3ME8A

Crystal structure of putative electron transfer protein aq_2194 from aquifex aeolicus vf5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
169
structure length
169
Chain Sequence
SLGTYVPGDITLVDSYGNEFQLKNLKGKPIILSPIYTHCRAACPLITKSLLKVIPKLGTPGKDFWVITFTFDPKDTLEDIKRFQKEYGIDGKGWKVVKAKTSEDLFKLLDAIDFRFMTAGNDFIHPNVVVVLSPELQIKDYIYGVNYNYLEFVNALRLARGEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of putative electron transfer protein aq_2194 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Electron transport
total genus 52
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3me8A00
3EWLA 1XW9A 3TKSA 1O85A 3EYTA 1FVKA 3KCMA 4IJIA 4JEDA 1Z7PA 2PVOC 3VLNA 2R3XA 3FW2A 5HR0A 3DEXA 3GA4A 1H75A 2O8VB 1GNWA 1A0FA 3V1WA 3HVXA 2FWHA 4MJAA 4EO3A 2B7KA 1M0UA 2PVQA 4TOPA 2NVLA 3I9V2 3GSSA 4NV2A 1ZYQB 3DWVA 4ZIJA 1PMTA 4ZL7A 4TR3A 3IAM2 5AIXA 2H6YA 4GQCA 3G7JA 1YEXA 3IE3A 4X0XA 1DE1A 2H1BA 1J9BA 1I9DA 2TRCP 3IRAA 4K2DA 1XBSA 1ILOA 2GT6A 4NXIA 1XFLA 5DALB 3GTUB 3J7Yk 2O85A 1Z5YE 1TRWA 2LJRA 1K0DA 3ERWA 4HU7A 3ERGA 5CRWA 2PN8A 1EZKA 3H1NA 3TJGA 2FD3A 3F6DA 3ISOA 4BVXA 1GNEA 3BD2A 5DQYA 4POLA 4RQXA 4MK3A 2DC5A 4KDXA 4DSSB 3KJYA 5G2ZA 1YQ1A 1S3DA 4IVFA 2C0EA 4I2UA 1WOUA 3DD3A 3F63A 5J4UA 2LNSA 3GKMA 3E9JB 1GSYA 2I4AA 3HYPA 4G19A 2O7KA 4O32A 3QOUA 1LU4A 3WD6A 1WMJA 3TJFA 4LL4B 5GZZB 1M7TA 3LG6A 2OA7A 3F8UA 2C80A 3BJ5A 5HFIA 2YCDA 4V1Ap 4V2LA 2PERA 2JU5A 3LXTA 1OKTA 2RM5A 4HJ2A 2IFQB 2VO4A 4KW6A 3KGKA 5IOXA 3CSIA 2QSIA 3GNJA 1NM3A 3HZ8A 1B9YC 1Q4JA 4K1FA 3PH9A 2E2MA 4ECBA 2I81A 5H5QA 3WT1A 2LEGA 1F2EA 2RM6A 5KN3A 1XCCA 3EE2A 4EXJA 1Z3EA 1TW9A 3ZIJA 1Y6EA 3IV4A 1K0CA 2X64A 2HRNA 4FIWA 1FAAA 2GQKA 4NHWA 4IQ1A 1EWXA 2H72A 3KP8A 2JSZA 4WR5A 4OFTA 3OR5A 1FO5A 1E2YA 3ZFLA 2ON5A 3RPPA 4FH8A 2GSTA 3L0HA 3DRNA 4GTUA 2P5RA 1OC8A 4MABA 2C0GA 2CZ2A 5KN0A 1OAZA 3WYWA 2DJ0A 2OKAA 2GT5A 1KTEA 1O73A 3GV1A 4IP6A 3D22A 1ML6A 3QAGA 1C72A 1RQMA 3VWUA 4NMUA 1TRSA 1ZOFA 3GUSA 1B8XA 1AQXA 4WETA 3QD9A 1M2BA 1FVJA 1DSBA 2R6KA 1JZOA 2AYTA 4EE0A 3M8NA 3FR6A 5HFGA 2IMKA 3QDNA 1EEJA 4WKWA 3ZYWA 3GHAA 2X99A 4KA0A 3L78A 1OVNA 2B6MA 2IMDA 2H71A 3ZITA 3GX8A 1T1VA 4OWYA 4O5RA 3CRTA 4O92A 4OFMA 4XS4B 3CTFA 2RUFA 3KZQA 3TOTA 4QL7A 3RDWA 3E3EA 4IJ3A 3GRXA 4CDOA 1MDJA 1Y25A 1TDIA 4XTSA 4JZQA 1UVZA 3TKPA 2YZUA 11GSA 1BJXA 4JU5A 2HLSA 3LGCA 4ISDA 1SJZA 2F51A 2YWOA 4JE1A 2WZ9A 3ZMKA 13GSA 2GLRA 1Z9HA 2XBQA 1WJKA 1V98A 3FHKA 2KP1A 1A8YA 1AQVA 2REMA 5IO0A 2H8LA 5LCZA 1GTUA 4WF5A 3KMOA 1GSDA 5ECKB 1N2AA 3QMXA 1V57A 1NHYA 1Z6MA 3GIXA 5HR2A 1XWGA 4GRFA 2N5FA 1THXA 2FY6A 2IN3A 3TKRA 1XVWA 3UARA 1XOAA 4TN8A 1THOA 5DAKB 3TGZA 2B7JA 4HI7A 2CZ3A 3PR8A 2H0IA 4BWSA 2AAWA 4MF5A 4ZL8A 1UC7A 2P0GA 5B8BA 4TKYA 2CX4A 3G7YA 3GN3A 5LD0A 1F3BA 1PL2A 4NV5A 3GX0A 1DE2A 3Q74A 4HUAA 4KGIA 3ZVJD 1K3LA 5G1KA 4IW9A 1AC1A 3WT2A 2MYGA 3IC4A 6GSUA 3BCIA 1JZWA 3HJMA 2L6DA 2WB9A 4PQ1A 2EC4A 2HYXA 1EV4A 3TOUA 5CAXA 2H1DA 3ME7A 1AUCA 1PX6A 1X5CA 1ERTA 4JBBA 3DVWA 2WULA 1XOBA 2GZYA 4V1Ag 2HZEB 3JCML 3DIEA 4JR6A 1ERVA 2VL2A 5B7CA 1O8XA 1SL2B 2OJLA 1WRYA 1ERWA 3D4TA 3IXRA 3ZMLA 5HFKA 3CSJA 4HU9A 4KDUA 2NDOA 4WEYA 22GSA 1ABAA 3KMNA 4V2NA 4Q5NA 5DCHA 5ECOB 4HOJA 4EVMA 1XIYA 2K8VA 2Z9SA 4ACSA 3F3RA 5COHA 1OYJA 4POMA 3F4TA 2XHFA 1NSWA 2LRTA 2V6OA 1TU7A 4IP1A 1YZXA 2YZHA 4YH2A 1A24A 1FB6A 2A2SA 3UVTA 2B1LA 1TI3A 1SD8A 3VFIA 4N0ZA 4MJBA 2H19A 4MF6A 1B4QA 1K3OA 2L4CA 1G0TA 4K7IA 3UBKA 4NPBA 1VRSD 3QAWA 4K0GA 1FW1A 1SKRB 1M2AA 4PUFC 4IN0A 2YV9A 1K0MA 1MDIA 5ECNB 1BX9A 5IMCA 4ZB9A 3O76A 3RAZA 1HQOA 3SWLA 4KDYA 1X9WB 4ZL9A 2LJKA 1JHBA 3GKKA 1J0FA 3QCPA 1I5GA 1SL1B 1GSQA 2B3SA 1Q98A 2RUEA 9GSSA 4HS1A 2AUVA 2VCXA 4G2EA 1EP7A 2VM1A 2H73A 1GSEA 3EU4A 