3ME5A

Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457t
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
452
structure length
414
Chain Sequence
NAAQAMLEKLLQIYDVKMLVAQLNGVGENHWSAAILKRALALSEKEFAHLQTLLPKPPEHHPHYAFRFIDLFAGIGGIRRGFESIGGQCVFTSEWNKHAVRTYKANHYCDPATHHFNEDIRDITLSHQEGVSDEAAAEHIRQHIPEHDVLLAGFPCQPFCDTQGTLFFDVVRIIDARRPAMFVLENVKNLKSHDKGKTFRIIMQTLDELGYDVADAEDNGPDDPKIIDGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKGMVYPNNPQSVTRTLSARDGAEILIDRGWDMATGEKDFDDPLNQQHRPRRLTPRECARLMGFEAPGEAKFRIPVSDTQAYRQFGNSVVVPVFAAVAKLLEPKIKQAVALRQQEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytosine-specific methyltransferase
publication title Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457T
rcsb
source organism Shigella flexneri 2a
molecule tags Transferase
total genus 136
structure length 414
sequence length 452
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.140 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3me5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3me5A02
3.90.120.30 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase; Chain A, domain 2 3me5A03
1NV8A 3EGEA 5DTMA 7MHTA 2I9KA 1XTPA 4B17A 2PVCA 5EMKA 3TPZA 1JQ3A 3ERCA 1M6YA 3KPVA 5CIYA 5HFJA 3UJAA 4A6EA 1XCLA 3MCZA 4KW7A 2GH1A 4DCGA 4POOA 5EQJB 2ORED 2IH5A 5CVEA 2OYRA 3G5TA 1H1DA 3TKAA 4OX9Y 1NBIA 2O06A 3C3PA 3E05A 4HTFA 5EKUA 5K0CA 3HCCA 3P9KA 4QPNA 4EMSA 4F85A 4PYJA 2E5WA 1NV9A 5DM0A 3DLIA 3DULA 5DM1A 5EKXA 3PLAE 4DKJA 5GIOE 5IKMA 3R3HA 3HCDA 4IWNA 1JQDA 3O4FA 2JH9A 2IH2A 5ICCA 2R6ZA 3G2OA 2PWYA 1Y8CA 2QRVA 1R8YA 5FCDA 2C7PA 3FYCA 3O7WA 4HTFB 1EIZA 1R74A 4GC9A 5K03A 2PV0A 3B3FA 2AOVA 5E9QA 4YMGA 3P97A 2H1RA 3EVAA 2QM3A 3UZUA 1KPGA 3KQTA 5BP7A 5LQRA 4PCAA 3CC8A 2OBFA 1FP2A 1VIDA 5CUQA 2CMGA 4PYLA 5DXJA 2XBMA 4X60A 3MAGA 3IYLW 5DM2A 2I62A 4RYLA 1RJDA 3DLCA 1JR4A 3GRZA 3DP7A 3FUWA 3GGDA 1O54A 3VC2A 4YV2A 1YB2A 4RTRA 2UZ4A 2PWPA 1INLA 2G71A 2WA2A 3PB3A 4A6DA 4R8SA 4XUDA 5D1HA 1YZ3A 3OFKA 2BR3A 3SM3A 2VZ9A 3NW9A 2GPYA 3EGVA 3FUVA 2VDUE 2DULA 3OU7A 4QTTB 4HG2A 5LQNA 3KPYA 5E9WA 1NW5A 3C0KA 1P91A 2EJTA 4LWOA 4E30A 3MTEA 4GOLD 3UA3A 5FADA 1X1CA 3FUUA 5GM2A 4QDJA 4EKIA 3CCFA 2PKWA 1YUBA 3G89A 3LSTA 4JXJA 5EMMA 2IFTA 5K01A 5FA8A 2ONZA 4HGZA 3GRYA 4R6WA 5LQKA 1SKMA 3A4TA 1AQJA 3BT7A 3MB5A 1XDSA 3C6MA 1NBHA 2QE6A 4Y30A 5LQCA 4RTSA 3A27A 5CVDA 1YFLA 3EGIA 4OBXA 5B1SA 4RVFA 4CWAA 4QVGA 3E23A 4PGGA 4U7PB 1Z3CA 4DZRA 2VS1A 5EHGA 4GUAA 5KYGA 3AY0A 4AUKA 2LD4A 3KPWA 4FSXA 5CD1A 1YF3A 3REOA 3ME5A 3KQSA 2OY0A 4FZVA 10MHA 4RTLA 4MHTA 5FULA 3UJBA 2O0LA 2JJQA 3K6RA 2YXEA 3KU1A 4FSDA 4RVDA 1VL5A 2NNWB 2B3TA 4WXHA 1EAMA 5HIIA 1D2CA 3PFGA 5CVUA 1UFKA 3HVJA 2FHPA 3GWZA 3M6WA 4GBED 1RI4A 2AS0A 1X19A 2AN5A 2ZIGA 2ZBQA 4HH4A 5EMLA 5EEGA 1I9GA 3DMGA 5DSXA 1R6AA 5EZQA 4PIMA 1JTEA 3DMHA 5GWXA 1WY7A 5G02A 4QQKA 4MWZA 4PYKA 3NTVA 5LSAA 4RTJA 1DCTA 1RJEA 3C3YA 1I4WA 2BH2A 2NXJA 2P8JA 2ZBRA 4BY9E 3NDJA 4AZVA 3HP7A 5EOVA 3M33A 5DRYA 4XUEA 3EVDA 4HSGA 2IBSA 1IXKA 2CMHA 5JR3A 3FTCA 2B2CA 4CKEA 5K05A 1FBNA 1ZKDA 2V7EA 3SXJA 3JWJA 5MHTA 3EVZA 3G88A 3P2IA 3UJDA 2C7QA 5KS2A 3A25A 2C7OA 2Z6QA 1BHJA 5EC8A 5C1IA 2BZGA 2ZW9A 4E2YA 2ZLBA 1AF7A 5EIWA 2ZIEA 4ZTBA 1XXLA 4ATNA 3Q87B 3G2QA 2XVMA 5EGSA 2IBTA 4FT4A 1SQGA 4GF5A 3THSA 2CKDA 4RTQA 3NJRA 4GQBA 4FS8A 3LX6A 4ER0A 1NW8A 3R24A 4DF3A 1VQ1A 1WS6A 2BM8A 3BWYA 5HIKA 1V39A 1WG8A 4AZSA 2P3LA 2FRXA 1KPIA 5K0GA 3KQMA 4PYQA 4BP1A 2YQZA 3QOWA 2ZTHA 3LKZA 4ER7A 3G7UA 4YUWA 4R6XA 3TQSA 1G8AA 1VP9A 3FUXA 3EPPA 3BGDA 1ZGJA 4YV1A 2ESRA 3GJYA 4OA8A 1SUSA 3SGLA 5DRTA 2ZWVA 4E2ZA 5P8WA 3DXYA 3QOXA 2AN3A 3LCUA 4UOEA 3BUSA 2GAFA 4HGYA 4ER3A 2P7HA 3A7DA 4OA5A 2FK7A 4PIPA 4EVIA 5K8VA 1XDZA 3TM4A 2CL5A 4PNEA 2YVLA 3FTFA 1FJXA 1UWVA 1JTFA 2HMYB 4MIKA 3P8ZA 3MERA 4KIFA 2GA9A 2P3OA 2DPMA 1ORIA 4C03A 3KR9A 3FTDA 5EPEA 1QYRA 3FPGA 4C08A 2P41A 2CWWA 3FPEA 1G60A 2PXXA 1TW3A 2PT6A 5DPMA 2P35A 3LKDA 5ICGA 5FHQA 2IP2A 5LQJA 4E32A 5M5BA 1KYZA 2FPOA 4YUVA 5EVJA 2XYVA 3KQWA 4IV8A 2ZULA 5DX8A 3S68A 4ER5A 4PCLA 3LPMA 3TM5A 3KPUA 5EG5A 1EG2A 2N47A 2ZIFA 4YMHA 5KQSA 2Z6AA 1QAMA 3LDFA 4X1OA 3HA5A 2AOWA 4F86A 3NVMB 3TLJA 2F8LA 4E33A 2Z6UA 5E8JA 5EIFA 3EVCA 3I9FA 2FK8A 3GRVA 3KHKA 1ZG3A 5E9JA 4RWZA 9MHTA 1IM8A 3KKZA 3DMFA 4P7JA 3HCEA 3JWIA 4PYNA 5JUWA 3L8DA 2P40A 3F4KA 3IV6A 3MTIA 1WZNA 4K6MA 4IV0A 5GP1A 4EQZA 3OE4A 1MJFA 4PINA 3E7PA 2IPXA 5K0LA 2XYQA 1HMYA 2VDWA 3MGGA 5T67A 4E31A 4Z2YA 3JWHA 3H2BA 5CM2Z 5E8RA 1OR8A 2XYRA 2NXEA 3GIWA 3R0QA 4WVLA 5ICFA 3TFWA 4E70A 5FA5A 2HWKA 5DT2A 4EK9A 1FPQA 1HNNA 2G8NA 4RV9A 4DM3A 4EKGA 5DM4A 2H00A 3TRKA 2I6GA 5BXYA 1T43A 3FRHA 1JG1A 3ELWA 3GRRA 4RVHA 2GS9A 1F38A 1PJZA 4QQNA 3M6VA 5FWAA 2K4MA 1DUSA 5T6BA 5DX1A 3HCBA 2XVAA 3NVKI 3P9IA 3GU3A 3RIEA 3EVFA 2ADMA 4YUZA 3R6TA 2AOXA 4KDRA 3OZRA 3EEOA 3A7EA 1TPYA 4AZTA 3NWEA 2UYOA 2EG5A 3ER9A 2WK1A 1EJ6A 2OO3A 5T64A 4FP9A 4BLUA 3M70A 4OQEA 1RI3A 2YUIA 2ZWAA 3OPNA 3CJQA 4P58A 3PFHA 5FHRA 2WA1A 2OKCA 5CCBA 3R9XB 2YXDA 2ZSUA 1QZZA 3EVGA 4XUCA 2ZBPA 1AQIA 4OQDA 5CVVA 2HR1A 4FR0A 3VC1A 5GINE 3FUTA 2AR0A 4M7RA 3TOSA 5LQAA 2AVNA 5BW5A 1I1NA 5K0BA 3OZTA 3HA3A 1L3CA 