3MDYB

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1B
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 27
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3mdyB00
4DRIA 2UZ5A 3UQIA 1PBKA 4TW7A 5HWBA 2D9FA 3KACA 3PRDA 4QT3A 1W26A 5DIUA 3TDBA 2FAPA 2XPAA 4IPXA 4MSPA 3KABA 1B6CA 4TYOA 3UQAA 3WH0A 3UQBA 1M5YA 2MPHA 1D7HA 1FKDA 4W9QA 1D7IA 3KAIA 3RGCA 1R9HA 1FD9A 1Q6HA 1HXVA 2MLXA 3CGNA 4ODOA 3RFWA 2PPNA 1FKSA 2PPOA 2Y78A 2DG3A 1FKHA 2ZQUA 4LAVA 3I6CA 4LAYA 4ODRA 1KT0A 2JZVA 3O5DA 2XP8A 4DRQA 4GIVA 1QPLA 1FKKA 1FAPA 2M1IA 3KAHA 3O5FA 4TW8A 4TX0A 4ITZA 4ODNA 2ZR6A 3IKDA 4DZ3A 5HWCA 2LKNA 5HW7A 3LUOA 3KCEA 2Q5AA 1FKRA 1L1PA 2KE0A 1D6OA 4NNRA 4W9PA 2F21A 2ZQVA 3JXVA 3KAFA 3UI4A 2ZR5A 2M2AA 2OFNA 3UI5A 4QT2A 1N1AA 2K8IA 4DZ2A 2VN1A 2XP6A 4W9OA 3UI6A 2AWGA 2XPBA 2KFWA 5DITA 4BF8A 1T11A 3VAWA 4DRMA 2PV2A 4J4OA 1F40A 1BKFA 2MF9A 2XP4A 2XP7A 1PINA 4JFLA 3NI6A 1F8AB 3FAPA 4LAWA 1ZCNA 2KGJA 2ITKA 1QPFA 1J6YA 5HTGA 1EQ3A 1FKIA 1FKTA 3O5RA 4DT4A 2ZR4A 3JYJA 2LJ4A 2LPVA 3JYMA 4R0XA 5B8IC 4IQCA 1FJDA 1Q1CA 2KO7A 3IHZA 1D7JA 5J6EA 2L2SA 2N87A 5BXJA 2VCDA 1J4RA 2PPPA 2XP3A 3GPKA 3ODKA 1C9HA 5HW6A 2MNTA 4J4NA 4DH0A 4ODKA 2DG4A 4ODPA 4O2TA 1JVWA 3PA7A 5HT1A 5GPGA 4DIPA 1A7XA 4FN2A 4TW6A 5HW8A 2XP5A 1NSGA 1KT1A 4DRPA 3O5QA 4JFJA 3MDYB 4ODLA 3O5KA 1FKJA 1NMVA 3O5PA 1QZ2A 2RUQA 2PBCA 3O5OA 4DRHA 4JFIA 1JNTA 3KADA 4LAXA 4DRKA 2LGOA 2DG9A 3IKGA 1TCOC 3UF8A 3PRBA 1ZK6A 4G50A 4QIBA 4DROA 3TCZA 3KZ7A 1P5QA 2RUDA 3EY6A 4ODQA 1YATA 4JYSA 1FKGA 2RSEA 1Q6UA 1J4IA 2ZQSA 4C02B 3O5LA 4IQ2A 3O5GA 5DIVA 5HKGA 3O5MA 1BL4A 1NMWA 2RQSA 2KR7A 2MLYA 3B7XA 3O5EA 2RUCA 5I98A 1FKFA 4JFKA 3O5IA 1Y0OA 4GGQA 4ODMA 2MLZA 3OOBA 1EYMA 2IF4A 4TNSA 4MGVA 1FKBA 2F2DA 4N19A 3NTPA 1Q6IA 4U85A 1J4HA 4FAPA 4DRNA 4DRJA 2PV1A 1ROUA 2KI3A 1ROTA 4G2PA 3NRKA 4JFMA 1YW5A 2ZQTA 5HUAA 3KAGA 3O5JA 3TC5A 2M08A 1JNSA 2PV3A 1FKLA 3IK8A 4U86A 4U84A 1U79A 2XP9A 2F4EA 5D75A 2FKEA 3H9RB 3CGMA 2RURA
chains in the Genus database with same CATH superfamily
2A3CA 2UZ5A 2YBUA 1W26A 4IPXA 1HJWA 4DWSD 4W9QA 1FD9A 3WL1A 3ALFA 1HXVA 1FKHA 1WB0A 4LAYA 3RM8A 4GIVA 1FKKA 1HKJA 1L1PA 4W9PA 2OFNA 2DSZA 3WKZA 2AWGA 2KFWA 4IT6A 4BF8A 4HBEA 1F40A 4J4OA 4JFLA 1PINA 3ARVA 3FAPA 1ZCNA 2ITKA 3OA5A 2B31A 1NH6A 2ZR4A 4R0XA 1ZBWA 1FJDA 2KO7A 1IX5A 3AQUA 5BXJA 1J4RA 3CH9A 1H0IA 2MNTA 4J4NA 1JVWA 4DIPA 1A7XA 4FN2A 2XP5A 1NSGA 1KT1A 1FFRA 3WD3A 3O5KA 1FKJA 3O5PA 3CHDA 4JFIA 1X6LA 3ARYA 1HKKA 1TFVA 2P4VA 3ARPA 1WAWA 2ZQSA 3O5GA 1OGGA 4Z2LA 1BL4A 1NMWA 4QZVB 2MLYA 4JFKA 2YBTA 4P8VA 2MLZA 1LG1A 4UDMA 5DO2A 1J4HA 1ZL1A 3RMEA 4G2PA 3NRKA 3B9EA 2M08A 