4PURA 4MCUA 3D4MA 1UA5A 1IYHA 1XWBA 4N10A 4PGTA 5DDLA 4BPYA 3QPMA 5D9WA 2OBKA 5JWQB 8GSSA 4ML1A 5F8BA 2IMIA 3GURA 2LUSA 2LTKA 1ZL9A 3F3QA 1R26A 4LL1B 1WPIA 2MBSA 3F6FA 1S3AA 1B4PA 2FCHA 1X9SB 3UMAA 1OC3A 4FYUA 3ZFBA 3G7IA 1FOVA 2M72A 3KP9A 4GSNA 1QQ2A 1J08A 3DGQA 2IPAA 5JWRB 3MNGA 1ON4A 2O89A 1K0AA 3H93A 2OE0A 4HQSA 3ZRDA 4E8HA 2N5AA 4IS0A 3APQA 1OE7A 2DMLA 3VWXA 5GSSA 5B8AA 3DYRA 2VCWA 3DVXA 5IMZA 1GUMA 1GTIA 5F06A 1SK2A 5ECSA 3HJOA 5ECHB 4MA9A 4JRRA 4TR1A 4F9ZA 1H4OA 3P8WA 1EV9A 5CNWA 4TXVA 1HD2A 5ECLB 3HDCA 1IYIA 4MJEA 1MD4A 3IDVA 3U5RE 3TRQA 2CVKA 5D9XA 1GULA 1F37A 1WWJA 3FKFA 2HSHA 3KTLA 5EL8A 5C00A 4MZCA 3UL3A 3EU3A 1GLPA 4YQVA 1T4ZA 2ES7A 5B6MA 4LMVA 14GSA 2AJQB 1X5EA 2IWTA 4K7OA 5J3RA 4KE3A 4OO5A 4PQHA 3DMLA 4TXOA 3L4NA 2K18A 2VOCA 3GL3A 3US3A 5J9BA 1QXHA 2FA4A 3ZZXA 2XPEA 4L5LA 2B5EA 3TJBA 2MZCA 4KCEA 2YWMA 2MMAA 1B48A 4KB3A 1DBYA 1PX7A 3BCKA 5IO2A 3GL5A 2V41A 2KP2A 1RK4A 1EP8A 2ZNMA 1G6YA 1ZMAA 1GSFA 1SENA 3VWWA 1V9WA 1R4WA 2FUG2 3ZVJA 1ZGNA 4ZB8A 2DJJA 2GQMA 5G5FA 2H66A 4GXZA 4RI7A 4QQ7A 4N11A 2GSSA 5JCUA 1XZOA 2O87A 5KN2A 2FWFA 2K6VA 4XRAA 5IMAA 4IGJA 2CX3A 1XXUA 2E0QA 1Z6NA 4AF2A 4D73B 4AGSA 2V6KA 2B1KA 4RUVA 4WBJA 4RI6A 2WS2A 2F3MA 3UBLA 3M3MA 2BTOT 4XS1A 2R4VA 4NWYA 1GUKA 5A4UA 1O8WA 2FA8A 3TJJA 4Q5FA 5F0GA 3L9SA 5D9TA 1V2AA 4I97A 1TK5B 2EIOA 2QGVA 1BAYA 4EF0A 4JR4A 3TRXA 1SJIA 5ECMB 5ECPB 2QC7A 1XW6A 3TKSC 3EURA 4ULXA 3D6IA 1T3BA 3J7Yb 2ON7A 5G1LA 3TJKA 4Q5RA 1SD9A 3W8SA 1O81A 5ID2B 1GSUA 5F07A 3IR4A 3P2AA 3VPTA 5CP1A 2LJAA 2A4VA 4TVEA 5E59A 2D2ZA 1PKZA 2E2GA 2PGTA 2R5GA 2A2RA 4ID0A 5D8IA 5DALA 3GTUA 1OC9B 4ML6A 4HJMA 1WIKA 4GSSA 2J9HA 3KH9A 1TJDA 2CAIA 4ZILA 1X9MB 3CMIA 3VI5A 5JWOB 5H5RA 2TRXA 5IQYA 4DSSA 1QMVA 4IELA 2C3NA 5J41A 1YEPA 1TK0B 1GL8A 4I6XA 3M9KA 4XHMA 4GCIA 3NIVA 3RPNA 2OACA 3GH9A 3GKNA 19GSA 5IPGA 2FHEA 1TXXA 5IM9A 2V1MA 3P90A 3MAKA 2L57A 1O6JA 3QR6A 4L5OA 2L5OA 4LA1A 1BEDA 1SKWB 5GAPD 3KD0A 3QFAC 2VL9A 3LSZA 1KNGA 3HA9A 2IFQA 4YQMA 4YAPA 3DKSA 1ACVA 4ECIA 5EPFA 2EIQA 1T00A 1V40A 1YKAA 3C1RA 1EEMA 3A2WA 2PPTA 1SJ6A 1TRUA 2H76A 5HR1A 20GSA 1V58A 3KTBA 4Q5QA 4K6XA 2H75A 2B5XA 3TKQA 5KEJA 2DJ1A 2C3QA 2NPBA 1M2DA 5CRHA 5AISA 1MEKA 3F4SA 2KUCA 2LS5A 5DVBA 2CV4A 3DXBA 4J56E 5FHIA 3MSZA 1QK8A 3C71A 2I3YA 4MH3A 16GSA 3WGDA 5DQSA 2YNXA 2JZRA 1XWKA 2XC2A 5IIZA 4DSRA 2PMTA 2L59A 1PL1A 4POKA 2FNOA 1OE8A 4HEA2 1PQNA 2MMOA 1M99A 1F3AA 4PX1A 4PXOA 1TOFA 2WDUA 3HXSA 2IIYA 1ERUA 1PD21 4FO5A 4BWQA 5B6NA 3UEMA 2H0GA 4O7HA 1AIUA 2YPMA 3VWVA 4GQFA 1YF1A 2VUPA 2H1AA 2NBSA 2RLIA 2L5LA 2VCVA 3D21A 2HNLA 3F0IA 3UAPA 5JCGA 1CQGA 2CVDA 5ELAA 2YJHA 3I69A 5KN1A 6GSTA 2L6CA 1KEBA 4K7NA 1W4VA 3F4RA 5ABRA 1GH2A 3EC3A 1G7OA 3HD5A 2VD1A 4OFNA 3WGXA 3EMXA 3WGEA 2H01A 2YP6A 1PSQA 4XS4A 3N9JA 4KSOA 3E0UA 5D93A 4KNDA 3HKRA 1OC9A 2PBJA 3ME8A 2DIZA 2C8UA 2VCQA 2VM2A 3O3TA 2PWJA 1DUGA 3IOSA 1G6WA 1BYEA 4MF7A 1EGRA 2I9HA 2PU9C 1SKSB 3ZLPA 1ZYEA 3EVIA 3Q6OA 4HZ4A 2HE3A 2KLXA 4L8EA 3IHQA 5DJMA 4BA7A 3LWAA 2LNTA 2WRTA 1XPVA 1GRXA 3BOAA 3A3TA 4WXTA 4FYCA 1ZCPA 3KEBA 2VLTA 2IL3A 1PA3A 1N8JA 2X8CA 3K8NA 2X8HA 5F05A 1SK0A 4MLYA 2C4JA 4H86A 3TCOA 1U87A 2FGXA 4DSQA 3LQ7A 2WGRA 2OBIA 1A8LA 4NAXA 4V2MA 1VF4A 3VK9A 3VI7A 4BL7A 5G31A 3C1SA 1SU9A 2LQQA 1GP1A 1S3CA 3TDGA 2XPDA 3GMFA 4MDCA 3UOMA 4ZB6A 2G2QA 3S9FA 1VF3A 5CREA 2H70A 5DAKA 17GSA 1QFNA 3LYPA 1M9AA 3UJ1A 1EGOA 4WF4A 3HVVA 3M9JA 1KBNA 2HI7A 3FZAA 2RIIA 5D73A 1XWCA 1TK8B 1GSSA 1O7UA 2WJUA 2OADA 4K9ZA 2MMZA 3LYKA 4E8EA 3HVSA 1F9MA 4G10A 5ECIB 4KSMA 1BG5A 3IK7A 2X8GA 3W6GA 2GSRA 4HDEA 1WE0A 2YANA 4ZBAA 4BVYA 4KH7A 4QL9A 1PRXA 2CQ9A 5FWGA 1HNCA 3EINA 5J5NA 5ECQB 2JACA 2LRCA 3RBTA 4DEJA 4KUNA 3VURA 2DJ3A 2FWGA 2F9SA 1HNBA 