3UJ8A 4AZWA 2BR5A 3B89A 3OE5A 1XVAA 1QAOA 4MQ4A 3ORHA 3SX0A 3B3GA 3QV2A 4PONA 3P2KA 5K0JA 2QYOA 1P1CA 4KWCA 4O29A 3LBFA 2ZFUA 1VPTA 3BGIA 3PVCA 5K0FA 2ZZMA 3D2LA 1WXXA 3M6UA 5KVAA 3A26A 1VE3A 3SR4A 4P7KA 3GRUA 5KQRA 4GEKA 4LG1A 1XDUA 4HRAA 4DMGA 3LDUA 1D2GA 3UJ9A 2OB2A 1R8XA 3AXSA 1EQAA 3VYWA 2UYHA 4FT2A 3UFBA 2PT9A 2P7IA 4RVGA 3I5UA 3LBYA 1NKVA 3BZBA 5DLYA 3DH0A 3NWBA 5K0EA 1BC5A 1NW6A 3BWMA 4X41A 5GIPE 4DA4A 1Q0SA 4DQ0A 3LHDA 1R00A 4DCMA 4YUYA 5EMJA 1X1DA 4PYIA 4E2WA 5CCXA 3HVIA 2FYTA 3DUWA 5DX0A 5DWQA 1YFJA 3PX2A 2Q41A 1P1BA 4P7FA 1MHTA 5H02A 4C05A 3DXZA 3KR1A 3UJCA 1X1BA 1ZGAA 2B25A 3FPHA 3E8SA 4KRGA 5FQOA 1KR5A 4CKCA 3HEMA 5EZSA 2ONYA 5HIJA 1U2ZA 2AN4A 3G8BA 2NP7A 3THRA 4X63A 3FZGA 2IDKA 1KIAA 3OZSA 2B78A 3BGVA 3OU2A 2YR0A 2ZZKA 3HCAA 2O57A 2P3QA 2JG3A 3GNLA 3BKWA 2NP6A 4V0RA 1RI1A 3ANXA 1UIRA 2AOTA 4M37A 4C06A 4LECA 3B3JA 5E1BA 4QVKA 3FPFA 3T7TA 5EHIA 5HEKA 1PRYA 3CJTA 4IKPA 4U7TB 3I64A 3ELDA 3UBTA 1NT2A 2YTZA 4GOOD 1KP9A 1RJFA 3ELUA 4X61A 2PGXA 2I7CA 2HNKA 1JSXA 2AVDA 3KQYA 4RTOA 2AOTB 1L9KA 3SSMA 2KW5A 2IIPA 5DTRA 2A14A 1VBFA 2H11A 2NXCA 5DXAA 1TW2A 3SVZA 4C04A 4F84A 3WSTA 5K09A 1R18A 4PGHA 3U81A 2V74B 4C07A 3ER8A 2JHCA 2YXLA 3GCZA 3I53A 3MHTA 1SVUA 1F3LA 1FP1D 3HM2A 3VSEA 3HVKA 1KYWA 3G2PA 3ID6C 1G8SA 3LDGA 2PBFA 3RODA 3T7RA 3PTAA 2C7RA 3LECA 4CKBA 3V8VA 3CBGA 2IH4A 3EMDA 3UJ7A 2AOUA 5E1DA 3HVHA 2PX2A 2PX4A 5C9ZA 5HZMA 1G6Q1 1P39A 2HTEA 4BLVA 2QRVB 2ZVJA 2GLUA 2BR4A 3DXXA 5U4XA 3M4XA 3FRIA 4NECA 2YX1A 2NYUA 5F2OA 2JHPA 5F2NA 2O07A 2OZVA 3SSOA 1L3BA 1DL5A 3KR0A 2AOUB 2BM9A 3FYDA 1WXWA 5E1OA 2PX8A 2OXTA 2JHAA 1JQEA 4RTNA 1XCJA 4KIGA 2UYCA 4QPPA 3NMUF 2EJUA 3PT9A 5FQNA 3HNRA 3AJDA 3LCCA 4G56A 3UA4A 1ZQ9A 3UWPA 5LQUA 2OPBA 2PX5A 3V97A 3EEYA 5IH3A 2PXAA 3PX3A 4KDCA 1VP3A 1O9HA 4XCXA 4ISCA 4Y2HA 2GB4A 1N7JA 1NW3A 3KR2A 3T0IA 1QANA 4BP3A 2Y1XA 3KPJA 4RSRA 5C0OE 3G8AA 4BLWA 1VLMA 3P9NA 3AWIA 3IEIA 4MTLA 2ZZNA 1XJ5A 3TKYA 2EX4A 3OCJA 3LCVB 3HA7A 2PJDA 3CKKA 3K0BA 4PWYA 1AV6A 2PLWA 4RX1A 3JWGA 4M36A 3OFJA 1BKYA 3EMBA 4P7GA 4V0QA 3HTXA 1RI5A 3MQ2A 4RTMA 3BKXA 1QAQA 1SQFA 3AXTA 3CVOA 3PS9A 3G2MA 1NW7A 1IY9A 1O9GA 3P71T 5BW4A 4CXMA 1X1AA 3KQPA 3LL7A 2OB1A 1NE2A 3I58A 5ERGB 2PSSA 2R3SA 5FUBA 5D1NA 5LR6A 2VP3A 5ICEA 2O05A 3CJRA 4PYMA 4R8RA 1KHHA 1BOOA 1ZHFA 5K0NA 1Q0TA 2PXCA 5CVJA 2EFJA 2FCAA 3FPJA 5EEHA 5HIMA 3DOUA 1G38A 2ZCJA 1YZHA 2JH8A 3G5LA 2UYQA 4GC5A 1RJGA 1D2HA 1SG9A 3GO4A 4GOND 3DR5A 2G70A 3DTNA 5E2BA 3UJ6A 1SUIA 5GOZA 3B5IA 2AZTA 2B9EA 3SSNA 5HILA 2ERCA 5HOQA 1JG4A 4PYOA 3KQOA 3FTEA 4M38A 4AX8A 3SMQA 2VDVE 5FWDA 4HC4A 2NXNA 4FGZA 2HV9A 1M0EA 1JSZA 3P9CA 3RW9A 1L3IA 3T7SA 4CTJA 3Q7EA 1KPHA 4R05A 4C4AA 3NDIA 1JG2A 8MHTA 5DSTA 1N7IA 3MCTA 1RI2A 2IDJA 4L7VA 4LWPA 5E1MA 1JG3A 2PY6A 3GXOA 4YV0A 2P1DA 2G1PA 3BWBA 4QDKA 3ELYA 4ER6A 3CGGA 5DTQA 1N2XA 3M6XA 3P2EA 2Y1WA 5E2AA 2G72A 4CTKA 3GDHA 3TR6A 3C6KA 4H0NA 4QTUB 1G55A 1EJ0A 3EVEA 5F2KA 3OU6A 2QY6A 3X0DA 1B42A 3KQVA 1ORHA 2IGTA 3B7PA 1KXZA 3BXOA 3HCFA 3LGAA 4GOMD 1M6EX 1L1EA 3IHTA 4E2XA 4RTPA 4OBWA 4YUXA 3EVBA 3KQQA 5FTWA 5GM1A 3TMAA 3BWCA 4KVZA 3O31A 4RTKA
chains in the Genus database with same CATH superfamily
1F0YA 4O0LA 1IXRC 2AXPA 2OHHA 2ZYRA 2GFQA 1I10A 2XI8A 3SIXA 4ZZ1A 3FG9A 1EH5A 4IW3B 1OGIA 4RKEA 7MDHA 4GHWA 1N2CA 2V3CC 1T29A 1JYEA 2PLFA 2WIDA 1Z0AA 1YZGA 3OWOA 2OL4A 3PC4A 2OYRA 4AN4A 1P7PA 4JOBA 4NZZA 1JQKA 1NBIA 3C3PA 3QVVA 4HTFA 3T9EA 3KQLA 1WW2A 4QPNA 5JH7F 1RBMA 3K0AA 1NOJA 1ZN8A 3I6IA 3P4YA 2YH2A 4Q9JA 5DM0A 5JNLA 1DJLA 1KHTA 2DQZA 1A97A 2H48A 3QWBA 4GXRA 5GVRA 4C20A 4IFEA 2FEWB 2F43B 3L7YA 5IKMA 5JW6A 4LJ7A 2PG3A 1V5WA 1EGQA 1ZXBA 4Y6LA 3W3AH 2IZZA 3FKQA 3A11A 4FLFA 2R6ZA 2XMGA 3QVGB 2QRVA 1R8YA 4XLTA 1EIZA 5IUKC 2IXBA 3RE1A 4BVAA 3FHOA 3OCCA 5FA6A 1ZINA 2ZSEA 4MUHA 3IKLA 2H1RA 2AC7A 2J9FB 2X3UA 1Z36A 5IAGA 2FSPA 3MLAA 1TQ8A 5DWDA 4RD2A 2OBFA 2BFNA 1NQTA 4ZT4A 4PYLA 1WZ2A 5AI9A 3GJ3A 3IEUA 5KWJA 4LY9A 1C30A 3REFA 1UJ4A 2J3QA 1N9ZA 3MAGA 2PXPA 2VF8A 3EWIA 3ND7A 5TRTA 4ZKEA 4KVGA 3WYAA 4EFNA 1SUPA 2PTGA 1H3FA 2J48A 3WRVA 1HR0B 2FMTA 3EIQA 4EVQA 3NHMA 3NXHA 1CF4A 4XX1A 3CEMA 2CT8A 1SXJA 1FFWA 3KJGA 1HFJA 4HX9A 4EF4A 2V6BA 2O4UX 2VF7A 1YB1A 5EY5B 1A9SA 4G0QA 4D74A 5A02A 4G0WA 4BNFA 4BL5A 1YL5A 3A3PA 1ZU5A 1QQ7A 2ORWA 3H13A 1EEHA 2BBSA 5IJ0A 3AY7A 2PO7A 1W0JD 2Q5LA 2WZQA 4UTPA 1QP0A 2YIMA 1XMXA 4S12A 4K46A 3GRYA 4NAVA 4R1SA 1V25A 3GGCA 4P4TA 4ZI5A 1SXIA 3Q2KA 1AN9A 3E1GA 2XNCA 4LA4A 2CROA 1K86A 1C7EA 1D4AA 1R0YA 1RFLA 2WKQA 4MPDA 4N39A 2HSJA 2EIHA 1QV9A 2BDUA 2WMYA 3MMXA 4TV9B 3SZ3A 3GFPA 3VKFA 4QGBA 2V3VA 4KH0A 4RETA 3LVRE 1UBKS 3VVBA 5A5EA 1XSEA 2PUWA 3F5FA 3FYTA 3LP5A 3N53A 4GUAA 3K92A 4IUYA 4FCTA 5JZ9A 1ENPA 3T95A 5A3RA 4AJEA 1BKSB 2UVDA 3OE7A 4FZVA 4PX9A 2A9FA 4JYAB 5LYJB 3JQPA 3JAKB 4RVOA 4FBLA 1V35A 2FZWA 1ZGBA 2X6RA 2B98A 5JSFA 2WC1A 1J2JA 5E4JA 3V1TC 4X00A 5CFPA 3EH1A 5JD6A 4HDRB 3RB8A 1JAZA 4KH1A 1GD1O 4X93A 3B1VA 2RCYA 4NOKA 1Y7LA 1RI4A 3IP3A 1B6TA 3FIUA 1WXEA 1NRIA 1BVUA 2XMPA 1DKOA 1ZOPA 3PUXA 4D9FA 5JI2E 3N2YA 2XODA 4FMCB 4P31A 4KWEA 4Y6OA 4YCAA 5H16A 5JECA 1Y8RB 4QQKA 1PE0A 3U16A 4C7OA 1ATZA 5AUQA 3U3ZA 1JPUA 1KIFA 2HA3A 4B4DA 