3MDYB

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1B
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
source organism Homo sapiens
molecule tags Transferase/isomerase
total genus 27
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3mdyB00
1FKSA 1ZCNA 4O2TA 4ODRA 4TW8A 2XP8A 3KAIA 4TNSA 5DIVA 1NMVA 4LAVA 3KADA 4GGQA 4JFMA 4ODOA 1FKDA 1FAPA 4N19A 3NI6A 2MF9A 2LKNA 4U86A 3UI5A 2MLYA 2RUCA 4DRQA 3IK8A 3NTPA 1ROTA 2M08A 3O5OA 1QZ2A 4JYSA 3I6CA 2ZQUA 2PV2A 4DH0A 2VN1A 1FD9A 4QIBA 4U85A 3JXVA 3TCZA 2F4EA 1J6YA 3KZ7A 3NRKA 1FKFA 2ZQSA 1HXVA 3O5MA 1FKHA 4GIVA 4TX0A 3O5PA 4BF8A 3UQAA 2ZR6A 1FKIA 3RFWA 1Q1CA 1NMWA 2LGOA 3OOBA 4LAWA 5HWBA 2KO7A 1TCOC 1F8AB 4JFLA 5HT1A 3LUOA 2XP3A 1Q6HA 2KGJA 4QT3A 3UF8A 1FKBA 4W9PA 1B6CA 1BL4A 4J4OA 4MGVA 3TDBA 2K8IA 2XP4A 3UI4A 4DRPA 1D6OA 3PRDA 4MSPA 4DRJA 2XP9A 1J4IA 3FAPA 2DG3A 1D7JA 4NNRA 5HW6A 5GPGA 4G2PA 1FJDA 3IKGA 5J6EA 1ZK6A 3KABA 3O5LA 4JFKA 3O5IA 4U84A 4W9QA 4ODMA 1Q6IA 3H9RB 4DZ3A 5HTGA 3UQBA 2M1IA 2ZR5A 3O5JA 2L2SA 5B8IC 5HW7A 1M5YA 4ODLA 3B7XA 1JNSA 1YATA 2AWGA 4ODQA 3PA7A 1KT0A 1D7HA 3KAHA 2F2DA 3GPKA 2FAPA 4IQ2A 4DRHA 1EQ3A 3O5FA 3JYMA 5DIUA 2KI3A 4DIPA 4JFIA 4JFJA 3KACA 2MLZA 4J4NA 2ZQTA 1W26A 2RURA 3IHZA 4TW7A 2PBCA 4FAPA 2PPNA 3WH0A 1R9HA 1FKJA 2IF4A 4G50A 1F40A 1L1PA 1FKGA 2M2AA 2PV3A 3O5DA 1C9HA 2XP5A 4FN2A 4LAYA 2JZVA 2N87A 3O5EA 4DROA 5HKGA 2DG4A 4DRIA 2D9FA 1Q6UA 3CGNA 1P5QA 2ZR4A 2XP7A 5HWCA 1PINA 1JNTA 3TC5A 1T11A 2KFWA 2Y78A 4LAXA 2FKEA 5HW8A 3JYJA 2KE0A 3KCEA 3PRBA 2XP6A 1N1AA 3UI6A 2MNTA 5BXJA 4IPXA 4ODKA 4C02B 2UZ5A 1QPLA 1FKTA 2XPAA 4DRNA 1ROUA 5DITA 3IKDA 3KAGA 3RGCA 2VCDA 5HUAA 4DRKA 2RUDA 5I98A 4DZ2A 1BKFA 2PPOA 1J4RA 1FKKA 5D75A 4DT4A 3CGMA 1FKRA 4TYOA 3O5QA 1EYMA 4QT2A 3VAWA 2MLXA 4ODNA 1D7IA 2LJ4A 1YW5A 1NSGA 2OFNA 4IQCA 2LPVA 3O5KA 2Q5AA 4ODPA 3O5RA 1J4HA 2MPHA 2F21A 1A7XA 3O5GA 2KR7A 2ZQVA 1JVWA 1FKLA 1Y0OA 2PV1A 2ITKA 3EY6A 3MDYB 1KT1A 2RUQA 4W9OA 4DRMA 2PPPA 4R0XA 3ODKA 2RSEA 4TW6A 1QPFA 3UQIA 2DG9A 3KAFA 4ITZA 2XPBA 2RQSA 1U79A 1PBKA
chains in the Genus database with same CATH superfamily
4O2TA 4Z2HA 1NMVA 4LAVA 1KFWA 4GGQA 5JH8A 1W9PA 1HJVA 2LKNA 3WQWA 1OGGA 1QZ2A 3RM4A 3I6CA 1X6LA 2ZQUA 2VN1A 4QIBA 4U85A 3TCZA 1W9UA 4HBOA 2FDMA 1NWUA 3O5PA 4MNLA 5HWBA 4LAWA 4MAVA 3LUOA 1O6IA 1Q6HA 2F23A 4QT3A 4MPKA 1B6CA 4DRPA 2K8IA 2XP4A 3B9AA 1VF8A 1J4IA 2A3CA 1W9VA 4NNRA 4G2PA 5J6EA 3CHFA 2DSVA 4P8VA 4WJXA 4ODMA 2EULA 2WK2A 3O5JA 1M5YA 4LGXA 2AWGA 1W1YA 3GPKA 1W1PA 3JYMA 3AS3A 4P8UA 1W26A 3IHZA 4FAPA 1W1TA 2A3BA 2IF4A 3FXYA 2IUZA 1FKGA 2M2AA 4WK9A 1C9HA 1WB0A 1HKIA 4LAYA 3O5EA 4DROA 3ARWA 5HKGA 2DG4A 