1U79A 1E15A 2F4EA 1ZU8A 4DRIA 1LL6A 1CTNA 3UQIA 4TW7A 2D9FA 2A3EA 3KACA 3TDBA 1E6PA 2XPAA 1OGBA 3UQBA 4P8UA 1D7IA 1R9HA 3WD1A 2IUZA 1X6NA 5DEZA 3CGNA 5GPRA 3EIPA 4ODOA 3RFWA 2Y78A 2DG3A 2ZQUA 4LAVA 3I6CA 4NZCA 2M1IA 3ARUA 4ITZA 2ZR6A 5HWCA 1WNOA 3KCEA 3WD2A 4ZPWR 2KE0A 3AS1A 3KAFA 3UI4A 2DSVA 3FY1A 3B8SA 2K8IA 2XP6A 2MF9A 2A3AA 4WK9A 3CZ8A 1EQ3A 5HTGA 2DSWA 4DWSA 1FFQA 4MPKA 4Q7NA 4Z2HA 1HKIA 1ZBCA 1HJVA 3IHZA 3GU0A 2N87A 4NSBA 2VCDA 3GPKA 4DH0A 4ODPA 4O2TA 5HT1A 1E9LA 5HW8A 4AY1A 4JFJA 1JCHB 2EULA 4W5UA 1NMVA 2PBCA 2PN0A 2B5UB 1E6ZA 2O9OA 4DRKA 1KFWA 1TCOC 2ETNA 1XRVA 1ZK6A 4G50A 4QIBA 2RUDA 1YATA 4JYSA 1Q6UA 5JH8A 5DF0A 3O5LA 1W9UA 2DT1A 3ALGA 3O5MA 2KR7A 3O5EA 3G6MA 5I98A 1O6IA 1FKFA 4WIWA 4MNJA 1UR8A 4GGQA 4ODMA 4ZPTR 2WM0A 2F2DA 4N19A 4PTMA 3NTPA 3AS2A 3CHEA 4WKFA 4DRJA 2PV1A 3B9DA 2ZQTA 3ARXA 5HUAA 2DT2A 3WL0A 2QF8A 1JNSA 4U86A 3B9AA 3CGMA 4Q22A 1PBKA 5HWBA 1H0GA 4ML4A 1ZBVA 2FDMA 4MSPA 4TYOA 3WH0A 2MPHA 1NWRA 3RGCA 4S3JA 2MLXA 3ARRA 1ITXA 1NWUA 2PPNA 2DSUA 4ODRA 1KT0A 1NWTA 1ZB5A 2JZVA 2XP8A 4DRQA 4Z2IA 1QPLA 2DPEA 1FAPA 3CHFA 3KAHA 1W1PA 4TW8A 4ODNA 5GQBA 3IKDA 3LUOA 1FKRA 2Q5AA 3WD4A 2WLYA 3WQWA 4NNRA 2F21A 2ZQVA 2M2AA 3UI5A 1OWQA 2ESCA 5DITA 1T11A 2PV2A 3RM9A 2XP7A 3NI6A 1W1TA 1F8AB 4LAWA 1LL7A 1J6YA 1W1VA 2WK2A 1FKTA 3BMBA 3O5RA 4DT4A 2LJ4A 2LPVA 4XAKA 4IQCA 1D2KA 3WD0A 4L3NA 1E6RA 5J6EA 1D7JA 2PPPA 3BXWA 5HW6A 2DT3A 3W4RA 3ARTA 2DG4A 1ZBKA 3WQVA 4TW6A 1UR9A 1SR0A 3O5QA 4MNKA 3MDYB 4ODLA 5HBFA 1QZ2A 2RUQA 1GOIA 2PI6A 4DRHA 4LAXA 1EHNA 2LGOA 1E6NA 1JNEA 3IKGA 2WLZA 3PRBA 1EIBA 3TCZA 1LJYA 4DZ3A 1FKGA 2DT0A 2RSEA 1J4IA 4Z2KA 3ARZA 1W9VA 5HKGA 2RQSA 1RD6A 3AS0A 4P8WA 3B7XA 2RUCA 4S3KA 4DWSB 4MTVA 1SYTA 1EYMA 4MGVA 4DWSC 1W9PA 4U85A 1VF8A 4FAPA 1ROTA 4JFMA 3KAGA 3O5JA 3TC5A 2PV3A 1FKLA 3IK8A 4U84A 1LL4A 3PRAA 4L72B 4HBOA 2RURA 1GPFA 4MNLA 3PRDA 4QT3A 4WKHA 5DIUA 1W1YA 2FAPA 3KABA 1B6CA 3UQAA 1M5YA 1D7HA 1FKDA 1XHGA 3KAIA 1Q6HA 3ARWA 4MAVA 1FKSA 2PPOA 2O92A 3O5DA 4IT4A 3O5FA 4TX0A 4LGXA 4URIA 4WKAA 2LKNA 5HW7A 1LQ0A 1D6OA 3JXVA 2ZR5A 3AS3A 4QT2A 4KR0B 1N1AA 4DZ2A 2VN1A 4W9OA 3FXYA 3UI6A 2XPBA 3AROA 4DRMA 3VAWA 1BKFA 2XP4A 1JNDA 2KGJA 4Z2JA 1QPFA 3QOKA 1K9TA 1FKIA 1LG2A 2A3BA 3JYJA 3RM4A 5B8IC 3JYMA 1Q1CA 2G41A 3G6LA 2L2SA 1GRJA 3ODKA 2XP3A 1HJXA 1C9HA 4ODKA 3PA7A 5GPGA 4KQZA 4DRPA 3ARQA 4R5EA 3WIJA 3O5OA 4HARA 1JNTA 2OLHA 3KADA 2AOSA 2DG9A 3UF8A 3PR9A 4DROA 1EDQA 3KZ7A 1P5QA 4ODQA 3EY6A 4ZPVR 4C02B 4ZS6A 4IQ2A 3CHCA 5DIVA 4P8XA 3O5IA 1Y0OA 1NWSA 3OOBA 1GUVA 2IF4A 4TNSA 1FKBA 3GTYX 1Q6IA 2F23A 4DRNA 1ROUA 2KI3A 2G8ZA 1YW5A 4Z2GA 4WJXA 1E44A 4MNMA 1HKMA 2XP9A 3ARSA 5D75A 2FKEA 3H9RB