4BNIA 1P2FA 4KYUA 4P0TA 3LQFA 5J4VA 5ALGA 4ZMRA 4R54A 3OWHA 5F1YA 5K8IA 2OBNA 3R5TA 3SN6A 2F67A 3ZXIA 5IKXA 1U2GC 1MX1A 2H07A 4RVNA 2PXBA 1UXIA 4UPVA 1Q15A 4N0QA 4XIFA 5K05A 4C3OB 5CLQA 3UKDA 1WZIA 1I6MA 2QWXA 4ENSA 3IVGA 1VBMA 4GSLA 4IIBA 4LJAA 1EBUA 1NURA 1SUAA 1XDWA 4I1RA 4DW8A 2EG9A 2R00C 3F8SA 5K4GA 1E2PA 1FEZA 5KYUB 3MF4A 2BT4A 1MX3A 4O5AA 1NVVQ 2WJPA 1AF7A 4P22A 2BFFA 4WBXC 3FXAA 1GT0C 1PJ3A 1XALA 1CR6A 4JB0A 4XUGB 4R84A 1WSWA 1ZVJA 4TSFD 3QM1A 4DARA 1CNEA 2AYZA 2CKDA 2JA1A 4GOJA 4RANA 5AJVB 1YAJA 5AKYA 2YRWA 3WIEA 2QG9A 4ZZIA 2RD2A 1GL9B 1DEXA 4YXWA 4RYDA 2XOKA 2G9RA 3BTVA 2ICPA 2ZRAA 1MQ8B 2GO1A 3L5KA 4J0EA 4NNOA 5DMHA 4YG4A 1O89A 5KYWA 3T9CA 4BP1A 2H4YA 2JJ2A 4I5GA 4QJ4A 4X8LA 4R6XA 3AYXB 2EDCA 3LY8A 2ANCA 4FNGA 1LCDA 1NSYA 1YDGA 1JU9A 4K9DA 2Q5QA 1QRDA 1H66A 1V95A 2YN4A 2A6CA 2WJYA 4QYXA 3JAMA 3BJEA 4A36A 2C9MA 2FVYA 2GAFA 4L3VA 1FW6A 3GG9A 1A9XA 2FCRA 2FK7A 4B6RA 1X7WB 1WULS 4QPZA 4XX0A 5JSZB 5IBQA 1PQUA 5IHPA 4G25A 2ZE6A 1I2AA 5ECYA 3ZCXA 2JCBA 1D1QA 2H4JA 2QD5A 3Q40A 5AR1A 2J08A 3S2EA 5CEEA 2VQEB 3C98A 1DAEA 5ES3A 2W5UA 3LE8A 5F4BA 2RB4A 3PGLA 2DKFA 2PZGA 4DLWA 5D8DA 1NF9A 4L8LA 5ALYA 3KR9A 3IERA 5JY1A 3GAMA 1ZD1A 4CM8B 1Y6GA 2ZUTA 5BWLA 1P2SA 4G84A 2KPJA 1MFPA 1ZX1A 1X80A 3FPEA 3H99A 4O2LA 4WKGA 4XGRA 3V9PA 4Z5XA 1EDDA 1T4BA 3KZ1E 2D2VA 2JIZA 3B1WA 2Q8PA 1B3RA 2XNDA 3I9OA 4CIBA 4CR6A 1GL7A 1PBNA 3D5TA 4M9ZA 2GR9A 1TC1A 2SBTA 2RGWA 5FV4A 2HZBA 3BWEA 2XE7A 3QYFA 4IDHA 4WH0A 3A04A 3BSFA 2BZ0A 1OWLA 4OKNA 4AXXA 4U39A 1ENOA 3JASB 3REQA 4OHYA 3TLJA 1JHUA 2PU7A 3CHYA 2BGLA 3SJZA 4I4IA 5BN4B 3ZKAA 1SELA 3IHLA 3SR3A 4LDRA 2EZ4A 5JJKA 3JQCA 9MHTA 3WKCA 3HCEA 4RF5A 1SCDA 3GD7A 3BIWA 3DZGA 3O1HB 2GM4A 5TT0A 3UK6A 1G20B 3OBBA 5GP1A 1G291 5AYVA 3HFGA 4LF7B 5FO0A 4TLMB 1ZD8A 1ZN7A 2BEVB 4KI7A 2DP4E 5HK8A 1RKQA 5JAQA 3WRYA 3O3NB 4I99A 1KQFA 3HWX1 1BHO1 3DOCA 2O0JA 4RPLA 1A9TA 3K15A 4BIIA 4E1VA 5E6UA 4Q39A 1JR6A 2CMKA 1OH7A 3WYNA 3HJAA 2P9QA 2RFLA 2W2NA 4R40A 3ROZA 3BA6A 2WG1A 3CSUA 3IUPA 2XOEA 4FCCA 1LRLA 3F96A 1E2MA 1LQCA 4M1OA 2IUSA 5DGDA 3JVIA 3ERCA 1E79A 3OLQA 3QHPA 5DWVA 3NVKI 4RHFA 3N9IA 3K0FA 3QKWA 3G13A 5TS3A 3RRYA 1TVCA 3A7EA 3QXSA 4PY2A 4FGLA 4EH1A 2EG5A 4K0KB 3JAWB 2WJ3A 1M67A 2WU0A 1JJFA 3TLGA 4OMUA 2R8EA 1G16A 3F78A 4GR9A 4Y2JA 4EVSA 4BDTA 3QUAA 4H6VA 2EZ8A 3K9WA 1B41A 1MNQA 3TLXA 4TL7A 2L17A 4ASUA 4BFUA 2ZSUA 5BSVA 3KDAA 3NT4A 4IXWA 1N1GA 2KM1A 5CJ2A 2IX3A 2R63A 4OQDA 2OP1A 1L1FA 1J7JA 2VDMB 3ZGYA 4K88A 4L75A 2GOYA 2QE7D 4OQXA 3OICA 4K9SA 4RPKA 3OIGA 1AX9A 3V8BA 3KAKA 5AJZA 3K09C 1G66A 1L7DA 1XDDA 3HKEA 4KPFC 3WLMA 1DXYA 3LUAA 4H1TA 5AK4A 3E9QA 1TQ2A 2QYOA 4QBFA 1Y3HA 2BE9A 2QUIA 1VPTA 3QEJA 121PA 4GYWA 3DFFA 1P2BA 3ZWMA 4BKPA 3LQ1A 3SR4A 3BMXA 4BN4A 3GRUA 2C8JA 4MOWA 1MAAA 3QNWA 4AY2A 3X2SA 4J94A 1YS1X 4GWLA 3LA8A 3F2IA 4C0AC 4KV9A 2QJOA 5DU2A 1A1SA 1IXSB 3KJNA 3LK6A 3UJ9A 4CM6A 3B6EA 4US2R 2QU7A 4YS6A 3I28A 3MHPA 3WGHA 4RVGA 3CN7A 3DHNA 4D81A 4TGLA 5JAMA 1SBZA 1UC9A 5CT9A 3ZQJA 1V26A 3VPDA 2W43A 1FDWA 1KI9A 4GR5A 3TB6A 4DB4A 1P73A 3NRBA 1RP7A 2J9YB 1QRUA 2FYTA 2C92A 1N6OA 3U1VA 3H1FA 4KXUA 2HKIA 3IAUA 2Q7DA 1P1BA 1ACLA 1OYWA 2B25A 3AHEA 3FDFA 3L1VA 3A6GA 1A2OA 1DMSA 1Q22A 4CR7A 1TO6A 4C1BA 1NQUA 1U2DA 2IXFA 4BU1A 1PS0A 2AN4A 1PVDA 2HCRA 2VAPA 1SZJG 2BEWA 2ZAOA 4ZRDA 4UVDA 3T4PA 3WSWA 1OH8A 3HDVA 3OSUA 5PGMA 4ZJYA 1UBGA 3CXUA 2A8YA 3MCWA 2CNNA 5LVAA 2H92A 5AWFC 2G4CA 5A9SB 2PL5A 4WDQA 4WY2A 5SZIA 3PPYA 4C88A 1PWYE 1ZGHA 4JZYA 4M6WA 2AOTA 3JATB 3DMRA 1N0HA 5M29A 1RYNA 1VE1A 2I29A 3QLUA 4XJXA 1TAUA 1D1PA 1IZ8A 1WXIA 2WINI 3HJUA 1DDOA 2GKOA 3I64A 2EX1A 3ZNOA 3BFJA 5AK6A 1ZRNA 2PX0A 3DHYA 4TV8F 3W5DA 3CRVA 2QB5A 1GQRA 4GDMA 2QENA 1LDBA 3DBLA 2DQYA 5I7OA 2J8ZA 2Q4DA 4G1BA 4DTCA 1JFFB 3JQAD 1TQ6A 3T52A 4ZICA 2BFEA 1T8SA 4UVGA 4ZVUA 5FX2A 4PXSA 1VLVA 1QGAA 3AJ8A 3PUKA 3OLCX 2EVWX 3I53A 4WESB 2NO6A 5FPKA 3BK7A 1S6YA 2YZ7A 1CC1S 2J5XA 2J1LA 2OK7A 4AP5A 1X1RA 1HH4A 3GK3A 3SJCA 4G8DA 2XD9A 5BQFA 4X4BA 3GN5A 1C0PA 1WB5A 3T5AA 3ZW7A 2J0UA 1OOEA 2BCGY 5HZMA 1N3LA 1NVWQ 1USIA 1RMQA 1YJXA 4LW8A 2BI7A 2QBYB 4XJTA 5CRIA 2I78A 2GLUA 2WJAA 2EJWA 3DXXA 4HDSB 4W8OA 3G2HA 4RA6B 3T7DA 2PUEA 1TJ5A 1XU9A 2BP7A 4HLNA 4IP0A 2FX5A 3TRIA 3YASA 2JHPA 4MEAA 3SSOA 2E2WA 2Q2NA 1X77A 2BHRA 3KR0A 5DBHX 4B74A 1WXWA 3HYTA 1FUKA 2UYGA 4AJJA 2XRMA 3C5HA 2YWRA 4MVJI 2WYOA 5FWYA 2JI7A 3VO8A 1DJQA 3BMNB 2EJUA 4A5OA 3KSUA 4ZGBA 2ZYSA 5D3QA 3R3YA 4J2OA 2JGKA 3K0KA 3L6CA 5LQUA 3KXIA 4P34A 1T4GA 3PEYA 4MHSA 3UXEA 4DJAA 1C1DA 4QJ3A 2F3RA 1N9GB 1QTRA 3URMA 4AIRA 3RSZA 3V9AA 4R01A 4GYKA 3ZXSA 1B2RA 1YZNA 3AP1A 3AHHA 4Q9LA 2UVPB 3S1AB 2P0YA 4B3DA 3AESB 3GMSA 1SKYE 3A1TA 2E89A 3ZDQA 5BUCA 5GZ1A 4TV8A 4LQLA 3KKLA 3IR6A 3N8KA 4YN3A 3SYMA 5C7LO 4NMLA 4NLLA 2HWWA 3WNVA 1NXQA 4R4JA 1NDQA 2X0RA 3KE8A 4GKAA 1FNNA 3F98A 4F4CA 3E9YA 1OWNA 4EY6A 2VSFA 4WT7A 2DUMA 5LIPA 4RHUA 1OTHA 3VPCA 4URHA 4WFQA 1O9GA 4XM2A 4XQEA 1MMFB 3RTAA 1PI3A 1X1AA 3U62A 2CXXA 1OXVA 2FR8C 1D6JA 2D5IA 2C8LA 2KS6A 2OB1A 3PLNA 1BMDA 4IBOA 4JSTA 3UMBA 1NJ8A 1TT5B 4N54A 4OK6A 1R0BA 2QROA 3LUJA 1ZOIA 4I08A 3U6KA 1M6NA 1PRUA 5CVJA 1KDVA 3WMXA 4CHGA 2JGJA 4D4LA 1NVMB 3S7TA 