3ME5A

Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457t
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
452
structure length
414
Chain Sequence
NAAQAMLEKLLQIYDVKMLVAQLNGVGENHWSAAILKRALALSEKEFAHLQTLLPKPPEHHPHYAFRFIDLFAGIGGIRRGFESIGGQCVFTSEWNKHAVRTYKANHYCDPATHHFNEDIRDITLSHQEGVSDEAAAEHIRQHIPEHDVLLAGFPCQPFCDTQGTLFFDVVRIIDARRPAMFVLENVKNLKSHDKGKTFRIIMQTLDELGYDVADAEDNGPDDPKIIDGKHFLPQHRERIVLVGFRRDLNLKADFTLRDISECFPAQRVTLAQLLDPMVEAKYILTPVLWKYLYRYAKKGMVYPNNPQSVTRTLSARDGAEILIDRGWDMATGEKDFDDPLNQQHRPRRLTPRECARLMGFEAPGEAKFRIPVSDTQAYRQFGNSVVVPVFAAVAKLLEPKIKQAVALRQQEAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative dna cytosine methylase from shigella flexneri 2a str. 2457T
rcsb
source organism Shigella flexneri 2a
molecule tags Transferase
molecule keywords Cytosine-specific methyltransferase
total genus 136
structure length 414
sequence length 452
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.140 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3me5A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3me5A02
3.90.120.30 Alpha Beta Alpha-Beta Complex DNA Methylase; Chain A, domain 2 DNA Methylase; Chain A, domain 2 3me5A03
3OZTA 5C0OE 1N7JA 1RI1A 2PBFA 4QDKA 4U7TB 1I9GA 1H1DA 4GC5A 3PX3A 2NXEA 5DM0A 4R6XA 2YXEA 1YB2A 3MB5A 1O9HA 3P2IA 4GEKA 4KDRA 4U7PB 1FBNA 5DTQA 2ZTHA 2G8NA 2NXNA 1SG9A 2JG3A 5LQUA 3GU3A 3HCAA 4PIPA 4FT4A 4RVDA 4BY9E 4BLVA 3HCDA 3LPMA 4LWPA 5H02A 3FPJA 2P3LA 1BOOA 2QE6A 3ELUA 5HILA 5DLYA 4E32A 5DRTA 5DM1A 4QQKA 5F2KA 3AJDA 3RODA 3UJCA 4RTJA 5P8WA 1RI3A 5FUBA 2PXCA 5K05A 4GC9A 3EEOA 1I4WA 3FRIA 2PXAA 5K0CA 4PNEA 5CCXA 2Y1WA 3SR4A 1EG2A 3FPEA 1P1BA 3HCBA 4GOMD 2GPYA 3GJYA 2O07A 3HVHA 3ORHA 3HVKA 1G8AA 4M37A 4RTKA 3GCZA 2ADMA 4AZTA 3THSA 1QZZA 2G71A 1O54A 1XTPA 4ISCA 1R00A 2IGTA 3HCCA 2P3QA 3LCVB 3R6TA 3LCCA 3TM5A 4OA5A 4AZVA 3SSOA 4GOOD 4YV0A 3P9KA 4H0NA 1QAOA 1MJFA 4P7GA 5FQOA 2OKCA 3DUWA 3FUTA 2ZBQA 3DULA 3LHDA 4KIGA 2ZIGA 5CVUA 1M6YA 2NXCA 4OQDA 2BR3A 1N7IA 3DLCA 2E5WA 3NDJA 4PYLA 2JHPA 3PFGA 3C0KA 5EOVA 3V8VA 4O29A 2UYCA 4CKEA 3TOSA 5U4XA 1HMYA 2OB1A 5CD1A 3TQSA 2GH1A 4CXMA 4HRAA 2G72A 3BGVA 3DMGA 2AN3A 2I7CA 2ERCA 1FPQA 4Z2YA 2AR0A 5MHTA 1RJFA 3LBYA 4HTFA 4K6MA 4LECA 4ZTBA 1M0EA 2IDJA 4ER0A 4RTQA 4BLWA 1XJ5A 4PIMA 2PSSA 3C6MA 3UA3A 3UBTA 2PX2A 2QRVA 4M38A 5IKMA 4HH4A 4EMSA 1SQFA 3FTEA 4P58A 3AXSA 5HOQA 1ZKDA 4C04A 4P7KA 1ORIA 1TW3A 4P7FA 3NJRA 4RVFA 2BR4A 1U2ZA 3REOA 1L1EA 1RI4A 5FA8A 5KYGA 3KQVA 2AOUA 3G2MA 2ZVJA 1OR8A 3EVGA 3IYLW 3BZBA 2GLUA 2ESRA 1SKMA 5EKUA 3ER8A 2O0LA 4EK9A 3HVJA 3EVBA 3IV6A 2R3SA 4FR0A 5ICGA 4F84A 2ZBRA 3PX2A 3HCFA 5HIKA 3JWHA 1WY7A 1WXWA 2WA1A 5T67A 3HP7A 3B7PA 4MIKA 2HNKA 3A7EA 2C7PA 2ONZA 1F3LA 2ZULA 3IHTA 4AZWA 3KR0A 3D2LA 3KQSA 1AQJA 4IKPA 1PJZA 4QPNA 1SUIA 2PLWA 1JG2A 3CBGA 4RX1A 3HM2A 4YUVA 4YV1A 1R6AA 4RTNA 1Z3CA 3KQPA 5E9QA 1ZGJA 3FRHA 3KQOA 3T7SA 1RJEA 1VL5A 4RVGA 5EEHA 2P35A 1YZ3A 3MERA 2O05A 5K09A 3LX6A 4MWZA 3ID6C 2DULA 3LDGA 1NW3A 5B1SA 3FPGA 3RIEA 2ZWVA 5FWAA 2QM3A 1KYWA 1ZHFA 2XYRA 1IY9A 5E1MA 4POOA 5DTRA 4GF5A 2ONYA 1JTFA 5FQNA 2AOUB 4R8RA 4KRGA 2LD4A 3P2KA 1YFLA 4CTKA 1QAQA 2NXJA 3E8SA 3F4KA 3GWZA 4XUEA 4ER3A 2IIPA 3EVZA 3R3HA 3UJDA 2HV9A 2AOTA 3G88A 5EC8A 3P71T 3PVCA 3SX0A 2FK7A 5DM2A 5K0LA 4DCGA 5C1IA 3LKDA 5HIJA 4RTPA 3KPYA 1KYZA 5GOZA 2PWPA 4DMGA 1G6Q1 2Z6UA 3BT7A 4RV9A 4XUDA 2ZIFA 4XCXA 2I6GA 1R74A 2AOVA 1NV9A 3CGGA 2A14A 3A26A 3LL7A 4HTFB 2B9EA 5E8JA 4BLUA 4ER6A 3HTXA 3UWPA 2CMGA 3R24A 5LQRA 1D2GA 5EIWA 2I9KA 1JSXA 1YZHA 3B5IA 3B89A 1F38A 3QOWA 2EG5A 2OY0A 4OA8A 5HFJA 3VC2A 5FCDA 3VC1A 4DQ0A 1MHTA 3I64A 4PGHA 5EKXA 5FULA 2V7EA 3T7RA 3ELDA 3EGEA 2G70A 1JSZA 3M6XA 4DF3A 4HG2A 1L3BA 3AXTA 3DXZA 2HMYB 5CVVA 2IH2A 5HIIA 5EG5A 3NVKI 3UJ6A 5KVAA 3NWBA 1X1CA 3OFKA 1EAMA 3FTDA 1UFKA 1BHJA 3NVMB 2JH9A 2PX5A 3KPVA 3MGGA 3UJAA 3DOUA 3G7UA 3DP7A 2PY6A 2IP2A 2XVAA 4E31A 1VIDA 5LQJA 4P7JA 2AN4A 4GOLD 2BR5A 2PV0A 5DSXA 3BWYA 3SSNA 5GM2A 3BKXA 3FYDA 1DUSA 4ER5A 1ZGAA 3EVDA 2YTZA 3FZGA 3R0QA 3K0BA 5DM4A 3GIWA 3TPZA 3E7PA 3DH0A 4PINA 2P3OA 5KS2A 3KR1A 5E1OA 2PXXA 3P2EA 2K4MA 4RTOA 3Q7EA 5D1HA 2OXTA 3G2PA 2WK1A 3CKKA 3TR6A 3M6UA 5M5BA 3A27A 5DXJA 1JG4A 1NT2A 5LSAA 5GWXA 2BM9A 3L8DA 2HR1A 4WXHA 3UJ8A 3LKZA 4DCMA 4RTSA 1L9KA 3A4TA 2VS1A 2CKDA 3FUXA 3CCFA 3VSEA 5GIPE 2GAFA 3T0IA 4IWNA 4X61A 5DX0A 1XXLA 2P40A 3BGIA 2VZ9A 3M6VA 2FHPA 3OCJA 4KW7A 4E30A 1NW7A 4C03A 2PX4A 5ICEA 1AF7A 3EVCA 4CKCA 3UA4A 3M33A 3HA5A 3M6WA 4F85A 1NBHA 4BP1A 2NYUA 3NDIA 2OPBA 1X1DA 1Y8CA 1R18A 2GA9A 2EJTA 3CC8A 3X0DA 3MHTA 3M4XA 1WXXA 3B3FA 4A6DA 2NP6A 2UYOA 2XYVA 2ZSUA 5F2NA 1N2XA 5CVEA 4EQZA 3MTIA 5EPEA 3GRZA 1JG3A 3SGLA 2Y1XA 4LWOA 3OU7A 2VDUE 3TM4A 4E2WA 3OU6A 1G38A 3DTNA 1FP2A 3LBFA 3HA3A 4KIFA 3G5TA 1ZG3A 2N47A 4KDCA 4LG1A 3KQWA 2YXDA 3G89A 1RJDA 3PLAE 2IDKA 3SMQA 5JUWA 3KQQA 5E9WA 4X41A 1ZQ9A 1VP3A 3GGDA 4DA4A 3IEIA 1KIAA 3KPWA 3OPNA 1T43A 1EJ0A 1NKVA 2I62A 2ZIEA 3OE4A 3UJ7A 4E33A 3EVEA 3GNLA 4FT2A 4KVZA 5F2OA 2ZW9A 2PVCA 3OFJA 3PB3A 4FZVA 3LSTA 3OE5A 3TFWA 3BKWA 1NV8A 1QANA 1JTEA 3FUUA 1DCTA 3A25A 2P7IA 2CL5A 1NE2A 2AVNA 2EFJA 2YR0A 3QOXA 4Y2HA 1XVAA 3TKAA 