chains in the Genus database with same CATH topology
2A3CA 2UZ5A 2YBUA 1W26A 4IPXA 1HJWA 4DWSD 4W9QA 1FD9A 3WL1A 3ALFA 1HXVA 1FKHA 1WB0A 4LAYA 3RM8A 4GIVA 1FKKA 1HKJA 1L1PA 4W9PA 2OFNA 2DSZA 3WKZA 2AWGA 2KFWA 4IT6A 4BF8A 4HBEA 1F40A 4J4OA 4JFLA 1PINA 3ARVA 3FAPA 1ZCNA 2ITKA 3OA5A 2B31A 1NH6A 2ZR4A 4R0XA 1ZBWA 1FJDA 2KO7A 1IX5A 3AQUA 5BXJA 1J4RA 3CH9A 1H0IA 2MNTA 4J4NA 1JVWA 4DIPA 1A7XA 4FN2A 2XP5A 1NSGA 1KT1A 1FFRA 3WD3A 3O5KA 1FKJA 3O5PA 3CHDA 4JFIA 1X6LA 3ARYA 1HKKA 1TFVA 3ARPA 1WAWA 2ZQSA 3O5GA 1OGGA 4Z2LA 1BL4A 1NMWA 4QZVB 2MLYA 4JFKA 2YBTA 4P8VA 2MLZA 1LG1A 5DO2A 1J4HA 1ZL1A 3RMEA 4G2PA 3NRKA 3B9EA 2M08A 1U79A 1E15A 2F4EA 1ZU8A 4DRIA 1LL6A 1CTNA 3UQIA 4TW7A 2D9FA 2A3EA 3KACA 3TDBA 1E6PA 2XPAA 1OGBA 3UQBA 4P8UA 1D7IA 1R9HA 3WD1A 2IUZA 1X6NA 5DEZA 3CGNA 5GPRA 4ODOA 3RFWA 2Y78A 2DG3A 2ZQUA 4LAVA 3I6CA 4NZCA 2M1IA 3ARUA 4ITZA 2ZR6A 5HWCA 1WNOA 3KCEA 3WD2A 4ZPWR 2KE0A 3AS1A 3KAFA 3UI4A 2DSVA 3FY1A 3B8SA 2K8IA 2XP6A 2MF9A 2A3AA 4WK9A 3CZ8A 1EQ3A 5HTGA 2DSWA 4DWSA 1FFQA 4MPKA 4Q7NA 4Z2HA 1HKIA 1ZBCA 1HJVA 3IHZA 4NSBA 2N87A 2VCDA 3GPKA 4DH0A 4ODPA 4O2TA 5HT1A 1E9LA 5HW8A 4AY1A 4JFJA 4W5UA 1NMVA 2PBCA 1E6ZA 2O9OA 4DRKA 1KFWA 1TCOC 1XRVA 1ZK6A 4G50A 4QIBA 2RUDA 1YATA 4JYSA 1Q6UA 5JH8A 5DF0A 3O5LA 1W9UA 2DT1A 3ALGA 3O5MA 2KR7A 3O5EA 3G6MA 5I98A 1O6IA 1FKFA 4WIWA 4MNJA 1UR8A 4GGQA 4ODMA 4ZPTR 2WM0A 2F2DA 4N19A 4PTMA 3NTPA 3AS2A 3CHEA 4WKFA 4DRJA 2PV1A 3B9DA 2ZQTA 3ARXA 5HUAA 2DT2A 3WL0A 2QF8A 1JNSA 4U86A 3B9AA 3CGMA 4Q22A 1PBKA 5HWBA 1H0GA 4ML4A 1ZBVA 2FDMA 4MSPA 4TYOA 3WH0A 2MPHA 1NWRA 3RGCA 4S3JA 2MLXA 3ARRA 1ITXA 1NWUA 2PPNA 2DSUA 4ODRA 1KT0A 1NWTA 1ZB5A 2JZVA 2XP8A 4DRQA 4Z2IA 1QPLA 2DPEA 1FAPA 3CHFA 3KAHA 1W1PA 4TW8A 4ODNA 5GQBA 3IKDA 3LUOA 1FKRA 2Q5AA 3WD4A 2WLYA 3WQWA 4NNRA 2F21A 2ZQVA 2M2AA 3UI5A 1OWQA 2ESCA 5DITA 1T11A 2PV2A 3RM9A 2XP7A 3NI6A 1W1TA 1F8AB 4LAWA 1LL7A 1J6YA 1W1VA 2WK2A 1FKTA 3O5RA 4DT4A 2LJ4A 2LPVA 4XAKA 4IQCA 1D2KA 3WD0A 4L3NA 1E6RA 5J6EA 1D7JA 2PPPA 3BXWA 5HW6A 2DT3A 3W4RA 3ARTA 2DG4A 1ZBKA 3WQVA 4TW6A 1UR9A 1SR0A 3O5QA 4MNKA 3MDYB 4ODLA 5HBFA 1QZ2A 2RUQA 1GOIA 2PI6A 4DRHA 4LAXA 1EHNA 2LGOA 1E6NA 1JNEA 3IKGA 2WLZA 3PRBA 1EIBA 3TCZA 1LJYA 4DZ3A 1FKGA 2DT0A 2RSEA 1J4IA 4Z2KA 3ARZA 1W9VA 5HKGA 2RQSA 1RD6A 3AS0A 4P8WA 3B7XA 2RUCA 4S3KA 4DWSB 4MTVA 1SYTA 1EYMA 4MGVA 4DWSC 1W9PA 4U85A 1VF8A 4FAPA 1ROTA 4JFMA 3KAGA 3O5JA 3TC5A 2PV3A 1FKLA 3IK8A 4U84A 1LL4A 3PRAA 4L72B 4HBOA 2RURA 1GPFA 4MNLA 3PRDA 4QT3A 4WKHA 5DIUA 1W1YA 2FAPA 3KABA 1B6CA 3UQAA 1M5YA 1D7HA 1FKDA 1XHGA 3KAIA 1Q6HA 3ARWA 4MAVA 1FKSA 2PPOA 2O92A 3O5DA 4IT4A 3O5FA 