2XP7A 2DT2A 2KFWA 2Y78A 4ZPTR 2FKEA 3KCEA 2KE0A 5DEZA 3B8SA 1N1AA 4C02B 1NWRA 1FKTA 2XPAA 5DITA 3IKDA 2VCDA 5HUAA 5GPRA 3CGMA 4WIWA 1EYMA 1D7IA 2LJ4A 1NSGA 1H0GA 1OWQA 3WD2A 1EDQA 4ODPA 1E15A 3O5GA 4WKAA 1LL7A 3EY6A 1JVWA 1Y0OA 1H0IA 3ODKA 4ITZA 1FKSA 4TW8A 3KAIA 4TNSA 5DIVA 4ODOA 1FKDA 1FAPA 3UI5A 2MF9A 2RUCA 4KQZA 1GUVA 4Z2JA 1IX5A 3O5OA 4DH0A 4Z2KA 3JXVA 1HXVA 1FKHA 3WL0A 4BF8A 1Q1CA 3AQUA 4WKFA 1LL6A 2G41A 2YBUA 3G6LA 3CHDA 1JNDA 4DRJA 2XP9A 3FAPA 2DT1A 1LG2A 5GPGA 1FJDA 4HBEA 1ZK6A 3KABA 1XHGA 3O5IA 3GTYX 1ZBVA 4W9QA 3WIJA 2ZR5A 5B8IC 4NSBA 1KT0A 1HKJA 1X6NA 2F2DA 1GOIA 2DT3A 4JFIA 3ARRA 4DIPA 1HJXA 2ZQTA 4L72B 3WH0A 1R9HA 1FKJA 1L1PA 3O5DA 1GPFA 2ETNA 3AS2A 2JZVA 4KR0B 2D9FA 4P8WA 4S3JA 1ZBCA 2P4VA 1PINA 1JNTA 4LAXA 5HW8A 1FFQA 1LL4A 3JYJA 3PRBA 5BXJA 4IPXA 1QPLA 3ARYA 4DRNA 1ROUA 2DT0A 5I98A 1BKFA 4HARA 1FKKA 1ZB5A 3EIPA 1LQ0A 3RMEA 1ZL1A 1YW5A 2OFNA 4IQCA 2LPVA 1J4HA 2WM0A 1OGBA 2F21A 2KR7A 3B9DA 2AOSA 2ZQVA 1HKMA 5HWCA 1KT1A 2RUQA 4DRMA 4R0XA 1W1VA 3UQIA 4TW6A 3KAFA 1PBKA 3O5MA 1ZCNA 4Q7NA 2XP8A 1UR8A 3KADA 4JFMA 3G6MA 3NI6A 3CH9A 1JNEA 4Z2GA 3ARXA 3IK8A 1RD6A 3NTPA 2G8ZA 2M08A 2O9OA 4JYSA 2A3EA 1E44A 1FD9A 2F4EA 4MNMA 1J6YA 4GIVA 4TX0A 1SR0A 1SYTA 3UQAA 2LGOA 3WD4A 3ARTA 5HT1A 2XP3A 4ZPVR 3UF8A 1HKKA 3ARVA 4J4OA 1BL4A 4MGVA 3UI4A 1UR9A 3CZ8A 1D2KA 1D6OA 1WNOA 4MSPA 2WLYA 1D7JA 1ZBKA 4S3KA 3IKGA 4DWSC 4JFKA 1Q6IA 3H9RB 4DWSD 2M1IA 3FY1A 5HW7A 1LG1A 4ODLA 3B7XA 3WL1A 4Q22A 1YATA 4ODQA 3KAHA 4URIA 1E6PA 5DO2A 4IQ2A 1FFRA 4DRHA 1EQ3A 4MNKA 3ARZA 4JFJA 2MLZA 4IT4A 3QOKA 2PBCA 2PPNA 3ARQA 4G50A 2PV3A 2B5UB 1LJYA 2PN0A 3OA5A 1JCHB 1Q6UA 1P5QA 1NH6A 4UDMA 3TC5A 1WAWA 2MNTA 4ODKA 2UZ5A 3KAGA 1E6NA 1EHNA 2RUDA 2DSWA 2PPOA 1FKRA 4TYOA 3O5QA 4QT2A 4ODNA 3O5KA 2A3AA 3ARPA 2Q5AA 3O5RA 2DSZA 2MPHA 3AROA 5GQBA 1FKLA 2OLHA 3AS1A 2ITKA 3WQVA 4DWSB 3CHEA 5HBFA 2XPBA 3RGCA 2RQSA 4R5EA 4ODRA 1E6RA 2PI6A 4N19A 4U86A 3WD1A 2MLYA 4DRQA 3ALGA 4Z2LA 1ROTA 1XRVA 1TFVA 2PV2A 1E9LA 4QZVB 3WD3A 3KZ7A 3NRKA 1FKFA 2ZQSA 2QF8A 2ZR6A 1FKIA 3AS0A 3RFWA 1NMWA 3OOBA 2ESCA 2KO7A 1TCOC 1F8AB 4JFLA 3BXWA 2KGJA 3CHCA 1FKBA 4W9PA 3TDBA 4MNJA 3PRDA 2DG3A 2YBTA 3ARSA 5HW6A 3O5LA 3PRAA 4U84A 3RM8A 4XAKA 4NZCA 4DZ3A 5HTGA 3UQBA 5DF0A 2L2SA 4AY1A 1JNSA 1NWSA 1ITXA 3PA7A 1D7HA 1EIBA 1ZU8A 3BMBA 2FAPA 2O92A 3O5FA 5DIUA 1HJWA 2WLZA 2KI3A 3KACA 4J4NA 3GU0A 2RURA 4TW7A 3WKZA 1F40A 4ZS6A 3WD0A 2XP5A 4Z2IA 3ARUA 4FN2A 4L3NA 2N87A 4P8XA 4DRIA 3CGNA 2ZR4A 3PR9A 4IT6A 4ML4A 4WKHA 1T11A 1E6ZA 3W4RA 3UI6A 2XP6A 4DWSA 4ZPWR 4W5UA 4DRKA 4DZ2A 1J4RA 5D75A 4DT4A 2B31A 1GRJA 3VAWA 2MLXA 3ALFA 3B9EA 3RM9A 4MTVA 1A7XA 1CTNA 2PV1A 3MDYB 4W9OA 2DPEA 4PTMA 2PPPA 1K9TA 2RSEA 1NWTA 1QPFA 1ZBWA 2DG9A 2DSUA 1U79A