4TTJA 3Q8MA 3WE7A 1VL1A 2ZR0A 1IBKB 2LGJA 4FKZA 1DC3A 3R5JA 5D00A 2IHJA 3HABA 2CHFA 2I1WA 5E3JA 3WGKA 1XZ8A 3CECA 1EFHA 4JI1B 2VJPA 2EP8A 2B9EA 1TVKB 1CRLA 2ERCA 2IYSA 1JALA 2B5WA 4HK4A 3FTNA 3Q41A 1DSSG 2ZT6A 3ZK9A 1T5BA 4Q2JA 1LBHA 1AQYA 2XZOA 1CHDA 3SCGA 5B2EA 3UATA 3EN0A 3RW9A 2BEUA 4KR2A 1BCRA 1MR3F 2QRPA 1R4MA 2WWHA 1A04A 2Z30A 2ZVDA 3WS7A 3PC8A 2O3SA 2P1DA 2DM6A 1E20A 3OHPA 4YCCA 4YT8A 2GCIA 3G0IA 5CX1B 1ZK1A 3EFHA 3A4YA 2JGFA 3MGCA 3OZBA 3P2EA 5DZSA 1MCZA 5KCMA 5LBIA 4B71A 1KYYA 3TLBA 1PWZA 1PDVA 3B1XA 3R6WA 3U7FB 1N78A 3Q6NA 4QGGA 1GLGA 1EQUA 2EQBA 4RS3A 5F2KA 5CA0B 1B42A 4KK4A 4OGWA 1Z06A 4K6MA 2K87A 4GQMA 4XPZA 1M6EX 4F6LA 1M7BA 4WLNA 2G40A 2DHDA 3O92A 1ZSVA 3W79A 2P5TB 3QKIA 1OU0A 3BMQB 4BE9A 2G9ZA 7MHTA 1R6XA 2PVCA 2WKWA 3IVMA 3KPVA 1E59A 1YCFA 1RD4A 5K0SA 3UJAA 4POOA 5AUNB 1E9FA 4HQFA 4DCGA 4TTIA 2RHHA 1CUXA 1NHWA 1SA0B 5JMWA 1E66A 2HHAA 1EX7A 1UK7A 1QQ5A 4M8KA 1LNSA 4NENB 5BQ3A 2CJFA 3GLVA 4ZYZA 1W36C 1GTRA 3ZDBA 1RT9A 2FFQA 4ZMSA 1E6MA 1RZRA 3JQDA 1Z2AA 3RNOA 3R3HA 3NEYA 4BNWA 4TQGA 4ZT3A 5LN1A 5L7WA 2VSOA 4KRXA 1WHSB 4ZI7B 3G2OA 3B85A 1YA4A 2R4TA 3VDQA 2C7PA 2ZRCA 2GHTA 1R74A 1HDXA 4O4LF 1F7UA 3VI4B 2O3RA 4YALA 5E9QA 4RM3A 1A9PA 4B79A 3EVAA 3NPAA 2HWXA 4IGEA 2IX9A 3E35A 4E5SA 5LQRA 1Y4SA 2JKYA 5FJIA 4DJFC 1N2BA 2JJ8A 2B30A 5KJEA 1Z38A 3GF4A 1T8PA 2Q8QA 4OH7A 5DBOA 1EUYA 4CCWA 1Z3IX 3IYLW 1JVBA 1ZS9A 1CUDA 2OCYC 2I7XA 1OZFA 4G5SA 4NC9A 1O54A 2RIPA 1A8QA 1UPXA 5JJCA 1H1TA 2PS9A 5EP1A 2QXYA 3IP5A 1ZM3A 4M0CA 1XQXA 3EDQA 5IDXA 2CXTA 4DLTA 2O2DA 3JPYA 4J1WA 2PL9A 2EP7A 2KMLA 3U4AA 4L57A 4X1KA 1UOQA 4BLOA 1GAJA 3R7BA 4O4IA 1GZSA 1GPNA 1P91A 4R9SA 4U6NA 4QDJA 4EKIA 3CLKA 2PKWA 1E92A 2XJ3A 2WTEA 4G65A 5IJAA 3ND9A 1CBUA 2IU6A 4MITA 3R9KA 3RWBA 2PVSA 3SE7A 4UU0A 3BT7A 3ASYA 4R6WA 3SQLA 3HKDA 4QUDA 1L4FA 3ZGLA 5KVQA 2QQGA 3C6MA 3AHDA 1GQFA 1PR3A 1AUOA 2YCBA 4MVJE 3RSCA 3DDHA 1LPPA 2QRLA 4URUR 3EIFA 3CROL 4LDNA 4BX3A 3GLIA 1N34B 1P7YA 3C41J 2VEOA 3PNLA 3ZJUA 4EGQA 3C70A 5EHXA 3GT3A 2P27A 1U7HA 1SIWA 1CUVA 2VDWB 4Z8YA 2Z83A 3GYGA 5AVTA 2TMDA 1RADA 2J4CA 1MJGM 2X4DA 5E0KB 1TIPA 3ZGOA 3AERB 3HWSA 3BCUA 3TIVA 2CFRA 4WE3A 2G9VA 4O4LA 4XASA 3EAFA 1KWGA 3S55A 4P3YA 1MA0A 3K6RA 4P35A 3ZDYB 3VMFA 3N2IA 4EFDA 3SQMA 2PUTA 1LLUA 4TVSA 4ABYA 1Z5UA 3E6AA 5A3SA 2ZBVA 3Q0IA 4MS3A 4CFZA 1OFIA 1QRRA 3NG1A 1W0CA 4KLCA 4DTIA 5I7AA 5BOSA 1CR2A 4ZVTA 3BZUA 4GBED 1NP6A 2FPRA 4R98A 1M2FA 4BWYA 3TGPA 4JJFA 3WV4A 2DXIA 1X15A 1O4VA 1T2DA 1T6XA 3CF6R 3JR3A 4REMA 1N8NA 1AQLA 2H4HA 1E61A 1T3HA 1UKVY 3U3OA 1Z7GA 3W4JA 4B8WA 5CDGA 1DFHA 5HX7A 4FD3A 4MWZA 4C4TA 1JIVA 1TDJA 1Z6PA 2IY9A 2NXJA 1RBYA 2VSYA 4OD0A 2ZB3A 3KKOA 1WDMA 3NDJA 4AZVA 3P2OA 1YL6A 2VUHB 4E4TA 1NXXA 3LM8A 3HJHA 3RUHA 2CMHA 1C7IA 4WKCA 5J1TB 4B3FX 5JYDA 2OV4A 2XB9A 3W06A 4F3NA 3F6YA 4OAOA 5KC8A 1VMIA 3RU9A 2QORA 4XGNA 1JN0A 2AI2A 2EF8A 4OB4A 3AEXA 3GFVA 4FTWA 1AV7A 1E2LA 3A9RA 4K1XA 3UJDA 7ADHA 1KFBB 4O2AB 3GLHB 2QRHA 5C1IA 4OYHA 3GGPA 5KX5B 2ZATA 2DPYA 5EIWA 1KC1A 2H1WA 5HQTA 2EKQA 4GOKA 4LE1A 1UP6A 1YE5A 2FUKA 2XPCA 5EGSA 3LSYA 3HPQA 4MP3A 2JVLA 3VGJA 4FS8A 1VGVA 3L7KA 3R0IA 4CV1A 5FI3A 5AHXA 5DOVA 4WGFA 4JBIA 1RQPA 4FJ1A 1IBSA 3G79A 2K2QB 4BZWA 5KNCA 1TM4E 2YFYA 4MS1B 4N9WA 5JPCA 2WPDA 5AESA 1II9A 4MA4A 2HUNA 1Z5GA 1ZAYA 2ZTHA 3ON5A 5L9AA 3UQZA 4YCBA 3VKUA 2EATA 3I1IA 2CUTA 2QT9A 3R9WA 1GN9A 4PRZA 3THXA 1H2ZA 3ZWOA 1Z2PX 3TAHA 4MKXA 3LUCA 4QKQA 2ZZMA 2ALJA 3P20A 4QUKA 3GJRA 3J80A 2A0YA 4PIPA 4KO2S 3BXZA 1CULC 2ZRIA 1UKAA 2IEYA 3PEWA 1A8PA 2XA1A 3FAKA 3HXOA 1DC8A 1RW4A 5GV7A 5KC9A 3FTFA 3FCEA 5D3KA 2BFCB 1B26A 1FDTA 2NSLA 1J23A 5DYTA 2BUAA 2ZSAA 4Z4IA 4P84A 3FUCA 1XTTA 4MCXA 2PSEA 2GDZA 4Q16A 4ROTA 5DBGA 1QYRA 1V2GA 4BQQA 5LXTB 5AHOA 4IIYA 1E7WA 2AJDA 2G5CA 2P41A 1NI4A 1LBTA 2W6JD 5EQFA 5KKCA 5LLTA 3NHRA 4ZDJA 6LDHA 5LQMA 1N6RA 3R3JA 1VDZA 3TAXA 2OA0A 4RF4A 1LI5A 1KYZA 4B82A 5LA6B 4ZJUA 3GGJA 4IO0A 4K7JA 5DX8A 4IV8A 2C7GA 4B7XA 4EGJA 4N8SA 4P33A 2FN3A 2J0EA 5EIBC 4JJZA 5HKAA 1EP2B 1OFGA 1RYZA 2IU0A 5B30A 4IZOA 4ZTUB 1IB0A 1VMDA 4EPYA 1HRDA 4PU3C 1ZG3A 3EBPA 2YOGA 4P5DA 3RZZA 2ECKA 5JUWA 1QX3A 3AP2A 2RHCA 1QWOA 4KN5A 4TS9A 4DCJA 4E3ZA 4WY8A 1QCCA 1RJWA 1HNXB 2IYRA 1VYVA 1JUDA 3MUFA 3RIYA 2YMQA 4E31A 3PUWA 1E0JA 1MOSA 3MFQA 3FX2A 3UNXA 5GONF 1WXGA 2QN6A 1X9HA 4EENA 2FOXA 5LNK6 2B6HA 5DT2A 4YIHA 2P2NA 3FDIA 3UMVA 2FY8A 1ORTA 1PZMA 1ZN9A 1WMEA 2DR0A 3USZA 4F3YA 4NOJA 5ALEA 1QOPB 1T3SA 2BHLA 3I92A 3QXGA 1FE8A 1V2HE 3LHFA 8OHMA 5IJ9A 5CM9C 2WHXA 3NFRA 3RIEA 3TSAA 5ES4B 5KOYA 1KZYC 1Z75A 4I19A 4CLOB 5JAUA 1CJGA 4UTZA 3R1FA 1PNVA 1RBZA 2ZWOA 5T4FA 1GT6A 4FE3A 2ZJ2A 3TDNA 4DEXA 2V0GA 2MJLA 4TRNA 4FWTA 1SBTA 4PFJA 5G4KB 1JRLA 1D3AA 3KXDA 4RPGA 2WSIA 1CZOA 2H1HA 3IBSA 4FHZA 2HDHA 4TYMA 4C78A 1HLDA 2HC9A 3L8MA 3U4GA 2I33A 3HZRA 4B87A 2DVMA 4XB1A 1TTPB 3EC1A 4MRVA 4OL9A 1AF4A 1AQ6A 2I67A 2V8BA 4GX1A 1Z63A 3UY4A 1PS9A 3V5NA 4I8IA 1K3FA 3I5MA 1MIOA 4G01B 1G5IA 1I1NA 1EG7A 1ORWA 1T5IA 1X6VA 3GHHA 3OZTA 3PZRA 4JEHA 4B3XA 4D0NA 5CG2A 5ED4A 1QYXA 4V0NA 4IA8A 1FYVA 5AOAA 4C0KA 5FBVB 3E5HA 1TM5E 1USUA 4ZT7A 4O29A 3H04A 5KNDA 4CM4B 2JFVA 1GNRA 4FFBA 5FL7A 1WXXA 4NYJR 4NZPA 4Q3EA 