4TX0A 4LGXA 4URIA 4WKAA 2LKNA 5HW7A 1LQ0A 1D6OA 3JXVA 2ZR5A 3AS3A 4QT2A 4KR0B 1N1AA 4DZ2A 2VN1A 4W9OA 3FXYA 3UI6A 2XPBA 3AROA 4DRMA 3VAWA 1BKFA 2XP4A 1JNDA 2KGJA 4Z2JA 1QPFA 3QOKA 1K9TA 1FKIA 1LG2A 2A3BA 3JYJA 3RM4A 5B8IC 3JYMA 1Q1CA 2G41A 3G6LA 2L2SA 3ODKA 2XP3A 1HJXA 1C9HA 4ODKA 3PA7A 5GPGA 4KQZA 4DRPA 3ARQA 4R5EA 3WIJA 3O5OA 4HARA 1JNTA 2OLHA 3KADA 2AOSA 2DG9A 3UF8A 3PR9A 4DROA 1EDQA 3KZ7A 1P5QA 4ODQA 3EY6A 4ZPVR 4C02B 4ZS6A 4IQ2A 3CHCA 5DIVA 4P8XA 3O5IA 1Y0OA 1NWSA 3OOBA 1GUVA 2IF4A 4TNSA 1FKBA 1Q6IA 4DRNA 1ROUA 2KI3A 2G8ZA 1YW5A 4Z2GA 4WJXA 4MNMA 1HKMA 2XP9A 3ARSA 5D75A 2FKEA 3H9RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI A;  2UZ5 A;  3UQI A;  1PBK A;  4TW7 A;  5HWB A;  2D9F A;  3KAC A;  3PRD A;  4QT3 A;  1W26 A;  5DIU A;  3TDB A;  2FAP A;  2XPA A;  4IPX A;  4MSP A;  3KAB A;  1B6C A;  4TYO A;  3UQA A;  3WH0 A;  3UQB A;  1M5Y A;  2MPH A;  1D7H A;  1FKD A;  4W9Q A;  1D7I A;  3KAI A;  3RGC A;  1R9H A;  1FD9 A;  1Q6H A;  1HXV A;  2MLX A;  3CGN A;  4ODO A;  3RFW A;  2PPN A;  1FKS A;  2PPO A;  2Y78 A;  2DG3 A;  1FKH A;  2ZQU A;  4LAV A;  3I6C A;  4LAY A;  4ODR A;  1KT0 A;  2JZV A;  3O5D A;  2XP8 A;  4DRQ A;  4GIV A;  1QPL A;  1FKK A;  1FAP A;  2M1I A;  3KAH A;  3O5F A;  4TW8 A;  4TX0 A;  4ITZ A;  4ODN A;  2ZR6 A;  3IKD A;  4DZ3 A;  5HWC A;  2LKN A;  5HW7 A;  3LUO A;  3KCE A;  2Q5A A;  1FKR A;  1L1P A;  2KE0 A;  1D6O A;  4NNR A;  4W9P A;  2F21 A;  2ZQV A;  3JXV A;  3KAF A;  3UI4 A;  2ZR5 A;  2M2A A;  2OFN A;  3UI5 A;  4QT2 A;  1N1A A;  2K8I A;  4DZ2 A;  2VN1 A;  2XP6 A;  4W9O A;  3UI6 A;  2AWG A;  2XPB A;  2KFW A;  5DIT A;  4BF8 A;  1T11 A;  3VAW A;  4DRM A;  2PV2 A;  4J4O A;  1F40 A;  1BKF A;  2MF9 A;  2XP4 A;  2XP7 A;  1PIN A;  4JFL A;  3NI6 A;  1F8A B;  3FAP A;  4LAW A;  1ZCN A;  2KGJ A;  2ITK A;  1QPF A;  1J6Y A;  5HTG A;  1EQ3 A;  1FKI A;  1FKT A;  3O5R A;  4DT4 A;  2ZR4 A;  3JYJ A;  2LJ4 A;  2LPV A;  3JYM A;  4R0X A;  5B8I C;  4IQC A;  1FJD A;  1Q1C A;  2KO7 A;  3IHZ A;  1D7J A;  5J6E A;  2L2S A;  2N87 A;  5BXJ A;  2VCD A;  1J4R A;  2PPP A;  2XP3 A;  3GPK A;  3ODK A;  1C9H A;  5HW6 A;  2MNT A;  4J4N A;  4DH0 A;  4ODK A;  2DG4 A;  4ODP A;  4O2T A;  1JVW A;  3PA7 A;  5HT1 A;  5GPG A;  4DIP A;  1A7X A;  4FN2 A;  4TW6 A;  5HW8 A;  2XP5 A;  1NSG A;  1KT1 A;  4DRP A;  3O5Q A;  4JFJ A;  3MDY B;  4ODL A;  3O5K A;  1FKJ A;  1NMV A;  3O5P A;  1QZ2 A;  2RUQ A;  2PBC A;  3O5O A;  4DRH A;  4JFI A;  1JNT A;  3KAD A;  4LAX A;  4DRK A;  2LGO A;  2DG9 A;  3IKG A;  1TCO C;  3UF8 A;  3PRB A;  1ZK6 A;  4G50 A;  4QIB A;  4DRO A;  3TCZ A;  3KZ7 A;  1P5Q A;  2RUD A;  3EY6 