3MDYB

Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1b (bmpr1b) in complex with fkbp12 and ldn-193189
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
109
structure length
109
Chain Sequence
b'SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1B
molecule tags Transferase/isomerase
source organism Homo sapiens
publication title Crystal structure of the cytoplasmic domain of the bone morphogenetic protein receptor type-1B (BMPR1B) in complex with FKBP12 and LDN-193189
rcsb
total genus 27
structure length 109
sequence length 109
chains with identical sequence D
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3mdyB00
2ZQUA 4GIVA 3TC5A 3JYMA 3GPKA 3RFWA 2DG3A 4W9PA 3LUOA 5HWCA 1JNSA 2F21A 3KACA 1EQ3A 2ZQTA 5DITA 3O5OA 4U85A 2UZ5A 1Q6UA 2LPVA 5BXJA 4DH0A 3FAPA 4J4OA 4LAYA 5J6EA 3JYJA 4LAXA 2KI3A 4DIPA 4IQCA 5GPGA 3H9RB 2XP6A 1FKKA 1T11A 3IK8A 3O5MA 1FD9A 1Q6IA 3WH0A 2XP3A 1D7IA 4JYSA 3UQIA 3O5IA 2XP4A 1D6OA 1NMVA 1Y0OA 4U84A 1YATA 2JZVA 4TX0A 3UI5A 5HWBA 1HXVA 2ZR6A 1J4IA 3IHZA 3O5DA 3KZ7A 4JFKA 4JFLA 1J4RA 1F40A 1ROUA 3PRDA 4MSPA 3JXVA 1NSGA 1ROTA 3I6CA 1FAPA 3KABA 4W9QA 2MLYA 2AWGA 1QPFA 2PPOA 2DG4A 2XP8A 3PRBA 4DRMA 4IQ2A 1JVWA 2PV1A 1N1AA 4DT4A 3MDYB 4DRIA 1FKIA 2ZQSA 2LGOA 2N87A 2KGJA 5HUAA 3O5RA 1F8AB 2KO7A 1FKTA 3O5JA 3EY6A 2L2SA 1R9HA 1Q1CA 1JNTA 2XP7A 3KCEA 2KFWA 2XPBA 4JFMA 2MF9A 2VCDA 5HW7A 2IF4A 1FKJA 1J4HA 5DIVA 3TDBA 3UF8A 1L1PA 1YW5A 1BKFA 2XP5A 4FN2A 2KR7A 4ODRA 4DZ2A 1NMWA 4GGQA 3O5KA 3O5PA 2LKNA 1FJDA 3TCZA 4DRQA 1EYMA 1KT0A 2DG9A 1B6CA 2Y78A 3NRKA 4TW6A 4N19A 3UQBA 3UQAA 4TNSA 5B8IC 2RSEA 4DROA 4U86A 4DRKA 2ITKA 4ODOA 2LJ4A 1QZ2A 2RUCA 2XPAA 3NTPA 3O5GA 3NI6A 2MLXA 3KAHA 1FKHA 4LAWA 3UI4A 2M08A 4ITZA 2PV2A 2VN1A 4NNRA 1TCOC 2RURA 2D9FA 2ZQVA 2PPNA 4LAVA 4MGVA 1FKGA 1FKSA 1KT1A 2XP9A 3O5LA 2ZR5A 4O2TA 3O5EA 3IKGA 1ZK6A 4ODQA 4R0XA 4TW7A 1M5YA 2M2AA 2RUQA 4G2PA 1Q6HA 4QT2A 1FKRA 4DRJA 4J4NA 2FAPA 3OOBA 3CGMA 2ZR4A 3CGNA 3IKDA 3VAWA 2F2DA 2MLZA 2FKEA 4DRPA 5HW6A 2PPPA 2RUDA 3KAFA 2KE0A 1A7XA 4TW8A 1P5QA 1PBKA 2OFNA 3KAGA 5D75A 4QT3A 2MPHA 3UI6A 1BL4A 2Q5AA 4BF8A 1W26A 4ODLA 2PBCA 4ODMA 1PINA 5I98A 5HKGA 4QIBA 4IPXA 1FKFA 3KAIA 1D7HA 3KADA 1U79A 4DRHA 4DZ3A 4G50A 1FKDA 1J6YA 5HTGA 3O5QA 1ZCNA 1C9HA 1D7JA 3O5FA 4W9OA 1FKBA 4JFIA 4JFJA 3PA7A 4ODNA 3RGCA 4DRNA 2K8IA 4ODPA 4TYOA 2RQSA 2M1IA 3B7XA 3ODKA 5HT1A 4FAPA 1FKLA 5HW8A 4ODKA 5DIUA 2PV3A 4C02B 1QPLA 2MNTA 2F4EA
chains in the Genus database with same CATH superfamily