chains in the Genus database with same CATH topology
4O2TA 4Z2HA 1NMVA 4LAVA 1KFWA 4GGQA 5JH8A 1W9PA 1HJVA 2LKNA 3WQWA 1OGGA 1QZ2A 3RM4A 3I6CA 1X6LA 2ZQUA 2VN1A 4QIBA 4U85A 3TCZA 1W9UA 4HBOA 2FDMA 1NWUA 3O5PA 4MNLA 5HWBA 4LAWA 4MAVA 3LUOA 1O6IA 1Q6HA 4QT3A 4MPKA 1B6CA 4DRPA 2K8IA 2XP4A 3B9AA 1VF8A 1J4IA 2A3CA 1W9VA 4NNRA 4G2PA 5J6EA 3CHFA 2DSVA 4P8VA 4WJXA 4ODMA 2WK2A 3O5JA 1M5YA 4LGXA 2AWGA 1W1YA 3GPKA 1W1PA 3JYMA 3AS3A 4P8UA 1W26A 3IHZA 4FAPA 1W1TA 2A3BA 2IF4A 3FXYA 2IUZA 1FKGA 2M2AA 4WK9A 1C9HA 1WB0A 1HKIA 4LAYA 3O5EA 4DROA 3ARWA 5HKGA 2DG4A 2XP7A 2DT2A 2KFWA 2Y78A 4ZPTR 2FKEA 3KCEA 2KE0A 5DEZA 3B8SA 1N1AA 4C02B 1NWRA 1FKTA 2XPAA 5DITA 3IKDA 2VCDA 5HUAA 5GPRA 3CGMA 4WIWA 1EYMA 1D7IA 2LJ4A 1NSGA 1H0GA 1OWQA 3WD2A 1EDQA 4ODPA 1E15A 3O5GA 4WKAA 1LL7A 3EY6A 1JVWA 1Y0OA 1H0IA 3ODKA 4ITZA 1FKSA 4TW8A 3KAIA 4TNSA 5DIVA 4ODOA 1FKDA 1FAPA 3UI5A 2MF9A 2RUCA 4KQZA 1GUVA 4Z2JA 1IX5A 3O5OA 4DH0A 4Z2KA 3JXVA 1HXVA 1FKHA 3WL0A 4BF8A 1Q1CA 3AQUA 4WKFA 1LL6A 2G41A 2YBUA 3G6LA 3CHDA 1JNDA 4DRJA 2XP9A 3FAPA 2DT1A 1LG2A 5GPGA 1FJDA 4HBEA 1ZK6A 3KABA 1XHGA 3O5IA 1ZBVA 4W9QA 3WIJA 2ZR5A 5B8IC 4NSBA 1KT0A 1HKJA 1X6NA 2F2DA 1GOIA 2DT3A 4JFIA 3ARRA 4DIPA 1HJXA 2ZQTA 4L72B 3WH0A 1R9HA 1FKJA 1L1PA 3O5DA 1GPFA 3AS2A 2JZVA 4KR0B 2D9FA 4P8WA 4S3JA 1ZBCA 1PINA 1JNTA 4LAXA 5HW8A 1FFQA 1LL4A 3JYJA 3PRBA 5BXJA 4IPXA 1QPLA 3ARYA 4DRNA 1ROUA 2DT0A 5I98A 1BKFA 4HARA 1FKKA 1ZB5A 1LQ0A 3RMEA 1ZL1A 1YW5A 2OFNA 4IQCA 2LPVA 1J4HA 2WM0A 1OGBA 2F21A 2KR7A 3B9DA 2AOSA 2ZQVA 1HKMA 5HWCA 1KT1A 2RUQA 4DRMA 4R0XA 1W1VA 3UQIA 4TW6A 3KAFA 3O5MA 1PBKA 1ZCNA 4Q7NA 2XP8A 1UR8A 3KADA 4JFMA 3G6MA 3NI6A 3CH9A 1JNEA 4Z2GA 3ARXA 3IK8A 1RD6A 3NTPA 2G8ZA 2M08A 2O9OA 4JYSA 2A3EA 1FD9A 2F4EA 4MNMA 1J6YA 4GIVA 4TX0A 1SR0A 1SYTA 3UQAA 2LGOA 3WD4A 3ARTA 5HT1A 2XP3A 4ZPVR 3UF8A 1HKKA 3ARVA 4J4OA 1BL4A 4MGVA 3UI4A 1UR9A 3CZ8A 1D2KA 1D6OA 1WNOA 4MSPA 2WLYA 1D7JA 1ZBKA 4S3KA 3IKGA 4DWSC 4JFKA 1Q6IA 3H9RB 4DWSD 2M1IA 3FY1A 5HW7A 1LG1A 4ODLA 3B7XA 3WL1A 4Q22A 1YATA 4ODQA 3KAHA 4URIA 1E6PA 5DO2A 4IQ2A 1FFRA 4DRHA 1EQ3A 4MNKA 3ARZA 4JFJA 2MLZA 4IT4A 3QOKA 2PBCA 2PPNA 3ARQA 4G50A 2PV3A 1LJYA 3OA5A 1Q6UA 1P5QA 1NH6A 3TC5A 1WAWA 2MNTA 4ODKA 2UZ5A 3KAGA 1E6NA 1EHNA 2RUDA 2DSWA 2PPOA 1FKRA 4TYOA 3O5QA 4QT2A 4ODNA 3O5KA 2A3AA 3ARPA 2Q5AA 3O5RA 2DSZA 2MPHA 3AROA 5GQBA 1FKLA 2OLHA 3AS1A 2ITKA 3WQVA 4DWSB 3CHEA 5HBFA 2XPBA 3RGCA 2RQSA 4R5EA 4ODRA 1E6RA 2PI6A 4N19A 4U86A 3WD1A 2MLYA 4DRQA 3ALGA 4Z2LA 1ROTA 1XRVA 1TFVA 2PV2A 1E9LA 4QZVB 3WD3A 3KZ7A 3NRKA 1FKFA 2ZQSA 2QF8A 