3BERA 4EG6A 2BONA 4K9PA 3GDFA 4I1YA 4P7KA 1HFWA 4HUQA 3NV9A 4YRNA 4NF2A 5D85A 1GILA 1FX0B 5GONA 1GSAA 3LDUA 4CIVA 2RB5A 1ZZEA 4MVJH 3D6MA 2WV7A 5IXSA 3LFUA 3NNNA 3DTYA 4L85A 4RHCA 1CERA 4LBYA 5EKTA 5KYGA 3SVLA 3GUUA 5DLYA 1UBFA 3QFTA 4D8UA 1U0NA 5IABA 2P9TA 4XVCA 1R12A 1YC5A 4EI8A 3C2QA 1KFEB 2CCGA 4E2WA 2RCNA 1IAQA 1FNMA 3GFSA 1TZKA 4G67A 4PZLA 4WCFC 4Y9RA 3RARA 3UCXA 3V32A 5JYEA 1NNEA 4M1KA 1KNXA 2LTAA 4LTMA 4XXHA 3OBIA 1MHTA 3CT4A 4JZKA 5J9FA 4BDSA 1X1BA 5CB4A 1UQUA 5FQOA 4IEIA 3SEQA 5AVWA 5EL0A 3C1UA 3Q3HA 2FSFA 3HEMA 1ZP6A 2PEYA 1AK2A 3QG5A 3KD2A 4JROA 4P4GA 3H8VA 5EZSA 5ILQA 3LF2A 3TCNA 3VR6A 1T36A 4MWTA 5CH8A 5LD2C 4EA9A 1ZD5A 3OHSX 2CXRA 3NNDA 4RJJA 2CZQA 3UHPA 3H2GA 3S0JA 2HIMA 2P3QA 3AUTA 3OCXA 3F47A 4BFVA 4ERNA 4O1IA 4IDFA 3UCFA 3HB5X 4YUZA 3EIEA 6PFKA 1QGZA 3TZBA 1E4EB 1ECCA 5JG7A 1UIRA 4DUYB 2I1VB 3WMFA 5TC4A 2DTDA 1USKA 2OV3A 2X0IA 3GR6A 4J0IA 1XXHB 3R8XA 3ZNQA 4D2IA 1ZR4A 4LVUA 2GVZC 4QU8A 2GM9A 1XQ9A 2CXUA 2OHIA 2OCAA 4J9UE 4X61A 3FJ1A 5ED0A 1NQOA 2FWPA 2PGXA 4AS3A 2BSAA 3GC6A 4KUGA 4LRSB 2ONJA 1EXDA 2AVDA 5K6RA 4RTOA 1Q1EA 1U1FA 5EXTA 4GQAA 5CFZA 1Y9EA 1ELOA 3DEYX 1JYFA 3COZA 3JZMA 3Q72A 4R1UA 4FHGA 1VJDA 1XLTA 5CDFA 2X9VA 1M34A 2XDQB 3DD1A 3ZH2A 3RTDA 4C04A 4Z53A 2X7HA 2L82A 4AUMA 5JQWA 1CJTC 3I45A 3LPDA 3NRCA 1NONA 2VTBB 1E5QA 3K1JA 6Q21A 2AWIA 4NJMB 4MGHA 3TVDA 1LDMA 4P80A 4PZPA 2XWQA 3T7RA 4CM1A 4QT4A 3OM1A 3PTAA 1UADA 3BHJA 3K2QA 1BJTA 1Z26A 1UKYA 2GZAA 3BD6A 4LZOA 4Q05A 4AMUA 4UTOA 1HG1A 1AQNA 5E1DA 4N0DA 4MGEA 2P6PA 2E37A 4HQKA 1T5TA 4WN9A 3L7DA 1CUIA 1CB0A 1P39A 2XCRB 1XI2A 2CJXA 2F59A 2FEXA 2GBGA 4J3JA 1GTL1 1Y6JA 4KPUB 1P6UA 2IYUA 1FL9A 1P5FA 2W6PA 4NECA 3RAJA 3U0VA 1U5CA 3NLLA 4G24A 1C9NA 2GXUA 1S89A 4IDCA 5FAXA 2O4AA 4Y6RA 2JCXA 1IB6A 4DLXA 2N9UA 4H60A 2O1SA 3UYLA 1JQ5A 1U7ZA 2VIIA 3GN1A 1KMHA 4PC1A 1GQSA 1IONA 4G56A 1JPVA 4TMFA 2B1JA 5YASA 3TQFA 3WTCA 3RR2A 4ALIA 1P5RA 2FXIA 3D6FA 5FFNA 5ITWA 1IN8A 5G1PA 1VSVA 2GNPA 3MWJA 2GB4A 1EE9A 1SC3A 4OMDA 1QTQA 3WIOA 1XRPA 4YB8A 3AC0A 2P68A 4FGKA 2ZIVB 3L0PA 1VZ3A 4BLWA 2BF4A 1CJKC 4QUGA 5FI0B 4J0JA 2HJRA 3CUYA 2ZYIA 3RFVA 1NUUA 2M6RA 5BYKA 1LTHR 1VKJA 2PJDA 4KODA 3N0TA 3GGOA 3K0BA 4FONA 5FD8A 4JI4B 5CLFA 1AURA 3R6GA 1IXYA 5H3CA 1EP3B 2FWIA 3OPVA 4ZOCA 4JSRA 1CEQA 4ZRNA 5HUQA 3ABZA 2LYSA 1YI1A 2WF5A 3OQIB 5AKJA 3NVAA 3SFZA 3ZCQA 3AU9A 4O8ZA 3NC4A 3K4HA 4YDRA 1QFSA 4Q4AA 3ZOZA 4BX0A 4MGKR 1R0XA 2UUPA 4IJKA 3HP4A 4QTZA 5SZHB 2P79A 3VI3B 1G3UA 2A59A 4LBVA 3L02A 5HW0A 3EEIA 1WVIA 1NTOA 2SECE 4J4HA 4O2BA 2GPJA 3L8YA 1YQUA 2D2IA 1R0KA 2FCAA 3I34X 3O84A 3CRNA 2GK4A 2YZ2A 3AR4A 5EPOA 1SCNE 1VOTA 3TQIA 1NVBA 1RJGA 2I6TA 3E8XA 1S4MA 5HUHA 5JMTA 1W25A 3UEOA 2O23A 1C8VB 2O0MA 1SUIA 3FROA 3B5IA 3R6DA 1VI6A 1JG4A 1VIVA 2YIVX 4K6KA 4P5EA 3OEED 3TEFA 3V1NA 1IG3A 1MABB 4INZA 3P19A 3MB8A 2FEOA 3F8TA 4YI3A 2WQ6A 4C7MA 4GPAA 2FW9A 3LQQA 3K31A 3A1VA 4EFLA 8MHTA 4J1TA 4WQMA 3RYFB 1JG3A 1MVOA 4LYGA 2FZ5A 1J7KA 3KUCA 3ELYA 4QDKA 4C2BA 3ZQKA 1DAHA 3LIPA 1PEAA 2ZUCA 3CTPA 4CTKA 1P9NA 3LAWA 4N12A 4X1IA 4R9NA 1H22A 2ZJ5A 5AFSA 4EAAA 3ABIA 1X86B 1QPGA 1ZUNB 2EV9A 2Y0CA 3BXOA 4RHTA 1F06A 1LJ8A 3EGDA 3KT6A 4XEUA 4DM3A 4XOUA 4ENUA 1CVLA 1PGOA 4I3FA 3WLIA 4Y9SA 2AXUA 4KAFA 2XDWA 3DWFA 5B1HA 4KVZA 3R7SA 2QRNA 3CE6A 5M34A 3E9RA 5DTMA 1HT3A 3WK5A 5JS8A 1XTPA 3DC2A 4ID3A 5EMKA 1Z33A 2J45A 2B5VA 3A06A 1DOZA 2G17A 2JD0A 2YYYA 3QLVA 4M76B 1MVLA 3CV3A 3PK0A 1QHFA 3LNTA 3MQ4A 4YRFA 1CUJA 4N40A 5AK0A 2R48A 1E60A 1NYRA 4PSVA 1WXQA 2WJ4A 4HLQB 4Z0NA 3GPLA 4AO8A 1RHJA 3PNSA 5KTKA 2JGNA 4JLWA 4C1NA 4D4KA 1XD2B 1S1CA 4GUDA 2NUAA 4LGCA 4N0EA 3PLAE 3DULA 4YDQA 1EUZA 5I7UA 2NMVA 2QRJA 1N2GA 5F1PA 3OTOB 4Q3BA 1ZGGA 4IHJB 4PCVA 2JFUA 4LC1A 5HKLA 1C3EA 2ADOA 3H65A 2IDZA 2I5PO 1GFSA 4R2KA 1WTCA 3UW1A 5FOXA 5SZKB 4ACAA 1DX9A 3ZIDA 3L6OO 1VL6A 4RV4A 1G21E 3UZUA 5KWSA 3AI2A 3FNEA 3KETA 2VHTA 3D8NA 2VF2A 4ZQHA 1BCSB 3FI0A 4D4MA 2ES4A 1L4NA 2BTQA 4MH0R 1DVRA 2FPUA 1PL0A 1U3VA 2BMVA 2XKJE 3FOEC 2R751 1H2AS 3A1DA 3D0KA 1JG6A 1QB8A 4QXRA 3RTBA 4I9GA 3SBXA 2QQ0A 2JCGA 1FDRA 1T24A 4IIFA 1B8NA 1RYHA 4OJMX 4C6RA 2QTVA 1GU1A 3QF4A 4PZCA 4R1NA 3QEMA 4EG1A 2HSWA 4V1CA 3R9XA 2H9YA 2YFQA 4KSYA 3I6ZA 4CIDA 3QYPA 4NMHA 3IXQA 5IDQA 2I4NA 3FDZB 2CE7A 3KB8A 4F2DA 2O8BB 1UMCB 3EGVA 1Y4AE 1XF9A 2W2TA 3B48A 3NU1A 3NW9A 4FHFA 5ECDA 6ADHA 3OU7A 4M1YA 2AMJA 3KPYA 3C0KA 3OX1A 1H93A 2EJTA 4FMBB 3UV3A 3WYFA 3K6SB 2PMFA 1GTVA 1MIHA 1NT4A 2RGGA 3FUUA 3G89A 4JLPA 5FBRB 3IEVA 4AL4A 3N2GA 1W93A 2L2QA 1CZLA 5FBZA 3SIRA 1W1WA 5J5CA 1AQJA 2MOKA 2GEKA 3FYUA 4OQPA 4O3MA 1J25A 2H1CA 2JIDA 3NHZA 3TMYA 1P45A 4BPBA 4D9GA 2LRHA 4HFMA 2XXQA 4Q21A 1R6BX 3WQHA 3W8FA 4A0HA 3NX4A 5K6TA 2YFHA 5AHRA 3QK7A 3WLEA 2HJ9A 4IIUA 4NHEA 4D25A 1RWOA 1E2BA 3NBQA 1B23P 4UFNA 1S2NA 3GXBA 1GRQA 3KPWA 2OYSA 4HTAA 2HK8A 4RH0A 4COOA 5AUPB 5EVCA 2LLWA 4X4HA 5BWBA 1T1IA 4MW6A 2GZ1A 3KB6A 4TVKA 2HTFA 2P9JA 4PSUA 4Y9UA 3SC2B 1YA8A 3S8YA 5FTNA 1EAMA 4Z3DA 1JJVA 1S8NA 4DE9A 1ZIYA 1E9RA 1G2QA 2P6OA 3EEFA 3T1OA 5C8ZA 4CIYA 1NL3A 1R0CA 5ENZA 2QD1A 1JNXX 4MINA 1UZNA 1Z6ZA 2XUHA 3SHWA 3G6KA 4G5RA 4AROA 1ODIA 3CNLA 1XX6A 2GBFA 2H85A 2P78A 2ZBQA 3BWDD 3DHEA 3N7AA 