1W1VA 2PN0A 2DSVA 3B8SA 4W9PA 1EQ3A 4ZPVR 2ZQTA 3O5OA 2UZ5A 2DPEA 5BXJA 4LAYA 1RD6A 4LAXA 1T11A 3WH0A 5GPRA 1EDQA 2XP4A 4U84A 3ARZA 5HWBA 2ZR6A 1W1PA 3RM4A 3CHCA 4JFLA 5DO2A 1LL7A 1D2KA 1FAPA 4MTVA 2XP8A 1QPFA 1JVWA 1FFRA 1N1AA 4DT4A 4DRIA 2KGJA 5HUAA 4MNMA 3WD4A 1JNTA 3FXYA 3KCEA 2XPBA 5DIVA 1J4HA 1HJVA 4ZPTR 4FN2A 4DWSA 4DZ2A 1HKMA 4WKAA 4P8VA 2ESCA 3ARUA 2LKNA 1OGBA 1EYMA 3ARXA 1VF8A 5B8IC 1GPFA 1OGGA 4DWSD 3B9EA 4DRKA 2ITKA 3ARQA 4ODOA 3WL0A 2G8ZA 2XPAA 4Z2IA 1FKHA 4LAWA 4NSBA 2A3AA 2VN1A 4NNRA 1TCOC 3CHFA 3O5LA 4TW7A 4O2TA 1ZK6A 2WK2A 1M5YA 2M2AA 1ZU8A 2RUQA 2DT1A 2A3CA 2F23A 3CGNA 3FY1A 3G6LA 5HW6A 2PPPA 5JH8A 4HBEA 1W26A 4WKHA 4ODMA 4DZ3A 4P8WA 3AS0A 4G50A 2DT3A 4W9OA 4JFIA 1LQ0A 2AOSA 1JNDA 3ODKA 3GTYX 4ODKA 2OLHA 2MNTA 3TC5A 4GIVA 4URIA 5HWCA 3LUOA 1ZBCA 4WJXA 1GUVA 2LPVA 3RM9A 5J6EA 3WKZA 3JYJA 3CHEA 2A3BA 5GPGA 3IK8A 1FD9A 3G6MA 3O5IA 1NMVA 1YATA 1HXVA 3QOKA 4KQZA 1J4RA 4L3NA 1ROUA 3PRDA 4MNKA 2PI6A 1ZBVA 1ROTA 3ARYA 4HARA 3BMBA 1GRJA 3MDYB 2N87A 1W9VA 4S3JA 3O5RA 4Z2HA 1ITXA 1SYTA 2DT0A 4L72B 2A3EA 2L2SA 3W4RA 2KFWA 1K9TA 1FKJA 3UF8A 1NWUA 2XP5A 3PRAA 3WD2A 4GGQA 3EIPA 3O5KA 1FJDA 3TCZA 2DG9A 3NRKA 2Y78A 4TW6A 1E6RA 3UQBA 4R5EA 1LL6A 3ARSA 3CZ8A 3NTPA 4P8XA 2MLXA 1E6PA 2M08A 3UI4A 4XAKA 2D9FA 1W1TA 1NH6A 1EHNA 4R0XA 4MNLA 1Q6HA 4QT2A 1W1YA 1FKRA 3OOBA 3VAWA 3ALGA 3AS1A 1IX5A 4TW8A 5D75A 2MPHA 4P8UA 1X6LA 1E15A 2Q5AA 4W5UA 2O9OA 2PBCA 1PINA 4QIBA 4DRHA 1FKFA 1J6YA 1FKDA 1LG1A 5HTGA 4HBOA 1XHGA 1ZCNA 4WKFA 3O5FA 1D7JA 4ODNA 3RGCA 4DRNA 4IT4A 2K8IA 3B7XA 5HW8A 2B31A 4FAPA 3OA5A 5DIUA 1HKKA 4C02B 2G41A 2DT2A 3AROA 3GPKA 3RFWA 1JNSA 1H0IA 1LL4A 3WIJA 1Q6UA 3CHDA 3FAPA 2KI3A 4DIPA 2XP6A 3O5MA 3GU0A 1Q6IA 4Q7NA 1W9UA 1D7IA 2P4VA 3UQIA 4Z2JA 1W9PA 5DEZA 3UI5A 1E44A 2O92A 3IHZA 3O5DA 4PTMA 1NWRA 3KZ7A 1F40A 4ZS6A 3KABA 1UR8A 2MLYA 4LGXA 1NWTA 2DG4A 2YBTA 4IQ2A 2PV1A 4AY1A 2LGOA 2KO7A 1HJXA 1FKTA 1UR9A 3PR9A 3WD3A 1R9HA 1Q1CA 4WK9A 2XP7A 2VCDA 4QZVB 2IF4A 3TDBA 1L1PA 3ARWA 1FFQA 2KR7A 4ODRA 1NWSA 4WIWA 1NMWA 1KT0A 4N19A 4TNSA 2RSEA 1H0GA 4DROA 4U86A 2DSWA 2IUZA 2RUCA 3WQWA 2ETNA 3NI6A 1ZL1A 2PV2A 2ZQVA 2PPNA 4ML4A 1FKGA 1FKSA 1KT1A 4DRMA 4ODQA 3O5EA 4DWSC 4S3KA 1WB0A 4G2PA 4DRJA 1XRVA 2FAPA 2ZR4A 3IKDA 2F2DA 2MLZA 2FKEA 2RUDA 3KAFA 2KE0A 2B5UB 1PBKA 2OFNA 3UI6A 1BL4A 1ZB5A 1HKIA 5HKGA 4IPXA 4Z2GA 1D7HA 3KADA 3O5QA 1WNOA 3WD0A 1FKBA 1CTNA 1OWQA 1LJYA 3ARRA 5DF0A 4ODPA 2M1IA 5HT1A 2PV3A 1QPLA 2ZQUA 3JYMA 2DG3A 2F21A 3KACA 5DITA 4U85A 4MAVA 4DWSB 4DH0A 4J4OA 4MPKA 3AS3A 1E6NA 4IQCA 1JNEA 1O6IA 1FKKA 3H9RB 3ARTA 2XP3A 4JYSA 5GQBA 1D6OA 1Y0OA 4TX0A 2JZVA 1J4IA 4Z2KA 4JFKA 5HBFA 4MSPA 3JXVA 1NSGA 2FDMA 3I6CA 4W9QA 1E9LA 2AWGA 2PPOA 3PRBA 1FKIA 2ZQSA 1LG2A 1X6NA 3AS2A 2EULA 1F8AB 4Q22A 1ZBKA 3O5JA 3EY6A 3ARPA 2WLYA 1EIBA 4JFMA 2MF9A 5HW7A 3RM8A 1YW5A 1BKFA 4KR0B 3B9AA 3O5PA 4DRQA 1GOIA 1B6CA 3WL1A 3UQAA 4Z2LA 3RMEA 4MNJA 3BXWA 3CH9A 1ZBWA 2LJ4A 1QZ2A 1SR0A 2WM0A 3O5GA 3KAHA 4ITZA 3B9DA 3ALFA 2RURA 3WQVA 4LAVA 2QF8A 4MGVA 2XP9A 2ZR5A 3IKGA 4J4NA 4UDMA 1WAWA 3CGMA 1HJWA 2YBUA 4DRPA 1A7XA 4NZCA 1P5QA 3KAGA 4QT3A 4BF8A 1HKJA 4ODLA 5I98A 2DSZA 3KAIA 3WD1A 1U79A 4IT6A 1JCHB 1C9HA 1KFWA 4JFJA 3PA7A 4TYOA 2RQSA 2WLZA 1FKLA 1TFVA 3AQUA 4ZPWR 1E6ZA 2DSUA 2F4EA 3ARVA