2OE3A 3Q18A 4I5QA 4PQIA 2OE1A 1SK1A 3APSA 4EL1A 2JSYA 3A2VA 5FT3A 3PINA 4P3YB 2DMMA 1SYRA 2HZEA 3LXZA 3ERFA 1M9BA 1VGLA 1YJ6A 2XBIA 1A2MA 5IPHA 1PGTA 5ENUA 1A2LA 4WBRD 2GQLA 1JLVA 1EOGA 1TRVA 3I6AA 1AW9A 4IBPA 3GSTA 5CYYA 5G5EA 2J23A 3FRCA 3FZ4A 5CRGA 3TB2A 4EDZA 4MH2A 2VL2C 3VPQA 3M0FA 4WR4A 2H1GA 4CW9A 3C8EA 4PNFA 1FHEA 5D96A 1PN9A 4KX4A 1USBA 1URMA 2DJKA 2LRNA 3A2XA 2H6ZA 2ALBA 2PUKC 2P31A 5INYA 2R37A 1R5PA 3H4KA 3FR9A 2TIRA 3FZ9A 3TKSE 5IMVA 1LJRA 4X43A 2C0FA 5HR3A 4GWRA 5H5SA 2HXKA 1OKDA 2GDRA 6GSYA 4POBA 3H8QA 3HJPA 1TP9A 2VAFA 4EC0A 1EOHA 4N30A 1XW5A 2G0FA 2QKEA 3D0ZA 3PGTA 1GWCA 2H0HA 1VF2A 6GSSA 3KH7A 1UN2A 3FYGA 1MTCA 1JFUA 3W8JA 4MZBA 3D5JA 3F9UA 4XRDA 3HZ4A 1T8EB 4PNGA 2M80A 3L9VA 3L9UA 3IPZA 1ST9A 2HZFA 2FLSA 4K0NA 1K3YA 4N0VA 2NTOA 2YN1A 2ZUPA 2DLXA 3CYNA 1TU8A 5D9VA 2C0DA 2IMFA 2VL3A 1QGVA 2ZCTA 3H79A 3QFBC 3GKXA 4DVCA 1Z7RA 1X5DA 2P5QA 2F8FA 2VLVA 2IJYA 2C3TA 5ELGA 4K8MA 2WCIA 3FZ5A 5AGYA 1T4YA 2VD0A 5DCGA 1RW1A 2HSYA 4ILFA 1HNAA 3G9BA 2YOIA 3C7MA 1U3AA 5A4VA 1A0RP 1F6MC 2FWEA 4AJ6A 2K9FA 2I1UA 5EVOA 3IBHA 2BMXA 3A5WA 4L0WA 3ED3A 2DSAA 5AIVA 4XCSA 5ECRB 3CXGA 5DBQA 4F0BA 3FR3A 6GSXA 3CSHA 2H30A 4RQRA 2DIYA 3ZREA 1WP0A 4I2TA 2JZSA 3NOFA 5A5KA 4Z7XA 2H6XA 1TTZA 4LMWA 3LFLA 4J57E 3RHCA 4GLTA 2E7PA 4OO4A 4KAEA 5GSTA 2AV4A 1U88A 5IMFA 4I8BA 2GSQA 4GSTA 4MJCA 2F8AA 4TR0A 1ZZYA 3ZL5A 4F2IA 3R2QA 4AJ8A 3HHVA 5A4WA 3BBYA 1E6BA 1TI1A 2GGTA 3SBCA 2JL4A 1YF0A 3P7XA 4TW5A 5C04A 3MDKA 2LQOA 1MDKA 3GFKA 1FB0A 1TKDB 2KOKA 3HCZA 4G9HA 4AJ7A 18GSA 2VLUA 3CBUA 3GH6A 1NW2A 3NZNA 4MP4A 3APOA 5CO3A 3CRUA 3KIJA 2VIMA 2BJXA 4CHSA 2GVPA 2H74A 2GTUA 4EUYA 1JLWA 1GLQA 3FK8A 2HT9A 4ZXGA 2LV3A 1PKWA 1X0RA 2R2JA 1HYUA 3IK9A 2VCTA 3UIWA 4D73A 1FG4A 4IKHA 2CAQA 3UVHA 1G7EA 1XVQA 3RHBA 5LNKe 4MPGA 2JZTA 4MZWA 5EY6A 4TR1B 5AN1A 1U3IA 2CVBA 2HRFA 4NHZA 1QUWA 2K8SA 4OMVA 4ECJA 3IAS2 3C73A 4FYBA 2C1YA 4OCFA 3TUEA 3O6TA 2N5BA 2GZPA 5DJLA 1JZRA 6GSVA 1LBKA 4ZBDA 2B5YA 4IQAA 4PUAA 3CTGA 3QAVA 1R7HA 1W89A 2HFDA 1K0NA 4GF0A 1VF1A 12GSA 2MMNA 5L71A 2AHEA 3LJRA 5ID2A 2JADA 3ZIVA 2WFCA 5CRDA 1GTAA 1K0BA 3M1GA 2DJ2A 2YWNA 3IA1A 4YAVA 4X1UA 1U6TA 4EKZA 2V32A 5GAND 4F0CA 3N5OA 4L0UA 4MPFA 1MD3A 5IOWA 3FEUA 5JCWA 4OD7A 2YWIA 2L4QA 4TRXA 1XWAA 4XS6A 2GZZA 4TXOB 6GSWA 1A23A 1YKCA 1B9XC 1CQHA 2CA8A 5IMDA 4F82A 3LEFA 1A2JA 4J2FA 3MWHA 3LORA 2KHPA 2LSTA 3GYKA 3EMPA 2YV7A 1YDKA 1AQWA 2VCZA 3KM6A 4ECCA 4OCEA 4KCAA 1GUHA 1AXDA 3AY8A 1GTBA 1NHOA 2EIRA 4MMMA 5J9CA 1K0OA 4HQZA 3U6VA 4ZBBA 4TR4A 3FY7A 4EDYA 2AB6A 3I43A 2M46A 1SL0B 2YJ7A 1T7PB 5G30A 1YY7A 3HY2A 4F03A 2MBTA 4LLRA 4XIHA 1AAZA 10GSA 7GSSA 1JZDA 2DBCA 2LKUA 4IHUA 1BQ7A 3ZTLA 1SYXA 1R5AA 2V2GA 4YQUA 5E4WA 2CT6A 5HQPA 3TRPA 2IMEA 2GS3A 3KXOA 4HZ2A 3Q19A
chains in the Genus database with same CATH superfamily
3EWLA 1XW9A 3TKSA 2R0CA 1O85A 3EYTA 1FVKA 3KCMA 4IJIA 4A5PA 4JEDA 1Z7PA 2PVOC 3VLNA 2R3XA 3FW2A 5HR0A 3DEXA 3GA4A 1H75A 2O8VB 1GNWA 1A0FA 3V1WA 3HVXA 2FWHA 4MJAA 4EO3A 2B7KA 1M0UA 2PVQA 4TOPA 2NVLA 3I9V2 3GSSA 4NV2A 1ZYQB 3DWVA 4ZIJA 1PMTA 4ZL7A 4TR3A 3IAM2 5AIXA 2H6YA 4GQCA 3G7JA 1YEXA 3IE3A 4X0XA 1DE1A 2H1BA 1J9BA 1I9DA 2TRCP 3IRAA 4K2DA 1XBSA 1ILOA 2GT6A 4NXIA 1XFLA 5DALB 3GTUB 3J7Yk 2O85A 1Z5YE 1TRWA 4BIKA 2LJRA 1K0DA 3ERWA 4HU7A 3ERGA 5CRWA 2PN8A 1EZKA 3H1NA 3TJGA 2FD3A 3F6DA 3ISOA 4BVXA 1GNEA 3BD2A 5DQYA 4POLA 4RQXA 4MK3A 2DC5A 4KDXA 4CY8A 4DSSB 3KJYA 5G2ZA 1YQ1A 1S3DA 4IVFA 2C0EA 4I2UA 1WOUA 3DD3A 3F63A 5J4UA 2LNSA 3GKMA 3E9JB 1GSYA 2I4AA 3HYPA 4G19A 2O7KA 4O32A 3QOUA 1LU4A 3WD6A 1WMJA 3TJFA 4LL4B 5GZZB 1M7TA 3LG6A 2OA7A 3F8UA 2C80A 3BJ5A 5HFIA 2YCDA 4V1Ap 4V2LA 2PERA 2JU5A 3LXTA 1OKTA 2RM5A 4HJ2A 2IFQB 2VO4A 4KW6A 3KGKA 5IOXA 