1 A;  2ZR6 A;  1ZBC A;  2A3E A;  1WAW A;  1HJW A;  1A7X A;  1HKI A;  1GPF A;  1NMV A;  4TYO A;  4QT2 A;  3ARQ A;  2ZQT A;  4Q7N A;  4UDM A;  3KAG A;  3WQW A;  1D7J A;  2PPN A;  3O5J A;  1EIB A;  4QIB A;  3PR9 A;  1KFW A;  4MSP A;  2YBU A;  3G6L A;  3O5D A;  2G8Z A;  2FDM A;  2L2S A;  1HJX A;  3UI6 A;  5B8I C;  4R0X A;  1ZU8 A;  4IQC A;  2ZQV A;  3NTP A;  4DRM A;  2F21 A;  1K9T A;  1W1T A;  1VF8 A;  3WKZ A;  4JFL A;  1JCH B;  1NH6 A;  1KT1 A;  4ZS6 A;  4MTV A;  3TDB A;  4W5U A;  1P5Q A;  1FKF A;  4XAK A;  4TNS A;  3WD3 A;  3RME A;  1E6R A;  3EIP A;  4WIW A;  2XP8 A;  1BL4 A;  4W9P A;  1FKL A;  2MF9 A;  3ARV A;  5DO2 A;  2DSW A;  1EHN A;  3RM4 A;  1FKK A;  2DSU A;  2WLY A;  1NWS A;  2OLH A;  2DG4 A;  2WLZ A;  4DRJ A;  3PRB A;  3WD2 A;  2F4E A;  3AS1 A;  4W9O A;  5HUA A;  1XRV A;  3AS2 A;  3CZ8 A;  2MLY A;  1O6I A;  1L1P A;  3FXY A;  3O5O A;  1OGG A;  5GQB A;  1ITX A;  2MPH A;  3OOB A;  4WK9 A;  4C02 B;  2M2A A;  4DRO A;  1HKJ A;  1WB0 A;  2M08 A;  1QZ2 A;  1W9P A;  2KFW A;  4BF8 A;  1UR9 A;  3KAI A;  4S3J A;  4Z2L A;  1FKS A;  4ML4 A;  1F8A B;  3GTY X;  1D6O A;  4NZC A;  1T11 A;  2XP6 A;  3O5L A;  2JZV A;  4DRP A;  1TCO C;  4G2P A;  2A3A A;  2LKN A;  4GGQ A;  5DIV A;  3O5R A;  4G50 A;  3RM9 A;  3QOK A;  2PV2 A;  3ARU A;  2B31 A;  3WH0 A;  3CHF A;  1C9H A;  2ZR4 A;  2IF4 A;  4ODM A;  3CGM A;  1RD6 A;  1GUV A;  5JH8 A;  3KZ7 A;  3UI4 A;  2RUR A;  1SYT A;  2K8I A;  3W4R A;  2AOS A;  1HJV A;  1ZBV A;  2XP5 A;  3WL1 A;  5HW6 A;  3O5G A;  3AQU A;  2ZQU A;  4U86 A;  3LUO A;  1E6Z A;  2RUD A;  4MNK A;  1B6C A;  4L3N A;  3BXW A;  4ZPV R;  3CHC A;  4LAX A;  4LAY A;  1LL6 A;  2EUL A;  3IHZ A;  2IUZ A;  3H9R B;  4HAR A;  3UI5 A;  1WNO A;  1EYM A;  4P8U A;  2XPA A;  3ARR A;  4DRN A;  4DZ3 A;  1J4H A;  2F23 A;  5J6E A;  2RUQ A;  4WKH A;  3IK8 A;  1ZB5 A;  5HTG A;  3ARW A;  2DPE A;  1ZBK A;  1NWU A;  4MNL A;  1E15 A;  1J6Y A;  1JNT A;  1W9V A;  2RSE A;  3WQV A;  4MNM A;  5GPG A;  4J4O A;  1FAP A;  2QF8 A;  4ZPW R;  1J4I A;  3NRK A;  1FKH A;  4LAV A;  1PBK A;  4FAP A;  1HKM A;  3O5F A;  1FKG A;  2RUC A;  4ODL A;  3CGN A;  1Q6I A;  3ARY A;  5HBF A;  2M1I A;  1NSG A;  3UQA A;  1NMW A;  4FN2 A;  1EQ3 A;  1HXV