chains in the Genus database with same CATH topology
1W1VA 2DSVA 3B8SA 4W9PA 1EQ3A 4ZPVR 2ZQTA 3O5OA 2UZ5A 2DPEA 5BXJA 4LAYA 1RD6A 4LAXA 1T11A 3WH0A 5GPRA 1EDQA 2XP4A 4U84A 3ARZA 5HWBA 2ZR6A 1W1PA 3RM4A 3CHCA 4JFLA 5DO2A 1LL7A 1D2KA 1FAPA 4MTVA 2XP8A 1QPFA 1JVWA 1FFRA 1N1AA 4DT4A 4DRIA 2KGJA 5HUAA 4MNMA 3WD4A 1JNTA 3FXYA 3KCEA 2XPBA 5DIVA 1J4HA 1HJVA 4ZPTR 4FN2A 4DWSA 4DZ2A 1HKMA 4WKAA 4P8VA 2ESCA 3ARUA 2LKNA 1OGBA 1EYMA 3ARXA 1VF8A 5B8IC 1GPFA 1OGGA 4DWSD 3B9EA 4DRKA 2ITKA 3ARQA 4ODOA 3WL0A 2G8ZA 2XPAA 4Z2IA 1FKHA 4LAWA 4NSBA 2A3AA 2VN1A 4NNRA 1TCOC 3CHFA 3O5LA 4TW7A 4O2TA 1ZK6A 2WK2A 1M5YA 2M2AA 1ZU8A 2RUQA 2DT1A 2A3CA 3CGNA 3FY1A 3G6LA 5HW6A 2PPPA 5JH8A 4HBEA 1W26A 4WKHA 4ODMA 4DZ3A 4P8WA 3AS0A 4G50A 2DT3A 4W9OA 4JFIA 1LQ0A 2AOSA 1JNDA 3ODKA 4ODKA 2OLHA 2MNTA 3TC5A 4GIVA 4URIA 5HWCA 3LUOA 1ZBCA 4WJXA 1GUVA 2LPVA 3RM9A 5J6EA 3WKZA 3JYJA 3CHEA 2A3BA 5GPGA 3IK8A 1FD9A 3G6MA 3O5IA 1NMVA 1YATA 1HXVA 3QOKA 4KQZA 1J4RA 4L3NA 1ROUA 3PRDA 4MNKA 2PI6A 1ZBVA 1ROTA 3ARYA 4HARA 3MDYB 2N87A 1W9VA 4S3JA 3O5RA 4Z2HA 1ITXA 1SYTA 2DT0A 4L72B 2A3EA 2L2SA 3W4RA 2KFWA 1K9TA 1FKJA 3UF8A 1NWUA 2XP5A 3PRAA 3WD2A 4GGQA 3O5KA 1FJDA 3TCZA 2DG9A 3NRKA 2Y78A 4TW6A 1E6RA 3UQBA 4R5EA 1LL6A 3ARSA 3CZ8A 3NTPA 4P8XA 2MLXA 1E6PA 2M08A 3UI4A 4XAKA 2D9FA 1W1TA 1NH6A 1EHNA 4R0XA 4MNLA 1Q6HA 4QT2A 1W1YA 1FKRA 3OOBA 3VAWA 3ALGA 3AS1A 1IX5A 4TW8A 5D75A 2MPHA 4P8UA 1X6LA 1E15A 2Q5AA 4W5UA 2O9OA 2PBCA 1PINA 4QIBA 4DRHA 1FKFA 1J6YA 1FKDA 1LG1A 5HTGA 4HBOA 1XHGA 1ZCNA 4WKFA 3O5FA 1D7JA 4ODNA 3RGCA 4DRNA 4IT4A 2K8IA 3B7XA 5HW8A 2B31A 4FAPA 3OA5A 5DIUA 1HKKA 4C02B 2G41A 2DT2A 3AROA 3GPKA 3RFWA 1JNSA 1H0IA 1LL4A 3WIJA 1Q6UA 3CHDA 3FAPA 2KI3A 4DIPA 2XP6A 3O5MA 1Q6IA 4Q7NA 1W9UA 1D7IA 3UQIA 4Z2JA 1W9PA 5DEZA 3UI5A 2O92A 3IHZA 3O5DA 4PTMA 1NWRA 3KZ7A 1F40A 4ZS6A 3KABA 1UR8A 2MLYA 4LGXA 1NWTA 2DG4A 2YBTA 4IQ2A 2PV1A 4AY1A 2LGOA 2KO7A 1HJXA 1FKTA 1UR9A 3PR9A 3WD3A 1R9HA 1Q1CA 4WK9A 2XP7A 2VCDA 4QZVB 2IF4A 3TDBA 1L1PA 3ARWA 1FFQA 2KR7A 4ODRA 1NWSA 4WIWA 1NMWA 1KT0A 4N19A 4TNSA 2RSEA 1H0GA 4DROA 4U86A 2DSWA 2IUZA 2RUCA 3WQWA 3NI6A 1ZL1A 2PV2A 2ZQVA 2PPNA 4ML4A 1FKGA 1FKSA 1KT1A 4DRMA 4ODQA 3O5EA 4DWSC 4S3KA 1WB0A 4G2PA 4DRJA 1XRVA 2FAPA 2ZR4A 3IKDA 2F2DA 2MLZA 2FKEA 2RUDA 3KAFA 2KE0A 1PBKA 2OFNA 3UI6A 1BL4A 1ZB5A 1HKIA 5HKGA 4IPXA 4Z2GA 1D7HA 3KADA 3O5QA 1WNOA 3WD0A 1FKBA 1CTNA 1OWQA 1LJYA 3ARRA 5DF0A 4ODPA 2M1IA 5HT1A 2PV3A 1QPLA 2ZQUA 3JYMA 2DG3A 2F21A 3KACA 5DITA 4U85A 4MAVA 4DWSB 4DH0A 4J4OA 4MPKA 3AS3A 1E6NA 4IQCA 1JNEA 1O6IA 1FKKA 3H9RB 3ARTA 2XP3A 4JYSA 5GQBA 1D6OA 1Y0OA 4TX0A 2JZVA 1J4IA 4Z2KA 4JFKA 5HBFA 4MSPA 3JXVA 1NSGA 2FDMA 3I6CA 4W9QA 1E9LA 2AWGA 2PPOA 3PRBA 1FKIA 2ZQSA 1LG2A 1X6NA 3AS2A 1F8AB 4Q22A 1ZBKA 3O5JA 3EY6A 3ARPA 2WLYA 1EIBA 4JFMA 2MF9A 5HW7A 3RM8A 1YW5A 1BKFA 4KR0B 3B9AA 3O5PA 4DRQA 1GOIA 1B6CA 3WL1A 3UQAA 4Z2LA 3RMEA 4MNJA 3BXWA 3CH9A 1ZBWA 2LJ4A 1QZ2A 1SR0A 2WM0A 3O5GA 3KAHA 4ITZA 3B9DA 3ALFA 2RURA 3WQVA 4LAVA 2QF8A 4MGVA 2XP9A 2ZR5A 3IKGA 4J4NA 1WAWA 3CGMA 1HJWA 2YBUA 4DRPA 1A7XA 4NZCA 1P5QA 3KAGA 4QT3A 4BF8A 1HKJA 4ODLA 5I98A 2DSZA 3KAIA 3WD1A 1U79A 4IT6A 1C9HA 1KFWA 4JFJA 3PA7A 4TYOA 2RQSA 2WLZA 1FKLA 1TFVA 3AQUA 4ZPWR 1E6ZA 2DSUA 2F4EA 3ARVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  4GIV A;  3TC5 A;  3JYM A;  3GPK A;  3RFW A;  2DG3 A;  4W9P A;  3LUO A;  5HWC A;  1JNS A;  2F21 A;  3KAC A;  1EQ3 A;  2ZQT A;  5DIT A;  3O5O A;  4U85 A;  2UZ5 A;  1Q6U A;  2LPV A;  5BXJ A;  4DH0 A;  3FAP A;  4J4O A;  4LAY A;  5J6E A;  3JYJ A;  4LAX A;  2KI3 A;  4DIP A;  4IQC A;  5GPG A;  3H9R B;  2XP6 A;  1FKK A;  1T11 A;  3IK8 A;  3O5M A;  1FD9 A;  1Q6I A;  3WH0 A;  2XP3 A;  1D7I A;  4JYS A;  3UQI A;  3O5I A;  2XP4 A;  1D6O A;  1NMV A;  1Y0O A;  4U84 A;  1YAT A;  2JZV A;  4TX0 A;  3UI5 A;  5HWB A;  1HXV A;  2ZR6 A;  1J4I A;  3IHZ A;  3O5D A;  3KZ7 A;  4JFK A;  4JFL A;  1J4R A;  1F40 A;  1ROU A;  3PRD A;  4MSP A;  3JXV A;  1NSG A;  1ROT A;  3I6C A;  1FAP A;  3KAB A;  4W9Q A;  2MLY A;  2AWG A;  1QPF A;  2PPO A;  2DG4 A;  2XP8 A;  3PRB A;  4DRM A;  4IQ2 A;  1JVW A;  2PV1 A;  1N1A A;  4DT4 A;  3MDY B;  4DRI A;  1FKI A;  2ZQS A;  2LGO A;  2N87 A;  2KGJ A;  5HUA A;  3O5R A;  1F8A B;  2KO7 A;  1FKT A;  3O5J A;  3EY6 A;  2L2S A;  1R9H A;  1Q1C A;  1JNT A;  2XP7 A;  3KCE A;  2KFW A;  2XPB A;  4JFM A;  2MF9 A;  2VCD A;  5HW7 A;  2IF4 A;  1FKJ A;  1J4H A;  5DIV A;  3TDB A;  3UF8 A;  1L1P A;  1YW5 A;  1BKF A;  2XP5 A;  4FN2 A;  2KR7 A;  4ODR A;  4DZ2 A;  1NMW A;  4GGQ A;  3O5K A;  3O5P A;  2LKN A;  1FJD A;  3TCZ A;  4DRQ A;  1EYM A;  1KT0 A;  2DG9 A;  1B6C A;  2Y78 A;  3NRK A;  4TW6 A;  4N19 A;  3UQB A;  3UQA A;  4TNS A;  5B8I C;  2RSE A;  4DRO A;  4U86 A;  4DRK A;  2ITK A;  4ODO A;  2LJ4 A;  1QZ2 A;  2RUC A;  2XPA A;  3NTP A;  3O5G A;  3NI6 A;  2MLX A;  3KAH A;  1FKH A;  4LAW A;  3UI4 A;  2M08 A;  4ITZ A;  2PV2 A;  2VN1 A;  4NNR A;  1TCO C;  2RUR A;  2D9F A;  2ZQV A;  2PPN A;  4LAV A;  4MGV A;  1FKG A;  1FKS A;  