2C7OA 5FADA 2F8LA 3GRYA 2YVLA 4M36A 1KR5A 5EZQA 5GP1A 5K0FA 5DX1A 4YUXA 2CMHA 2H1RA 3LDUA 3RW9A 3UJ9A 1ORHA 1RJGA 2YUIA 5DRYA 4PYQA 4PYKA 5HZMA 5FHQA 3GRRA 1UWVA 4OBXA 2GS9A 2CWWA 4WVLA 2OBFA 4PYOA 3TMAA 3EPPA 3I9FA 2ZCJA 3P9IA 1KXZA 3BUSA 3P9CA 2IFTA 2UYQA 5GIOE 1JR4A 3KR9A 3B3JA 4DM3A 1EIZA 3E23A 4AUKA 1RI2A 1QAMA 3DR5A 3PTAA 5CM2Z 3HNRA 5E1DA 3G8BA 2FCAA 1VQ1A 1NW6A 2ORED 3CJRA 3I53A 5DT2A 2XVMA 5DX8A 4FSDA 4AZSA 1YFJA 1INLA 3NWEA 1SVUA 5KQRA 3MCTA 5KQSA 1WZNA 2OO3A 1D2CA 1AQIA 2QYOA 3O7WA 4GQBA 1IXKA 2PT6A 5EGSA 4HGYA 4R6WA 3PS9A 2PT9A 4R8SA 2WA2A 4E2XA 2YQZA 4OBWA 5FA5A 2C7RA 2IPXA 1P1CA 2EJUA 1M6EX 1VLMA 2ZWAA 4A6EA 5K0JA 2ZLBA 3QV2A 2P1DA 1KPHA 3Q87B 1YF3A 3P97A 7MHTA 4IV0A 4C05A 4RTMA 2O06A 1G55A 2BH2A 1YUBA 2ZFUA 3LECA 5E1BA 3SXJA 4DZRA 1I1NA 3DXYA 4CKBA 4G56A 3FUWA 4E70A 2PJDA 2V74B 4EKIA 4MHTA 3UJBA 5ICFA 5EQJB 1SUSA 3OU2A 4QDJA 2YXLA 1TPYA 1KPIA 5EHIA 5K01A 2YX1A 4CWAA 1KPGA 3FUVA 5ERGB 5G02A 5FTWA 5DSTA 3ERCA 5DXAA 4YV2A 5E2BA 3LDFA 2JHCA 3LGAA 4PCLA 3TKYA 4HC4A 1VBFA 2JJQA 1WS6A 2XYQA 2FYTA 3BXOA 4E2ZA 3G2QA 2HTEA 3KKZA 4PYNA 2AS0A 1DL5A 1X19A 5T64A 1D2HA 2Z6AA 1JQ3A 3UFBA 5K0GA 4PYIA 3U81A 3DXXA 4X63A 2Z6QA 2AN5A 2B78A 3GRUA 4PCAA 1KP9A 4YUZA 4RTRA 5EMJA 3ANXA 3GXOA 5IH3A 5DPMA 1X1AA 5EMMA 5LR6A 4KWCA 4GOND 3ER9A 3JWJA 2G1PA 3TRKA 3HVIA 4QPPA 3V97A 4RSRA 3JWIA 4RWZA 5DTMA 1BKYA 3AWIA 5K0NA 1KHHA 4FP9A 10MHA 3THRA 5BW5A 4HGZA 2P8JA 2AZTA 3KQTA 4FSXA 5FWDA 4F86A 5EZSA 3LCUA 3G5LA 3MTEA 5ICCA 1FJXA 1NBIA 5EMKA 1XDUA 3DMHA 3EVAA 4CTJA 3FTFA 3DMFA 4OQEA 3CJQA 1R8XA 1UIRA 3OZSA 3BGDA 4MTLA 3T7TA 4UOEA 3C3YA 1PRYA 4Y30A 4RVHA 3UZUA 4B17A 3FYCA 3NTVA 3PFHA 2R6ZA 3C6KA 3H2BA 4IV8A 5CVDA 1G60A 3EMDA 3MQ2A 2VP3A 2HWKA 5T6BA 2O57A 2PX8A 2OZVA 3KPUA 1G8SA 5JR3A 5LQCA 3NW9A 5CCBA 3C3PA 5DWQA 5CIYA 3E05A 3TLJA 4E2YA 2PWYA 4GUAA 3EVFA 2UYHA 3GRVA 4BP3A 5D1NA 4QQNA 2BM8A 1JQEA 5LQNA 3SM3A 4EKGA 5K03A 2ZZMA 5EMLA 3AY0A 4C08A 1VPTA 2ZZKA 2IBSA 3KPJA 3KHKA 5BW4A 3VYWA 4NECA 3MCZA 4R05A 3BWBA 4OX9Y 2DPMA 3EGIA 3ME5A 2QRVB 1JQDA 3G8AA 2NP7A 4QTUB 1JG1A 4EVIA 1SQGA 3JWGA 3PT9A 4QVKA 2FPOA 3OZRA 2KW5A 1Q0SA 3SVZA 1V39A 2PKWA 3KQYA 4DKJA 2AVDA 3ELWA 4QTTB 2IH5A 2AOTB 2B2CA 3GO4A 5E9JA 4X1OA 4YMGA 5BP7A 3CJTA 3P9NA 1O9GA 2ZZNA 3FTCA 4AX8A 2PGXA 4L7VA 4MQ4A 2H11A 3NMUF 2GB4A 3HCEA 4C06A 9MHTA 1L3IA 3O31A 4C07A 4JXJA 1HNNA 2P7HA 2Q41A 1FP1D 5E2AA 3M70A 3S68A 1RI5A 5K8VA 3CVOA 3K6RA 4FGZA 4PWYA 3HEMA 2FK8A 4V0QA 4ER7A 4QVGA 4GBED 4XUCA 4ATNA 1NW8A 1TW2A 3I58A 2XBMA 2EX4A 4C4AA 4HSGA 1WG8A 4PYJA 4YMHA 1AV6A 2P41A 3EEYA 1XDZA 1VE3A 5EVJA 1IM8A 3EMBA 3MAGA 4PYMA 5CUQA 5E8RA 4YUYA 2QY6A 5CVJA 2UZ4A 2FRXA 1QYRA 4RYLA 2AOXA 2BZGA 1BC5A 3GDHA 3SSMA 1L3CA 5EHGA 3P8ZA 3O4FA 4M7RA 4V0RA 3KR2A 1NW5A 1B42A 5LQAA 2JH8A 2JHAA 2B3TA 4PONA 2OYRA 5K0EA 2ZBPA 1Q0TA 2OB2A 3BWMA 5GINE 4X60A 1R8YA 3R9XB 3A7DA 2C7QA 1XCJA 3BWCA 1P39A 3G2OA 3KQMA 1X1BA 2VDVE 3FPHA 3I5UA 3EGVA 4FS8A 2VDWA 4PGGA 5K0BA 5GM1A 1EQAA 5LQKA 5C9ZA 5FHRA 2IBTA 3B3GA 1XCLA 2B25A 3WSTA 4RTLA 2IH4A 3KU1A 5HIMA 8MHTA 1VP9A 1XDSA 1P91A 3DLIA 3HA7A 1EJ6A 3ELYA 2NNWB 5HEKA 2AOWA 2H00A 4YUWA 5EEGA 5BXYA 3FPFA 5EIFA
chains in the Genus database with same CATH superfamily
1RXIA 3B1YA 1R4ZA 1E59A 1U1EA 1E61A 4EG3A 1GR1A 5C8YA 1QG2A 2OC9A 1F0NA 3O3NB 2BWJA 1LPNA 2OV8A 2R8YA 2QTAA 4X7MA 4EG5A 3LDAA 4A91A 5G41A 4NONA 3F7MA 1QVWA 1Y1KE 1Z5VA 3IILA 2NXNA 9GPBA 2WT8A 3CLSD 4PIPA 2HGZA 4XYMA 5AXBA 2VL7A 2QTFA 2BGRA 2P6MA 4M8LA 5EWMB 2Q4TA 5F33A 3ZE2B 3MS4A 3B36A 2FH5B 2FLWA 2R6GA 4MR8A 5L4LA 1E1LA 3AWDA 5DLEA 2RJNA 3VOTA 4EG7A 2O8DB 2O0HA 4OQNA 4QQKA 2QB5A 3A6JA 3JYQA 3SYRA 3NDBB 3AG6A 5LFAA 1QRSA 1A50B 1UBEA 1WCV1 2OLJA 4M21A 3OF3A 4LCBA 1JJ7A 5E4JA 3TLXA 5CAEA 5KYXB 1RZRD 3TPCA 1SULA 1OXBB 2ZIXA 3Q9SA 3L6UA 2O59A 3UQYS 2CL7X 1UMCB 1UFVA 3GCZA 1ONOA 1AZLA 1VKZA 3GJ3A 2R7LA 4KQHA 3SS8A 3H18A 3R3ZA 2C77A 3U3MA 1WL8A 3D4IA 4RKRA 4YR9A 2JJ1A 4Y0NA 1PWHA 3BJMA 2A0KA 4N65A 3SBXA 4DLAA 4W5NA 4BFCA 1Y7HA 3F71A 4GSLA 1P4JA 1RYNA 2OKCA 2PXLA 1H2AS 4OYYA 3NAGA 5CFOA 3JXBC 2ZBQA 1GKYA 2JFHA 1UH5A 1NP6A 2GZ1A 2XNJA 1FSSA 2B5OA 4EZIA 3E61A 3PHJA 4LHYA 4M9RA 3TW6A 2Q6KA 3RLFA 3V4OA 1SIWA 3PPWA 4CQLB 2W43A 1C9KA 3DOOA 1ZH4A 1PZMA 3W6UA 1U5BA 2BKXA 2JFBA 2UYCA 5JNRA 1YE3A 1O6FA 4F4HA 5CD1A 2EZTA 2FUG6 1X77A 3I2IA 2PXQA 3V1LA 4JEHA 2XXAA 5DK4A 2O8EB 5FPHA 1RJFA 4EHIA 1BRTA 4NYJQ 5DF1A 1CE8A 3JR7A 3R3JA 3PDCA 4ND6A 5BV2P 3A4MA 2AEMA 4OAQA 3QKIA 3L40A 1IQRA 1K97A 1XJ5A 4QGFA 5DN9A 3C6MA 5G40A 1Y1LA 3PDJA 3HY6A 4Q9LA 1JFTA 3CWQA 2RHDA 5HYVA 4Q9DA 1A8UA 3KB8A 4H7JA 1EM8A 2OK8A 1J00A 5AVSA 2HH9A 1HOTA 4RVFA 2C88A 3UCEA 1H6BA 4F1WA 5KX5B 1RI4A 1U7XA 1UL1X 1YDGA 3LO5A 2AXUA 3TTUA 5AW1A 2UUPA 3IODA 5HW0A 5LJLA 1KSJA 3UAVA 4GQAA 3EXG2 1G41A 1PTKA 3R3UA 4PM4A 1Z2PX 1YTLA 1PQWA 2ZBRA 3JAWA 3OEHA 3PNBA 2HK8A 1GIAA 2O5RA 4IYRA 4PCUA 2WMOB 5HIKA 4ZV7A 3IL2A 1GNSA 3SC2B 1IEVA 2SCUA 3HP7A 4TWRA 2B7BA 1BTOA 3A05A 1J1IA 3AERA 4CIAA 5BN3A 3MWGA 1BFKA 2C7PA 5F3WB 3DVAB 2FWJA 4QPNA 4CCYA 4NV1A 4QOHA 4QUEA 1JG2A 4R41A 1USGA 3MC1A 2HDOA 1Q6YA 2A92A 1JYEA 1E6WA 2VPIA 1BXRA 3C5WP 3X1YA 2HQ1A 3IOYA 1SB8A 2XH8A 4U2BA 4C7JA 3C8HA 