A;  4ODQ A;  1YAT A;  4JYS A;  1FKG A;  2RSE A;  1Q6U A;  1J4I A;  2ZQS A;  4C02 B;  3O5L A;  4IQ2 A;  3O5G A;  5DIV A;  5HKG A;  3O5M A;  1BL4 A;  1NMW A;  2RQS A;  2KR7 A;  2MLY A;  3B7X A;  3O5E A;  2RUC A;  5I98 A;  1FKF A;  4JFK A;  3O5I A;  1Y0O A;  4GGQ A;  4ODM A;  2MLZ A;  3OOB A;  1EYM A;  2IF4 A;  4TNS A;  4MGV A;  1FKB A;  2F2D A;  4N19 A;  3NTP A;  1Q6I A;  4U85 A;  1J4H A;  4FAP A;  4DRN A;  4DRJ A;  2PV1 A;  1ROU A;  2KI3 A;  1ROT A;  4G2P A;  3NRK A;  4JFM A;  1YW5 A;  2ZQT A;  5HUA A;  3KAG A;  3O5J A;  3TC5 A;  2M08 A;  1JNS A;  2PV3 A;  1FKL A;  3IK8 A;  4U86 A;  4U84 A;  1U79 A;  2XP9 A;  2F4E A;  5D75 A;  2FKE A;  3H9R B;  3CGM A;  2RUR A; 
#chains in the Genus database with same CATH topology
 2A3C A;  2UZ5 A;  2YBU A;  1W26 A;  4IPX A;  1HJW A;  4DWS D;  4W9Q A;  1FD9 A;  3WL1 A;  3ALF A;  1HXV A;  1FKH A;  1WB0 A;  4LAY A;  3RM8 A;  4GIV A;  1FKK A;  1HKJ A;  1L1P A;  4W9P A;  2OFN A;  2DSZ A;  3WKZ A;  2AWG A;  2KFW A;  4IT6 A;  4BF8 A;  4HBE A;  1F40 A;  4J4O A;  4JFL A;  1PIN A;  3ARV A;  3FAP A;  1ZCN A;  2ITK A;  3OA5 A;  2B31 A;  1NH6 A;  2ZR4 A;  4R0X A;  1ZBW A;  1FJD A;  2KO7 A;  1IX5 A;  3AQU A;  5BXJ A;  1J4R A;  3CH9 A;  1H0I A;  2MNT A;  4J4N A;  1JVW A;  4DIP A;  1A7X A;  4FN2 A;  2XP5 A;  1NSG A;  1KT1 A;  1FFR A;  3WD3 A;  3O5K A;  1FKJ A;  3O5P A;  3CHD A;  4JFI A;  1X6L A;  3ARY A;  1HKK A;  1TFV A;  2P4V A;  3ARP A;  1WAW A;  2ZQS A;  3O5G A;  1OGG A;  4Z2L A;  1BL4 A;  1NMW A;  4QZV B;  2MLY A;  4JFK A;  2YBT A;  4P8V A;  2MLZ A;  1LG1 A;  4UDM A;  5DO2 A;  1J4H A;  1ZL1 A;  3RME A;  4G2P A;  3NRK A;  3B9E A;  2M08 A;  1U79 A;  1E15 A;  2F4E A;  1ZU8 A;  4DRI A;  1LL6 A;  1CTN A;  3UQI A;  4TW7 A;  2D9F A;  2A3E A;  3KAC A;  3TDB A;  1E6P A;  2XPA A;  1OGB A;  3UQB A;  4P8U A;  1D7I A;  1R9H A;  3WD1 A;  2IUZ A;  1X6N A;  5DEZ A;  3CGN A;  5GPR A;  3EIP A;  4ODO A;  3RFW A;  2Y78 A;  2DG3 A;  2ZQU A;  4LAV A;  3I6C A;  4NZC A;  2M1I A;  3ARU A;  4ITZ A;  2ZR6 A;  5HWC A;  1WNO A;  3KCE A;  3WD2 A;  4ZPW R;  2KE0 A;  3AS1 A;  3KAF A;  3UI4 A;  2DSV A;  3FY1 A;  3B8S A;  2K8I A;  2XP6 A;  2MF9 A;  2A3A A;  4WK9 A;  3CZ8 A;  1EQ3 A;  5HTG A;  2DSW A;  4DWS A;  1FFQ A;  4MPK A;  4Q7N A;  4Z2H A;  1HKI A;  1ZBC A;  1HJV A;  3IHZ A;  3GU0 A;  2N87 A;  4NSB A;  2VCD A;  3GPK A;  4DH0 A;  4ODP A;  4O2T A;  5HT1 A;  1E9L A;  5HW8 A;  4AY1 A;  4JFJ A;  1JCH B;  2EUL A;  4W5U A;  1NMV A;  2PBC A;  2PN0 A;  2B5U B;  1E6Z A;  2O9O A;  4DRK A;  1KFW A;  1TCO C;  2ETN A;  1XRV A;  1ZK6 A;  4G50 A;  4QIB A;  2RUD A;  1YAT A;  4JYS A;  