1KT1 A;  2XP9 A;  3O5L A;  2ZR5 A;  4O2T A;  3O5E A;  3IKG A;  1ZK6 A;  4ODQ A;  4R0X A;  4TW7 A;  1M5Y A;  2M2A A;  2RUQ A;  4G2P A;  1Q6H A;  4QT2 A;  1FKR A;  4DRJ A;  4J4N A;  2FAP A;  3OOB A;  3CGM A;  2ZR4 A;  3CGN A;  3IKD A;  3VAW A;  2F2D A;  2MLZ A;  2FKE A;  4DRP A;  5HW6 A;  2PPP A;  2RUD A;  3KAF A;  2KE0 A;  1A7X A;  4TW8 A;  1P5Q A;  1PBK A;  2OFN A;  3KAG A;  5D75 A;  4QT3 A;  2MPH A;  3UI6 A;  1BL4 A;  2Q5A A;  4BF8 A;  1W26 A;  4ODL A;  2PBC A;  4ODM A;  1PIN A;  5I98 A;  5HKG A;  4QIB A;  4IPX A;  1FKF A;  3KAI A;  1D7H A;  3KAD A;  1U79 A;  4DRH A;  4DZ3 A;  4G50 A;  1FKD A;  1J6Y A;  5HTG A;  3O5Q A;  1ZCN A;  1C9H A;  1D7J A;  3O5F A;  4W9O A;  1FKB A;  4JFI A;  4JFJ A;  3PA7 A;  4ODN A;  3RGC A;  4DRN A;  2K8I A;  4ODP A;  4TYO A;  2RQS A;  2M1I A;  3B7X A;  3ODK A;  5HT1 A;  4FAP A;  1FKL A;  5HW8 A;  4ODK A;  5DIU A;  2PV3 A;  4C02 B;  1QPL A;  2MNT A;  2F4E A; 
#chains in the Genus database with same CATH topology
 1W1V A;  2PN0 A;  2DSV A;  3B8S A;  4W9P A;  1EQ3 A;  4ZPV R;  2ZQT A;  3O5O A;  2UZ5 A;  2DPE A;  5BXJ A;  4LAY A;  1RD6 A;  4LAX A;  1T11 A;  3WH0 A;  5GPR A;  1EDQ A;  2XP4 A;  4U84 A;  3ARZ A;  5HWB A;  2ZR6 A;  1W1P A;  3RM4 A;  3CHC A;  4JFL A;  5DO2 A;  1LL7 A;  1D2K A;  1FAP A;  4MTV A;  2XP8 A;  1QPF A;  1JVW A;  1FFR A;  1N1A A;  4DT4 A;  4DRI A;  2KGJ A;  5HUA A;  4MNM A;  3WD4 A;  1JNT A;  3FXY A;  3KCE A;  2XPB A;  5DIV A;  1J4H A;  1HJV A;  4ZPT R;  4FN2 A;  4DWS A;  4DZ2 A;  1HKM A;  4WKA A;  4P8V A;  2ESC A;  3ARU A;  2LKN A;  1OGB A;  1EYM A;  3ARX A;  1VF8 A;  5B8I C;  1GPF A;  1OGG A;  4DWS D;  3B9E A;  4DRK A;  2ITK A;  3ARQ A;  4ODO A;  3WL0 A;  2G8Z A;  2XPA A;  4Z2I A;  1FKH A;  4LAW A;  4NSB A;  2A3A A;  2VN1 A;  4NNR A;  1TCO C;  3CHF A;  3O5L A;  4TW7 A;  4O2T A;  1ZK6 A;  2WK2 A;  1M5Y A;  2M2A A;  1ZU8 A;  2RUQ A;  2DT1 A;  2A3C A;  2F23 A;  3CGN A;  3FY1 A;  3G6L A;  5HW6 A;  2PPP A;  5JH8 A;  4HBE A;  1W26 A;  4WKH A;  4ODM A;  4DZ3 A;  4P8W A;  3AS0 A;  4G50 A;  2DT3 A;  4W9O A;  4JFI A;  1LQ0 A;  2AOS A;  1JND A;  3ODK A;  3GTY X;  4ODK A;  2OLH A;  2MNT A;  3TC5 A;  4GIV A;  4URI A;  5HWC A;  3LUO A;  1ZBC A;  4WJX A;  1GUV A;  2LPV A;  3RM9 A;  5J6E A;  3WKZ A;  3JYJ A;  3CHE A;  2A3B A;  5GPG A;  3IK8 A;  1FD9 A;  3G6M A;  3O5I A;  1NMV A;  1YAT A;  1HXV A;  3QOK A;  4KQZ A;  1J4R A;  4L3N A;  1ROU A;  3PRD A;  4MNK A;  2PI6 A;  1ZBV A;  1ROT A;  3ARY A;  4HAR A;  3BMB A;  1GRJ A;  3MDY B;  2N87 A;  1W9V A;  4S3J A;  3O5R A;  4Z2H A;  1ITX A;  1SYT A;  2DT0 A;  4L72 B;  2A3E A;  2L2S A;  3W4R A;  2KFW A;  1K9T A;  1FKJ A;  3UF8 A;  1NWU A;  2XP5 A;  