1V1MB 4MTCA 3ESYA 3ZE8A 5D00A 2Q1YA 4NQZA 3QIAA 2ZYWX 1TKBA 2UUCB 2PZEA 3CLUC 2ID7A 1HZJA 1NW3A 2JD2A 2K87A 1IN5A 1AXGA 3WGUA 2IY7A 3L8FA 1N6KA 1KYWA 1FTYA 5ESRA 1L4EA 2HUPA 4XPZA 4POOA 3CO0S 1UBRS 3KLBA 4QODA 4A26A 5GAGi 2IEYA 5JVDA 2W71A 4IHJB 4BIMA 3CEJA 3KYBA 2WIFA 4KBGA 4ND3A 5FOTA 5I3CA 3GLSA 1RYMA 1XZFA 2LNMA 4PW0A 1OC4A 2BTQA 2J41A 1HA3A 2XKJE 4IFBA 1H2EA 4QG7A 1BFUA 1T0UA 4QJ4A 1Y6ZA 1FDUA 1PFKA 1VA5A 1T36A 3G1WA 4QUBA 4NXMB 3CF0A 5GOZA 1OBOA 1SCIA 4DXHA 5IHPA 3WLOA 4FFVA 1COZA 3H2HA 1U3DA 3N5CA 1PEAA 3AJ9A 3H2YA 1EB8A 1OI3A 2VAMA 4TM8A 3K9QO 1DFHA 3MGBA 1CEYA 2H4YA 2R85A 3F46A 4HY3A 1ZHHA 4P54A 2PUBA 1GRCA 2B3DA 3GH1A 3BL8A 5LQRA 2JIRA 2ONJA 5YASA 2Q9BA 2QXYA 3ZJ5A 3B89A 1F38A 1SU8A 1FU8A 3VC1A 3P9RA 1I5EA 3QXHA 1ZM4A 4PQGA 2HMVA 5LKRA 3RUDA 1L1QA 3PC8A 5EIEA 4QEZA 2F1IA 3TFOA 5J5CA 1EFKA 1WDWB 1CR2A 3DO5A 4G1EB 4LRUA 4P53A 3W5SA 3WP0A 4ZDIA 3AM5A 5CCEA 1WF6A 4P86A 3NVKI 3PE3A 5FO1A 2FZ4A 2XA9A 4F4CA 5HGJA 4G1CA 3T1HB 1KE2A 3CEAA 3T0FA 4P4SB 2DWOA 2ZWIA 3KOWA 5TMBA 4QQ8A 2B92A 3O83A 2LUOA 2Q9UA 3WK4A 1TVKB 3LUCA 4GZ3A 1MFQC 1DUSA 3KJGA 1I2DA 5J63A 4FCVA 3TUJC 4L4YA 3EQ2A 3W9UA 5FBQB 1G8GA 1G1AA 3IV9A 4Y2GA 5TSDA 1T5TA 3NAZA 4PN3A 2CXXA 4XWKA 4U2KA 5JI3E 3S2EA 1DPFA 1RXCA 1SBCA 2PYDA 5DCWA 3ZWPA 4RORA 3HDGA 1ECFA 2WWTA 5D84A 2P91A 2EW2A 3DHNA 5FL7A 4HNUA 1WOYA 1OUMA 3UJ8A 4C0LA 3IB3A 1EX1A 1Z68A 2VK2A 3F6SA 3OZBA 1U4OA 2XIQA 2YV3A 4G5FA 1L9KA 1M1XB 3BWXA 2DBRA 4LPSA 3WGJA 4RJTA 1ZMOA 2GAFA 1EM8B 1F2DA 1Y98A 3E3OA 1CCWA 3EQ8A 1W35A 4LHWA 4UUOA 2GDJA 5K4GA 3QE9Y 4E30A 1WHSA 2VWQA 3ES9A 3H1AA 3OBBA 4LOIA 4LF4B 1BS9A 3FWZA 3PQ7A 2ATCA 1P7CA 4FYWA 3ZU3A 2O48X 1LVUA 3A1NA 2BHLA 5F9HA 1T2UA 4PO8A 5GV7A 5HX7A 1LQ2A 2GPJA 2Z5FA 3GRCA 1GPDG 3HB1A 4IGAA 2PRYA 3L8MA 3TGWA 3TXYA 2HBYA 4P98A 3ZXSA 1MH1A 3CC8A 2WIAA 3NU1A 5ALXA 3MHTA 4YPOA 4J3JA 1WXXA 5LD2C 4JUDX 3C7KA 5LB2A 5LZ7A 1RKQA 3EQ6A 4GGMX 4AJJA 1EIWA 5EE5B 4AUMA 3PDIB 4X20B 4DLRA 2QLMA 1EXVA 1TM1E 1Z8FA 2OECA 4XARA 1UJMA 4L78A 1UWLA 1NXWA 1PHRA 3AVOA 2ZT6A 3DYBA 5FD8A 1BN7A 1II8A 1FQJA 3IAS1 2XY4A 1CZNA 2I3DA 1H8ED 4Y6PA 1Y9ZA 3PJDA 1KY5A 4UKDA 5C34B 3KQQA 4L2IB 5JO9A 3WGVA 1FX0B 1ZCJA 4DZTA 3AU8A 5LP1A 3CUEF 3A1TA 3L6OO 2G7ZA 4KQMA 4WOKA 3UJHA 3TG2A 1EJ0A 1Z2OX 2FFHA 2CBGA 1UK7A 1T2FA 1E66A 4JSYA 5TY0A 1WMSA 3BMCA 3ZHBA 3H9JA 2PD4A 3SYMA 2VHWA 4UOQA 3TFWA 1J7KA 2K5UA 1LPSA 2VT2A 1FYFA 1NN0A 3DMRA 2A7XA 1NV8A 5A4AA 2MXDA 1N0UA 3VH2A 4BL5A 4XVCA 5ITZB 4EJ2A 4KAJA 2WWRA 1N2GA 3SLKA 4L07A 4H15A 4JX8A 1AGYA 1G98A 2VJMB 3X44A 4J0CA 1PD0A 3GJSA 1M2KA 3LDUA 2ETXA 4INOA 3ISJA 4M1TA 3OX1A 1E4EA 1I4EB 4HMPA 3TS1A 3ZX5A 4A8HA 5IC4A 5JWOA 3WL8A 2JATA 2PZAA 1SKYE 2XB9A 4RQBA 2XBLA 1NYTA 2PUTA 4MOWA 4CTOA 1GZ4A 4LHSA 3FKSA 2ZRGA 2EZUA 3DE4X 5C51B 1CLUA 5AJHA 5FT9A 2GZDA 1O8CA 2CL6X 1UWKA 2CUNA 1HTTA 2Z2YA 3WNQA 4BE7B 4QKQA 5CDHA 3GZNB 3K70D 1E9RA 4YJGA 1RAGA 1CF4A 1F2VA 3NV7A 4KAFA 4QU5A 4FNOA 1XTVA 2II6A 4B46A 1OWOA 2R1VB 1A5TA 1NBAA 1C3LA 1EHIA 4RFLA 4DLPA 1BU5A 1G17A 3BAZA 2JI6A 2GYUA 3OEEA 2DH6A 2YHAA 1PG0A 3FG9A 4B5LA 4ZZ1A 2G04A 4HDAA 4PG5A 3NXHA 3Q2OA 3K8YA 4W7HA 4IOMA 5GZ3A 1IJFA 1JHYA 2X6RA 4G8CA 1KI8A 3HKDA 3Q3JB 2YIJA 1EXMA 3DL7A 3SIXA 4OLBA 3TDNA 4PZ0A 2J9ZB 5DI3B 5I01A 2JQEA 2Q3BA 1YF3A 1NM5C 5A1TA 4FUTA 3F47A 2P77A 4UM9B 2ZFUA 3UUEA 3VNQA 4E70A 3ESXA 4G56A 4NZPA 4FHGA 3EULA 4N82A 1HDXA 2CVFA 1TXGA 3BRWD 3MAAC 2YXLA 4TKMA 3H7AA 3NIGB 4BMVA 4TYYA 4C89A 4Q66C 5K3EA 1L7XA 2GK6A 1DAIA 1XWFA 2F3SA 2RGDA 4RHFA 4MKZA 5DHSA 1IOZA 2WJHA 1DWKA 2HY7A 3QI7A 1TTHA 3LDFA 2JF0A 3D2BA 3GFGA 4LF8B 1XMIA 3MJVA 2K2QB 1S8NA 2WZCA 2PXVA 1X19A 2DBVO 1JQ3A 1WKVA 2MCFA 4LFBB 1I5OA 3K05A 1ZIXA 2P9GA 4IILA 4MGEA 4O4JA 3SJBA 4AO8A 3GMIA 2MEZA 2X7JA 1PDWA 5LWHA 3GLHB 1X7GA 2OO5C 4JQYA 4WZ6A 4IVZA 5AJYA 2CFIA 4MRPA 5TC4A 3T35A 4BFZA 2O3QA 4F8DA 1YACA 3EPJA 1M9NA 1XHLA 5K1ZA 4N3BA 3RC2A 3I04A 4OHVA 5G4LA 4I08A 1U8UA 5EZSA 4WY5A 3LCUA 1E6LA 3UMRA 2GSWA 4KK4A 5BMVB 3ZKWA 1RP7A 3MCUA 3PZBA 4FYPA 4E3ZA 1VG9B 5FJJA 2CHFA 2YW2A 2XW6A 1U04A 3H1BA 1CB7A 2H29A 2Y66A 3NTVA 1IQPA 4MQLA 4D9GA 3T15A 3INTA 3IKMB 4OQQA 2HFKA 4YJ3B 4K2AA 2V6JA 3VMMA 2HCRA 3TSCA 3UENA 1R0ZA 4U0KA 3RSLA 1AKWA 1HT1E 4G0UA 1ORDA 1VHWA 1GPAA 1H1LA 4C78A 4G84A 2IHYA 2ZZMA 3HK2A 1FFXB 2LWIA 2G1KA 4MB6A 2R2GA 4FD3A 2HSWA 5EI5A 3AOEA 3M6IA 1NIPA 1TO6A 3DCYA 5JXHA 5JSZB 4ND4A 2XB2A 3ESAA 5AP9A 2DQYA 3SKXA 4AMYA 1T25A 2QQGA 3C4QA 4N0MA 4WGFA 3SEQA 4B3DA 1VPLA 4D82A 3NYIA 4QTUB 4YCMA 3L02A 3G7NA 1WW8A 3UK6A 2OFOA 3HH8A 2GEFA 1HMPA 2K2WA 4P4NA 2BEWA 1E1KA 1GNVA 2CHGA 1LZLA 3NUZA 4OMDA 1D6JA 3ZPXA 2Z09A 1S0UA 1JEQA 2H51A 4DJEC 4I6RA 1HBJA 4X4IA 1XU9A 1PJCA 1ZH8A 1ZC4A 2WIUB 3KUCA 2HLDA 3OO0A 3W8FA 4DKJA 3Q8XB 1NQOA 3LWZA 1DAKA 3NNNA 3H11A 4ZDWA 5A9SA 3IV7A 2H4JA 4YECA 1NUTA 1T24A 3G17A 3PXUA 2RDMA 3VM6A 2XGJA 1E7QA 4JSRA 5A7GA 3INGA 4I1SA 3WLTA 1G3RA 4BU1A 3NANA 1WXHA 3MEJA 2FJPA 3QU9A 4PQFA 4XQGA 4OOFA 5IU6A 3BCSA 2OO7A 3BA1A 1GZHB 3V4SA 1JTVA 3HRHA 3MRSA 1UT5A 1PJBA 5EJAA 1BRMA 5KO2A 4P2GA 3QIVA 2P9QA 1TMGE 3I58A 1MO6A 1VCNA 5ALYA 1B0ZA 3OQMA 1ECBA 1GEGA 4QOEA 1JPUA 2C2ZA 3ZHTA 1G0OA 4B3HA 4UU1A 1Q1AA 5FUQA 1LK7A 2QY6A 