2ZR6A 1FKIA 3AS0A 3RFWA 1NMWA 3OOBA 2ESCA 2KO7A 1TCOC 1F8AB 4JFLA 3BXWA 2KGJA 3CHCA 1FKBA 4W9PA 3TDBA 4MNJA 3PRDA 2DG3A 2YBTA 3ARSA 5HW6A 3O5LA 3PRAA 4U84A 3RM8A 4XAKA 4NZCA 4DZ3A 5HTGA 3UQBA 5DF0A 2L2SA 4AY1A 1JNSA 1NWSA 1ITXA 3PA7A 1D7HA 1EIBA 1ZU8A 2FAPA 2O92A 3O5FA 5DIUA 1HJWA 2WLZA 2KI3A 3KACA 4J4NA 2RURA 4TW7A 3WKZA 1F40A 4ZS6A 3WD0A 2XP5A 4Z2IA 3ARUA 4FN2A 4L3NA 2N87A 4P8XA 4DRIA 3CGNA 2ZR4A 3PR9A 4IT6A 4ML4A 4WKHA 1T11A 1E6ZA 3W4RA 3UI6A 2XP6A 4DWSA 4ZPWR 4W5UA 4DRKA 4DZ2A 1J4RA 5D75A 4DT4A 2B31A 3VAWA 2MLXA 3ALFA 3B9EA 3RM9A 4MTVA 1A7XA 1CTNA 2PV1A 3MDYB 4W9OA 2DPEA 4PTMA 2PPPA 1K9TA 2RSEA 1NWTA 1QPFA 1ZBWA 2DG9A 2DSUA 1U79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKS A;  1ZCN A;  4O2T A;  4ODR A;  4TW8 A;  2XP8 A;  3KAI A;  4TNS A;  5DIV A;  1NMV A;  4LAV A;  3KAD A;  4GGQ A;  4JFM A;  4ODO A;  1FKD A;  1FAP A;  4N19 A;  3NI6 A;  2MF9 A;  2LKN A;  4U86 A;  3UI5 A;  2MLY A;  2RUC A;  4DRQ A;  3IK8 A;  3NTP A;  1ROT A;  2M08 A;  3O5O A;  1QZ2 A;  4JYS A;  3I6C A;  2ZQU A;  2PV2 A;  4DH0 A;  2VN1 A;  1FD9 A;  4QIB A;  4U85 A;  3JXV A;  3TCZ A;  2F4E A;  1J6Y A;  3KZ7 A;  3NRK A;  1FKF A;  2ZQS A;  1HXV A;  3O5M A;  1FKH A;  4GIV A;  4TX0 A;  3O5P A;  4BF8 A;  3UQA A;  2ZR6 A;  1FKI A;  3RFW A;  1Q1C A;  1NMW A;  2LGO A;  3OOB A;  4LAW A;  5HWB A;  2KO7 A;  1TCO C;  1F8A B;  4JFL A;  5HT1 A;  3LUO A;  2XP3 A;  1Q6H A;  2KGJ A;  4QT3 A;  3UF8 A;  1FKB A;  4W9P A;  1B6C A;  1BL4 A;  4J4O A;  4MGV A;  3TDB A;  2K8I A;  2XP4 A;  3UI4 A;  4DRP A;  1D6O A;  3PRD A;  4MSP A;  4DRJ A;  2XP9 A;  1J4I A;  3FAP A;  2DG3 A;  1D7J A;  4NNR A;  5HW6 A;  5GPG A;  4G2P A;  1FJD A;  3IKG A;  5J6E A;  1ZK6 A;  3KAB A;  3O5L A;  4JFK A;  3O5I A;  4U84 A;  4W9Q A;  4ODM A;  1Q6I A;  3H9R B;  4DZ3 A;  5HTG A;  3UQB A;  2M1I A;  2ZR5 A;  3O5J A;  2L2S A;  5B8I C;  5HW7 A;  1M5Y A;  4ODL A;  3B7X A;  1JNS A;  1YAT A;  2AWG A;  4ODQ A;  3PA7 A;  1KT0 A;  1D7H A;  3KAH A;  2F2D A;  3GPK A;  2FAP A;  4IQ2 A;  4DRH A;  1EQ3 A;  3O5F A;  3JYM A;  5DIU A;  2KI3 A;  4DIP A;  4JFI A;  4JFJ A;  3KAC A;  2MLZ A;  4J4N A;  2ZQT A;  1W26 A;  2RUR A;  3IHZ A;  4TW7 A;  2PBC A;  4FAP A;  2PPN A;  3WH0 A;  1R9H A;  1FKJ A;  2IF4 A;  4G50 A;  1F40 A;  1L1P A;  1FKG A;  2M2A A;  2PV3 A;  3O5D A;  1C9H A;  2XP5 A;  4FN2 A;  4LAY A;  2JZV A;  2N87 A;  3O5E A;  4DRO A;  5HKG A;  2DG4 A;  4DRI A;  2D9F A;  1Q6U A;  3CGN A;  1P5Q A;  2ZR4 A;  2XP7 A;  5HWC A;  1PIN A;  1JNT A;  3TC5 A;  1T11 A;  2KFW A;  2Y78 A;  4LAX A;  2FKE A;  5HW8 A;  3JYJ A;  2KE0 A;  3KCE A;  3PRB A;  2XP6 A;  1N1A A;  3UI6 A;  