3PRA A;  3WD2 A;  4GGQ A;  3EIP A;  3O5K A;  1FJD A;  3TCZ A;  2DG9 A;  3NRK A;  2Y78 A;  4TW6 A;  1E6R A;  3UQB A;  4R5E A;  1LL6 A;  3ARS A;  3CZ8 A;  3NTP A;  4P8X A;  2MLX A;  1E6P A;  2M08 A;  3UI4 A;  4XAK A;  2D9F A;  1W1T A;  1NH6 A;  1EHN A;  4R0X A;  4MNL A;  1Q6H A;  4QT2 A;  1W1Y A;  1FKR A;  3OOB A;  3VAW A;  3ALG A;  3AS1 A;  1IX5 A;  4TW8 A;  5D75 A;  2MPH A;  4P8U A;  1X6L A;  1E15 A;  2Q5A A;  4W5U A;  2O9O A;  2PBC A;  1PIN A;  4QIB A;  4DRH A;  1FKF A;  1J6Y A;  1FKD A;  1LG1 A;  5HTG A;  4HBO A;  1XHG A;  1ZCN A;  4WKF A;  3O5F A;  1D7J A;  4ODN A;  3RGC A;  4DRN A;  4IT4 A;  2K8I A;  3B7X A;  5HW8 A;  2B31 A;  4FAP A;  3OA5 A;  5DIU A;  1HKK A;  4C02 B;  2G41 A;  2DT2 A;  3ARO A;  3GPK A;  3RFW A;  1JNS A;  1H0I A;  1LL4 A;  3WIJ A;  1Q6U A;  3CHD A;  3FAP A;  2KI3 A;  4DIP A;  2XP6 A;  3O5M A;  3GU0 A;  1Q6I A;  4Q7N A;  1W9U A;  1D7I A;  2P4V A;  3UQI A;  4Z2J A;  1W9P A;  5DEZ A;  3UI5 A;  1E44 A;  2O92 A;  3IHZ A;  3O5D A;  4PTM A;  1NWR A;  3KZ7 A;  1F40 A;  4ZS6 A;  3KAB A;  1UR8 A;  2MLY A;  4LGX A;  1NWT A;  2DG4 A;  2YBT A;  4IQ2 A;  2PV1 A;  4AY1 A;  2LGO A;  2KO7 A;  1HJX A;  1FKT A;  1UR9 A;  3PR9 A;  3WD3 A;  1R9H A;  1Q1C A;  4WK9 A;  2XP7 A;  2VCD A;  4QZV B;  2IF4 A;  3TDB A;  1L1P A;  3ARW A;  1FFQ A;  2KR7 A;  4ODR A;  1NWS A;  4WIW A;  1NMW A;  1KT0 A;  4N19 A;  4TNS A;  2RSE A;  1H0G A;  4DRO A;  4U86 A;  2DSW A;  2IUZ A;  2RUC A;  3WQW A;  2ETN A;  3NI6 A;  1ZL1 A;  2PV2 A;  2ZQV A;  2PPN A;  4ML4 A;  1FKG A;  1FKS A;  1KT1 A;  4DRM A;  4ODQ A;  3O5E A;  4DWS C;  4S3K A;  1WB0 A;  4G2P A;  4DRJ A;  1XRV A;  2FAP A;  2ZR4 A;  3IKD A;  2F2D A;  2MLZ A;  2FKE A;  2RUD A;  3KAF A;  2KE0 A;  2B5U B;  1PBK A;  2OFN A;  3UI6 A;  1BL4 A;  1ZB5 A;  1HKI A;  5HKG A;  4IPX A;  4Z2G A;  1D7H A;  3KAD A;  3O5Q A;  1WNO A;  3WD0 A;  1FKB A;  1CTN A;  1OWQ A;  1LJY A;  3ARR A;  5DF0 A;  4ODP A;  2M1I A;  5HT1 A;  2PV3 A;  1QPL A;  2ZQU A;  3JYM A;  2DG3 A;  2F21 A;  3KAC A;  5DIT A;  4U85 A;  4MAV A;  4DWS B;  4DH0 A;  4J4O A;  4MPK A;  3AS3 A;  1E6N A;  4IQC A;  1JNE A;  1O6I A;  1FKK A;  3H9R B;  3ART A;  2XP3 A;  4JYS A;  5GQB A;  1D6O A;  1Y0O A;  4TX0 A;  2JZV A;  1J4I A;  4Z2K A;  4JFK A;  5HBF A;  4MSP A;  3JXV A;  1NSG A;  2FDM A;  3I6C A;  4W9Q A;  1E9L A;  2AWG A;  2PPO A;  3PRB A;  1FKI A;  2ZQS A;  1LG2 A;  1X6N A;  3AS2 A;  2EUL A;  1F8A B;  4Q22 A;  1ZBK A;  3O5J A;  3EY6 A;  3ARP A;  2WLY A;  1EIB A;  4JFM A;  2MF9 A;  5HW7 A;  3RM8 A;  1YW5 A;  1BKF A;  4KR0 B;  3B9A A;  3O5P A;  4DRQ A;  1GOI A;  1B6C A;  3WL1 A;  3UQA A;  4Z2L A;  3RME A;  4MNJ A;  3BXW A;  3CH9 A;  1ZBW A;  