3CSIA 2QSIA 3GNJA 1NM3A 3HZ8A 1B9YC 4K2XA 1Q4JA 4K1FA 3PH9A 2E2MA 1PFOA 4ECBA 2I81A 5H5QA 3WT1A 2LEGA 1F2EA 2RM6A 5KN3A 1XCCA 3EE2A 4EXJA 1Z3EA 1TW9A 4PTSA 3ZIJA 1Y6EA 3IV4A 1K0CA 2X64A 2HRNA 4FIWA 1FAAA 2GQKA 4NHWA 5KOWA 4IQ1A 1EWXA 2H72A 3KP8A 2JSZA 4WR5A 1M3JA 4OFTA 3OR5A 1FO5A 1E2YA 3ZFLA 2ON5A 3RPPA 1M3IA 4FH8A 2GSTA 3L0HA 3DRNA 4GTUA 3EPTA 2P5RA 1OC8A 4MABA 2C0GA 2CZ2A 5KN0A 1OAZA 3WYWA 2DJ0A 2OKAA 2GT5A 1KTEA 1O73A 3LW9A 3GV1A 4IP6A 3D22A 1ML6A 3QAGA 1C72A 1RQMA 3VWUA 4NMUA 1TRSA 1ZOFA 3GUSA 1B8XA 1AQXA 4WETA 3QD9A 1M2BA 1FVJA 1DSBA 2R6KA 1JZOA 2AYTA 4EE0A 3M8NA 3FR6A 5HFGA 4ICYA 2IMKA 3QDNA 1EEJA 4WKWA 3ZYWA 3GHAA 2X99A 4KA0A 3L78A 1OVNA 2B6MA 2IMDA 2H71A 3ZITA 3GX8A 1T1VA 4OWYA 4O5RA 3CRTA 4O92A 4OFMA 4XS4B 3CTFA 2RUFA 3KZQA 3TOTA 4QL7A 3RDWA 3E3EA 4IJ3A 3GRXA 4CDOA 1MDJA 1Y25A 1TDIA 4XTSA 4JZQA 1UVZA 3TKPA 2YZUA 5BRTA 11GSA 1BJXA 4JU5A 2HLSA 3LGCA 4ISDA 1SJZA 2F51A 2YWOA 4JE1A 2WZ9A 3ZMKA 13GSA 2GLRA 1Z9HA 2XBQA 1WJKA 1V98A 3FHKA 2KP1A 1A8YA 1AQVA 2REMA 5IO0A 2H8LA 5LCZA 4K5RA 1GTUA 4WF5A 3KMOA 1GSDA 5ECKB 4BL7B 1N2AA 3QMXA 1V57A 1NHYA 1Z6MA 3GIXA 5HR2A 1XWGA 2HRAA 4GRFA 2N5FA 1THXA 2FY6A 2HRKA 2IN3A 3TKRA 1XVWA 3UARA 1XOAA 4TN8A 1THOA 5DAKB 3TGZA 2B7JA 4HI7A 2CZ3A 3PR8A 2H0IA 4BWSA 2AAWA 4MF5A 4ZL8A 1UC7A 2P0GA 5B8BA 4TKYA 2CX4A 3G7YA 3GN3A 5LD0A 1F3BA 1PL2A 4NV5A 3GX0A 1DE2A 3Q74A 4HUAA 4KGIA 3ZVJD 1K3LA 5G1KA 4IW9A 1AC1A 4BVYB 3WT2A 2MYGA 3IC4A 6GSUA 3BCIA 4EIPA 1JZWA 3HJMA 2L6DA 2WB9A 4PQ1A 2EC4A 2HYXA 1EV4A 3TOUA 5CAXA 2H1DA 3ME7A 1AUCA 1PX6A 1X5CA 1ERTA 4JBBA 3DVWA 2WULA 1XOBA 2GZYA 4V1Ag 2HZEB 3JCML 3DIEA 4JR6A 1ERVA 2VL2A 5B7CA 1O8XA 1SL2B 2OJLA 1WRYA 1ERWA 3D4TA 3IXRA 3ZMLA 5HFKA 3CSJA 4HU9A 4KDUA 2NDOA 4WEYA 2A2PA 22GSA 1ABAA 3KMNA 4V2NA 4Q5NA 5DCHA 5ECOB 4HOJA 4EVMA 1XIYA 2K8VA 2Z9SA 4ACSA 3F3RA 5COHA 1OYJA 4POMA 3F4TA 2XHFA 1NSWA 2LRTA 2V6OA 1TU7A 4IP1A 1YZXA 2YZHA 4YH2A 1A24A 1FB6A 2A2SA 3UVTA 2B1LA 1TI3A 1SD8A 3VFIA 4N0ZA 4MJBA 2H19A 4MF6A 1B4QA 1K3OA 4HSCX 2L4CA 1G0TA 4K7IA 3UBKA 4NPBA 1VRSD 3QAWA 4K0GA 1FW1A 1SKRB 1M2AA 4PUFC 4IN0A 2YV9A 1K0MA 1MDIA 5ECNB 1BX9A 5IMCA 4ZB9A 3O76A 3RAZA 1HQOA 3SWLA 4KDYA 1X9WB 4ZL9A 2LJKA 1JHBA 3GKKA 1J0FA 3QCPA 1I5GA 1SL1B 1GSQA 2X4AA 2B3SA 1Q98A 2RUEA 9GSSA 4HS1A 5BMUA 2AUVA 2VCXA 4G2EA 1EP7A 2VM1A 2H73A 1GSEA 3EU4A 4PURA 4MCUA 3D4MA 1UA5A 1IYHA 1XWBA 4N10A 4PGTA 5DDLA 4BPYA 3QPMA 5D9WA 2OBKA 5JWQB 8GSSA 4ML1A 5F8BA 2IMIA 3GURA 2LUSA 2LTKA 4YKFA 1ZL9A 3F3QA 1R26A 4LL1B 1WPIA 2MBSA 3F6FA 1S3AA 1B4PA 2FCHA 1X9SB 3UMAA 1OC3A 4FYUA 3ZFBA 3G7IA 1FOVA 2M72A 3KP9A 4GSNA 1QQ2A 1J08A 3DGQA 2IPAA 5JWRB 3MNGA 1ON4A 2O89A 1K0AA 3H93A 2OE0A 4HQSA 3ZRDA 4E8HA 2N5AA 4IS0A 3APQA 1OE7A 2DMLA 3VWXA 5GSSA 5B8AA 3DYRA 2VCWA 3DVXA 5IMZA 1GUMA 1GTIA 5F06A 1SK2A 5ECSA 3HJOA 5ECHB 4MA9A 4JRRA 4TR1A 4F9ZA 1H4OA 3P8WA 1EV9A 5CNWA 4MNNA 4TXVA 1HD2A 5ECLB 3HDCA 1IYIA 4MJEA 1MD4A 3IDVA 3U5RE 3TRQA 2CVKA 5D9XA 1GULA 1F37A 1WWJA 3FKFA 2HSHA 3KTLA 5EL8A 5C00A 4MZCA 3UL3A 3EU3A 1GLPA 4YQVA 1T4ZA 2ES7A 5B6MA 4LMVA 14GSA 2AJQB 1X5EA 2IWTA 4K7OA 5J3RA 4KE3A 4OO5A 4PQHA 3DMLA 4TXOA 3L4NA 2K18A 2VOCA 3GL3A 3US3A 5J9BA 1QXHA 2FA4A 3ZZXA 2XPEA 4L5LA 2B5EA 3TJBA 2MZCA 4KCEA 2YWMA 2MMAA 1B48A 4KB3A 1DBYA 1PX7A 3BCKA 5IO2A 3GL5A 2V41A 2KP2A 1RK4A 1EP8A 2ZNMA 1G6YA 1ZMAA 1GSFA 1SENA 3VWWA 1V9WA 1R4WA 2FUG2 3ZVJA 1ZGNA 4ZB8A 2DJJA 2GQMA 4YKGA 5G5FA 2H66A 4GXZA 4RI7A 4QQ7A 4N11A 2GSSA 5JCUA 1XZOA 2O87A 5KN2A 2FWFA 2K6VA 4XRAA 5IMAA 4IGJA 2CX3A 1XXUA 2E0QA 1Z6NA 4AF2A 4D73B 4AGSA 2V6KA 2B1KA 4RUVA 4WBJA 4RI6A 2WS2A 2F3MA 3UBLA 3M3MA 2BTOT 4XS1A 2R4VA 4NWYA 1GUKA 5A4UA 1O8WA 1S3RA 2FA8A 1ZYNA 3TJJA 4Q5FA 5F0GA 3L9SA 5D9TA 1V2AA 4I97A 1TK5B 