2MNT A;  5BXJ A;  4IPX A;  4ODK A;  4C02 B;  2UZ5 A;  1QPL A;  1FKT A;  2XPA A;  4DRN A;  1ROU A;  5DIT A;  3IKD A;  3KAG A;  3RGC A;  2VCD A;  5HUA A;  4DRK A;  2RUD A;  5I98 A;  4DZ2 A;  1BKF A;  2PPO A;  1J4R A;  1FKK A;  5D75 A;  4DT4 A;  3CGM A;  1FKR A;  4TYO A;  3O5Q A;  1EYM A;  4QT2 A;  3VAW A;  2MLX A;  4ODN A;  1D7I A;  2LJ4 A;  1YW5 A;  1NSG A;  2OFN A;  4IQC A;  2LPV A;  3O5K A;  2Q5A A;  4ODP A;  3O5R A;  1J4H A;  2MPH A;  2F21 A;  1A7X A;  3O5G A;  2KR7 A;  2ZQV A;  1JVW A;  1FKL A;  1Y0O A;  2PV1 A;  2ITK A;  3EY6 A;  3MDY B;  1KT1 A;  2RUQ A;  4W9O A;  4DRM A;  2PPP A;  4R0X A;  3ODK A;  2RSE A;  4TW6 A;  1QPF A;  3UQI A;  2DG9 A;  3KAF A;  4ITZ A;  2XPB A;  2RQS A;  1U79 A;  1PBK A; 
#chains in the Genus database with same CATH topology
 4O2T A;  4Z2H A;  1NMV A;  4LAV A;  1KFW A;  4GGQ A;  5JH8 A;  1W9P A;  1HJV A;  2LKN A;  3WQW A;  1OGG A;  1QZ2 A;  3RM4 A;  3I6C A;  1X6L A;  2ZQU A;  2VN1 A;  4QIB A;  4U85 A;  3TCZ A;  1W9U A;  4HBO A;  2FDM A;  1NWU A;  3O5P A;  4MNL A;  5HWB A;  4LAW A;  4MAV A;  3LUO A;  1O6I A;  1Q6H A;  2F23 A;  4QT3 A;  4MPK A;  1B6C A;  4DRP A;  2K8I A;  2XP4 A;  3B9A A;  1VF8 A;  1J4I A;  2A3C A;  1W9V A;  4NNR A;  4G2P A;  5J6E A;  3CHF A;  2DSV A;  4P8V A;  4WJX A;  4ODM A;  2EUL A;  2WK2 A;  3O5J A;  1M5Y A;  4LGX A;  2AWG A;  1W1Y A;  3GPK A;  1W1P A;  3JYM A;  3AS3 A;  4P8U A;  1W26 A;  3IHZ A;  4FAP A;  1W1T A;  2A3B A;  2IF4 A;  3FXY A;  2IUZ A;  1FKG A;  2M2A A;  4WK9 A;  1C9H A;  1WB0 A;  1HKI A;  4LAY A;  3O5E A;  4DRO A;  3ARW A;  5HKG A;  2DG4 A;  2XP7 A;  2DT2 A;  2KFW A;  2Y78 A;  4ZPT R;  2FKE A;  3KCE A;  2KE0 A;  5DEZ A;  3B8S A;  1N1A A;  4C02 B;  1NWR A;  1FKT A;  2XPA A;  5DIT A;  3IKD A;  2VCD A;  5HUA A;  5GPR A;  3CGM A;  4WIW A;  1EYM A;  1D7I A;  2LJ4 A;  1NSG A;  1H0G A;  1OWQ A;  3WD2 A;  1EDQ A;  4ODP A;  1E15 A;  3O5G A;  4WKA A;  1LL7 A;  3EY6 A;  1JVW A;  1Y0O A;  1H0I A;  3ODK A;  4ITZ A;  1FKS A;  4TW8 A;  3KAI A;  4TNS A;  5DIV A;  4ODO A;  1FKD A;  1FAP A;  3UI5 A;  2MF9 A;  2RUC A;  4KQZ A;  1GUV A;  4Z2J A;  1IX5 A;  3O5O A;  4DH0 A;  4Z2K A;  3JXV A;  1HXV A;  1FKH A;  3WL0 A;  4BF8 A;  1Q1C A;  3AQU A;  4WKF A;  1LL6 A;  2G41 A;  2YBU A;  3G6L A;  3CHD A;  1JND A;  4DRJ A;  2XP9 A;  3FAP A;  2DT1 A;  1LG2 A;  5GPG A;  1FJD A;  4HBE A;  1ZK6 A;  3KAB A;  1XHG A;  3O5I A;  3GTY X;  1ZBV A;  4W9Q A;  3WIJ A;  2ZR5 A;  5B8I C;  4NSB A;  1KT0 A;  1HKJ A;  1X6N A;  2F2D A;  1GOI A;  2DT3 A;  4JFI A;  3ARR A;  4DIP A;  1HJX A;  2ZQT A;  4L72 B;  3WH0 A;  1R9H A;  1FKJ A;  1L1P A;  3O5D A;  1GPF