1Q6U A;  5JH8 A;  5DF0 A;  3O5L A;  1W9U A;  2DT1 A;  3ALG A;  3O5M A;  2KR7 A;  3O5E A;  3G6M A;  5I98 A;  1O6I A;  1FKF A;  4WIW A;  4MNJ A;  1UR8 A;  4GGQ A;  4ODM A;  4ZPT R;  2WM0 A;  2F2D A;  4N19 A;  4PTM A;  3NTP A;  3AS2 A;  3CHE A;  4WKF A;  4DRJ A;  2PV1 A;  3B9D A;  2ZQT A;  3ARX A;  5HUA A;  2DT2 A;  3WL0 A;  2QF8 A;  1JNS A;  4U86 A;  3B9A A;  3CGM A;  4Q22 A;  1PBK A;  5HWB A;  1H0G A;  4ML4 A;  1ZBV A;  2FDM A;  4MSP A;  4TYO A;  3WH0 A;  2MPH A;  1NWR A;  3RGC A;  4S3J A;  2MLX A;  3ARR A;  1ITX A;  1NWU A;  2PPN A;  2DSU A;  4ODR A;  1KT0 A;  1NWT A;  1ZB5 A;  2JZV A;  2XP8 A;  4DRQ A;  4Z2I A;  1QPL A;  2DPE A;  1FAP A;  3CHF A;  3KAH A;  1W1P A;  4TW8 A;  4ODN A;  5GQB A;  3IKD A;  3LUO A;  1FKR A;  2Q5A A;  3WD4 A;  2WLY A;  3WQW A;  4NNR A;  2F21 A;  2ZQV A;  2M2A A;  3UI5 A;  1OWQ A;  2ESC A;  5DIT A;  1T11 A;  2PV2 A;  3RM9 A;  2XP7 A;  3NI6 A;  1W1T A;  1F8A B;  4LAW A;  1LL7 A;  1J6Y A;  1W1V A;  2WK2 A;  1FKT A;  3BMB A;  3O5R A;  4DT4 A;  2LJ4 A;  2LPV A;  4XAK A;  4IQC A;  1D2K A;  3WD0 A;  4L3N A;  1E6R A;  5J6E A;  1D7J A;  2PPP A;  3BXW A;  5HW6 A;  2DT3 A;  3W4R A;  3ART A;  2DG4 A;  1ZBK A;  3WQV A;  4TW6 A;  1UR9 A;  1SR0 A;  3O5Q A;  4MNK A;  3MDY B;  4ODL A;  5HBF A;  1QZ2 A;  2RUQ A;  1GOI A;  2PI6 A;  4DRH A;  4LAX A;  1EHN A;  2LGO A;  1E6N A;  1JNE A;  3IKG A;  2WLZ A;  3PRB A;  1EIB A;  3TCZ A;  1LJY A;  4DZ3 A;  1FKG A;  2DT0 A;  2RSE A;  1J4I A;  4Z2K A;  3ARZ A;  1W9V A;  5HKG A;  2RQS A;  1RD6 A;  3AS0 A;  4P8W A;  3B7X A;  2RUC A;  4S3K A;  4DWS B;  4MTV A;  1SYT A;  1EYM A;  4MGV A;  4DWS C;  1W9P A;  4U85 A;  1VF8 A;  4FAP A;  1ROT A;  4JFM A;  3KAG A;  3O5J A;  3TC5 A;  2PV3 A;  1FKL A;  3IK8 A;  4U84 A;  1LL4 A;  3PRA A;  4L72 B;  4HBO A;  2RUR A;  1GPF A;  4MNL A;  3PRD A;  4QT3 A;  4WKH A;  5DIU A;  1W1Y A;  2FAP A;  3KAB A;  1B6C A;  3UQA A;  1M5Y A;  1D7H A;  1FKD A;  1XHG A;  3KAI A;  1Q6H A;  3ARW A;  4MAV A;  1FKS A;  2PPO A;  2O92 A;  3O5D A;  4IT4 A;  3O5F A;  4TX0 A;  4LGX A;  4URI A;  4WKA A;  2LKN A;  5HW7 A;  1LQ0 A;  1D6O A;  3JXV A;  2ZR5 A;  3AS3 A;  4QT2 A;  4KR0 B;  1N1A A;  4DZ2 A;  2VN1 A;  4W9O A;  3FXY A;  3UI6 A;  2XPB A;  3ARO A;  4DRM A;  3VAW A;  1BKF A;  2XP4 A;  1JND A;  2KGJ A;  4Z2J A;  1QPF A;  3QOK A;  1K9T A;  1FKI A;  1LG2 A;  2A3B A;  3JYJ A;  3RM4 A;  5B8I C;  3JYM A;  1Q1C A;  2G41 A;  3G6L A;  2L2S A;  1GRJ A;  3ODK A;  2XP3 A;  1HJX A;  1C9H A;  4ODK A;  3PA7 A;  5GPG A;  4KQZ A;  4DRP A;  3ARQ A;  4R5E A;  3WIJ A;  3O5O A;  4HAR A;  1JNT A;  2OLH A;  3KAD A;  2AOS A;  2DG9 A;  3UF8 A;  3PR9 A;  4DRO A;  1EDQ A;  3KZ7 A;  1P5Q A;  4ODQ A;  3EY6 A;  4ZPV R;  4C02 B;  4ZS6 A;  4IQ2 A;  3CHC A;  5DIV A;  4P8X A;  3O5I A;  1Y0O A;  1NWS A;  3OOB A;  1GUV A;  2IF4 A;  4TNS A;  1FKB A;  3GTY X;  1Q6I A;  2F23 A;  4DRN A;  1ROU A;  2KI3 A;  2G8Z A;  1YW5 A;  4Z2G A;  4WJX A;  1E44 A;  4MNM A;  1HKM A;  2XP9 A;  3ARS A;  5D75 A;  2FKE A;  3H9R B; 