4KVAA 4M49A 4FGSA 3MJCA 4YP9A 1SXJC 1JMYA 3IESA 5GWXA 5G02A 3UWDA 5CFRA 2WM2A 3N2EA 4JIMA 5DO9A 5TR9A 5CEJA 3QEKA 1RJEA 1A69A 2XHEA 3UV7A 4R81A 2Y9PB 3ZD6A 5BV8A 2JFGA 4UARA 5TPZD 4K28A 2JIQA 4AJ1A 4UATA 3WP1B 5HS4A 4GMHA 3TGLA 3DWEX 2EBWA 2GKGA 2Z2ZA 3SF8A 1KH3A 2H65A 5EP2A 2FDXA 4MIEA 4BNNA 4C4ZA 4JUBA 5TLSA 4GX2A 3H0CA 1SK9A 3U61B 5BR4A 1GM5A 4ZQCB 2NVBA 1JILA 4Q3OA 3IMCA 3KZMA 3RVKA 3ICQB 1J8DA 3N2KA 3FD8A 1KSGA 2O3UA 1G41A 5C2JB 5KS2A 1DCMA 1W35A 2EZUA 3DE6X 3PA6A 4KNVA 2CFOA 3Q87B 3VR3D 5JFTA 5KREA 2BTEA 3RYTC 3DBHB 5HJEA 2DWOA 3V34A 3A1UA 3NJRA 5C7OO 3CINA 2B37A 3WIUA 4CV3A 3O0TA 1TZBA 1WDKA 3R24A 4OATA 1FX1A 2X41A 5DFAA 4PZUA 2XSZD 1I2BA 1KI1A 2JIMA 5AICA 2O1EA 1O4XA 1ZD4A 4LY0A 5IJZA 2I1LA 4ZQGA 5K0GA 3KQMA 3ONNA 4JBLA 1FFHA 4A92A 2KHZA 4PTLA 2D2XA 4LY6A 1GRRA 1CFZA 1T3TA 4LOLA 4Q6BA 4HNUA 3AY6A 2P4HX 1UXOA 2W2LD 4BVEA 1HSOA 3QW2A 1ODFA 1MB4A 3A7DA 2OZLB 2O2HA 2A9QA 2VPQA 3RGGA 3TZHA 1GPDG 3IAHA 3G0CA 5JOQA 3HBJA 1IFXA 1FU8A 2C2XA 4HEA6 5CGZA 4HLUA 3BCSA 3DV9A 1A76A 1ZZBA 1YOVA 3MERA 4AY3A 3H5OA 3C6ZA 4J3FA 2P3OA 3QBTA 1U98A 4M0FA 3UC9A 4EZBA 5AM2A 1MTOA 1POWA 3CMMA 2HDWA 4IJQA 2XNKA 3JRXA 4AKSA 3O74A 4FBMA 2CWWA 3NM5A 3EF1A 4UDOA 1J9ZA 5JHHB 1CP3A 1LDEA 2JGRA 3PTZA 1CJSA 3R09A 1KMQA 1WPXA 3NV7A 3G85A 3S7ZA 1CZHA 1EUDB 3AJAA 1P4JA 1RHMA 1NC1A 1WE2A 3O8OB 1YB6A 2PN1A 1JDNA 2YJ5A 1SQ6A 3WGUA 1NN5A 4UHHA 2D1YA 3G9TA 5DULA 3UMJA 4PFSA 1ONPA 2F8LA 3BEOA 3G0BA 3ZJVA 4X4CA 3BF7A 1U3TA 2ZI9A 5HZHA 5KYVA 1V4NA 1IM8A 1Q2XA 1VSBA 1KE2A 3OCYA 3HUTA 3ZBUA 1E9CA 4EQZA 2OXRA 2JARA 3LFHA 1DUVG 1UXGA 3OY2A 3TQTA 3ZWXA 1M6VB 2IPXA 2AEEA 1X1QA 2XYQA 3M3PA 4U7GA 2VDLB 4NYIR 1FTNA 2OQIA 4P92A 1GJRA 4WVFA 2D7JA 1RKBA 5DTEA 2INGX 3AMVA 3OO0A 2NXEA 4F1WA 3ITNA 4E21A 1IL0A 4J03A 2HWKA 2R1TA 3ZY4A 2OZPA 1H1LA 3BQMB 4ILKA 2MDTA 3DFKA 4YRBA 2B7BA 2NIPA 3P9RA 4UEOA 2BGKA 3PJRA 1MC8A 2D5VA 5HTKA 1T6BY 1WSAA 3LWDA 4TT3A 2P6RA 4B5KA 3ELWA 3ND6A 3UOWA 4RJKA 1CKEA 1DUSA 3RC8A 3DLTA 3VPHA 3TL6A 2WTMA 4G85A 4L6AA 5HQ3A 5KNCH 4G5HA 3QG1A 3GFBA 1KU0A 1GEGA 9ABPA 1XKTA 4DBLE 1S02A 3PDIB 4K86A 1C4XA 3M1AA 2A1TR 2W90A 1OASA 1SVSA 2GPSA 2LIVA 2ZWAA 2QTCA 1MFQC 3I0ZA 3L1JA 3PFHA 5FIUA 1CE8B 2G88A 1QS0B 2E4UA 1QGUB 2NN3C 4B45A 1KTIA 2ZRFA 1Y9QA 1FP7A 3V1YA 3D4OA 1X13A 2E4XA 4OPMA 2CYAA 3MJ4A 5DCLA 5E6SA 3ZQ6A 5LP6A 2PH7A 1PGPA 4JITA 1GZDA 1WMBA 2BFAA 2AR0A 2O4CA 1NG1A 2FAXA 5JVDB 3CVUA 3TOSA 2C54A 4YASA 4U3JB 5TQ2B 2WIBA 3ZWPA 3HKBA 3H5AA 5JH7B 1L3CA 4NAHA 1Y81A 3M82A 1NERA 3QU5A 3T7JA 3ZNPA 3M4ZA 5TNXA 2RHTA 1Y5LA 1AXEA 2I65A 4ZVMA 1N36B 1GKKA 2VWHA 4BTLA 2YQ4A 3IUBA 4IH4A 4OKSA 3GJ4A 3VOSA 1XVTA 1C7ZA 3C6QA 4GVXA 4KWCA 5LLSA 5JQGF 2EBYA 1Z0SA 3GCXA 3NJ4A 3WRYC 3M6UA 3KVNA 3LMKA 1RYBA 2HQOA 1MH1A 5AXBA 4Z58A 3DE0X 1DIOB 4IDEA 4M0MA 5C53B 3LH5A 1EU1A 1SAYA 3QIVA 4FFOA 4H6WA 4RHXA 3UUWA 4KREA 1S7CA 4KLNA 3IKTA 2IUEA 1VHWA 1TCBA 1FYFA 4EMTA 4FX2A 1F60A 5EJFA 4LFCB 2CF6A 5F1KA 2MCFA 1CY4A 1I36A 2XRFA 1JAYA 1Z5OA 3ZEIA 5EP3A 1OHHA 4L5CA 1WLYA 3LHSA 1RRMA 2R8BA 5ALZA 3ZJTA 4AYWA 2Y2UA 8LDHA 2P5SA 5CCXA 4HKTA 4LMBA 2QPOA 3R0VA 5EQTA 2WTBA 4DSNA 5DX0A 2GK6A 2OCIA 3WB9A 1ODCA 3P4XA 1YVPA 3TJRA 3VPBA 3QWIA 4HEJA 5A4JA 4L22A 1IY1A 4KN8A 4O08A 1TADA 1JHYA 5L7YA 3PGXA 4I6RA 4I9UA 2OKGA 2VHQA 3G2IA 3W4IA 4KMMA 1HE4A 3ZLUA 4JIGA 2HI0A 2VL7A 1FU7A 1Y8QB 1FQJA 1XEFA 5L4SA 1EHCA 3EJWA 3TR5A 1G18A 3OOJA 1PLJA 1ESNA 2UDPA 2ZZKA 3WL3A 2ACKA 3ZTWA 1OAOA 3DB1A 3OJLA 1ZRSA 2NSJA 4YC7A 3Q9SA 3N75A 4UUBA 1BD4A 4DLZA 1I2MA 4ZOLF 2G1AA 4HH0A 1WW3A 1Z45A 1KDRA 4OLBA 1C8KA 3HVUA 3M8KA 3ESZA 4PHFA 1WMAA 4D0SA 1KXJA 4UOZA 4DNFA 4IKPA 4U7TB 1XGKA 2ZPAA 3I4LA 4BV3A 4DUGA 4HDNB 2IF0A 2I7CA 4RJ2A 5GOTA 4B6GA 3WK6A 1W0KA 3H42B 4JLNA 1X8JA 3KQYA 2AMYA 4FOOA 3UPDA 2Q1YA 2IS4A 1O57A 2HRRA 2JI9A 2PM8A 2YWHA 2BFDA 3OWXA 1IXZA 1LPSA 4DZZA 5JCZA 4QUHA 2ECOA 1NMZA 2I7DA 5EUMA 1NJ6A 1E2GA 4IM7A 3IDFA 1E99A 1P5ZB 4JLMA 2PD3A 3HFJA 3WRXA 3ZWWA 1NVTA 3GCZA 4E5UA 2JLZA 2AFHB 4RUKA 5AW2A 3IPAA 4AKEA 2QLFA 4L95C 2VNSA 5FL7D 1SCAA 4L16A 3CKLA 1LPOA 3INNA 4L4UA 4PFQA 3LTNC 2Q62A 4DLNA 1NU8A 3MS4A 4FLMA 2JLSA 3JYQA 1QDEA 4ZDWA 3DO8A 3O8QA 1IOWA 2I66A 5HTOA 2PWZA 1JE0A 2Z5FA 4CEJA 1CDZA 3T38A 2Z57A 5DYWA 5F2OA 3ED5A 1TF5A 2JH3A 1ONOA 1NVGA 1L3BA 1G3MA 2KB0A 2O8VA 2E49A 3G8DA 3GHYA 3NHWA 2ZJ7A 4M8IA 4WZAB 2PX8A 5AK3A 5DW0A 3RFUA 3RC3A 1UDWA 3LK7A 621PA 3CVYA 1FTSA 2ODEA 2E7ZA 1JEQB 1XRMA 2W98A 1ZDMA 2HGSA 3BE8A 2AUMA 1VJ5A 4RIGA 1GGHA 3UWPA 4A23A 4M98A 1MAWA 3QHAA 2P8SA 1JPJA 1O87A 3WZ2A 4ZU6X 3PX3A 4IH9A 4WN3A 1NRWA 4O4HA 4KTVE 1KAGA 3QLUC 3C1OA 1NNUA 5I4KA 2FPIB 4AJLA 3OIDA 4P82A 4KUHA 2W58A 3AETA 4RGQA 3EWNA 2ZQZA 3CRQA 4H17A 4Z7JA 3ND8A 3TCKA 2DPHA 2PR2A 1NJSA 1KZHA 4YT2A 2VJKA 4NULA 5L4LA 4BIMA 1OSLA 5JLJA 3QELA 4V3CA 2EX4A 5FEMA 4IJ6A 2NU6A 2AI3A 4PG6A 2W2VA 2IVQA 5E4TA 1PWEA 1E77A 3C24A 4HZIA 4R2JA 2WD7A 3AVPA 4EITA 1MENA 1PUJA 4OP3A 1QC5A 1Z6QA 2C5LA 2XXBA 3DZIA 3EQ8A 4F6RB 1Z5WA 3AHFA 4FM9A 2HINA 5AOVA 2G0NA 4J91A 3LPAA 4PG4A 3NALA 1GP2A 5TPWB 1QIEA 5K2OA 4LXGA 3EZ2A 3DQQA 5GPBA 4ZIRB 5BW4A 2UUCB 2VWQA 2GVNA 3GFGA 2KZ8A 1H94A 4CEHB 1PZHA 3TPCA 3HSSA 4C4XA 2R6HA 4DS3A 3FSGD 1WCV1 