A;  2ETN A;  3AS2 A;  2JZV A;  4KR0 B;  2D9F A;  4P8W A;  4S3J A;  1ZBC A;  2P4V A;  1PIN A;  1JNT A;  4LAX A;  5HW8 A;  1FFQ A;  1LL4 A;  3JYJ A;  3PRB A;  5BXJ A;  4IPX A;  1QPL A;  3ARY A;  4DRN A;  1ROU A;  2DT0 A;  5I98 A;  1BKF A;  4HAR A;  1FKK A;  1ZB5 A;  3EIP A;  1LQ0 A;  3RME A;  1ZL1 A;  1YW5 A;  2OFN A;  4IQC A;  2LPV A;  1J4H A;  2WM0 A;  1OGB A;  2F21 A;  2KR7 A;  3B9D A;  2AOS A;  2ZQV A;  1HKM A;  5HWC A;  1KT1 A;  2RUQ A;  4DRM A;  4R0X A;  1W1V A;  3UQI A;  4TW6 A;  3KAF A;  1PBK A;  3O5M A;  1ZCN A;  4Q7N A;  2XP8 A;  1UR8 A;  3KAD A;  4JFM A;  3G6M A;  3NI6 A;  3CH9 A;  1JNE A;  4Z2G A;  3ARX A;  3IK8 A;  1RD6 A;  3NTP A;  2G8Z A;  2M08 A;  2O9O A;  4JYS A;  2A3E A;  1E44 A;  1FD9 A;  2F4E A;  4MNM A;  1J6Y A;  4GIV A;  4TX0 A;  1SR0 A;  1SYT A;  3UQA A;  2LGO A;  3WD4 A;  3ART A;  5HT1 A;  2XP3 A;  4ZPV R;  3UF8 A;  1HKK A;  3ARV A;  4J4O A;  1BL4 A;  4MGV A;  3UI4 A;  1UR9 A;  3CZ8 A;  1D2K A;  1D6O A;  1WNO A;  4MSP A;  2WLY A;  1D7J A;  1ZBK A;  4S3K A;  3IKG A;  4DWS C;  4JFK A;  1Q6I A;  3H9R B;  4DWS D;  2M1I A;  3FY1 A;  5HW7 A;  1LG1 A;  4ODL A;  3B7X A;  3WL1 A;  4Q22 A;  1YAT A;  4ODQ A;  3KAH A;  4URI A;  1E6P A;  5DO2 A;  4IQ2 A;  1FFR A;  4DRH A;  1EQ3 A;  4MNK A;  3ARZ A;  4JFJ A;  2MLZ A;  4IT4 A;  3QOK A;  2PBC A;  2PPN A;  3ARQ A;  4G50 A;  2PV3 A;  2B5U B;  1LJY A;  2PN0 A;  3OA5 A;  1JCH B;  1Q6U A;  1P5Q A;  1NH6 A;  4UDM A;  3TC5 A;  1WAW A;  2MNT A;  4ODK A;  2UZ5 A;  3KAG A;  1E6N A;  1EHN A;  2RUD A;  2DSW A;  2PPO A;  1FKR A;  4TYO A;  3O5Q A;  4QT2 A;  4ODN A;  3O5K A;  2A3A A;  3ARP A;  2Q5A A;  3O5R A;  2DSZ A;  2MPH A;  3ARO A;  5GQB A;  1FKL A;  2OLH A;  3AS1 A;  2ITK A;  3WQV A;  4DWS B;  3CHE A;  5HBF A;  2XPB A;  3RGC A;  2RQS A;  4R5E A;  4ODR A;  1E6R A;  2PI6 A;  4N19 A;  4U86 A;  3WD1 A;  2MLY A;  4DRQ A;  3ALG A;  4Z2L A;  1ROT A;  1XRV A;  1TFV A;  2PV2 A;  1E9L A;  4QZV B;  3WD3 A;  3KZ7 A;  3NRK A;  1FKF A;  2ZQS A;  2QF8 A;  2ZR6 A;  1FKI A;  3AS0 A;  3RFW A;  1NMW A;  3OOB A;  2ESC A;  2KO7 A;  1TCO C;  1F8A B;  4JFL A;  3BXW A;  2KGJ A;  3CHC A;  1FKB A;  4W9P A;  3TDB A;  4MNJ A;  3PRD A;  2DG3 A;  2YBT A;  3ARS A;  5HW6 A;  3O5L A;  3PRA A;  4U84 A;  3RM8 A;  4XAK A;  4NZC A;  4DZ3 A;  5HTG A;  3UQB A;  5DF0 A;  2L2S A;  4AY1 A;  1JNS A;  1NWS A;  1ITX A;  3PA7 A;  1D7H A;  1EIB A;  1ZU8 A;  3BMB A;  2FAP A;  2O92 A;  3O5F A;  5DIU A;  1HJW A;  2WLZ A;  2KI3 A;  3KAC A;  4J4N A;  3GU0 A;  2RUR A;  4TW7 A;  3WKZ A;  1F40 A;  4ZS6 A;  3WD0 A;  2XP5 A;  4Z2I A;  3ARU A;  4FN2 A;  4L3N A;  2N87 A;  4P8X A;  4DRI