A;  2PV3 A;  4WKF A;  3CHD A;  4R5E A;  4NNR A;  1E6N A;  1U79 A;  3EY6 A;  5DEZ A;  2FAP A;  2XPB A;  3JXV A;  2MLX A;  1UR8 A;  3PRA A;  3OA5 A;  4IT4 A;  3B9A A;  2O92 A;  3B9E A;  3KAF A;  2KO7 A;  3KCE A;  3G6M A;  4DRK A;  2KGJ A;  4DRH A;  3MDY B;  3O5E A;  1W1P A;  3O5P A;  3I6C A;  4ITZ A;  1W1V A;  1OGB A;  4JFK A;  4LAW A;  3UQI A;  1GRJ A;  4HBO A;  3O5I A;  4N19 A;  1N1A A;  3ODK A;  3ARZ A;  1LL7 A;  4KQZ A;  1FKD A;  1TFV A;  3WIJ A;  5D75 A;  1ROU A;  3FAP A;  3IKG A;  3AS0 A;  2ESC A;  3UQB A;  4ZPT R;  2KR7 A;  4J4N A;  1XHG A;  1NWR A;  3AS3 A;  1H0G A;  1LQ0 A;  2MLZ A;  2ZQS A;  1E6P A;  1H0I A;  1W26 A;  3KAH A;  1QPL A;  1ZL1 A;  1PIN A;  4MAV A;  1ZK6 A;  2YBT A;  1Q1C A;  4IT6 A;  1FJD A;  3ALF A;  1FKI A;  1JVW A;  4JFI A;  4MPK A;  2N87 A;  2ZR5 A;  4Z2G A;  2KI3 A;  3RFW A;  3WL0 A;  1E9L A;  4TW6 A;  2PV1 A;  4ODN A;  1JNS A;  3NI6 A;  4U84 A;  4URI A;  1W9U A;  4S3K A;  2O9O A;  5GPR A;  1Q6H A;  3GU0 A;  4DWS C;  3TCZ A;  2PI6 A;  1ZBW A;  1SR0 A;  1D7I A;  4IPX A;  4QT3 A;  2DT2 A;  2RQS A;  3PA7 A;  4P8X A;  5I98 A;  3ARX A;  3RM8 A;  1LJY A;  2PPO A;  4MNJ A;  2DG3 A;  1HKK A;  1CTN A;  4JYS A;  1YW5 A;  2P4V A;  2F2D A;  2WK2 A;  3FY1 A;  2WM0 A;  2A3B A;  3ARP A;  4DRQ A;  4WJX A;  5HWC A;  1M5Y A;  4ODO A;  2XP9 A;  3B9D A;  2KE0 A;  1ZCN A;  3VAW A;  5BXJ A;  4U85 A;  2DSV A;  4P8V A;  5HW7 A;  2B5U B;  2DT1 A;  1E44 A;  1FKR A;  2ITK A;  1KT0 A;  1FKJ A;  4L72 B;  1NWT A;  3O5K A;  5HWB A;  3WD4 A;  4DWS B;  3TC5 A;  3IKD A;  1FD9 A;  1J4R A;  2D9F A;  1W1Y A;  4GIV A;  4Z2K A;  4P8W A;  4ODP A;  3UF8 A;  4IQ2 A;  1JND A;  1D7H A;  2ETN A;  4WKA A;  2PBC A;  1LG1 A;  3WD1 A;  4Z2I A;  4MGV A;  3JYM A;  3PRD A;  1F40 A;  1ROT A;  2LPV A;  4Z2J A;  4ODR A;  1FFR A; 
#chains in the Genus database with same CATH homology
 3ARO A;  3O5Q A;  3KAB A;  5HKG A;  2DSZ A;  4TW8 A;  3ALG A;  2XP4 A;  2FKE A;  2DG9 A;  4NSB A;  4PTM A;  5HW8 A;  1R9H A;  2AWG A;  1LG2 A;  3JYJ A;  4JFM A;  3KAC A;  4DIP A;  3O5M A;  5DIT A;  2G41 A;  4DWS D;  1IX5 A;  4Q22 A;  4W9Q A;  4JFJ A;  3CHE A;  2PPP A;  4DH0 A;  2Q5A A;  4HBE A;  2VN1 A;  2VCD A;  2LJ4 A;  1FKT A;  1EDQ A;  5DIU A;  1Y0O A;  4DWS A;  1X6L A;  4ODK A;  4DZ2 A;  1OWQ A;  2DT0 A;  3ARS A;  2MNT A;  4LGX A;  3ART A;  1YAT A;  4O2T A;  1BKF A;  2XP7 A;  1FFQ A;  4QZV B;  2A3C A;  4ODQ A;  3B8S A;  4DRI A;  4DT4 A;  3B7X A;  1GOI A;  4KR0 B;  4TW7 A;  2Y78 A;  4TX0 A;  1QPF A;  4AY1 A;  1LL4 A;  3KAD A;  2UZ5 A;  3CH9 A;  1X6N A;  2OFN A;  1JNE A;  3RGC A;  1FKB A;  2DT3 A;  2LGO A;  1D2K A;  1Q6U A;  5DF0 A;  3GPK A;  4Z2H A;  3WD0 A;  2XP3 A;  5HT1 A;  2ZR6 A;  1ZBC A;  2A3E A;  1WAW A;  1HJW A;  1A7X A;  1HKI A;  1GPF A;  1NMV A;  4TYO A;  4QT2 A;  3ARQ A;  2ZQT A;  4Q7N A;  3KAG A;  3WQW A;  1D7J A;  2PPN A;  3O5J A;  1EIB A;  4QIB A;  3PR9 A;  1KFW A;  4MSP A;  2YBU A;  3G6L A;  3O5D A;  2G8Z A;  2FDM A;  2L2S A;  1HJX A;  3UI6 A;  5B8I C;  4R0X A;  1ZU8 A;  4IQC A;  2ZQV A;  3NTP A;  4DRM A;  2F21 A;  1K9T A;  1W1T A;  1VF8 A;  3WKZ A;  4JFL A;  1NH6 A;  1KT1 A;  4ZS6 A;  4MTV A;  3TDB A;  4W5U A;  1P5Q A;  1FKF A;  4XAK A;  4TNS A;  3WD3 A;  3RME A;  1E6R A;  4WIW A;  2XP8 A;  1BL4 A;  4W9P A;  1FKL A;  2MF9 A;  3ARV A;  5DO2 A;  2DSW A;  1EHN A;  3RM4 A;  1FKK A;  2DSU A;  2WLY A;  1NWS A;  2OLH A;  2DG4 A;  2WLZ A;  4DRJ A;  3PRB A;  3WD2 A;  2F4E A;  3AS1 A;  4W9O A;  5HUA A;  1XRV A;  3AS2 A;  3CZ8 A;  2MLY A;  1O6I A;  1L1P A;  3FXY A;  3O5O A;  1OGG A;  5GQB A;  1ITX A;  2MPH A;  3OOB A;  4WK9 A;  4C02 B;  2M2A A;  4DRO A;  1HKJ A;  1WB0 A;  2M08 A;  1QZ2 A;  1W9P A;  2KFW A;  4BF8 A;  1UR9 A;  3KAI A;  4S3J A;  4Z2L A;  1FKS A;  4ML4 A;  1F8A B;  1D6O A;  4NZC A;  1T11 A;  2XP6 A;  3O5L A;  2JZV A;  4DRP A;  1TCO C;  4G2P A;  2A3A A;  2LKN A;  4GGQ A;  5DIV A;  3O5R A;  4G50 A;  3RM9 A;  3QOK A;  2PV2 A;  3ARU A;  2B31 A;  3WH0 A;  3CHF A;  1C9H A;  2ZR4 A;  2IF4 A;  4ODM A;  3CGM A;  1RD6 A;  1GUV A;  5JH8 A;  3KZ7 A;  3UI4 A;  2RUR A;  1SYT A;  2K8I A;  3W4R A;  2AOS A;  1HJV A;  1ZBV A;  2XP5 A;  3WL1 A;  5HW6 A;  3O5G A;  3AQU A;  2ZQU A;  4U86 A;  3LUO A;  1E6Z A;  2RUD A;  4MNK A;  1B6C A;  4L3N A;  3BXW A;  4ZPV R;  3CHC A;  4LAX A;  4LAY A;  1LL6 A;  3IHZ A;  2IUZ A;  3H9R B;  4HAR A;  3UI5 A;  1WNO A;  1EYM A;  4P8U A;  2XPA A;  3ARR A;  4DRN A;  4DZ3 A;  1J4H A;  5J6E