#chains in the Genus database with same CATH homology
 2A3C A;  2UZ5 A;  2YBU A;  1W26 A;  4IPX A;  1HJW A;  4DWS D;  4W9Q A;  1FD9 A;  3WL1 A;  3ALF A;  1HXV A;  1FKH A;  1WB0 A;  4LAY A;  3RM8 A;  4GIV A;  1FKK A;  1HKJ A;  1L1P A;  4W9P A;  2OFN A;  2DSZ A;  3WKZ A;  2AWG A;  2KFW A;  4IT6 A;  4BF8 A;  4HBE A;  1F40 A;  4J4O A;  4JFL A;  1PIN A;  3ARV A;  3FAP A;  1ZCN A;  2ITK A;  3OA5 A;  2B31 A;  1NH6 A;  2ZR4 A;  4R0X A;  1ZBW A;  1FJD A;  2KO7 A;  1IX5 A;  3AQU A;  5BXJ A;  1J4R A;  3CH9 A;  1H0I A;  2MNT A;  4J4N A;  1JVW A;  4DIP A;  1A7X A;  4FN2 A;  2XP5 A;  1NSG A;  1KT1 A;  1FFR A;  3WD3 A;  3O5K A;  1FKJ A;  3O5P A;  3CHD A;  4JFI A;  1X6L A;  3ARY A;  1HKK A;  1TFV A;  3ARP A;  1WAW A;  2ZQS A;  3O5G A;  1OGG A;  4Z2L A;  1BL4 A;  1NMW A;  4QZV B;  2MLY A;  4JFK A;  2YBT A;  4P8V A;  2MLZ A;  1LG1 A;  5DO2 A;  1J4H A;  1ZL1 A;  3RME A;  4G2P A;  3NRK A;  3B9E A;  2M08 A;  1U79 A;  1E15 A;  2F4E A;  1ZU8 A;  4DRI A;  1LL6 A;  1CTN A;  3UQI A;  4TW7 A;  2D9F A;  2A3E A;  3KAC A;  3TDB A;  1E6P A;  2XPA A;  1OGB A;  3UQB A;  4P8U A;  1D7I A;  1R9H A;  3WD1 A;  2IUZ A;  1X6N A;  5DEZ A;  3CGN A;  5GPR A;  4ODO A;  3RFW A;  2Y78 A;  2DG3 A;  2ZQU A;  4LAV A;  3I6C A;  4NZC A;  2M1I A;  3ARU A;  4ITZ A;  2ZR6 A;  5HWC A;  1WNO A;  3KCE A;  3WD2 A;  4ZPW R;  2KE0 A;  3AS1 A;  3KAF A;  3UI4 A;  2DSV A;  3FY1 A;  3B8S A;  2K8I A;  2XP6 A;  2MF9 A;  2A3A A;  4WK9 A;  3CZ8 A;  1EQ3 A;  5HTG A;  2DSW A;  4DWS A;  1FFQ A;  4MPK A;  4Q7N A;  4Z2H A;  1HKI A;  1ZBC A;  1HJV A;  3IHZ A;  4NSB A;  2N87 A;  2VCD A;  3GPK A;  4DH0 A;  4ODP A;  4O2T A;  5HT1 A;  1E9L A;  5HW8 A;  4AY1 A;  4JFJ A;  4W5U A;  1NMV A;  2PBC A;  1E6Z A;  2O9O A;  4DRK A;  1KFW A;  1TCO C;  1XRV A;  1ZK6 A;  4G50 A;  4QIB A;  2RUD A;  1YAT A;  4JYS A;  1Q6U A;  5JH8 A;  5DF0 A;  3O5L A;  1W9U A;  2DT1 A;  3ALG A;  3O5M A;  2KR7 A;  3O5E A;  3G6M A;  5I98 A;  1O6I A;  1FKF A;  4WIW A;  4MNJ A;  1UR8 A;  4GGQ A;  4ODM A;  4ZPT R;  2WM0 A;  2F2D A;  4N19 A;  4PTM A;  3NTP A;  3AS2 A;  3CHE A;  4WKF A;  4DRJ A;  2PV1 A;  3B9D A;  2ZQT A;  3ARX A;  5HUA A;  2DT2 A;  3WL0 A;  2QF8 A;  1JNS A;  4U86 A;  3B9A A;  3CGM A;  4Q22 A;  