4L7QA 5BUQA 1I8TA 3DTVD 3FPCA 5KYTA 1JFSA 3ZHMA 2H2IA 4GX5A 5KOJB 3H2HA 1CF9A 4MUEA 3OQHA 5ELLA 1J0AA 3ROKA 3TSOA 1TC2A 1OWPA 5CDSA 1Y9ZA 1K88A 2O5CA 3KB1A 1NMYA 1LDNA 2XMBA 4PAMA 2XUFA 4MVJF 5DLDA 5IG2A 2O8EB 3WBJA 4A8HA 1YB5A 1X7YA 1ZH8A 5HFAA 3QMVA 2EWTA 3NGLA 4GE3A 1U63A 4ESOA 1QQBA 2V54A 1TM3E 1VHLA 2C1EA 2I2WA 3NYQA 1OTXA 4IMIB 1E2KA 1ZK4A 3MTAA 3WNCA 3BFKA 2A0XA 4B6JA 1Z6XA 3IUNA 1XWRA 3PIRA 2FU5C 3L3BA 2YS7A 4LOIA 4OGLA 4B3BA 4AKGA 1EVIA 2VYFA 1QF6A 1QK3A 1J0CA 4GMFA 1I6LA 2D2FA 3H9QA 5ESDA 4EM6A 4TUYF 3K2BA 2O7RA 3PE5A 1QZ3A 1BXGB 2ID9A 3AVXA 4QEKA 2ABWA 3EXEB 4WJZA 3FI9A 1IM5A 3M6XA 4JQSA 3U17A 2NV0A 2Y71A 4OF4A 3BTUA 4ZCQA 4CIXA 1WX1A 2W93A 1MXHA 3CONA 3X0DA 2C03A 1I13A 2YHIB 1WNFA 1BRTA 3KZNA 4BVJA 2ZETA 2A58A 3CNHA 3HCFA 2QVGA 4BYMA 3V4PB 2XX3A 4EBBA 1I32A 4IY1A 3O3MB 4NE2A 3TMAA 4NMWA 2FQWA 2IA5A 2PPVA 4RTKA 4I7EA 4N3NA 4IQ4A 4YJHA 2NT3A 2QZSA 4B17A 3O1JC 3E27A 1OBFO 2IJGX 5HGJA 1AS0A 3IS3A 1RWMA 3E9DA 4EKEA 4IF4A 3HJCA 3MEQA 4V39A 5G0VA 5IP5A 1OYYA 4GYYA 5CVEA 1KYIA 4UNQA 3S1LA 3S8QA 2RAUA 4HRXA 5F7ZA 4CT0A 3LC7O 1DJMA 1L5WA 5INTA 2JFZA 4IMRA 1JL3A 1OXXK 2TYSB 4O8BA 5B3KA 4XRGA 1BO6A 1NV9A 3DDNA 2GI4A 1UPFA 2D4HA 2YJ4A 3R6LA 4G89A 3HLKA 4QAJA 3SJBA 3RYCA 2VYNA 3HBNA 5AIAA 1R0RE 4UEQA 3F52A 1LCIA 4FHDA 1KDTA 2JAXA 3GNTA 3SBEA 3PIIA 1SBIA 4N7BA 4ZO9A 1YFKA 1Q91A 2FZGA 2FUNB 1A7KA 2B4TO 2JLQA 1N6HA 5CT4A 2YDYA 2Q45A 4QREA 2OR1L 4UUPA 1JBQA 1OT3A 1P6QA 2IELA 3BPSA 4QPJC 3ZI0A 4I36A 3EA5A 4Q18A 3U7EB 1KPGA 3RS9A 2F3PA 5BP7A 2ZPTX 1KRWA 1FLAA 3GLGB 5H5JA 1BW9B 3PC8C 4EJ0A 1FP2A 1EK6A 5KJCA 1O5IA 4NEHB 1E8NA 4JQCA 1YRLA 2OC4A 2PWBA 2HQBA 2R5NA 1JJ7A 2IKQA 1CS0B 3ICCA 4FFVA 1OLXB 3NHKA 4IL5A 4PC6A 1JQBA 2GM3A 2X7XA 4YJ3F 5ARDA 5LZ7A 1NLYA 2X58A 2QRKA 2ODRD 3ANMA 1CQZA 3I8XA 4K2AA 2C84A 4G0UA 3LZDA 1OIWA 3VTZA 2HFZA 4TMTA 4WERA 5CLGA 1YQDA 4BGVA 1J21A 3FSEA 4E5KA 1EE2A 4YAEA 4K6HA 3ACBA 3EULA 4HG2A 3T4XA 1EFVB 3DONA 1PD1A 4F7WA 1V71A 4UMFA 5JWRA 1HX7A 2DSTA 4B7ZA 2ZM6B 1JIUA 4A2QA 2WNSA 3CCFA 3OD5A 1UPUA 1Q7RA 2Q6IA 3C7CB 1ZI6A 4HR7A 3K8QA 1A50B 4LTNA 3IFSA 4Q37A 4U63A 4DY4A 1H8ED 3DAHA 1PRVA 3KK0A 4IQ8A 1PJRA 4RZXA 5IARA 4KYIB 1E58A 4FW8A 2P0EA 4HL6A 1TKAA 1BX1A 1ZIDA 4UQPA 4JOQA 4MV6A 4KPEC 3SHVA 3G7DA 1MJGA 3T5MA 3FHTA 5DEOA 3RIMA 3RJMA 1RQ2A 2V0CA 3O5AA 4S1OA 5BSUA 1YSEA 2ZRNA 3GT0A 3C3BA 3ST7A 1QXSA 1RPEL 2PD6A 3WLLA 1CRPA 4L8WB 4UNSA 3JWPA 1M0WA 4QZVA 1YF3A 4RPHA 2JFPA 4HUJA 2RI1A 3EFEA 2DU8A 1YBAA 4JLSA 4KQEA 4QASA 3D1LA 1KAQA 3K2IA 5JJIA 1YRYE 2QIPA 3WJ1A 3R8CA 2GK7A 2KBEA 3AGPA 1PZEA 3KRTA 2HSDA 3IOBA 3PPWA 3AVYA 4W9NA 1B0PA 4B4UA 3JQFA 5AVJA 3MINB 3OKCA 4MI3A 3DAOA 3VR4H 4WZBB 1E5LA 3WGMA 3EPJA 1KS2A 2J6HA 2V7GA 4HGRA 4MUNA 2XNJA 3V4SA 3ETCA 4RY0A 1HI9A 1M66A 3FMPB 4YRMA 4H0CA 2OAQ1 3FNIA 3JARB 3KG2A 3NTVA 4MPPA 1K2VN 5CG1A 5I8WA 3ZDAA 3GEDA 2E4YA 3ETGA 4Y6SA 4EEZA 3HP7A 1ESDA 4BTEA 4BVBA 2QTHA 3DDZX 2JGLA 4YQYA 4BQIA 1OF1A 4TVBA 1W88A 1TQDA 4DCCA 5ALWA 4CKEA 3FB1A 4IWYA 3WLKX 3PVSA 4B09A 5DNYB 3BH7A 4YPFA 2ZIZA 3G88A 3S44A 1DX4A 1UKEA 3GZNB 4W82A 2RSLA 3DGFC 4PBTA 4YLGA 4AMZA 5B64A 3D4IA 4G0VA 1GPUA 1FU4A 2HXYA 5M04A 2UZAA 2YN2A 4XI9A 1QRTA 4MSUA 1SQGA 2GBLA 3Q0EA 2F8TA 4R8MA 3M3DA 2IXAA 1J1ZA 4FMDF 1YHNA 1LC3A 3DKPA 4ER0A 4FDUA 4WX2B 1LRJA 5CAEB 1VQ1A 3ENQA 1XPJA 5BVGB 2BMWA 1GXSB 2YJ6A 4MEJA 2GDJA 3AJEA 3QY9A 3W05A 4OLJA 2Z4RA 4XD7D 5HIKA 5M7EA 1GRCA 2DWQA 2C2MA 1IH8A 1QHHB 5FR2A 1MF7A 3QOWA 1T0PA 3E9EA 3LLSA 4XTCS 1CUZA 5KSYA 3EPPA 4L4XA 3AT1A 3ZHYA 2JRLA 1ZZCA 3B6KA 2IS6A 4UZFA 3R5KA 4S24A 4YGXB 5EZYA 4QM7A 1Q7EA 3FOWA 1NUSA 4RA9A 3W7BA 2G07A 4HQ0A 2P7HA 1CEXA 4W4TA 3PYXA 2WUEA 2GWHA 4FVTA 2HV8A 2JHGA 3QQ5A 2GAOA 4P6VF 1TK2A 1C1XA 1CDOA 1XDZA 3OQ6A 3Q85A 3KVVA 4PNEA 5L7TA 4DG8A 2W9XA 4IIJA 3KB2A 1V3QE 1CEYA 1I51A 1ETUA 2D8AA 2HMYB 4NFYA 4QYTA 2NU9A 2NVUB 3WA6A 5A62A 1NDUA 3WR5A 1SXHA 4IGFA 3EZYA 3GZJA 1TD1A 4JC0A 1KP2A 1UBMS 3Q88A 5EE1A 2V7QD 1GQQA 3PBKA 2WDZA 5KDLA 1U3FA 5CHYA 1YDWA 2IVZA 1XAGA 1SY7A 4IVNA 4YMWA 3LCMA 4M3NA 3ZG6A 4RKYA 3H9JA 4KZPA 1CVRA 2QG6A 1CYDA 4MS4A 1FFXB 1P0IA 2VNHA 4I4TA 1KERA 4JBGA 3IB3A 5EVJA 2RGXA 1ZH4A 2NQTA 3H7AA 1ZCBA 5KU1A 2G4VA 1Z0FA 3KJQA 4B5LA 1N3YA 2FMUA 1KY2A 4RSHA 1EG2A 2F1RA 2AV6A 1DNPA 3MJHA 5DBIA 2PUHA 4ICIA 1VXRA 2W2KA 4HWKA 2W70A 4FMPA 3ZI7A 2RKOA 4TXMA 5EIFA 1XOIA 1KEZA 1PTKA 2FRVA 2FUG6 4RJTA 1Y4ZA 4NPCA 1GPMA 5E9JA 1WH6A 2W7TA 1WQ3A 4IIDA 3IVCA 3KOWA 1VKOA 4P7JA 1E63A 4RK5A 4RHEA 5GJCA 4NBRA 1VL2A 4GHJA 2Z5LA 1JXQA 3ICPA 3L8DA 4IMPA 3A1EA 4OQQA 1TUBA 3SXUB 5CEFA 1HV8A 2GRUA 5BYAA 5ALPA 1PJ8A 2OOSA 1OAKA 2VH2A 3RIHA 3GLFB 1X8KA 1JU4A 3JWHA 1UK6A 2I2XB 2IYEA 3H2BA 1VA5A 3KXLA 2H7VA 4QRIA 5CJJA 2NZ8A 2XIJA 3ZZMA 1ESZA 3WY9A 1XP8A 1WB9A 1GZ4A 2QX8A 4HNGA 1NFFA 2H2AA 4OG2A 3TBHA 1UOPA 2AN1A 4RD3A 5E6RB 4RQBA 2HJVA 5BQXA 2GA8A 2GS9A 2VPZA 4HF7A 2YOHA 2DFTA 4YP1A 2CLFB 2VYQA 4U02A 2CUZA 1SMKA 4CRWB 3P9IA 4YBAA 1HSZA 1JNYA 1TF7A 3GRCA 4F3TA 4HQNA 3OZRA 5AKHA 4O1HA 1E5DA 1TPYA 2QJRA 3KFXA 3N6VA 4LZPA 4A2CA 4A7PA 1EESA 3CCCA 3OMWA 4WACA 1LU9A 5TF0A 3FPKA 5DVZA 4BAUA 1DZIA 1ID8A 1GSIA 1QOQB 3JQ8B 4BLUA 4CJXA 2EYUA 5FHRA 5CCBA 3H5LA 5KZMB 3V4RA 