2LJ4 A;  1QZ2 A;  1SR0 A;  2WM0 A;  3O5G A;  3KAH A;  4ITZ A;  3B9D A;  3ALF A;  2RUR A;  3WQV A;  4LAV A;  2QF8 A;  4MGV A;  2XP9 A;  2ZR5 A;  3IKG A;  4J4N A;  4UDM A;  1WAW A;  3CGM A;  1HJW A;  2YBU A;  4DRP A;  1A7X A;  4NZC A;  1P5Q A;  3KAG A;  4QT3 A;  4BF8 A;  1HKJ A;  4ODL A;  5I98 A;  2DSZ A;  3KAI A;  3WD1 A;  1U79 A;  4IT6 A;  1JCH B;  1C9H A;  1KFW A;  4JFJ A;  3PA7 A;  4TYO A;  2RQS A;  2WLZ A;  1FKL A;  1TFV A;  3AQU A;  4ZPW R;  1E6Z A;  2DSU A;  2F4E A;  3ARV A; 
#chains in the Genus database with same CATH homology
 1W1V A;  2DSV A;  3B8S A;  4W9P A;  1EQ3 A;  4ZPV R;  2ZQT A;  3O5O A;  2UZ5 A;  2DPE A;  5BXJ A;  4LAY A;  1RD6 A;  4LAX A;  1T11 A;  3WH0 A;  5GPR A;  1EDQ A;  2XP4 A;  4U84 A;  3ARZ A;  5HWB A;  2ZR6 A;  1W1P A;  3RM4 A;  3CHC A;  4JFL A;  5DO2 A;  1LL7 A;  1D2K A;  1FAP A;  4MTV A;  2XP8 A;  1QPF A;  1JVW A;  1FFR A;  1N1A A;  4DT4 A;  4DRI A;  2KGJ A;  5HUA A;  4MNM A;  3WD4 A;  1JNT A;  3FXY A;  3KCE A;  2XPB A;  5DIV A;  1J4H A;  1HJV A;  4ZPT R;  4FN2 A;  4DWS A;  4DZ2 A;  1HKM A;  4WKA A;  4P8V A;  2ESC A;  3ARU A;  2LKN A;  1OGB A;  1EYM A;  3ARX A;  1VF8 A;  5B8I C;  1GPF A;  1OGG A;  4DWS D;  3B9E A;  4DRK A;  2ITK A;  3ARQ A;  4ODO A;  3WL0 A;  2G8Z A;  2XPA A;  4Z2I A;  1FKH A;  4LAW A;  4NSB A;  2A3A A;  2VN1 A;  4NNR A;  1TCO C;  3CHF A;  3O5L A;  4TW7 A;  4O2T A;  1ZK6 A;  2WK2 A;  1M5Y A;  2M2A A;  1ZU8 A;  2RUQ A;  2DT1 A;  2A3C A;  3CGN A;  3FY1 A;  3G6L A;  5HW6 A;  2PPP A;  5JH8 A;  4HBE A;  1W26 A;  4WKH A;  4ODM A;  4DZ3 A;  4P8W A;  3AS0 A;  4G50 A;  2DT3 A;  4W9O A;  4JFI A;  1LQ0 A;  2AOS A;  1JND A;  3ODK A;  4ODK A;  2OLH A;  2MNT A;  3TC5 A;  4GIV A;  4URI A;  5HWC A;  3LUO A;  1ZBC A;  4WJX A;  1GUV A;  2LPV A;  3RM9 A;  5J6E A;  3WKZ A;  3JYJ A;  3CHE A;  2A3B A;  5GPG A;  3IK8 A;  1FD9 A;  3G6M A;  3O5I A;  1NMV A;  1YAT A;  1HXV A;  3QOK A;  4KQZ A;  1J4R A;  4L3N A;  1ROU A;  3PRD A;  4MNK A;  2PI6 A;  1ZBV A;  1ROT A;  3ARY A;  4HAR A;  3MDY B;  2N87 A;  1W9V A;  4S3J A;  3O5R A;  4Z2H A;  1ITX A;  1SYT A;  2DT0 A;  4L72 B;  2A3E A;  2L2S A;  3W4R A;  2KFW A;  1K9T A;  1FKJ A;  3UF8 A;  1NWU A;  2XP5 A;  3PRA A;  3WD2 A;  4GGQ A;  3O5K A;  1FJD A;  3TCZ A;  2DG9 A;  3NRK A;  2Y78 A;  4TW6 A;  1E6R A;  3UQB A;  4R5E A;  1LL6 A;  3ARS A;  3CZ8 A;  3NTP A;  4P8X A;  2MLX A;  1E6P A;  2M08 A;  3UI4 A;  4XAK A;  2D9F A;  1W1T A;  1NH6 A;  1EHN A;  4R0X A;  4MNL A;  1Q6H A;  4QT2 A;  1W1Y A;  1FKR A;  3OOB A;  3VAW A;  3ALG A;  3AS1 A;  1IX5 A;  4TW8 A;  5D75 A;  2MPH A;  4P8U A;  1X6L A;  1E15 A;  2Q5A A;  4W5U A;  2O9O A;  2PBC A;  1PIN A;  4QIB A;  4DRH