A;  2RUQ A;  4WKH A;  3IK8 A;  1ZB5 A;  5HTG A;  3ARW A;  2DPE A;  1ZBK A;  1NWU A;  4MNL A;  1E15 A;  1J6Y A;  1JNT A;  1W9V A;  2RSE A;  3WQV A;  4MNM A;  5GPG A;  4J4O A;  1FAP A;  2QF8 A;  4ZPW R;  1J4I A;  3NRK A;  1FKH A;  4LAV A;  1PBK A;  4FAP A;  1HKM A;  3O5F A;  1FKG A;  2RUC A;  4ODL A;  3CGN A;  1Q6I A;  3ARY A;  5HBF A;  2M1I A;  1NSG A;  3UQA A;  1NMW A;  4FN2 A;  1EQ3 A;  1HXV A;  2PV3 A;  4WKF A;  3CHD A;  4R5E A;  4NNR A;  1E6N A;  1U79 A;  3EY6 A;  5DEZ A;  2FAP A;  2XPB A;  3JXV A;  2MLX A;  1UR8 A;  3PRA A;  3OA5 A;  4IT4 A;  3B9A A;  2O92 A;  3B9E A;  3KAF A;  2KO7 A;  3KCE A;  3G6M A;  4DRK A;  2KGJ A;  4DRH A;  3MDY B;  3O5E A;  1W1P A;  3O5P A;  3I6C A;  4ITZ A;  1W1V A;  1OGB A;  4JFK A;  4LAW A;  3UQI A;  4HBO A;  3O5I A;  4N19 A;  1N1A A;  3ODK A;  3ARZ A;  1LL7 A;  4KQZ A;  1FKD A;  1TFV A;  3WIJ A;  5D75 A;  1ROU A;  3FAP A;  3IKG A;  3AS0 A;  2ESC A;  3UQB A;  4ZPT R;  2KR7 A;  4J4N A;  1XHG A;  1NWR A;  3AS3 A;  1H0G A;  1LQ0 A;  2MLZ A;  2ZQS A;  1E6P A;  1H0I A;  1W26 A;  3KAH A;  1QPL A;  1ZL1 A;  1PIN A;  4MAV A;  1ZK6 A;  2YBT A;  1Q1C A;  4IT6 A;  1FJD A;  3ALF A;  1FKI A;  1JVW A;  4JFI A;  4MPK A;  2N87 A;  2ZR5 A;  4Z2G A;  2KI3 A;  3RFW A;  3WL0 A;  1E9L A;  4TW6 A;  2PV1 A;  4ODN A;  1JNS A;  3NI6 A;  4U84 A;  4URI A;  1W9U A;  4S3K A;  2O9O A;  5GPR A;  1Q6H A;  4DWS C;  3TCZ A;  2PI6 A;  1ZBW A;  1SR0 A;  1D7I A;  4IPX A;  4QT3 A;  2DT2 A;  2RQS A;  3PA7 A;  4P8X A;  5I98 A;  3ARX A;  3RM8 A;  1LJY A;  2PPO A;  4MNJ A;  2DG3 A;  1HKK A;  1CTN A;  4JYS A;  1YW5 A;  2F2D A;  2WK2 A;  3FY1 A;  2WM0 A;  2A3B A;  3ARP A;  4DRQ A;  4WJX A;  5HWC A;  1M5Y A;  4ODO A;  2XP9 A;  3B9D A;  2KE0 A;  1ZCN A;  3VAW A;  5BXJ A;  4U85 A;  2DSV A;  4P8V A;  5HW7 A;  2DT1 A;  1FKR A;  2ITK A;  1KT0 A;  1FKJ A;  4L72 B;  1NWT A;  3O5K A;  5HWB A;  3WD4 A;  4DWS B;  3TC5 A;  3IKD A;  1FD9 A;  1J4R A;  2D9F A;  1W1Y A;  4GIV A;  4Z2K A;  4P8W A;  4ODP A;  3UF8 A;  4IQ2 A;  1JND A;  1D7H A;  4WKA A;  2PBC A;  1LG1 A;  3WD1 A;  4Z2I A;  4MGV A;  3JYM A;  3PRD A;  1F40 A;  1ROT A;  2LPV A;  4Z2J A;  4ODR A;  1FFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...