1PBK A;  5HWB A;  1H0G A;  4ML4 A;  1ZBV A;  2FDM A;  4MSP A;  4TYO A;  3WH0 A;  2MPH A;  1NWR A;  3RGC A;  4S3J A;  2MLX A;  3ARR A;  1ITX A;  1NWU A;  2PPN A;  2DSU A;  4ODR A;  1KT0 A;  1NWT A;  1ZB5 A;  2JZV A;  2XP8 A;  4DRQ A;  4Z2I A;  1QPL A;  2DPE A;  1FAP A;  3CHF A;  3KAH A;  1W1P A;  4TW8 A;  4ODN A;  5GQB A;  3IKD A;  3LUO A;  1FKR A;  2Q5A A;  3WD4 A;  2WLY A;  3WQW A;  4NNR A;  2F21 A;  2ZQV A;  2M2A A;  3UI5 A;  1OWQ A;  2ESC A;  5DIT A;  1T11 A;  2PV2 A;  3RM9 A;  2XP7 A;  3NI6 A;  1W1T A;  1F8A B;  4LAW A;  1LL7 A;  1J6Y A;  1W1V A;  2WK2 A;  1FKT A;  3O5R A;  4DT4 A;  2LJ4 A;  2LPV A;  4XAK A;  4IQC A;  1D2K A;  3WD0 A;  4L3N A;  1E6R A;  5J6E A;  1D7J A;  2PPP A;  3BXW A;  5HW6 A;  2DT3 A;  3W4R A;  3ART A;  2DG4 A;  1ZBK A;  3WQV A;  4TW6 A;  1UR9 A;  1SR0 A;  3O5Q A;  4MNK A;  3MDY B;  4ODL A;  5HBF A;  1QZ2 A;  2RUQ A;  1GOI A;  2PI6 A;  4DRH A;  4LAX A;  1EHN A;  2LGO A;  1E6N A;  1JNE A;  3IKG A;  2WLZ A;  3PRB A;  1EIB A;  3TCZ A;  1LJY A;  4DZ3 A;  1FKG A;  2DT0 A;  2RSE A;  1J4I A;  4Z2K A;  3ARZ A;  1W9V A;  5HKG A;  2RQS A;  1RD6 A;  3AS0 A;  4P8W A;  3B7X A;  2RUC A;  4S3K A;  4DWS B;  4MTV A;  1SYT A;  1EYM A;  4MGV A;  4DWS C;  1W9P A;  4U85 A;  1VF8 A;  4FAP A;  1ROT A;  4JFM A;  3KAG A;  3O5J A;  3TC5 A;  2PV3 A;  1FKL A;  3IK8 A;  4U84 A;  1LL4 A;  3PRA A;  4L72 B;  4HBO A;  2RUR A;  1GPF A;  4MNL A;  3PRD A;  4QT3 A;  4WKH A;  5DIU A;  1W1Y A;  2FAP A;  3KAB A;  1B6C A;  3UQA A;  1M5Y A;  1D7H A;  1FKD A;  1XHG A;  3KAI A;  1Q6H A;  3ARW A;  4MAV A;  1FKS A;  2PPO A;  2O92 A;  3O5D A;  4IT4 A;  3O5F A;  4TX0 A;  4LGX A;  4URI A;  4WKA A;  2LKN A;  5HW7 A;  1LQ0 A;  1D6O A;  3JXV A;  2ZR5 A;  3AS3 A;  4QT2 A;  4KR0 B;  1N1A A;  4DZ2 A;  2VN1 A;  4W9O A;  3FXY A;  3UI6 A;  2XPB A;  3ARO A;  4DRM A;  3VAW A;  1BKF A;  2XP4 A;  1JND A;  2KGJ A;  4Z2J A;  1QPF A;  3QOK A;  1K9T A;  1FKI A;  1LG2 A;  2A3B A;  3JYJ A;  3RM4 A;  5B8I C;  3JYM A;  1Q1C A;  2G41 A;  3G6L A;  2L2S A;  3ODK A;  2XP3 A;  1HJX A;  1C9H A;  4ODK A;  3PA7 A;  5GPG A;  4KQZ A;  4DRP A;  3ARQ A;  4R5E A;  3WIJ A;  3O5O A;  4HAR A;  1JNT A;  2OLH A;  3KAD A;  2AOS A;  2DG9 A;  3UF8 A;  3PR9 A;  4DRO A;  1EDQ A;  3KZ7 A;  1P5Q A;  4ODQ A;  3EY6 A;  4ZPV R;  4C02 B;  4ZS6 A;  4IQ2 A;  3CHC A;  5DIV A;  4P8X A;  3O5I A;  1Y0O A;  1NWS A;  3OOB A;  1GUV A;  2IF4 A;  4TNS A;  1FKB A;  1Q6I A;  4DRN A;  1ROU A;  2KI3 A;  2G8Z A;  1YW5 A;  4Z2G A;  4WJX A;  4MNM A;  1HKM A;  2XP9 A;  3ARS A;  5D75 A;  2FKE A;  3H9R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...