A;  3CGN A;  2ZR4 A;  3PR9 A;  4IT6 A;  4ML4 A;  4WKH A;  1T11 A;  1E6Z A;  3W4R A;  3UI6 A;  2XP6 A;  4DWS A;  4ZPW R;  4W5U A;  4DRK A;  4DZ2 A;  1J4R A;  5D75 A;  4DT4 A;  2B31 A;  1GRJ A;  3VAW A;  2MLX A;  3ALF A;  3B9E A;  3RM9 A;  4MTV A;  1A7X A;  1CTN A;  2PV1 A;  3MDY B;  4W9O A;  2DPE A;  4PTM A;  2PPP A;  1K9T A;  2RSE A;  1NWT A;  1QPF A;  1ZBW A;  2DG9 A;  2DSU A;  1U79 A; 
#chains in the Genus database with same CATH homology
 4O2T A;  4Z2H A;  1NMV A;  4LAV A;  1KFW A;  4GGQ A;  5JH8 A;  1W9P A;  1HJV A;  2LKN A;  3WQW A;  1OGG A;  1QZ2 A;  3RM4 A;  3I6C A;  1X6L A;  2ZQU A;  2VN1 A;  4QIB A;  4U85 A;  3TCZ A;  1W9U A;  4HBO A;  2FDM A;  1NWU A;  3O5P A;  4MNL A;  5HWB A;  4LAW A;  4MAV A;  3LUO A;  1O6I A;  1Q6H A;  4QT3 A;  4MPK A;  1B6C A;  4DRP A;  2K8I A;  2XP4 A;  3B9A A;  1VF8 A;  1J4I A;  2A3C A;  1W9V A;  4NNR A;  4G2P A;  5J6E A;  3CHF A;  2DSV A;  4P8V A;  4WJX A;  4ODM A;  2WK2 A;  3O5J A;  1M5Y A;  4LGX A;  2AWG A;  1W1Y A;  3GPK A;  1W1P A;  3JYM A;  3AS3 A;  4P8U A;  1W26 A;  3IHZ A;  4FAP A;  1W1T A;  2A3B A;  2IF4 A;  3FXY A;  2IUZ A;  1FKG A;  2M2A A;  4WK9 A;  1C9H A;  1WB0 A;  1HKI A;  4LAY A;  3O5E A;  4DRO A;  3ARW A;  5HKG A;  2DG4 A;  2XP7 A;  2DT2 A;  2KFW A;  2Y78 A;  4ZPT R;  2FKE A;  3KCE A;  2KE0 A;  5DEZ A;  3B8S A;  1N1A A;  4C02 B;  1NWR A;  1FKT A;  2XPA A;  5DIT A;  3IKD A;  2VCD A;  5HUA A;  5GPR A;  3CGM A;  4WIW A;  1EYM A;  1D7I A;  2LJ4 A;  1NSG A;  1H0G A;  1OWQ A;  3WD2 A;  1EDQ A;  4ODP A;  1E15 A;  3O5G A;  4WKA A;  1LL7 A;  3EY6 A;  1JVW A;  1Y0O A;  1H0I A;  3ODK A;  4ITZ A;  1FKS A;  4TW8 A;  3KAI A;  4TNS A;  5DIV A;  4ODO A;  1FKD A;  1FAP A;  3UI5 A;  2MF9 A;  2RUC A;  4KQZ A;  1GUV A;  4Z2J A;  1IX5 A;  3O5O A;  4DH0 A;  4Z2K A;  3JXV A;  1HXV A;  1FKH A;  3WL0 A;  4BF8 A;  1Q1C A;  3AQU A;  4WKF A;  1LL6 A;  2G41 A;  2YBU A;  3G6L A;  3CHD A;  1JND A;  4DRJ A;  2XP9 A;  3FAP A;  2DT1 A;  1LG2 A;  5GPG A;  1FJD A;  4HBE A;  1ZK6 A;  3KAB A;  1XHG A;  3O5I A;  1ZBV A;  4W9Q A;  3WIJ A;  2ZR5 A;  5B8I C;  4NSB A;  1KT0 A;  1HKJ A;  1X6N A;  2F2D A;  1GOI A;  2DT3 A;  4JFI A;  3ARR A;  4DIP A;  1HJX A;  2ZQT A;  4L72 B;  3WH0 A;  1R9H A;  1FKJ A;  1L1P A;  3O5D A;  1GPF A;  3AS2 A;  2JZV A;  4KR0 B;  2D9F A;  4P8W A;  4S3J A;  1ZBC A;  1PIN A;  1JNT A;  4LAX A;  5HW8 A;  1FFQ A;  1LL4 A;  3JYJ A;  3PRB A;  5BXJ A;  4IPX A;  1QPL A;  3ARY A;  4DRN A;  1ROU A;  2DT0 A;  5I98 A;  1BKF A;  4HAR A;  1FKK A;  1ZB5 A;  1LQ0 A;  3RME A;  1ZL1 A;  1YW5 A;  2OFN A;  4IQC A;  2LPV A;  1J4H A;  2WM0 A;  1OGB A;  2F21 A;  