1BWRA 3AB8A 3E22A 4OH1A 4C4PA 2GT1A 3O8OB 4KJZA 4M53A 4O4HF 4GX1A 3T4PA 1ADBA 4E1BA 2ZJOA 3T5CA 4HXGA 3PUXA 4BGUA 3R1IA 5EQFA 3WKBA 1EFAA 2QAGB 4FDMA 3TEJA 2X2PA 2I1VB 1RC1A 3EIEA 3ZU2A 4INPA 4LWQA 3LIPA 4UREA 1ZOPA 1ZIPA 3W6PA 1Q0TA 1A9ZA 1NMQA 1UXOA 2QQFA 3FCUB 4DRXA 4WOJA 3FDXA 4IGEA 4BFUA 2J3IA 4JQDA 3PC3A 2GK7A 4DV5B 3LSYA 3R9XB 4JNCA 1EK5A 3GLGA 1I13A 1ZD2P 4FS8A 2FY8A 3ZV5A 5JDCC 4LBWA 6REQA 2OQIA 5K0BA 2VJOA 1JRLA 4H6VA 1C2TA 4RIEA 5HUJA 2QL6A 1RCTE 3O73A 1CZUA 3CKLA 3A3KA 4DUGD 3CW2A 1EWYA 4RTLA 1YZYA 1D2MA 4U63A 2ZB3A 3H4TA 4OAOA 4ZICA 3GG2A 3JQRA 4JI8B 5FR1A 1PLKA 3CISA 3N74A 4JEUA 5F2OA 3EIWA 3BOSA 4E22A 4JKIA 1RI1A 4TS9A 4TV9B 1J06A 2WC1A 4D2IA 2QTZA 1GPWB 2G83A 2CF5A 2QTHA 3L4EA 5AVYA 5DGDA 4F56A 4A8JB 1D6SA 2X5JO 2G1UA 3RJ5A 2AX4A 3HCAA 4R98A 1N33B 1I4LD 2XZTA 3QPWA 3O8QB 1J1UA 3FJYA 4QU0A 2P3LA 4HWPA 3P5BA 3I9V1 3OFVA 1UEIA 1V3TA 5DLDA 5FORA 3VRHA 5HM8A 2I2CA 4N6GA 2AEEA 2WOJA 3CECA 1CNFA 1YIAA 1QVRA 3QK7A 3AJDA 4WXYB 2PS1A 5EN4A 4WBXC 3NBZC 1ENYA 1DZ3A 4UNPA 4BPBA 2GYWA 1M0TA 2A9OA 3SPXA 3MUNA 2BFAA 3HY3A 1A71A 1X3LA 4YRJA 3GJYA 4AWBA 3THWB 7REQB 4D44A 3H65A 1VIVA 1R0XA 4ZVUA 4C0QC 2PZMA 4I5IA 1IOVA 1DWOA 1QVVA 4JIMA 1JB9A 1OJ7A 3F3SA 3R6TA 4QO8A 3SQMA 2GPWA 1QQ7A 3AEKA 1A1SA 4ZJYA 1KOFA 3R77A 3CX6A 4C76A 3B20A 1DAMA 5FPKA 5I7EA 4P8RA 1BEZA 4CKZA 1RD4A 2BELA 2ZB4A 4ARVA 3AUUA 4UPEA 2IV1A 3OZAA 1VC2A 1XVUA 2JHPA 1R66A 3K53A 1KO8A 1UBHS 2HSJA 5TQ0A 2RHJA 3U26A 1K3TA 4XX1A 3ACBA 1JDJA 2HJWA 5CTJA 3UT5A 1JHRA 2QVZX 4DE8A 1RIIA 2GH1A 1U1CA 1FS6A 4MVXA 3E2IA 4OXQA 1FQOA 1ST3A 1K27A 2I7CA 4R81A 4S24A 5ETJA 5H70A 3BWDD 4RD1A 2VQSA 4AJEA 1J20A 3CRW1 4MWCA 1DJOA 2AKEA 2W6MA 3GC6A 4W5OA 5KYWA 3D7KA 4RDHA 2Q62A 4WADA 7ADHA 1Z63A 1D1TA 3UBTA 4MA4A 4NCJA 1LH0A 3G0TA 1XP5A 4NU6A 3BYZA 5CM8B 2ADFA 3O9VA 3P96A 2JJMA 2C5AA 1I2BA 1SQFA 3WRXA 4FHEA 4OQYA 5IJ9A 2AZXA 2JCXA 4BQOA 2JIPA 5H4HA 3L6BA 3TNDA 1JHPA 4BNGA 1VMDA 3PXEA 4X3OA 2XXJA 4U9UA 1U1DA 3GV0A 3JXEA 4MS1B 5A02A 3O8BA 1FUYB 3G2MA 3QBTA 3H4IA 3I9LA 2IIVA 4KQXA 5JSUA 1SBIA 2Z9BA 1CJGA 2QW0X 3EVBA 1JJBA 1LJUA 5ICGA 5JCXA 5KX5A 1UZUA 4HZUB 3PP8A 5ED0A 4KQGA 4PICA 1G5RA 1TCBA 2ZQ5A 5GONB 3H5IA 4L28A 2GBCA 4ZI7F 2ZROA 3F6PA 4MP8A 2A5YB 4OOEA 3GCDA 3VDMA 3AVUA 2X19A 2BKUA 5JZBA 3PXPA 1HGXA 3AUXA 5JC1A 2IDMA 5ICSA 2QX9A 3HO1A 1I0ZA 3AESB 2CHVA 5AW2A 2XDWA 3DVAA 3KT6A 3ZWKA 2WHXA 3ADCA 1JHVA 1YL7A 3STVA 1U28A 2PNFA 5FKJA 3R41A 2QZPA 3IKLA 4U02A 1FFCA 3ZCTA 4JR0A 4KN6A 4BE4A 3H1PA 1QYDA 2X1VA 3ETNA 3M5DA 2OL4A 3W0LB 3C97A 4UTPA 1PERL 1RHQA 1W0JA 3O4GA 1ZW6A 2V4ZA 4YJKA 2AFIE 4WNIA 2DFPA 2XAUA 1AMUA 5KYVA 2AJ8A 2R96A 2ORIA 1JV2B 3W8RA 1QYVA 3QVJA 4AJ4A 2QE7A 4MVJP 1LDYA 1O95A 4IOKA 3WRXC 1F5NA 1O5TA 4B43A 2DUMA 3W2EA 3PVCA 2TECE 3HSYA 2OXRA 1AB6A 1KBQA 1SMKA 3ND7A 4Y6LA 1OBFO 3WGHA 4KR0A 4DPMA 4OB4A 1K68A 5CAEB 5KYXA 1Z3IX 2NX2A 2O1XA 2V7QA 3DTVB 2BF7A 1Y4DE 1E2NA 1Z07A 1T36B 2F6RA 3O4RA 4K9QA 1MKYA 1KL7A 1I32A 4QDXA 3CGGA 3A26A 3D54D 3HJAA 1D2GA 2ZBUA 3SS7X 4H59A 1HORA 2Q1UA 3KS9A 3F7OA 5EIWA 5IANA 1K06A 2MT9A 4PPQA 3T3IA 3JSXA 1ICIA 5AUQA 1AKEA 2X23A 5FULA 5HCIA 3VH4A 4EOGA 2B83A 1QU2A 1HFJA 4HB4A 4B3JA 2C84A 4LEIA 2BKAA 2COKA 1R8SA 3IBGA 2I6XA 4LJYA 2WWFA 3I6ZA 1IHUA 5H7XA 2NGRA 1SCQA 5CFLA 3PU6A 5EJ4A 3UKJA 2QZJA 3EDOA 4MPDA 4OTZA 5EXDA 2HU7A 2BEUA 2C57A 2B61A 3EIXA 1Q16A 2PY6A 2IP2A 2R8PA 2XVAA 1R9NA 4TYNA 5FWXA 1L5MA 4CDGA 2PFSA 1C4WA 1M5UA 4BEWA 5AKYA 4AKHA 5TLSA 5I4IA 1PRAA 4BFXA 4ER5A 2O19A 1F8UA 1J56A 1LK5A 3WSWA 2Q5JA 1BSVA 2GGSA 1OZAA 2VBIA 1M33A 2JZCA 3OPQA 3AP2A 3QE0A 1PR6A 4JJAA 1MQSA 1E64A 2PR2A 3DBLB 2B4RO 4NS4A 1E5DA 3QG1A 1O4XA 5BMOA 3NC0C 2NSLA 5CB4B 3JARB 3GXBA 1YCDA 2IYTA 1QZUA 1P0CA 4XAQA 5K4HA 1XMXA 5HQ3B 5AHXA 2HMUA 2IYLD 2P5UA 1NVKA 4E5KA 3UKDA 2Z98A 3B78A 3WMXA 1TCVA 3TI9A 4O33A 3U0VA 1HDZA 3H2JA 2QAGA 4KMMA 4JU8A 2NN3C 4D3YA 1Q22A 1TYAE 4OQ4A 4YDSA 3QMPA 3FUXA 3WNBA 3EZ9A 5CJPA 3FAZA 5ILOA 3AY7A 4KQIA 4JL6A 3GNSA 2C58A 4P80A 3L79A 2H16A 1NW7A 4BJHB 4C03A 1GPJA 4NZ9A 2WINI 4OHBA 4PAQA 1A1VA 4F85A 4HDSA 2C2GA 3PXCX 4MYUA 5AHKA 5DLPA 3E4CA 1K2WA 4MPRA 3SEFA 4C4TA 1PUJA 2QRNA 1ZIOA 4UBKA 4X9XA 1OLSB 3WGOA 3AF5A 1AOXA 1N3IA 1VHTA 4INJA 2GCGA 1ENPA 2C61A 4GMDA 2EJTA 1GY8A 2Q5FA 4JELA 4DN6A 4EMBA 2NP6A 2L17A 4O2BB 1RAFA 1R64A 3PEEA 2YFQA 4CW7A 3D3KA 4MB2A 4XDYA 4ZJUA 2V7WA 3BG5A 3NNDA 3F6CA 3HBNA 5ALZA 3WKAA 4JP3A 3GY0A 4AB1A 4CBVA 4O5AA 1QRRA 5ELLA 3IQWA 1N3BA 1OOEA 2P75A 5DJ5A 1CDEA 1L0BA 1VL0A 1LPBB 5EKSA 3RDPA 3RIMA 4EQ6B 3L9XA 1JALA 3KQWA 3AX6A 4DV4B 3WS7A 1PHPA 1RJDA 1TIBA 2JL1A 4CM9A 3I04M 3RVBA 3DBRB 3ZWAA 3T4UA 3IJ5A 4AP9A 2H5EA 2CKMA 5HA5A 3UANA 3OQOA 1N8SA 3JQEA 4ZCSA 4M22A 2XT9A 4EFNA 5ISMA 3CPEA 2HD4A 4F4DA 4B4KA 4CKYA 5FEUA 3TLZA 5J1SB 1L5QA 1S8FA 3LSTA 3OE5A 1I30A 1LTHR 1V5IA 2IT1A 2O23A 3BBPA 4LXTA 1ZCFA 5AO9A 1CVRA 3BBLA 2OXCA 4X45A 3FUUA 3A25A 1MXFA 2CL5A 1QCZA 2AVNA 4H7FA 4OMCA 4Y2HA 1PGNA 5B58C 2AQHA 4KQFA 4NG5A 2ZAMA 3Q85A 3QEJA 1A9SA 4A36A 2EQAA 5K0FA 3WE7A 1BE6A 4FFOA 2X13A 2DCMA 4Q03A 2NU9B 1KC1A 1UJ2A 3NTQA 3N0WA 4CIWA 1SQ8A 3GEHA 3L18A 5DIFA 1AS0A 5K3FB 3UH1A 2BZSA 1QF9A 3O9ZA 3VVBA 3ZU4A 2EKPA 2A6PA 4UNNA 1W75A 