A;  1FKF A;  1J6Y A;  1FKD A;  1LG1 A;  5HTG A;  4HBO A;  1XHG A;  1ZCN A;  4WKF A;  3O5F A;  1D7J A;  4ODN A;  3RGC A;  4DRN A;  4IT4 A;  2K8I A;  3B7X A;  5HW8 A;  2B31 A;  4FAP A;  3OA5 A;  5DIU A;  1HKK A;  4C02 B;  2G41 A;  2DT2 A;  3ARO A;  3GPK A;  3RFW A;  1JNS A;  1H0I A;  1LL4 A;  3WIJ A;  1Q6U A;  3CHD A;  3FAP A;  2KI3 A;  4DIP A;  2XP6 A;  3O5M A;  1Q6I A;  4Q7N A;  1W9U A;  1D7I A;  3UQI A;  4Z2J A;  1W9P A;  5DEZ A;  3UI5 A;  2O92 A;  3IHZ A;  3O5D A;  4PTM A;  1NWR A;  3KZ7 A;  1F40 A;  4ZS6 A;  3KAB A;  1UR8 A;  2MLY A;  4LGX A;  1NWT A;  2DG4 A;  2YBT A;  4IQ2 A;  2PV1 A;  4AY1 A;  2LGO A;  2KO7 A;  1HJX A;  1FKT A;  1UR9 A;  3PR9 A;  3WD3 A;  1R9H A;  1Q1C A;  4WK9 A;  2XP7 A;  2VCD A;  4QZV B;  2IF4 A;  3TDB A;  1L1P A;  3ARW A;  1FFQ A;  2KR7 A;  4ODR A;  1NWS A;  4WIW A;  1NMW A;  1KT0 A;  4N19 A;  4TNS A;  2RSE A;  1H0G A;  4DRO A;  4U86 A;  2DSW A;  2IUZ A;  2RUC A;  3WQW A;  3NI6 A;  1ZL1 A;  2PV2 A;  2ZQV A;  2PPN A;  4ML4 A;  1FKG A;  1FKS A;  1KT1 A;  4DRM A;  4ODQ A;  3O5E A;  4DWS C;  4S3K A;  1WB0 A;  4G2P A;  4DRJ A;  1XRV A;  2FAP A;  2ZR4 A;  3IKD A;  2F2D A;  2MLZ A;  2FKE A;  2RUD A;  3KAF A;  2KE0 A;  1PBK A;  2OFN A;  3UI6 A;  1BL4 A;  1ZB5 A;  1HKI A;  5HKG A;  4IPX A;  4Z2G A;  1D7H A;  3KAD A;  3O5Q A;  1WNO A;  3WD0 A;  1FKB A;  1CTN A;  1OWQ A;  1LJY A;  3ARR A;  5DF0 A;  4ODP A;  2M1I A;  5HT1 A;  2PV3 A;  1QPL A;  2ZQU A;  3JYM A;  2DG3 A;  2F21 A;  3KAC A;  5DIT A;  4U85 A;  4MAV A;  4DWS B;  4DH0 A;  4J4O A;  4MPK A;  3AS3 A;  1E6N A;  4IQC A;  1JNE A;  1O6I A;  1FKK A;  3H9R B;  3ART A;  2XP3 A;  4JYS A;  5GQB A;  1D6O A;  1Y0O A;  4TX0 A;  2JZV A;  1J4I A;  4Z2K A;  4JFK A;  5HBF A;  4MSP A;  3JXV A;  1NSG A;  2FDM A;  3I6C A;  4W9Q A;  1E9L A;  2AWG A;  2PPO A;  3PRB A;  1FKI A;  2ZQS A;  1LG2 A;  1X6N A;  3AS2 A;  1F8A B;  4Q22 A;  1ZBK A;  3O5J A;  3EY6 A;  3ARP A;  2WLY A;  1EIB A;  4JFM A;  2MF9 A;  5HW7 A;  3RM8 A;  1YW5 A;  1BKF A;  4KR0 B;  3B9A A;  3O5P A;  4DRQ A;  1GOI A;  1B6C A;  3WL1 A;  3UQA A;  4Z2L A;  3RME A;  4MNJ A;  3BXW A;  3CH9 A;  1ZBW A;  2LJ4 A;  1QZ2 A;  1SR0 A;  2WM0 A;  3O5G A;  3KAH A;  4ITZ A;  3B9D A;  3ALF A;  2RUR A;  3WQV A;  4LAV A;  2QF8 A;  4MGV A;  2XP9 A;  2ZR5 A;  3IKG A;  4J4N A;  1WAW A;  3CGM A;  1HJW A;  2YBU A;  4DRP A;  1A7X A;  4NZC A;  1P5Q A;  3KAG A;  4QT3 A;  4BF8 A;  1HKJ A;  4ODL A;  5I98 A;  2DSZ A;  3KAI A;  3WD1 A;  1U79 A;  4IT6 A;  1C9H A;  1KFW A;  4JFJ A;  3PA7 A;  4TYO A;  2RQS A;  2WLZ A;  1FKL A;  1TFV A;  3AQU A;  4ZPW R;  1E6Z A;  2DSU A;  2F4E A;  3ARV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...