2KR7 A;  3B9D A;  2AOS A;  2ZQV A;  1HKM A;  5HWC A;  1KT1 A;  2RUQ A;  4DRM A;  4R0X A;  1W1V A;  3UQI A;  4TW6 A;  3KAF A;  3O5M A;  1PBK A;  1ZCN A;  4Q7N A;  2XP8 A;  1UR8 A;  3KAD A;  4JFM A;  3G6M A;  3NI6 A;  3CH9 A;  1JNE A;  4Z2G A;  3ARX A;  3IK8 A;  1RD6 A;  3NTP A;  2G8Z A;  2M08 A;  2O9O A;  4JYS A;  2A3E A;  1FD9 A;  2F4E A;  4MNM A;  1J6Y A;  4GIV A;  4TX0 A;  1SR0 A;  1SYT A;  3UQA A;  2LGO A;  3WD4 A;  3ART A;  5HT1 A;  2XP3 A;  4ZPV R;  3UF8 A;  1HKK A;  3ARV A;  4J4O A;  1BL4 A;  4MGV A;  3UI4 A;  1UR9 A;  3CZ8 A;  1D2K A;  1D6O A;  1WNO A;  4MSP A;  2WLY A;  1D7J A;  1ZBK A;  4S3K A;  3IKG A;  4DWS C;  4JFK A;  1Q6I A;  3H9R B;  4DWS D;  2M1I A;  3FY1 A;  5HW7 A;  1LG1 A;  4ODL A;  3B7X A;  3WL1 A;  4Q22 A;  1YAT A;  4ODQ A;  3KAH A;  4URI A;  1E6P A;  5DO2 A;  4IQ2 A;  1FFR A;  4DRH A;  1EQ3 A;  4MNK A;  3ARZ A;  4JFJ A;  2MLZ A;  4IT4 A;  3QOK A;  2PBC A;  2PPN A;  3ARQ A;  4G50 A;  2PV3 A;  1LJY A;  3OA5 A;  1Q6U A;  1P5Q A;  1NH6 A;  3TC5 A;  1WAW A;  2MNT A;  4ODK A;  2UZ5 A;  3KAG A;  1E6N A;  1EHN A;  2RUD A;  2DSW A;  2PPO A;  1FKR A;  4TYO A;  3O5Q A;  4QT2 A;  4ODN A;  3O5K A;  2A3A A;  3ARP A;  2Q5A A;  3O5R A;  2DSZ A;  2MPH A;  3ARO A;  5GQB A;  1FKL A;  2OLH A;  3AS1 A;  2ITK A;  3WQV A;  4DWS B;  3CHE A;  5HBF A;  2XPB A;  3RGC A;  2RQS A;  4R5E A;  4ODR A;  1E6R A;  2PI6 A;  4N19 A;  4U86 A;  3WD1 A;  2MLY A;  4DRQ A;  3ALG A;  4Z2L A;  1ROT A;  1XRV A;  1TFV A;  2PV2 A;  1E9L A;  4QZV B;  3WD3 A;  3KZ7 A;  3NRK A;  1FKF A;  2ZQS A;  2QF8 A;  2ZR6 A;  1FKI A;  3AS0 A;  3RFW A;  1NMW A;  3OOB A;  2ESC A;  2KO7 A;  1TCO C;  1F8A B;  4JFL A;  3BXW A;  2KGJ A;  3CHC A;  1FKB A;  4W9P A;  3TDB A;  4MNJ A;  3PRD A;  2DG3 A;  2YBT A;  3ARS A;  5HW6 A;  3O5L A;  3PRA A;  4U84 A;  3RM8 A;  4XAK A;  4NZC A;  4DZ3 A;  5HTG A;  3UQB A;  5DF0 A;  2L2S A;  4AY1 A;  1JNS A;  1NWS A;  1ITX A;  3PA7 A;  1D7H A;  1EIB A;  1ZU8 A;  2FAP A;  2O92 A;  3O5F A;  5DIU A;  1HJW A;  2WLZ A;  2KI3 A;  3KAC A;  4J4N A;  2RUR A;  4TW7 A;  3WKZ A;  1F40 A;  4ZS6 A;  3WD0 A;  2XP5 A;  4Z2I A;  3ARU A;  4FN2 A;  4L3N A;  2N87 A;  4P8X A;  4DRI A;  3CGN A;  2ZR4 A;  3PR9 A;  4IT6 A;  4ML4 A;  4WKH A;  1T11 A;  1E6Z A;  3W4R A;  3UI6 A;  2XP6 A;  4DWS A;  4ZPW R;  4W5U A;  4DRK A;  4DZ2 A;  1J4R A;  5D75 A;  4DT4 A;  2B31 A;  3VAW A;  2MLX A;  3ALF A;  3B9E A;  3RM9 A;  4MTV A;  1A7X A;  1CTN A;  2PV1 A;  3MDY B;  4W9O A;  2DPE A;  4PTM A;  2PPP A;  1K9T A;  2RSE A;  1NWT A;  1QPF A;  1ZBW A;  2DG9 A;  2DSU A;  1U79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...