2WTAA 3OETA 4KAXA 1CY8A 5EZYA 3JQCA 3TELA 1YMVA 1ZNYA 2UYQA 1G8YA 3DEJA 3KR9A 3NS7A 3U3RA 2F1RA 3QBVA 4B6PA 4BX2A 4DCJA 3PC7A 4EJFA 4Z49A 1GZVA 1QAMA 1GA6A 1X92A 1V8PA 3D5TA 4HN2A 1EM6A 2A0FA 2FUKA 1KF0A 2NAPA 1E9VA 4JBLA 4LQ4A 3I6QA 2VUHB 1WWKA 1MO4A 4RVCA 1UKZA 2BFBB 2ID9A 3MWFA 5GONF 1XRRA 4C4OA 3GUVA 3NWEA 5JNTA 3G1UA 2V0NA 1LDMA 2V7PA 5GMOA 5IASA 3CIOA 2OO3A 5B2FA 1X7YA 3O7WA 5KNCA 4IIFA 2I1QA 4OSOA 2PKQO 4AG6A 1W0CA 5EKTA 4FYIA 5LUBA 1DBPA 3RB8A 4BMOB 2PSJA 2C7RA 1PQ4A 5ALQA 3PD1A 5JHGB 2R65A 1UTXA 2PGIA 2CJPA 2FVYA 2ZSIA 4XD7D 3ICOA 5BSVA 1Q2XA 2FSIA 2CUZA 2JFUA 2VEOA 4QTYA 1CJMA 1RQPA 3LECA 4CPDA 4FKMA 2Q45A 5JBNA 5K45A 3H8JA 5CLHA 3RGGA 1GM5A 1ZICA 1CS0A 2B8TA 1P31A 1SUSA 2GM4A 1GWNA 1EWTA 3N58A 1IFXA 2NU7B 1ZNWA 3I0MA 3TD2A 5EHIA 3BGOS 2IWHA 2EP7A 2J5BA 3EUAA 4RMHA 1J0EA 3T1NA 4YRGA 5IWCA 1HNXB 3ICQB 1RPEL 1Q91A 3ZHVA 4Q4JB 2G77B 3SJZA 4HC4A 1R9GA 2IW1A 2EX0A 2AE2A 3B9RA 1ISFA 1PEYA 1L1MA 1SA0A 2AS0A 2NUTA 1F2UB 2BIFA 3QKRB 2YFYA 3AB3A 3PQ6A 2UKDA 4G25A 5AKIA 5THKA 4AY5A 1FRVA 1B14A 5LA6B 2WWVD 1EI9A 1FDSA 3L92A 3I8OA 2BHRA 3H9EO 2ZUWA 5KYYA 1KWKA 1L7BA 4FZ5A 1AUOA 1C1XA 1NJFA 1SXGA 3H3FA 4JL5A 3ZQJA 2RGYA 2I2DA 2Y99A 3ND5A 3R7DA 3Q11A 3ZYCA 2RIPA 3CT6A 3M4JA 4HH3C 2QM7A 3QQ6A 1ATIA 1Z5NA 3LX8A 4RSRA 4V0LA 3V97A 3ZWBA 2CHEA 4YB8A 1RLMA 2C3UA 1BDHA 2A4MA 1T4DA 2E4AA 1FJHA 1H2HA 3LTEA 1MEEA 2FQYA 1UODA 2D59A 1KMCA 2CXPA 2RHGB 3LUGA 1JHAA 4KMSA 4WT7A 3ROPA 3W7AA 1T0IA 1IWBB 2OHOA 3MTEA 4Z59A 5EMKA 3SNHA 3EVAA 4BQFA 3LZDA 4H0FA 3CJQA 4NARA 2HPHA 1VRVA 1SXJD 2E37A 2VYCA 1BOFA 2GPNA 1DKQA 2YW9A 4WBNA 4CUJA 1QPGA 3J81A 3EGDA 4RMGA 2J0QA 4IV8A 4PY2A 3IVGA 5L6MB 4LDAA 3OQPA 2LYKA 1ELOA 3K15A 5IDQA 2QUBA 3U60B 2BGGA 4M99A 3CEHA 5DHUA 1E2HA 3FNBA 2C5HA 3TOXA 3ITNA 3DC7A 2AJCA 2CVPA 3GDWA 3NHKA 4MDHA 3CN9A 3I28A 2NU6B 2JKZA 3ZLJA 1L4GA 1Q83A 3QLVC 3IJRA 2HYDA 1G8KA 3Q15C 3TEMA 1NEQA 3MS7A 4OJTA 3L06A 5IKOA 4BO3A 5BVGA 2QMHA 3VR3D 4N8EA 2FFRA 2TRSB 3UEOA 3FBWA 2QRVB 3VK0A 4XXHA 5A4KA 4HQ0A 4H6WA 4KQ6A 3TL6A 5BYKA 1E3WA 3ZCUA 4D8VA 4G8DA 2KW5A 1M2OB 4JEMA 1A3CA 5KC9A 5C31A 1LCCA 5AI6A 3SVZA 4R2KA 2QW1A 1B8UA 1KZGB 2Z83A 2ZITA 3ADOA 3STXA 5IJ0A 4D8YA 3AM4A 3FB4A 3FHJA 3BORA 2GRUA 3CJTA 1ATZA 3H9QA 1MB2A 3KOMA 2Q6LA 3EG9B 3KLMX 1M34E 4QSMA 1RYDA 1J2TA 3DTTA 1A98A 2Q8QA 3CT4A 3ZS9A 1U2EA 4CQLA 9MHTA 3SDBA 1VM6A 2VBCA 4IS2A 2VJMA 4CCSA 3AVTA 2AR9A 1R12A 2CMDA 1NQXA 1ECPA 1JMYA 5A3SA 2VZLA 1QZTA 1C3JA 2FKNA 5TDHA 3OJOA 4ARUA 3ETGA 1M2JA 1OZ0A 4H08A 5CNMA 3DBHA 3VYTB 5IFLA 1N2SA 1AV6A 1DI0A 3SC3A 1N5OX 2XCIA 3COZA 4LX8A 2BYTA 3NGXA 3WWPA 1EAYA 5DBFA 3MK31 2PPXA 1Q0ZA 2EKLA 1S3SA 2CFTA 3JASB 1GUDA 2XQGA 3KOUA 4H1TA 4WKNA 5FA6A 3TAUA 1DKUA 1NUAA 3A4YA 3EB9A 4JVNA 2PSEA 5JZVA 3DMTA 4G9EA 2E48A 3EZGA 3I01A 3B52X 4O0MA 5MN5A 2OTCA 3SIPA 1MW8X 2AOXA 4QECA 4MYCA 1ZH2A 1G9TA 3GDHA 1XXHB 3VDRA 4B2YA 4F7WA 5K6RA 4CU5A 5L3VA 1H6CA 2P2NA 3I2GA 4D80A 4NCBA 3HB4X 4FEGA 3HP4A 2WHEA 1IHOA 1HE5A 1LS6A 3TRFA 1XYGA 5BORA 3FGOA 4URFA 3QLJA 1Q3HA 1XDWA 1Z9BA 3WNVA 4FLEA 1XCJA 3BWCA 1NYRA 2VP0A 3V8EA 1U1GA 1DC4A 2PR7A 1OWNA 1VHLA 1U99A 2VDVE 3I6MA 1E60A 3MZ0A 2Q1WA 3PJGA 1EE1A 4FX2A 4IIDA 5EPOA 5BURA 1EQAA 1M1YA 4LRXA 1EP2B 4MYSA 4R84A 2WG2A 5H3HA 2ONKA 3W6ZA 1G21B 3B13B 3S29A 3JXDL 3U3KA 1YVPA 1YR1A 3ABRB 4KQJA 4QLBA 2W6NA 2HEGA 3GJRA 3ELYA 3PHIA 4I66A 4C22A 5IJ0B 2XT6A 2XDAA 1QB2A 2QD2A 2I99A 5DBEX 4YMLA 1IUKA 4JYZA 3PX3A 2ZREA 4Q39A 3ZZTA 4U2GA 4M76B 2RK4A 3U1VA 4WX2B 1U5CA 1JEJA 1FMLA 3U3OA 2H7VA 1FBNA 2C8VA 2W8BA 4ZVLA 4E1VA 4AFNA 1HNZB 4GVPA 4R3NA 4E4RA 2Z57A 3PWZA 2BN4A 5KNLA 1BXKA 5JBQA 3IPAA 4Q6WA 3K1TA 3G9TA 3U17A 1F0YA 1Y6JA 4GAEA 3U48A 3FA2A 1V7QA 2J4FA 2DC1A 4IJ6A 4DQUA 4HL6A 2QVCA 2QYTA 4OYLA 2I8LA 5DLYA 6LDHA 1HDYA 2JKYA 2N1BA 2OV1A 3PXGA 2GVNA 1Q1NA 1QHXA 2XUDA 2CDRA 5FUBA 3UMFA 2HF7A 5MFZA 1F7UA 3VX4A 3RTCA 3UT6A 2RGNC 4DQDA 1DX4A 4BN0A 4GOMD 5KKCA 4UCWA 2RD2A 1ZOSA 2DY0A 3AI3A 1VSQA 4DDMA 3PT5A 4HUQB 3M2PA 4EVQA 4E46A 3GLIE 3M3DA 4RJIA 4TROA 1KVRA 1VZ2A 3HCCA 3TK1A 3ZDYB 1HDEA 1I1QB 3G8YA 2F3QA 4XFJA 1ZU4A 1MJFA 3LQ1A 2PSDA 5IKXA 2VK1A 1CQJB 1V1JA 4HNTA 1W2HA 3PPYA 4R9NA 4OL9A 4C7KA 3L7BA 1E7WA 4LPKA 1GEEA 2BR3A 4OKSA 1V16B 4ND2A 1H4SA 4QEDA 4TKLA 2QNBA 1ISIA 1WSWA 3AFGA 4GXTA 5EJMA 4E7PA 3PFGA 2AKAB 2H1CA 3NXKA 1D4AA 3QSGA 3KUKA 2ZUDA 1QTRA 2OT3B 5G53C 1O94C 1OTXA 1P2SA 1USKA 1TQHA 3L46A 5DTEA 1ZXBA 2SHKA 3U49A 3ZHRA 3TXXA 2DY1A 4FYJA 4IRXA 4MWSA 3CPSA 1YJBA 1ZITA 1WF3A 1ORTA 1TQ4A 3QY0A 4O2BF 3ONFA 4KQ1A 4UFNA 2OYCA 3W1VA 4A0GA 2WYWA 3W5AA 4M1EA 4EI2A 1FQWA 3FVTA 4DWWA 2X6TA 2JLCA 3KXDA 1K9SA 1NMZA 4LVUA 4BXOB 2F48A 2P30A 4EW3A 5KVCA 1AG9A 4QTXA 5HJ5A 1L7AA 1AHHA 1T9ZA 1IBSA 2VZEA 4LI3X 5KQGA 1IY8A 2B8EA 3OVMA 4WY8A 4TVBA 2RHBA 1ZUNA 2H2FA 2ZYUX 3D4NA 3PX2A 4CMIB 5LA6A 2R6CA 2Z56A 3DJYA 2Q4RA 2C2OA 1DWQA 2ZSHA 3EHEA 4YQZA 3W2FA 3S5UA 5IWAB 5IK2D 3MGKA 3WGKA 4BMXA 3A7EA 3JQDA 4L3WA 1Z62A 1SVOA 4ZOAA 3AK4A 3ICPA 5IW8A 5AUOB 1KFEB 2I9PA 2X1MA 4CL3A 4D43A 2YH2A 5E0KB 3HM2A 3A36A 4M9CA 3RYFB 5KNCD 1P1FA 2AQKA 1Y1QA 1KGDA 3JQ8A 2Q1XA 3QVGB 4OXNA 4BECA 4BB0A 3C6ZA 4IKOA 1JHXA 4QICA 1Y0BA 1YR9A 1ZGJA 2FZKA 3FRHA 5FRDA 4QM7A 