2EIOA 2QGVA 1BAYA 4EF0A 4JR4A 3TRXA 1SJIA 5ECMB 5ECPB 2QC7A 1XW6A 3TKSC 3EURA 4ULXA 3D6IA 1T3BA 3J7Yb 2ON7A 5G1LA 3TJKA 4Q5RA 1SD9A 3W8SA 1O81A 5ID2B 1GSUA 5F07A 3IR4A 3P2AA 3VPTA 5CP1A 2LJAA 2A4VA 4TVEA 5E59A 2D2ZA 1PKZA 2E2GA 2PGTA 2R5GA 2A2RA 4ID0A 5D8IA 5DALA 3GTUA 2DKHA 4G0LA 1OC9B 4ML6A 4HJMA 2R0GA 1WIKA 4GSSA 2J9HA 3KH9A 1TJDA 2CAIA 4ZILA 1X9MB 3CMIA 3VI5A 5JWOB 5H5RA 2TRXA 5IQYA 4DSSA 1QMVA 4IELA 2C3NA 5J41A 3A5IA 1YEPA 1TK0B 1GL8A 4I6XA 3M9KA 4XHMA 4GCIA 3NIVA 3RPNA 2OACA 4Z2RA 3GH9A 3GKNA 19GSA 5IPGA 2FHEA 1TXXA 5IM9A 2V1MA 3P90A 3MAKA 2L57A 1O6JA 3QR6A 4L5OA 2L5OA 4LA1A 4FQUA 1BEDA 4Z2TA 1SKWB 5GAPD 3KD0A 3QFAC 2VL9A 3LSZA 1KNGA 3HA9A 2IFQA 4YQMA 4YAPA 3DKSA 1ACVA 4ECIA 5EPFA 2EIQA 1T00A 1V40A 1YKAA 3C1RA 1EEMA 3A2WA 2PPTA 2HSMA 3R3EA 1SJ6A 1TRUA 2H76A 5HR1A 20GSA 1V58A 3KTBA 4Q5QA 4K6XA 2H75A 2B5XA 3TKQA 5KEJA 2DJ1A 2C3QA 2NPBA 1M2DA 5CRHA 5AISA 1MEKA 3F4SA 2KUCA 2LS5A 5DVBA 1ZYPA 2CV4A 3DXBA 4J56E 5FHIA 3MSZA 1QK8A 3C71A 2I3YA 4MH3A 16GSA 3WGDA 5DQSA 3IHGA 2YNXA 2JZRA 1XWKA 2XC2A 5IIZA 4DSRA 4G0KA 2PMTA 4O5QA 2L59A 4POKA 1PL1A 2FNOA 1OE8A 4HEA2 1PQNA 2MMOA 1M99A 1F3AA 4PX1A 4PXOA 1TOFA 2WDUA 3HXSA 2IIYA 1ERUA 1PD21 4FO5A 4BWQA 5B6NA 3UEMA 2H0GA 4O7HA 1AIUA 2YPMA 3VWVA 4GQFA 1YF1A 2VUPA 2H1AA 2NBSA 2RLIA 2L5LA 2VCVA 3D21A 4BVXB 2HNLA 3F0IA 3UAPA 5JCGA 1CQGA 2CVDA 5ELAA 2YJHA 3I69A 5KN1A 6GSTA 2L6CA 1KEBA 4K7NA 1W4VA 3F4RA 5ABRA 1FOHA 1GH2A 3EC3A 1G7OA 3HD5A 2VD1A 4OFNA 3WGXA 3EMXA 3WGEA 2H01A 2YP6A 1PSQA 4XS4A 3N9JA 4KSOA 3E0UA 5D93A 4KNDA 3HKRA 1OC9A 2PBJA 3ME8A 2DIZA 2C8UA 2VCQA 2VM2A 3O3TA 2PWJA 1DUGA 3IOSA 1G6WA 1BYEA 4MF7A 1EGRA 2I9HA 2PU9C 1SKSB 3ZLPA 2QA1A 1ZYEA 3EVIA 3Q6OA 4HZ4A 2HE3A 2KLXA 4L8EA 3IHQA 5DJMA 4BA7A 3LWAA 2LNTA 2WRTA 1XPVA 1GRXA 3BOAA 3A3TA 4WXTA 4FYCA 1ZCPA 3KEBA 2VLTA 2IL3A 1PA3A 1N8JA 2X8CA 3K8NA 2X8HA 5F05A 1SK0A 4MLYA 2C4JA 4H86A 3TCOA 1U87A 2FGXA 4DSQA 3LQ7A 2WGRA 2OBIA 1A8LA 4NAXA 4V2MA 1VF4A 3VK9A 3VI7A 4BL7A 5G31A 3C1SA 1SU9A 2LQQA 1GP1A 1S3CA 3TDGA 2XPDA 3GMFA 4MDCA 3UOMA 3MIXA 4ZB6A 2G2QA 3S9FA 1VF3A 5CREA 2H70A 5DAKA 17GSA 1QFNA 3LYPA 1M9AA 3UJ1A 1EGOA 4WF4A 3HVVA 3M9JA 1KBNA 2HI7A 3FZAA 2RIIA 5D73A 1XWCA 1TK8B 1GSSA 1O7UA 2WJUA 2OADA 4K9ZA 2MMZA 3LYKA 4E8EA 3HVSA 1F9MA 4G10A 5ECIB 4KSMA 1BG5A 3IK7A 2X8GA 3W6GA 2GSRA 4HDEA 1WE0A 2YANA 4ZBAA 4BVYA 4KH7A 4QL9A 1PRXA 2CQ9A 5FWGA 1HNCA 3EINA 5J5NA 5ECQB 2JACA 2LRCA 3RBTA 4DEJA 4KUNA 3CQFA 3VURA 2DJ3A 2FWGA 2F9SA 1HNBA 2OE3A 3Q18A 4I5QA 4PQIA 2OE1A 1SK1A 3APSA 4EL1A 2JSYA 3A2VA 5FT3A 3PINA 4P3YB 2DMMA 4O5UA 1SYRA 2HZEA 3LXZA 2R0PA 3ERFA 1M9BA 5KOXA 1VGLA 1YJ6A 2XBIA 1A2MA 5IPHA 1PGTA 5ENUA 1A2LA 4WBRD 2GQLA 1JLVA 1EOGA 1TRVA 3I6AA 1AW9A 4IBPA 3GSTA 5CYYA 5G5EA 2J23A 4CY6A 3FRCA 3FZ4A 5CRGA 3TB2A 4EDZA 4MH2A 2VL2C 3VPQA 3M0FA 4WR4A 2H1GA 4CW9A 3C8EA 4PNFA 1FHEA 5D96A 1PN9A 4KX4A 1USBA 1URMA 2DJKA 2LRNA 3A2XA 2H6ZA 2ALBA 2PUKC 2P31A 5INYA 2R37A 1R5PA 3H4KA 3FR9A 2TIRA 3FZ9A 3TKSE 5IMVA 1LJRA 4X43A 2C0FA 5HR3A 4GWRA 5H5SA 2HXKA 1OKDA 2GDRA 6GSYA 4POBA 3H8QA 3HJPA 1TP9A 2VAFA 4K5SA 4EC0A 1EOHA 4N30A 1XW5A 2G0FA 2QKEA 3D0ZA 3PGTA 1GWCA 2H0HA 1VF2A 6GSSA 3KH7A 1UN2A 3FYGA 1MTCA 1JFUA 3W8JA 4MZBA 3D5JA 3F9UA 4XRDA 3HZ4A 1T8EB 4PNGA 2M80A 3L9VA 3L9UA 3IPZA 1ST9A 2HZFA 2FLSA 4K0NA 1K3YA 4N0VA 2NTOA 2YN1A 2ZUPA 2DLXA 3CYNA 1TU8A 4USSA 2C0DA 5D9VA 2IMFA 2VL3A 1QGVA 2ZCTA 3H79A 3QFBC 3GKXA 4DVCA 1Z7RA 1X5DA 2P5QA 2F8FA 2VLVA 2DKIA 2IJYA 2C3TA 5ELGA 4K8MA 2WCIA 3MYDA 3FZ5A 5AGYA 1XG8A 1T4YA 2VD0A 5DCGA 1RW1A 2HSYA 4ILFA 1HNAA 3G9BA 2YOIA 3C7MA 1U3AA 5A4VA 1A0RP 1F6MC 2FWEA 4AJ6A 2K9FA 2I1UA 5EVOA 3IBHA 2BMXA 3A5WA 4L0WA 3ED3A 2DSAA 5AIVA 4XCSA 5ECRB 3CXGA 5DBQA 4F0BA 3FR3A 