4EF5A 2Y4OA 4PHGA 2YXDA 3LOPA 1E9SA 4ZN6A 4CCYA 1WXDA 3UW3A 2JS7A 2ZJFA 5BOVA 1F8UA 2HR1A 3OI7A 4V1CB 1R4NA 2D06A 1TGVA 1RLJA 4AMBA 3L6RA 5FWXB 1XYGA 4JI0B 4B2LA 1VLQA 4K05A 3B1FA 3C6BA 2PPXA 1KAOA 4UMVA 4BKMA 4K9KA 4NKRA 1B1AA 1SXQA 4JI8B 3K70C 3UMGA 2ZAYA 3B89A 1E4VA 1JX6A 1QE3A 4I0WB 5PNTA 3AUUA 4FJ0A 5DK6A 2HADA 4YP0A 1ADFA 2V6FA 1TJNA 3RLFA 3ZLVA 4X9XA 4FCWA 2PXUA 5C46F 3BGIA 4IDGA 1H2HA 4N6NA 4RKRA 1U2SA 2YIJA 5G3YA 4NMMA 5JV5A 4NCKA 4U8HA 3JD3A 2NM0A 3OP1A 2LLVA 3GDWA 4KQMA 2A5LA 1S96A 1ZK2A 3WRWA 4EW1A 4UC0A 4PANA 1H4VB 3EXHB 4BRUA 4CTOA 5SY4A 4DMUB 1T1EA 4HB3A 3VDRA 3RUFA 1EFAA 1P2GA 2B4AA 4KN6A 1U4SA 3EAQA 2P7IA 3TE7A 4D57A 4EY3A 5IM5A 1A9OA 4MQ6A 3WLJA 1VYHA 3G2NA 5EUQB 2QLLA 1Z17A 3K05A 3U7QA 1MU0A 3FVQA 3VDXA 3VNRA 1X1DA 5BSEA 4CEIB 3WGOA 1VC2A 4MLZA 4RACA 3HVIA 1P1IA 3I01M 1WIZA 2REQA 5AJTA 3ROFA 4AJOA 1VSQA 3DEZA 1E0SA 1EWQA 2ZRGA 2ZKLA 4GM4A 4XOIA 4C05A 5C7IO 4Y2UA 1YZQA 1URPA 1C3VA 4H4EA 5LMNB 4YP5A 3JD4A 4ZGWA 5BNIA 3IQIX 1V1MB 3MCUA 3WX0A 1V5EA 3A2MA 2V5UA 2WYIA 1M76A 5IUJC 1RM5A 3A9XA 2J3KA 1OBHA 2XQIA 4KXYA 1C7RA 1F0NA 4U9IS 5TF4A 3C4QA 4CF3A 3U7HB 2JG3A 3GLHE 1ONBA 3BKWA 1DKLA 1GVHA 1G5HA 1RI1A 1KDPA 1WCIB 1XHEA 3G2KA 4LJYA 4PBRA 3O8DA 2KLBA 3D43A 1MFZA 3T7TA 3ZHCA 4PU4C 3LVFO 1ZM9A 2WV9A 1VL0A 4G0XA 2LXNA 1WRBA 1RJFA 4X85A 4A8PA 1ESCA 1GZ5A 4O59O 1NI5A 3TQQA 3EARA 5BWNA 1QBKC 2JRCA 4HDOB 4KR9A 3R9IA 3VAYA 2RHWA 5TARA 4U00A 4OHBA 1J2TA 2QDKA 1H69A 3VU0A 5EJ6A 2PFKA 3K7EA 3WLFA 4EJ2A 1KU6A 1U7DA 2MYUA 2C61A 1W5SA 1JA1A 1Y5MA 3EZ9A 3FKSD 3NB0A 4IOJA 1GSOA 4C0BA 5JQGB 5K09A 3ZZ0A 2Q6KA 3ER6A 3VH1A 3ER8A 4TVOA 1PRAA 3DAYA 1S2IA 3EHDA 2Y1GA 4KHPB 2ZIUB 2EGGA 2GCPA 3G2PA 2PBFA 3PQ7A 3OOHA 1Y9JA 2NUTB 1S2OA 3A3NA 5KYXB 2IH4A 4XJSA 3AUYA 1P3Y1 2DFDA 3VC3A 3ZBQA 3UJNA 4PNPA 3W77A 3NBUA 4YRLA 5TGZA 1NVVR 1QHEA 1QRAA 1OXBB 3BQNB 2LV8A 1Q20A 1M7HA 4NE9A 1U0JA 5U4XA 3RVPA 2FWBA 4CF5A 4ZGGA 5BSHA 1B16A 2XGJA 2X8WA 1J00A 3ZE7A 4B31A 4CW7A 3L18A 1R0SA 2WJ6A 3A6DA 2Y0DA 1WB4A 2JIPA 3NBAA 1RAHA 1F6DA 2X9QA 2VJOA 3GPDG 4HNHA 5ADWA 2P11A 1P60A 2FI1A 4QICA 5BW8A 2LWIA 3JYOA 1II8A 3TN7A 3PT9A 2HDOA 1PZXA 2RGBA 1G1AA 1KQOA 3LXUX 2J5QA 4QXMA 4TZKA 3ZR4B 2PX5A 3I52A 3TTXA 4BQSA 2OZKA 3U80A 1DAPA 4ZCLA 4KITB 3A36A 2JFXA 5JSYA 5AIBA 2NTEA 3T4UA 4FOTA 3FCUB 2WM3A 1V1RA 1LF0A 1ZZ8A 1C1HA 1FP4B 1NPTO 2JANA 2ODTX 3D6VA 1YHZA 4BVFA 2VCHA 3F6PA 4NCBA 1KJNA 3F1KA 4J7XA 3RVBA 2UUBB 5K8LA 3HA7A 1D07A 2OOKA 4LQ4A 2X77A 1QTIA 1U65A 1B0ZA 4MKGA 1FXWF 1ML4A 4KQXA 2C9ZA 1XLTC 3HO1A 1V8PA 1Z07A 4P7GA 4XM0A 1E4YA 4KOEC 4G1CA 4M99A 2B1RA 2YMLA 4X7RA 3TD6A 1R6DA 4F6CA 2IVFA 2Q4EA 3R3WA 1T9HA 1O0CA 4K9LA 4Z1MD 4ZCRA 1NUTA 1UM9A 3VSCA 3KVRA 1ZH2A 4YT4A 4AVYA 1XDGA 1IJFA 4TKMA 2HNBA 1MOQA 4CV2A 3AYZB 2Y3IA 2PMCA 1F4VA 3L92A 1FOEB 2RH8A 5EN4A 1BOOA 4J0DA 5K0NA 4DANA 3STVA 3FPJA 3KALA 2CNBA 1VZ2A 2B69A 1PYDA 2JAOA 1KSHA 3C8HA 5DNEA 1XEXA 1ZRMA 4DBLC 4RDXA 2ZCJA 2ZDQA 1QJCA 1DIAA 2X8LA 3CNEA 4GP6A 2AQIA 1SG9A 5HXAA 2NV2B 3DR5A 3Q7IA 1NJ5A 1QIFA 2FWJA 3GROA 2A9JA 5ETJA 1T3GA 5HILA 3A6KA 1GUYA 4DRXA 3DT8A 4LNUA 5REQB 3WGIA 5ALOA 4AX8A 3FBWA 4FYIA 2JLBA 2ZT8A 4JWTA 5FOSA 4OLAA 1SZCA 2HSGA 1ORRA 4P83A 4OREX 1W5BA 5DI3B 4Q15A 3TG8A 1W36B 2PLNA 3KTOA 1RMTA 2H1IA 3GBPA 1UH5A 2G1JA 4HJXA 1GQYA 4RL4A 3DOIA 5E1MA 2PY6A 1WV0A 5I47A 4A1FA 1JHQA 1N6PA 2ZR8A 3W5AA 2I54A 4X6UA 1GAQA 4C4OA 1YULA 2O1XA 2D8MA 1E6EA 1T0IA 3EVEA 3IDZA 3LYLA 3L8EA 2DT5A 2J9GA 3OF5A 4ZOBA 4ZXPA 3MT7A 4D1YA 2KEIA 3ILYA 2GN4A 3A1SA 1W4BA 2M6SA 3ZY6A 3BWCA 3G17A 4QSHA 3NOVA 2G28A 4G4SP 2C3UA 4CLRA 2HA7A 1Z4JA 1CD5A 2MQKA 2NGRA 4MVJG 2FZVA 2JBAB 3T9BA 4BLPA 4I9HA 4JELA 4LF4B 2PUGA 1FTGA 4M0EA 2O2YA 1T9DA 4RDCA 2DBRA 1H3EA 4W5NA 1CUAA 1DWUA 2DGDA 3RI3A 1AGPA 2BF7A 2OLEA 3AFOA 1AC5A 2FUEA 2V7UA 2XUAA 1M5TA 4Q66C 3DL7A 2G1UA 2QRZA 3OFNA 3D1NI 4MKIA 5LQSA 1HT2E 3GUVA 4C0XA 2DECA 1O77A 2OGZA 4N9QA 4ZCPA 4B4WA 2J3MA 1ZMXA 2GETA 2YYAA 3NIFB 3VBCA 3PNBA 1OX6A 5FI1B 3X1YA 5L45A 3NROA 3PXXA 1J06A 4JT2A 1JQDA 2ZSFA 5DM70 1OLSA 1XTBA 3KP1A 3PR1A 2WYVA 4GLFA 4F45A 2OFWA 3FYCA 3KTFA 2OORA 4GAEA 1QUEA 2AXEA 3DPIA 3PKZA 2VJNA 3P97A 1QE5A 2MMCA 1NR7A 4KG7A 2A0KA 4FEGA 4HWTA 5D7NA 3D4PA 3KQTA 3OKPA 4HJRA 1QQAA 3JX9A 4J1TC 2HHJA 4I66A 2WF7A 1RC0A 4HAIA 1VIDA 1BVYF 2HIAA 5FP0A 4UU8A 1MG0A 3T7CA 5D7BA 5I9NA 1AZSC 3BD7A 5D2CA 2HLHA 5DM2A 3RT1A 3DP9A 1GPYA 3CKYA 4X20B 1Q0QA 3T0FA 1QM5A 4TKZA 3ZOKA 4JP2A 5EHQA 3FDJA 4IH1A 2AA3A 1Z37A 1PFGA 3PB3A 3GAFA 1PDOA 3MTDA 3E22A 4DG5A 3U19A 2DWUA 3EG9B 3CH7A 5JXWA 4GBGA 4Y1RA 3VNQA 4TYWA 1U0SY 1T8WA 1G3QA 1UC4B 2J4FA 4MVCA 3SOZA 5E9WA 4C7KA 4DWJA 2K7FA 1TMOA 1OZ0A 3EPRA 4G1MB 4P4LA 4WWHA 1DXQA 3O9MA 2WABA 4HFRA 3FR8A 4AKIA 1KI3A 1RWNA 2OM2A 3ODPA 4HGZA 3H11A 4TN5A 2CB0A 1UEIA 3R8FA 3E18A 2FLVA 4B84A 1XDSA 1RRCA 3TB4A 4ZWNA 4Z6KA 3VNAA 1IUKA 1BXRB 2ENWA 3BZWA 3LBIA 4MROA 4R7ZA 1YFLA 1Y9AA 4MR9B 3TNJA 1JG7A 4AG3A 3R3SA 4RELA 5C8YA 4DLVA 1XHFA 2B5AA 3FCAA 3HADA 4W6ZA 1PT5A 3QPUA 1M9NA 1L4KA 2DLDA 2W37A 3AUFA 3JVEA 2CZCA 2W4QA 1JLLB 2JZNA 2ZJOA 4GECA 4YRKA 3M0EA 4DPMA 3AVVA 3AY0A 3UHAA 3D0OA 2NG1A 2B9VA 2AKEA 2FZEA 2QIOA 2O9JA 1IC6A 2XCIA 4Q9NA 4HX5A 2PUVA