3HCWA 3OUZA 1U2DA 3KP1A 5KAMA 3VHRA 4C3ZA 2ZUSA 4QGGA 5AKKA 3PLNA 2GN1A 2ZIAA 3OA0A 4LJ7A 3OIUA 3G0GA 4TRNA 2GESA 2ZWVA 2QM3A 4Q9IA 4IDOA 5TMPA 2FSSA 1XK7A 2PSHA 2XYRA 3D1NI 1C29B 1XHEA 5LDGA 3AEQB 5JG7A 2GRJA 3G0CA 2JGDB 2FRDC 2AOUB 1BHSA 1GUZA 4R2IA 3U4GA 1PQPA 5CPFA 4KREA 1QAQA 2NYAA 2ENWA 3E8SA 3O4VA 4HWSA 4K40A 5E95A 3EOZA 4L0CA 1PK8A 3H3XA 1YUMA 2CFCA 1V8BA 2HV9A 3Q40A 3V2HA 3OZGA 5B3KA 1A9PA 1C0PA 1TAQA 4BNLA 1VGRA 4XH9B 4WFIA 3E9CA 1E58A 1Z5ZA 3JD4A 4QWWA 2KLBA 3DOHA 3JQQA 1K8YB 3OKZA 4I9FA 3AGQA 2D8MA 2QTBA 2G88A 1CULC 1M8PA 1Y3CE 3SHOA 3USZA 1NX6A 3EWIA 4RZIA 4WY2A 4DCNA 3LYLA 1VCOA 2PFGA 2Q0HA 3GUZA 4HSEA 1ISGA 4Q12A 5B3AA 5J2TA 4JGGA 3I61A 2JGRA 8MHTA 5JZ9A 2PXPA 1RRMA 1PP4A 3I64A 3MELA 5EKXA 1RXVA 1J09A 3AR3A 5FAKA 3ELDA 1CHNA 4FFMA 1ESEA 3RK0A 2WJAA 3DOIA 2UUOA 5FTJA 1Z28A 5TR9A 4BBZA 2O20A 2SKDA 4DF3A 4W5TA 1YCGA 2XRFA 3NCTA 4RKFA 5CVVA 4ZZ0A 5H5JA 3DSRA 3QXCA 3NWBA 1EAMA 4XB1A 5E4TA 3W2TA 2XT0A 3K1AB 3R5HA 1UPUA 1TJNA 4XJXA 5LLSA 2AG5A 3ENNA 5KQLA 2K7FA 3BDAA 2PV7A 3GZJA 4RJ2A 5LQJA 3NBMA 2ZJ4A 3OOEA 2H1LA 5FBRB 4ABTA 1AGXA 2VKQA 3FGNA 3SR3A 4DV6B 5MFPA 1POXA 3QFTA 3AONB 1UMBB 4C2TA 2B7LA 3BJRA 1T1GA 1CZOA 5DBHX 5L51A 3DBHB 4QUKA 1KAGA 2XA1A 4ZOQI 721PA 1NG1A 1P60A 5D5PA 3P2EA 2QWXA 4NPCA 3HCNA 3W7BA 4DLWA 3PHHA 1DUVG 3DKIA 4FWBA 4NSNA 2B0CA 1LQTA 3HKDB 5CYFA 5EZ6B 2O4AA 2BM9A 3L1UA 2HR1A 4X1KA 4N0PA 1EJ2A 1VPWA 1J22A 4LQCA 1W36C 3U4MA 4K86A 5B1IA 3DFZA 1CY0A 1YVDA 1T5IA 4C6TB 3U4AA 4ENTA 1WDLA 3TQFA 1V9CA 1T8SA 3DV0A 3GHYA 2AFHA 4HI0E 4WZBA 4EFLA 3QHAA 3QEOA 4W5WA 4EWLA 2A9VA 4AJ9A 3OM9A 2C9DA 1FX1A 1A9TA 2CCKA 5EQTA 4DSUA 1RFLA 2NYUA 3DE2X 1Q7EA 2M4HA 2VHTA 3Q98A 4MV8A 3UGQA 2PH1A 3TNLA 4N54A 5IEBA 3V2GA 3FCXA 3INRA 1QVAA 2YHBA 1C4XA 3C3AA 2PNJA 3TR0A 1GXSA 4MQBA 3Q6MA 4BNYA 4D5EA 1DGQA 4U7DA 4OB6A 3QELA 3I8XA 4EJSA 1P2FA 1E92A 1V48A 3STTA 1OXXK 2I67A 3FWHA 3RGWS 1XZGA 2QN2A 3QU4A 1ZR4A 2RHRA 1QV7A 1QLJA 3ACDA 3WHIA 4GYJA 2EG9A 2JAXA 3W6NA 3B12A 2W70A 5AVUA 4KIWA 4LF9B 4N0QA 2CNDA 1JR6A 3ZV7A 3G5TA 3VSDA 4GXNA 1H9AA 1Q0LA 1KE1A 1XF1A 1RBQA 4EO4A 2ENUA 1JH9A 4GKJB 1JGTA 5AM0A 3HU2A 4YXWA 4GI2A 2Z2KA 4G5HA 1KARA 4LFCB 2QJRA 3UATA 4YYZA 1IHDA 1OY1A 4I55A 3GGDA 2R25B 1J49A 3IEIA 3K2QA 5C8XA 2A1UB 2XUGA 2XWBF 1HY3A 3JV7A 3C74A 16PKA 5HJ2A 1F2TA 1AC5A 1U1IA 4HWRA 5AVRA 3OFJA 2DQZA 2NT4A 2VDOB 4MUAA 2BLNA 2HREA 2XI4A 3PPXA 1Y9QA 3ND9A 4JLDA 3U1TA 1KMMA 3X1DA 4Q3OA 4EY3A 5ALDA 2FG6C 2F8LA 2P65A 5AKHA 1B76A 1QFZA 1V8OA 2GEKA 2GHTA 3BGSA 3D3WA 5C1DA 5F9MA 4OIFA 3R1FA 2J45A 4QJBA 1JIXA 2QW8A 3HGTA 5F64A 3LVQE 1U8YA 4PNHA 1UAAA 1GFIA 2ES4A 2B37A 3FTNA 4B3GA 3B8EA 2D7CA 1BMTA 1GAJA 1UOQA 2O7RA 4NNJA 2JIZD 2ZETA 2ZSEA 1ZR2A 2H2WA 4LC1A 4WLVA 5IAJA 3TMAA 1DDIA 3I9FA 1W48A 1KXZA 1N9GA 1JBQA 2YWHA 3FN4A 3M6FA 5GIOE 2W0SA 4B3RB 2KJQA 3DGEC 3PDHA 1VG1A 3HN2A 4H4EA 5JDIC 4GDFA 2KYRA 4N18A 4DNOA 1QS0A 3COVA 2PXUA 3UK1A 3UPDA 5EJ5A 2EYUA 2J6HA 5IT9A 1OH5A 4AJIA 4XASA 2PXHA 3B82A 5TGZA 1NW6A 2OCYC 2HBRA 2ZSFA 5LLDA 5FWYB 3HZHA 4PZEA 1RAIA 1XZDA 3Q8KA 3ETEA 3IESA 3UXMA 5E3IA 1D2CA 2QG9A 2WFLA 3WB2A 4QHSA 1GCIA 3PC6A 4HOYA 2BGTA 4KVAA 4QPZA 4U2EA 5EGSA 3WQRA 4QBFA 2V0CA 4LZJA 4MKIA 3G0OA 4UM9D 4X1IA 1AKQA 3EDQA 3RHSA 1DKMA 2YQZA 2G9VA 1RJ9B 4CU2A 5B4TA 1P1CA 1Q7CA 2YL2A 3C6XA 3M5CA 2LCQA 5TQJA 5J4HA 1GNPA 3JQGA 4UQPA 1UWCA 2WAAA 5IDXA 1XF9A 3RF6A 3SHQA 3HDJA 2XE6A 4ZEWA 1JIVA 1ZRHA 3O92A 4MQEB 1I1NA 2X9QA 4I19A 4ZIRB 3P0IA 4FMPA 4UTRA 5KSYA 1UKBA 1MV8A 2J31A 2JDID 3MUOA 3L6CA 1NRXA 3TKLA 1OGYA 1AN0A 1XD2B 3K32A 3UHPA 4ZT3A 4YJGB 1M7BA 3LK6A 2W2MA 4EFDA 3MINA 2NUAA 1KP2A 2GN2A 4XFKA 2JFPA 1SUCA 5LMUB 2OD9A 3NOOA 2P5SA 3K5PA 2PRKA 2OLEA 3ODGA 1SVWA 2XNHA 4X4HA 4TTIA 3DZDA 4LY9A 2AD5A 2V7QD 2XZLA 1DL5A 2OVFA 4MS3A 1TJPB 4GKVA 3GVIA 3I39X 4J9VA 4DBLE 3WBBA 3EX7C 2Q8NA 5JCJD 2D5BA 3K35A 3OESA 1KFCB 3WDSA 3L8GA 1G16A 4RTRA 4B5KA 1E0JA 2G07A 4Y7CA 3I5AA 3R9XA 2ROQA 1TC1A 1UEJA 2G1PA 4E03A 3UPUA 3JQBC 1QNLA 3HB5X 4XJTA 3NEJA 5JZOA 4EJSB 5DTMA 1KXJA 1RP1A 2A4KA 4DKXA 1JKXA 4TZ0A 4O2RA 4AUEA 1UZAA 1VKOA 2Z2XA 4Q4HA 3DLTA 3THRA 2P8JA 3G13A 2W42A 3VZCA 2VRWA 1E8NA 3FR8A 4YJ2A 1KJ9A 4MKRA 2PMEA 1UBLS 2OHGA 1JZQA 4CTJA 1KWGA 2EL9A 4IJ5A 3IO3A 1JNYA 4XWGA 1IUPA 3TX6A 1LBTA 2Q5OA 4DY6A 3EC2A 3B53X 4B17A 1DTEA 4K88A 2ZRHA 3D7NA 3E5NA 3FJ1A 4HVTA 5K3CA 3EMDA 5K99A 3ASUA 2HWKA 3T06B 2HCSA 4IIJF 4QE3A 2O57A 5LVAA 5JR3A 3PGVA 2UVDA 3KIPA 4HVAA 4QYSA 1CQPA 1X70A 4RPHA 2WI8A 1CNMA 3OCCA 5CIYA 3GI1A 3QEBZ 1GAXA 3ESDA 2VCYA 4BP3A 4QQNA 1FRNA 4V02A 3DL0A 3Q5GA 3A70A 1XRLA 4KXUA 2IY9A 3DT8A 2I91A 2PUWA 1G5IA 2WU1A 1CRQA 1E2EA 4CZ2A 4MWDA 1F8GA 2CLSA 4KI0A 1FYVA 4I5EA 3M9WA 4Q1CA 5DI9A 1A72A 1NBMD 4IMPA 4ABYA 2Y2UA 2NYVA 3QGMA 3K9CA 4ZJPA 2PRJA 5BR1A 2DCUA 3PQ3A 1BDIA 2XDQB 4Q4AB 3BILA 3G59A 3PG5A 2E87A 1C4KA 2VCEA 4TV8B 2GPAA 2V6MA 4KI7A 4YP1A 3VPHA 5JDCA 2D2FA 4LJLA 1PD1A 3DEKA 1JR3E 5FFFA 1SWVA 1SC6A 2X3UA 2E4XA 1U7UA 1D4OA 5KJCA 4V0SA 4ARSA 1J4AA 3GFRA 2FA9A 3WSVA 3BK7A 2V6GA 2AMJA 1KU6A 1Q11A 2BMEA 3L3BA 4NMHA 1H9CA 3USES 2Q49A 1WDMA 4EHJA 1PT9A 2GO1A 3I45A 1QB8A 4V0QA 2GNAA 3NBAA 3HNPA 1G20E 1PV2A 4OAPA 2XBMA 4X62B 1OCEA 3AEZA 1D8TA 