6GSXA 3CSHA 2H30A 4X4JA 4RQRA 2DIYA 3ZREA 1WP0A 4I2TA 2JZSA 3NOFA 5A5KA 4Z7XA 2H6XA 1TTZA 4LMWA 3LFLA 4J57E 3RHCA 4GLTA 2E7PA 2UZ8A 4OO4A 4KAEA 5GSTA 2AV4A 1U88A 5IMFA 4I8BA 3PPUA 2GSQA 4GSTA 4MJCA 4G0IA 4TR0A 2F8AA 1ZZYA 3ZL5A 4F2IA 3R2QA 4AJ8A 3HHVA 5A4WA 3BBYA 1E6BA 1TI1A 2GGTA 3SBCA 2JL4A 1YF0A 3P7XA 4TW5A 5C04A 3MDKA 2LQOA 1MDKA 3GFKA 1FB0A 1TKDB 2KOKA 3HCZA 4G9HA 3FMWA 18GSA 2VLUA 3CBUA 3GH6A 4AJ7A 1NW2A 3NZNA 4MP4A 3APOA 5CO3A 3CRUA 3KIJA 2VIMA 2BJXA 4CHSA 2GVPA 2H74A 2GTUA 4EUYA 1JLWA 1GLQA 3FK8A 2HT9A 4ZXGA 2LV3A 1PKWA 1X0RA 2R2JA 1HYUA 3IK9A 2VCTA 3UIWA 4D73A 1FG4A 4KF9A 4IKHA 2CAQA 3UVHA 1G7EA 1XVQA 3RHBA 5LNKe 4MPGA 2JZTA 4MZWA 5EY6A 4TR1B 5AN1A 1U3IA 2CVBA 2HRFA 4NHZA 1QUWA 2K8SA 4OMVA 4ECJA 3IC8A 3IAS2 3C73A 4FYBA 2C1YA 4OCFA 3TUEA 3O6TA 2N5BA 2GZPA 5DJLA 2X49A 1JZRA 6GSVA 1LBKA 4ZBDA 2B5YA 4IQAA 4PUAA 3CTGA 3QAVA 1R7HA 1W89A 2HFDA 1K0NA 4GF0A 1VF1A 12GSA 2MMNA 5L71A 2AHEA 3LJRA 5ID2A 2JADA 3ZIVA 2WFCA 4Z2UA 5CRDA 1GTAA 1K0BA 3M1GA 2DJ2A 2YWNA 3IA1A 4YAVA 4X1UA 4EIQA 1U6TA 4EKZA 2V32A 5GAND 4F0CA 3N5OA 4L0UA 4MPFA 1MD3A 5IOWA 3FEUA 5JCWA 4OD7A 2YWIA 2L4QA 4TRXA 1XWAA 4XS6A 2GZZA 4TXOB 6GSWA 1A23A 1YKCA 1B9XC 1CQHA 2CA8A 5IMDA 4F82A 3LEFA 1A2JA 4J2FA 3MWHA 2A4HA 3LORA 2KHPA 2LSTA 3GYKA 3EMPA 2YV7A 1YDKA 1AQWA 2VCZA 3KM6A 2QA2A 4ECCA 4OCEA 4KCAA 1GUHA 1AXDA 3AY8A 1GTBA 1NHOA 2EIRA 4MMMA 5J9CA 1K0OA 4HQZA 3U6VA 4ZBBA 4TR4A 3FY7A 4EDYA 2AB6A 3I43A 2M46A 1SL0B 2YJ7A 1T7PB 5G30A 1YY7A 3HY2A 4F03A 2MBTA 4LLRA 4XIHA 1AAZA 10GSA 7GSSA 1JZDA 2DBCA 2LKUA 4IHUA 1BQ7A 3HVNA 3ZTLA 1PN0A 1SYXA 1R5AA 2V2GA 4YQUA 5E4WA 2CT6A 5HQPA 3TRPA 2IMEA 2GS3A 3KXOA 4HZ2A 3Q19A
chains in the Genus database with same CATH topology
3EWLA 1XW9A 3TKSA 2R0CA 1O85A 3EYTA 1FVKA 3KCMA 4IJIA 4A5PA 4JEDA 1Z7PA 2PVOC 3VLNA 2R3XA 3FW2A 5HR0A 3DEXA 3GA4A 1H75A 2O8VB 1GNWA 1A0FA 3V1WA 3HVXA 2FWHA 4MJAA 4EO3A 2B7KA 1M0UA 2PVQA 4TOPA 2NVLA 3I9V2 3GSSA 4NV2A 1ZYQB 3DWVA 4ZIJA 1PMTA 4ZL7A 4TR3A 3IAM2 5AIXA 2H6YA 4GQCA 3G7JA 1YEXA 3IE3A 4X0XA 1DE1A 2H1BA 1J9BA 1I9DA 2TRCP 3IRAA 4K2DA 1XBSA 1ILOA 2GT6A 4NXIA 1XFLA 5DALB 3GTUB 3J7Yk 2O85A 1Z5YE 1TRWA 2LJRA 1K0DA 3ERWA 4HU7A 3ERGA 5CRWA 2PN8A 1EZKA 3H1NA 3TJGA 2FD3A 3F6DA 3ISOA 4BVXA 1GNEA 3BD2A 5DQYA 4POLA 4RQXA 4MK3A 2DC5A 4KDXA 4CY8A 4DSSB 3KJYA 5G2ZA 1YQ1A 1S3DA 4IVFA 2C0EA 4I2UA 1WOUA 3DD3A 3F63A 5J4UA 2LNSA 3GKMA 3E9JB 1GSYA 2I4AA 3HYPA 4G19A 2O7KA 4O32A 3QOUA 1LU4A 3WD6A 1WMJA 3TJFA 4LL4B 5GZZB 1M7TA 3LG6A 2OA7A 3F8UA 2C80A 3BJ5A 5HFIA 2YCDA 4V1Ap 4V2LA 2PERA 2JU5A 3LXTA 1OKTA 2RM5A 4HJ2A 2IFQB 2VO4A 4KW6A 3KGKA 5IOXA 3CSIA 2QSIA 3GNJA 1NM3A 3HZ8A 1B9YC 4K2XA 1Q4JA 4K1FA 3PH9A 2E2MA 4ECBA 2I81A 5H5QA 3WT1A 2LEGA 1F2EA 2RM6A 5KN3A 1XCCA 3EE2A 4EXJA 1Z3EA 1TW9A 4PTSA 3ZIJA 1Y6EA 3IV4A 1K0CA 2X64A 2HRNA 4FIWA 1FAAA 2GQKA 4NHWA 5KOWA 4IQ1A 1EWXA 2H72A 3KP8A 2JSZA 4WR5A 4OFTA 3OR5A 1FO5A 1E2YA 3ZFLA 2ON5A 3RPPA 4FH8A 2GSTA 3L0HA 3DRNA 4GTUA 3EPTA 2P5RA 1OC8A 4MABA 2C0GA 2CZ2A 5KN0A 1OAZA 3WYWA 2DJ0A 2OKAA 2GT5A 1KTEA 1O73A 3LW9A 3GV1A 4IP6A 3D22A 1ML6A 3QAGA 1C72A 1RQMA 3VWUA 4NMUA 1TRSA 1ZOFA 3GUSA 1B8XA 1AQXA 4WETA 3QD9A 1M2BA 1FVJA 1DSBA 2R6KA 1JZOA 2AYTA 4EE0A 3M8NA 3FR6A 5HFGA 4ICYA 2IMKA 3QDNA 1EEJA 4WKWA 3ZYWA 3GHAA 2X99A 4KA0A 3L78A 1OVNA 2B6MA 2IMDA 2H71A 3ZITA 3GX8A 1T1VA 4OWYA 4O5RA 3CRTA 4O92A 4OFMA 4XS4B 3CTFA 2RUFA 3KZQA 3TOTA 4QL7A 3RDWA 3E3EA 4IJ3A 3GRXA 4CDOA 1MDJA 1Y25A 1TDIA 4XTSA 4JZQA 1UVZA 3TKPA 2YZUA 5BRTA 11GSA 1BJXA 4JU5A 2HLSA 3LGCA 4ISDA 1SJZA 2F51A 2YWOA 4JE1A 2WZ9A 3ZMKA 13GSA 2GLRA 1Z9HA 2XBQA 1WJKA 1V98A 3FHKA 2KP1A 1A8YA 1AQVA 2REMA 5IO0A 2H8LA 5LCZA 4K5RA 1GTUA 4WF5A 3KMOA 1GSDA 5ECKB 4BL7B 1N2AA 3QMXA 1V57A 1NHYA 1Z6MA 3GIXA 5HR2A 1XWGA 2HRAA 4GRFA 2N5FA 1THXA 2FY6A 2HRKA 2IN3A 3TKRA 1XVWA 3UARA 1XOAA 4TN8A 1THOA 5DAKB 3TGZA 2B7JA 4HI7A 2CZ3A 3PR8A 2H0IA 4BWSA 2AAWA 4MF5A 4ZL8A 1UC7A 2P0GA 5B8BA 4TKYA 2CX4A 3G7YA 3GN3A 5LD0A 1F3BA 1PL2A 4NV5A 3GX0A 1DE2A 3Q74A 4HUAA 4KGIA 3ZVJD 1K3LA 5G1KA 4IW9A 1AC1A 4BVYB 3WT2A 2MYGA 3IC4A 6GSUA 3BCIA 4EIPA 1JZWA 3HJMA 2L6DA 2WB9A 4PQ1A 2EC4A 2HYXA 1EV4A 3TOUA 5CAXA 2H1DA 3ME7A 1AUCA 1PX6A 1X5CA 1ERTA 4JBBA 3DVWA 2WULA 1XOBA 2GZYA 4V1Ag 2HZEB 3JCML 3DIEA 4JR6A 1ERVA 2VL2A 5B7CA 1O8XA 1SL2B 2OJLA 1WRYA 1ERWA 3D4TA 3IXRA 3ZMLA 5HFKA 3CSJA 4HU9A 4KDUA 2NDOA 4WEYA 2A2PA 22GSA 1ABAA 3KMNA 4V2NA 4Q5NA 5DCHA 5ECOB 4HOJA 4EVMA 1XIYA 2K8VA 2Z9SA 4ACSA 3F3RA 5COHA 1OYJA 4POMA 3F4TA 2XHFA 1NSWA 2LRTA 2V6OA 1TU7A 4IP1A 1YZXA 2YZHA 4YH2A 1A24A 1FB6A 2A2SA 3UVTA 2B1LA 1TI3A 1SD8A 3VFIA 4N0ZA 4MJBA 2H19A 4MF6A 1B4QA 1K3OA 2L4CA 1G0TA 4K7IA 3UBKA 4NPBA 1VRSD 3QAWA 4K0GA 1FW1A 1SKRB 1M2AA 4PUFC 4IN0A 2YV9A 1K0MA 1MDIA 5ECNB 1BX9A 5IMCA 4ZB9A 3O76A 3RAZA 1HQOA 3SWLA 4KDYA 1X9WB 4ZL9A 2LJKA 1JHBA 3GKKA 1J0FA 3QCPA 1I5GA 1SL1B 1GSQA 2X4AA 2B3SA 1Q98A 2RUEA 9GSSA 4HS1A 5BMUA 2AUVA 2VCXA 4G2EA 1EP7A 2VM1A 2H73A 1GSEA 3EU4A 4PURA 4MCUA 3D4MA 1UA5A 1IYHA 1XWBA 4N10A 4PGTA 5DDLA 4BPYA 3QPMA 5D9WA 2OBKA 5JWQB 8GSSA 4ML1A 5F8BA 2IMIA 3GURA 2LUSA 2LTKA 4YKFA 1ZL9A 3F3QA 1R26A 4LL1B 1WPIA 2MBSA 3F6FA 1S3AA 1B4PA 2FCHA 1X9SB 3UMAA 1OC3A 4FYUA 3ZFBA 3G7IA 1FOVA 2M72A 3KP9A 4GSNA 1QQ2A 1J08A 3DGQA 2IPAA 5JWRB 3MNGA 1ON4A 2O89A 1K0AA 3H93A 2OE0A 4HQSA 3ZRDA 4E8HA 2N5AA 4IS0A 3APQA 1OE7A 2DMLA 3VWXA 5GSSA 5B8AA 3DYRA 2VCWA 3DVXA 5IMZA 1GUMA 1GTIA 5F06A 1SK2A 5ECSA 3HJOA 5ECHB 4MA9A 4JRRA 4TR1A 4F9ZA 1H4OA 3P8WA 1EV9A 5CNWA 4MNNA 4TXVA 1HD2A 5ECLB 3HDCA 1IYIA 4MJEA 1MD4A 3IDVA 3U5RE 3TRQA 2CVKA 5D9XA 1GULA 1F37A 1WWJA 3FKFA 2HSHA 3KTLA 5EL8A 5C00A 4MZCA 3UL3A 3EU3A 1GLPA 4YQVA 1T4ZA 2ES7A 5B6MA 4LMVA 14GSA 2AJQB 1X5EA 2IWTA 4K7OA 5J3RA 4KE3A 4OO5A 4PQHA 3DMLA 4TXOA 3L4NA 2K18A 2VOCA 3GL3A 3US3A 5J9BA 1QXHA 2FA4A 3ZZXA 2XPEA 4L5LA 2B5EA 3TJBA 2MZCA 4KCEA 2YWMA 2MMAA 1B48A 4KB3A 1DBYA 1PX7A 3BCKA 5IO2A 3GL5A 2V41A 2KP2A 1RK4A 1EP8A 2ZNMA 1G6YA 1ZMAA 1GSFA 1SENA 3VWWA 1V9WA 1R4WA 2FUG2 3ZVJA 1ZGNA 4ZB8A 2DJJA 2GQMA 4YKGA 5G5FA 2H66A 4GXZA 4RI7A 4QQ7A 4N11A 2GSSA 5JCUA 1XZOA 2O87A 5KN2A 2FWFA 2K6VA 4XRAA 5IMAA 4IGJA 2CX3A 1XXUA 2E0QA 1Z6NA 4AF2A 4D73B 4AGSA 2V6KA 2B1KA 4RUVA 4WBJA 4RI6A 2WS2A 2F3MA 3UBLA 3M3MA 2BTOT 4XS1A 2R4VA 4NWYA 1GUKA 5A4UA 1O8WA 2FA8A 1ZYNA 3TJJA 4Q5FA 5F0GA 3L9SA 5D9TA 1V2AA 4I97A 1TK5B 2EIOA 2QGVA 1BAYA 4EF0A 4JR4A 3TRXA 1SJIA 5ECMB 5ECPB 2QC7A 1XW6A 3TKSC 3EURA 4ULXA 3D6IA 1T3BA 3J7Yb 2ON7A 5G1LA 3TJKA 4Q5RA 1SD9A 3W8SA 1O81A 5ID2B 1GSUA 5F07A 3IR4A 3P2AA 3VPTA 5CP1A 2LJAA 2A4VA 4TVEA 5E59A 2D2ZA 1PKZA 2E2GA 2PGTA 2R5GA 2A2RA 4ID0A 5D8IA 5DALA 3GTUA 2DKHA 4G0LA 1OC9B 4ML6A 4HJMA 2R0GA 1WIKA 4GSSA 2J9HA 3KH9A 1TJDA 2CAIA 4ZILA 1X9MB 3CMIA 3VI5A 5JWOB 5H5RA 2TRXA 5IQYA 4DSSA 1QMVA 4IELA 2C3NA 5J41A 3A5IA 1YEPA 1TK0B 1GL8A 4I6XA 3M9KA 4XHMA 4GCIA 3NIVA 3RPNA 2OACA 4Z2RA 3GH9A 3GKNA 19GSA 5IPGA 2FHEA 1TXXA 5IM9A 2V1MA 3P90A 3MAKA 2L57A 1O6JA 3QR6A 4L5OA 2L5OA 4LA1A 4FQUA 1BEDA 4Z2TA 1SKWB 5GAPD 3KD0A 3QFAC 2VL9A 3LSZA 1KNGA 3HA9A 2IFQA 4YQMA 4YAPA 3DKSA 1ACVA 4ECIA 5EPFA 2EIQA 1T00A 1V40A 1YKAA 3C1RA 1EEMA 3A2WA 2PPTA 2HSMA 3R3EA 1SJ6A 1TRUA 2H76A 5HR1A 20GSA 1V58A 3KTBA 4Q5QA 4K6XA 2H75A 2B5XA 3TKQA 5KEJA 2DJ1A 2C3QA 2NPBA 1M2DA 5CRHA 5AISA 1MEKA 3F4SA 2KUCA 2LS5A 5DVBA 1ZYPA 2CV4A 3DXBA 4J56E 5FHIA 3MSZA 1QK8A 3C71A 2I3YA 4MH3A 16GSA 3WGDA 5DQSA 3IHGA 2YNXA 2JZRA 1XWKA 2XC2A 5IIZA 4DSRA 4G0KA 2PMTA 4O5QA 2L59A 4POKA 1PL1A 2FNOA 