7GPBA 5BSWA 5H4GA 1HYEA 2WJZB 5AKEA 1UOPA 3N53A 4A2PA 1T0BA 3VAYA 2WIKA 3HWWA 2MMGA 1O97D 4RLQA 2C7BA 4ZXPA 7YASA 2YMLA 1NR5A 3L7JA 1XZKA 2G06A 3QA9A 3R5KA 3W9YA 4AULA 5CDYA 4YAUA 1K8XB 1AO0A 1LF0A 3PUHA 4QPCA 1QIMA 4RF4A 1Z6QA 4F5DA 4DQKA 5BR4A 1MZPA 4DLVA 4FDUA 2I55A 2A8YA 4A2QA 2XUKA 2B3TA 5HRAA 3GLGB 4PBTA 2ZBPA 4Q18A 4YGYA 3WLLA 2J7PD 1PWXA 1R8YA 3AI1A 3QELB 1N0VC 2Z5GA 4LYEA 5DHPA 3FFXA 5IVKA 4C2UA 1G5QA 2Z8YM 2GWRA 4GU5A 1JQLB 4UUBA 4B3XA 3DE7X 2QTVB 3WLAA 3WMWA 3A06A 1ECGA 3GHHA 4LZZA 3THYB 1T26A 2Z5VA 4RDXA 2BMWA 3E8XA 1BWQA 3NIDB 5JW6A 1Y82A 4HB3A 5B64A 1N3LA 2EJBA 4O08A 4QYXA 1XDSA 3RKRA 1TJ5A 5JYEA 4J16A 1F3OA 1QIIA 3KTDA 4LZPA 5HEKA 4BQIA 1E7RA 3SI7A 5FBWB 4MQ6A 1ZD9A 2YY6A 1T9CA 2G9ZA 3EDCA 3ZKAA 3IVAA 3A6GA 2NVUB 1RFGE 3O2SB 2XODA 3UV6A 4BX9A 1LGYA 2IYVA 3H9GA 2QBYB 4XPIA 3SHWA 5JTUA 1EEXB 2GXQA 3I2FA 4Y6RA 2B9VA 3SZLA 1GDHA 3UUFA 2ZRKA 3SK0A 3DPSA 5F7JA 3ZCSA 1NW4A 4BY9E 2XUHA 3HCDA 1AZSC 3BL6A 4C7VA 2P6PA 2REQB 1FU4A 3JCZA 1Q1GA 1ZZBA 3VJKA 3OLYA 2QE6A 1P73A 3GRAA 5DGTA 2PJZA 2PYIA 821PA 1L5WA 3ZWMA 1XGKA 5F2KA 3ZDCA 4UQLA 1RVDA 2ECFA 4OFZA 2HQRA 4YP0A 3GN5A 3QG5A 3WO0A 4ARZB 1I0IA 3FRIA 4HNSA 3CYFA 4LXYA 3SBDA 3VNUA 3SR4A 3OF5A 3S0JA 1RKXA 2OHXA 5F1OA 1K7EB 3H7IA 4B33A 1JIIA 3KK0A 2OCAA 3N9IA 2CT8A 2Q6OA 3JS5A 2J9FA 3LPCA 3THSA 1MC8A 4L3OA 1OQAA 1JIUA 2O2YA 2O2JA 5K2OA 2I4OA 1Q14A 3RO7A 2GN8A 2P3QA 5FTNA 4ZK6A 5JH7B 3N87A 4N03A 2V3VA 5JAPA 2RGRA 3GDGA 3P9KA 1MVOA 3EXFB 3NVDA 1MQ9A 4OQFA 3B1KA 4B0OA 2W37A 5B7GA 4JODA 3KO8A 4P4UA 4R2MA 4XCQA 1LTQA 2IL1A 1BQ3A 2D1YA 2NXCA 2CLMB 1QGUB 3JQ6A 3UK2A 2ZTUA 4RACA 4C2BA 2WKWA 3O4HA 4LI0A 4EUSA 2LCFA 3OWXA 4V0OA 5BW8A 2ZAIA 1PLLA 2ZB7A 1HETA 4BZWA 3VU0A 4WJKB 2CZQA 1FMTA 3OCWA 2HHLA 2OZKA 2QJTA 1E2PA 2IHJA 3G2LA 1TM3E 1O95D 4UUMA 5CJJA 1T2EA 5G1NA 1GLNA 3KQNA 1HV8A 2G0TA 5F76A 4Z2YA 1R4AA 1IPEA 2OHFA 3BE5A 3KFVA 4KVGA 4QA9A 5DNCA 3B1WA 2CJYA 2JPDA 4DIKA 5EE3A 3EUSA 4OY3A 1JKMA 2IDJA 1ZISA 4NH0A 3ROGA 4LYFA 1UKYA 4Z4FA 5AM3A 3U2QA 2XIUA 1T5SA 3QMVA 1CUJA 2GK4A 3UA3A 3W90A 4K28A 2QF7A 4C4XA 4D41A 4F12A 2UVQA 1T6ZA 4HDKB 2F17A 1QYCA 3AKCA 1R4NA 1ZRNA 3QEMA 4PX3A 4BQPA 2JJ8A 4C04A 2WVAA 2J32A 4RSGA 1YJCA 1Q1EA 1K5HA 3HADA 4GZ5A 2H2DA 2HA6A 4NU8X 2BFCA 3NJRA 4HB2A 4YVFA 4PXAA 5L3RA 2XVZA 1N77A 1VIYA 1J07A 1WP9A 3E1SA 1YBMA 4CT5A 5DP1A 2GBLC 3NBKA 4DT1A 4WXPA 3H4MA 1TIKA 3DONA 2NZJA 4BO8A 2WUWE 2C54A 4TUYF 1OFUX 4BV8A 5IXYA 5T67A 5AQ1A 1AA6A 1NMXA 1O57A 4AM8A 1G5HA 4ENRA 4WXEA 1YL6A 2I33A 1Y9JA 4HDQB 5K8JB 1ZXLA 2IC5A 1JA1A 1UMDB 1ZZGA 3EF1A 3SG0A 3IDOA 2UUAB 4Q7EA 3C8MA 4JCYA 4J4BA 2H17A 2IZ1A 3RBZA 1AXEA 4OD0A 4DG9A 4OGKA 3R6LA 4IFIA 1OGIA 4D9NA 2LLWA 2PD6A 5I7WA 4RVGA 5EEHA 5K9ZA 1YZ3A 5KPDA 3L8ZA 2D54A 3QU7A 4MWZA 4UFOA 4ZEVA 1TDJA 2EEZA 2YBEA 1T8TA 3JW8A 5B1SA 3ZDBA 3FPGA 1XNRB 2QK4A 4ZVVA 3ASZA 1XPOA 1MX1A 4CM8A 1U90A 3OKCA 1B43A 1M1UA 2KWIA 4V2IA 1XN4A 2GPBA 1YQUA 1ZAKA 2L69A 3F0TA 3MFQA 4R8RA 4DUZB 2LD4A 3PJFA 3MEQA 4ZYVA 1DQSA 2AUNA 4ZPXA 4CTKA 2O2DA 2JDIA 3C3WA 4QJ5A 1NXTA 4YY3B 4LTDA 3QXJA 1S2GA 2AOTA 2WNIA 1VDMA 4UMEA 3EXHC 4DCGA 1N6PA 2QMZA 4X8HA 1LBHA 5JJCA 3B6JA 1NM5A 3JVEA 4WI1A 3QNUA 1S6YA 1R15A 3PHBE 1VB5A 4KE9A 3TINA 1TAHA 3TRIA 3WGYA 1W6UA 1HM5A 2GFHA 2YWDA 3O2JA 3C39A 2DRIA 3FRJA 3NT5A 4H18A 4CV3A 3R24A 4RA6B 1TLTA 3A8TA 4M0LA 5I7RA 2OR1L 3B5IA 3V8RA 1MHTA 2VSFA 3CCCA 3LV8A 2LYJA 1K0FA 2E4UA 5K0SA 3NVAA 4NEGA 5KJ6A 5FXMA 3MCAA 2OESA 3PFKA 4H6PA 1L5VA 1EG7A 2M6SA 2VDRB 3VR4D 3OEWA 3IUPA 1IN6A 5KVAA 1CUVA 2XUPA 3I37X 3OFKA 4PLWA 1U2DC 4WHMA 4C88A 1XTSA 2EDCA 2H8KA 3K2BA 5G0VA 5HFAA 5BSMA 3X43A 4F7DA 2OBXA 3MGGA 2OEPA 4M0UA 4IVPA 3UHOA 1KC3A 3H9UA 2IYUA 4HB0A 4O3MA 3KYDB 5JBIA 3LW8A 4NYMQ 4DC0A 4B76A 4FYMA 2BFBA 3ZVNA 3FWYA 5I3ZA 1E1YA 1SU4A 4J4TA 2HSGA 3ADBA 3REQB 2IS4A 5DYIA 1MJGA 1H0HA 1LQUA 2C9MA 1AKTA 3AIKA 1PR3A 3N1UA 3PGMA 3QX8A 1M72A 4REQB 2DBYA 2IP4A 2RSLA 4TYQA 4LRWA 4OQXA 1T8PA 1EGMB 3EG5A 1LBSA 3JU3A 5E6SB 4GOKA 2LNDA 2FW7A 4CQJA 3CKKA 2PXBA 1E9DA 1YU9A 1FXWF 2FN3A 3GFBA 2EX1A 2F00A 3AQIA 3G6WA 4QYIB 4UC0A 3VHLB 4GWGA 5CGQB 4JUBA 3LKZA 4URHA 3WLHA 2SNIE 4KXXA 2DFVA 1O6BA 1ZIDA 4M9ZA 4YRIA 4GL4A 1JG7A 1PTJC 2F1JA 1NJ8A 3TW8B 3JXCL 1KIFA 2VRBA 2VZ9A 2DMRA 4OGWA 2Y9MB 5IX8A 2HIMA 3PQ2A 5LJIA 1P4SA 1AF7A 4NJOA 1C8LA 4F1KA 3OAAA 1OU4A 4E5MA 3IDAA 2CB0A 4FE4A 5D85A 2A9FA 1Y6QA 1QRUA 5JHHB 3DC2A 2HEIA 3E3AA 3PRYA 3JAWB 3FWKA 4Z51A 3FETA 1YVEI 2CVHA 3A9CA 5CRIA 3UWKA 1LQCA 1XZLA 4KSBA 1E2GA 1KYQA 3L4SO 1A9XB 2P5YA 1ZLYA 2YS6A 3EPRA 4HUJA 5K3SA 1II0A 2WAXA 2JJYA 4XQCA 1R0RE 3FF1A 1EBBA 4R16A 3WISA 4N01A 5JANA 2OKGA 3QF7A 4PRLA 4EHAA 3ZNPA 3BGWA 2QDKA 4R3UC 1WZEA 4LMRA 7AT1A 5A03A 1KAOA 4KDCA 1K92A 1W2GA 4OBEA 4XCVA 4KO1S 3A1WA 3ADKA 4OM7A 2XOKA 4J49A 4PPGA 1X2EA 4FXOA 4LHXA 4EG4A 4L27A 2WB2A 2ZRLA 3T95A 1M8JA 4ZQBA 5E3HA 3GAAA 5AIBA 3CQ9A 3MWDA 1PN3A 2I4MA 4HX5A 1T3HA 1X87A 4J94A 1SELA 4RL6A 4TQAA 2CVZA 3WGGA 4FBGA 3GLFA 4ZTUB 4A73A 1PJQA 1MNAA 4GBMA 4B09A 5CK4A 5JQGA 1R2QA 4ARZA 4WZAA 1J5XA 4PG6A 5DGXA 4LHVA 3V4ZA 3RRFA 4F45A 5HJEA 1ORWA 1A9YA 4PFKA 2Y1OA 5FI3A 4J4HA 1OT5A 1ULSA 2WW8A 3TW4A 3KJNA 4PR3A 1NF9A 3I6YA 5A04A 1BS2A 2B1JA 4YCDA 4RMNA 5EZQA 2FJRA 3KEOA 4HJXA 4OHWA 3DMNA 3D02A 3RW9A 3UJ9A 2C3YA 1VZ3A 2MTBA 3C41J 4PYKA 4W1RA 1Z0KA 2KPOA 3GJ4A 4OBXA 4MWGA 1LC3A 1FMFA 1J2YA 2H85A 4ZCPA 5F23A 5FYQA 2YJ6A 4FTWA 1C2YA 1EIZA 2F4VB 4G5OA 2SKEA 5HSGA 1Z0UA 3O0DA 1MOQA 2NO9A 2RHWA 5FOWA 3UHAA 1EZZA 1ZSYA 1QGYA 4ZT5A 1GT91 2M1ZA 2VWPA 2CZGA 3OJWA 4FXPA 3GQBB 3KKPA 1PYDA 5JSHA 1INLA 2MOKA 1Z2CA 1BMQA 1DTWA 4N7BA 3R7SA 3HJCA 1SD5A 5LOVA 1HE4A 2O3UA 4O3FA 3IPXA 4DCPA 5JO0A 1A76A 2FPIB 1YZQA 1XKXA 5F77A 5EJ8A 1YDMA 4AZ3A 3MNFA 1UK6A 4R8SA 1ZM3A 3SXUA 4OBWA 2HZ7A 1QO9A 3QTTA 2WAYA 2EJUA 1RS0A 3FFTA 3RC3A 3NTRA 1WB4A 4LSWA 5G0WA 4F06A 1P7ZA 1J0CA 4QGBA 5FP0A 4KACA 4D97A 4HPXB 1PL8A 1OX4A 3HJNA 4LQLA 3LHSA 7MHTA 4Y98A 1YR2A 4FILA 2GCEA 1KRWA 4US1R 2HF9A 4ASUD 2AJDA 4ID9A 2FKAA 1XVVA 2VDJA 3AHJA 8LDHA 1EB9A 6YASA 1PRUA 1ZXXA 5BN4B 2HJVA 4YJFB 2XXPA 4OXRA 4BTEA 2AX3A 1C0KA 4OQLA 3VSCA 2X8BA 2NVOA 3W9SA 1ZI6A 2AN1A 2F43A 1YBAA 2XEXA 2XMPA 4RS3A 4BAGA 2QVXX 3N75A 4E2ZA 4Y2SA 2CD9A 3K9WA 4UEKA 5LYJB 1HEUA 1MVLA 2I1LA 4EG8A 2ZBFA 5LZ9A 3HZZA 2P2YA 5K0EA 1SBYA 2ID8A 1JQ5A 1W9MA 3E3LA 3KKOA 1HF0A 1QPZA 3DA8A 1OT3A 1ZL0A 1G7CA 3LQKA 2Z6QA 4IDFA 3J7TA 5IH3A 2RAPA 1OLXA 2PMWB 1X1AA 5AK5A 5LR6A 4GOND 1WY5A 4RIFA 1L5RA 3I76A 1C8VB 3HVIA 3KWMA 3L1VA 1Z8DA 4BO5A 1FLNA 2C9YA 4UW9A 4F5ZA 4EFMA 4UEOA 3T4XA 5K0NA 3HJRA 5G3ZA 1T35A 3A28A 3NHJA 4KG7A 4ZQEA 2BJCA 3UWMA 4J43A 1SRRA 2FEPA 4G5SA 4LV5B 2WU4A 4LVCA 4RZXA 2JLRA 3LLCA 5FOUA 2A5GA 5H16A 3VR0A 3WFZA 4U6SA 2HRDA 3KUUA 3AF3A 5H59A 1GILA 2TSYB 3DZHA 3KSRA 1SH7A 3NUQA 1PJ4A 3HO8A 1KJYA 4JLJA 4JR1A 4NBLA 4EGSA 1II9A 3ITKA 5BQ5A 1UANA 2ZBEA 4EARA 1Q84A 3KPUA 3DD1A 1JZTA 5C8YF 1GTL1 1ID1A 1A2KC 2QUIA 3CINA 4MPPA 4RK6A 3RAJA 3P2YA 1ABEA 4HX9A 1MJHA 2FUG1 1UKCA 4PLTA 3UB2A 3JAMA 3PNOA 3VTZA 2SICE 2GFQA 2LP4Y 4ZP1A 1CD5A 1LX6A 4H7PA 4OMFG 2ONCA 3WXMA 2HLNA 1RWBA 3AP1A 3KPJA 3Q7PA 2WQ7A 3K4HA 3CH6A 1O0BA 2A84A 4BN4A 1JFLA 2D62A 2JCSA 4B4VA 2CUKA 3BF8A 3LC7O 5EMNA 3N2IA 4N4AA 4EGCB 4JVMA 4RETA 3C3JA 2ZUFA 3ZJ4A 2HINA 3PT9A 2V6IA 2W9XA 1CIPA 2J30A 3DWIA 3MHPA 1NNEA 4G86A 1Q1QA 4XGNA 1PL0A 2YXPX 4LQDA 4OXKA 5AM1A 3T0GA 1LF5A 1J8QA 1TPZA 2KPJA 1KDTA 2AVDA 3DFMA 2I78A 3C5CA 4QTTB 4RZQA 4BHTA 1E3IA 2FLKA 1ODKA 2OAQ1 3FNGA 1U7ZA 5BP7A 4AXXA 1OILA 2ODTX 1T9GR 1ILEA 2OGSA 3VR5H 3EUEA 3ZY4A 2XZDA 3D7SA 3GZDA 5CH8A 1FP4A 2H7XA 3IUNA 2XE8A 2LYSA 4WKGA 2CEAA 3F52A 1RLUA 5L40A 5F4BA 3CRQA 1FFDA 4QVGA 1NLUA 1RRFA 1S7EA 4KQ2A 3P52A 4C4AA 1WG8A 2GM5A 3L7KA 4R8VA 4PLGA 1OCTC 2ZE7A 3OMLA 2IODA 1ZVVA 1Z16A 5CMLA 3VR6A 2H4WA 3AI7A 4WA8A 3Q10A 3MINB 4MCAA 4D4GA 3TW8A 1V3UA 1DKPA 2G1AA 3EXHA 4JLNA 3WQBA 1USWA 1T5OA 1YS4A 4YG1A 4DMLA 2ZBGA 1ZGBA 4J29A 1ZBQA 2O1EA 4NBNA 1FC0A 3O9XA 1C9EA 1FUUA 4NRDA 4P4SA 5FPYA 3OIGA 3V8MA 4HWKA 4HS4A 3GUHA 3EIFA 1XO1A 4IH4A 3LGXA 4OJKA 5DHFA 2YJGA 2WJWA 5JS1A 5EUQB 1B15A 1AGNA 1ZRSA 1J33A 2WLTA 3A9YA 4OF4A 5DNVA 3UKOA 1XR3A 3QWFA 4J3FA 1U9CA 1HZZC 2X1LA 5K0TA 3FHTA 3ZLBA 1L5ZA 1K86A 4QPDA 2FX2A 4TWAA 3LO8A 1Z6GA 4JJ7A 4S1TA 5C9ZA 3UH0A 2R5WA 5DN6A 4N5MA 3B3GA 4KGVA 4V03A 3UMMA 1KKUA 1QUFA 2IKQA 2Q5CA 2JRCA 1CK4A 1U3GA 1F17A 3AIOA 1ZJ4A 1NPTO 1PQUA 2HMSA 2ZOSA 5EIAA 3RRJA 4JVOA 1AVTA 1YQEA 4QARA 4NKRA 4HDNB 4LTMA 2ZT7A 4RHTA 5EEGA 5BXYA 4RKWA 3QQ5A 3GFFA 5AVOA 2LKCA 4G81A 5JEDA 2BM1A 1R6DA 2FSHA 3GJ6A 4YRCA 2V59A 3ZN2A 1XMPA 4FHDA 4KDRA 4U7PB 5LYYA 1Y9DA 5REQB 5T57A 1UKAA 2BFNA 3C3EA 4GWKA 4B75A 4U2FA 3MAJA 1RQXA 3QFHA 2WZQA 3Q4GA 1ND6A 4ZCRA 1QQTA 1R5NA 2ZYSA 4RH0A 3RNLA 3UQZA 4ALKA 3QMWA 4MS3B 3RU3A 4HQOA 3VA7A 2EF8A 1XFAA 3ZIAD 3CVWA 3I42A 3HVRA 1NUPA 1BFDA 1R27A 1Y3IA 3M9XA 4LOKA 4E32A 1G5FA 4P3PA 4HT3B 1JHDA 3WAGA 1EFLA 1B26A 1G8FA 3HKEA 1ZH0A 2OSBA 3FI9A 2PXCA 1C9MA 3A58B 4FGJA 4J3NA 3RSHA 2AXQA 4EPWA 4BVFA 1EG2A 3Q5DA 5E4YA 4RZUA 3IPLA 2AJLI 3P27A 3I5XA 4XGKA 1I7LA 4I3FA 3TTVA 3N3BC 2OUKA 1QU3A 3KV1A 5E2IA 3FFAA 1UJ5A 1BS1A 1R00A 1H23A 3DCNA 3UMJA 2OHVA 4AVYA 3DHYA 4LXXA 3WGTA 4LSGA 5AJUA 2DFNA 4OGGA 2GXUA 1L4YA 2VJYA 5F5XA 5IBQA 4L5CA 1GGJA 1XYVA 1HE2A 3PQFA 2ZYHA 1ADYA 2LLVA 1DDGA 3DULA 4I1OA 2HSDA 3UGTA 3ZWWA 1AUPA 1G64A 3D3EA 4EEZA 3NDRA 2WTBA 3DLCA 4KLAA 4YUAA 4NL4H 4B82A 1RQLA 4AZ3B 1KI3A 3G0IA 4HZGA 1Z06A 4IQ0A 4JUFA 1A97A 4H77A 4LJ5A 1XLTA 2MINA 2PQMA 2ZAYA 1UZNA 2QN8A 1XMVA 1OSLA 3HB7A 3K8ZA 3VI3B 2B4TO 1UZLA 2BFEB 1KZ9A 4N9WA 5IXJA 2G4VA 1X2BA 2DOKA 3ZIDA 4A4DA 1PJRA 1ZGGA 1IATA 5KNDD 3Q3GE 4XX0B 4Z99A 2CXNA 4ZVTA 3D81A 4HAWA 1L7EA 1LWOA 3H2ZA 3U4QA 5L3QA 1W7AA 1UEXC 1X9GA 4Y9RA 5DNEA 4B6JA 1AU9A 2OYSA 1Z82A 1HEYA 3ONWA 4I1IA 4DABA 4EMSA 4RGBA 5KHOC 1YQ9A 1KK2A 3RH0A 2FMHA 2ARKA 1KI4A 4O2AB 5IVDA 5E9AA 4BNXA 3WKCA 3IIJA 1H85A 3REOA 5EY5B 4TOIA 5FA8A 3FNRA 2EBYA 1V16A 1XZCA 1XZAA 1UCFA 1ZP6A 2JVJA 3DG9A 2PPVA 1DAPA 4OL0A 4R1QA 2FMFA 5REQA 4WNAB 4XM1A 2IS6A 5EKUA 3ZH9B 4CKXA 3KSAC 3I6BA 2VSOA 5B3JA 2AFIB 1N9KA 1WY7A 1WXWA 3PIDA 3FOAA 3TQQA 4YPVA 1C8KA 2HNKA 5DOVA 2HJSA 5AW5A 1RAAA 1PVOA 4EX6A 2EP5A 4A8JC 3T1QA 3EMVA 3MSXA 3P0RA 3RTEA 1DEAA 1NL3A 4A2CA 5JRZA 4NI5A 2NO6A 3L9WA 3S44A 4CLHA 2QRHA 3S28A 2NNLD 5JCJA 4EY7A 5IEJA 2I29A 3UMVA 2CJFA 1M2HA 3AFHA 1QHHA 4MR9A 4HAOA 1Y4AE 4M89A 2B2XA 2BTOA