1OE8A 4HEA2 1PQNA 2MMOA 1M99A 1F3AA 4PX1A 4PXOA 1TOFA 2WDUA 3HXSA 2IIYA 1ERUA 1PD21 4FO5A 4BWQA 5B6NA 3UEMA 2H0GA 4O7HA 1AIUA 2YPMA 3VWVA 4GQFA 1YF1A 2VUPA 2H1AA 2NBSA 2RLIA 2L5LA 2VCVA 3D21A 4BVXB 2HNLA 3F0IA 3UAPA 5JCGA 1CQGA 2CVDA 5ELAA 2YJHA 3I69A 5KN1A 6GSTA 2L6CA 1KEBA 4K7NA 1W4VA 3F4RA 5ABRA 1FOHA 1GH2A 3EC3A 1G7OA 3HD5A 2VD1A 4OFNA 3WGXA 3EMXA 3WGEA 2H01A 2YP6A 1PSQA 4XS4A 3N9JA 4KSOA 3E0UA 5D93A 4KNDA 3HKRA 1OC9A 2PBJA 3ME8A 2DIZA 2C8UA 2VCQA 2VM2A 3O3TA 2PWJA 1DUGA 3IOSA 1G6WA 1BYEA 4MF7A 1EGRA 2I9HA 2PU9C 1SKSB 3ZLPA 2QA1A 1ZYEA 3EVIA 3Q6OA 4HZ4A 2HE3A 2KLXA 4L8EA 3IHQA 5DJMA 4BA7A 3LWAA 2LNTA 2WRTA 1XPVA 1GRXA 3BOAA 3A3TA 4WXTA 4FYCA 1ZCPA 3KEBA 2VLTA 2IL3A 1PA3A 1N8JA 2X8CA 3K8NA 2X8HA 5F05A 1SK0A 4MLYA 2C4JA 4H86A 3TCOA 1U87A 2FGXA 4DSQA 3LQ7A 2WGRA 2OBIA 1A8LA 4NAXA 4V2MA 1VF4A 3VK9A 3VI7A 4BL7A 5G31A 3C1SA 1SU9A 2LQQA 1GP1A 1S3CA 3TDGA 2XPDA 3GMFA 4MDCA 3UOMA 3MIXA 4ZB6A 2G2QA 3S9FA 1VF3A 5CREA 2H70A 5DAKA 17GSA 1QFNA 3LYPA 1M9AA 3UJ1A 1EGOA 4WF4A 3HVVA 3M9JA 1KBNA 2HI7A 3FZAA 2RIIA 5D73A 1XWCA 1TK8B 1GSSA 1O7UA 2WJUA 2OADA 4K9ZA 2MMZA 3LYKA 4E8EA 3HVSA 1F9MA 4G10A 5ECIB 4KSMA 1BG5A 3IK7A 2X8GA 3W6GA 2GSRA 4HDEA 1WE0A 2YANA 4ZBAA 4BVYA 4KH7A 4QL9A 1PRXA 2CQ9A 5FWGA 1HNCA 3EINA 5J5NA 5ECQB 2JACA 2LRCA 3RBTA 4DEJA 4KUNA 3VURA 2DJ3A 2FWGA 2F9SA 1HNBA 2OE3A 3Q18A 4I5QA 4PQIA 2OE1A 1SK1A 3APSA 4EL1A 2JSYA 3A2VA 5FT3A 3PINA 4P3YB 2DMMA 4O5UA 1SYRA 2HZEA 3LXZA 2R0PA 3ERFA 1M9BA 5KOXA 1VGLA 1YJ6A 2XBIA 1A2MA 5IPHA 1PGTA 5ENUA 1A2LA 4WBRD 2GQLA 1JLVA 1EOGA 1TRVA 3I6AA 1AW9A 4IBPA 3GSTA 5CYYA 5G5EA 2J23A 4CY6A 3FRCA 3FZ4A 5CRGA 3TB2A 4EDZA 4MH2A 2VL2C 3VPQA 3M0FA 4WR4A 2H1GA 4CW9A 3C8EA 4PNFA 1FHEA 5D96A 1PN9A 4KX4A 1USBA 1URMA 2DJKA 2LRNA 3A2XA 2H6ZA 2ALBA 2PUKC 2P31A 5INYA 2R37A 1R5PA 3H4KA 3FR9A 2TIRA 3FZ9A 3TKSE 5IMVA 1LJRA 4X43A 2C0FA 5HR3A 4GWRA 5H5SA 2HXKA 1OKDA 2GDRA 6GSYA 4POBA 3H8QA 3HJPA 1TP9A 2VAFA 4K5SA 4EC0A 1EOHA 4N30A 1XW5A 2G0FA 2QKEA 3D0ZA 3PGTA 1GWCA 2H0HA 1VF2A 6GSSA 3KH7A 1UN2A 3FYGA 1MTCA 1JFUA 3W8JA 4MZBA 3D5JA 3F9UA 4XRDA 3HZ4A 1T8EB 4PNGA 2M80A 3L9VA 3L9UA 3IPZA 1ST9A 2HZFA 2FLSA 4K0NA 1K3YA 4N0VA 2NTOA 2YN1A 2ZUPA 2DLXA 3CYNA 1TU8A 4USSA 2C0DA 5D9VA 2IMFA 2VL3A 1QGVA 2ZCTA 3H79A 3QFBC 3GKXA 4DVCA 1Z7RA 1X5DA 2P5QA 2F8FA 2VLVA 2DKIA 2IJYA 2C3TA 5ELGA 4K8MA 2WCIA 3MYDA 3FZ5A 5AGYA 1T4YA 2VD0A 5DCGA 1RW1A 2HSYA 4ILFA 1HNAA 3G9BA 2YOIA 3C7MA 1U3AA 5A4VA 1A0RP 1F6MC 2FWEA 4AJ6A 2K9FA 2I1UA 5EVOA 3IBHA 2BMXA 3A5WA 4L0WA 3ED3A 2DSAA 5AIVA 4XCSA 5ECRB 3CXGA 5DBQA 4F0BA 3FR3A 6GSXA 3CSHA 2H30A 4X4JA 4RQRA 2DIYA 3ZREA 1WP0A 4I2TA 2JZSA 3NOFA 5A5KA 4Z7XA 2H6XA 1TTZA 4LMWA 3LFLA 4J57E 3RHCA 4GLTA 2E7PA 2UZ8A 4OO4A 4KAEA 5GSTA 2AV4A 1U88A 5IMFA 4I8BA 3PPUA 2GSQA 4GSTA 4MJCA 4G0IA 4TR0A 2F8AA 1ZZYA 3ZL5A 4F2IA 3R2QA 4AJ8A 3HHVA 5A4WA 3BBYA 1E6BA 1TI1A 2GGTA 3SBCA 2JL4A 1YF0A 3P7XA 4TW5A 5C04A 3MDKA 2LQOA 1MDKA 3GFKA 1FB0A 1TKDB 2KOKA 3HCZA 4G9HA 3FMWA 18GSA 2VLUA 3CBUA 3GH6A 4AJ7A 1NW2A 3NZNA 4MP4A 3APOA 5CO3A 3CRUA 3KIJA 2VIMA 2BJXA 4CHSA 2GVPA 2H74A 2GTUA 4EUYA 1JLWA 1GLQA 3FK8A 2HT9A 4ZXGA 2LV3A 1PKWA 1X0RA 2R2JA 1HYUA 3IK9A 2VCTA 3UIWA 4D73A 1FG4A 4KF9A 4IKHA 2CAQA 3UVHA 1G7EA 1XVQA 3RHBA 5LNKe 4MPGA 2JZTA 4MZWA 5EY6A 4TR1B 5AN1A 1U3IA 2CVBA 2HRFA 4NHZA 1QUWA 2K8SA 4OMVA 4ECJA 3IC8A 3IAS2 3C73A 4FYBA 2C1YA 4OCFA 3TUEA 3O6TA 2N5BA 2GZPA 5DJLA 2X49A 1JZRA 6GSVA 1LBKA 4ZBDA 2B5YA 4IQAA 4PUAA 3CTGA 3QAVA 1R7HA 1W89A 2HFDA 1K0NA 4GF0A 1VF1A 12GSA 2MMNA 5L71A 2AHEA 3LJRA 5ID2A 2JADA 3ZIVA 2WFCA 4Z2UA 5CRDA 1GTAA 1K0BA 3M1GA 2DJ2A 2YWNA 3IA1A 4YAVA 4X1UA 4EIQA 1U6TA 4EKZA 2V32A 5GAND 4F0CA 3N5OA 4L0UA 4MPFA 1MD3A 5IOWA 3FEUA 5JCWA 4OD7A 2YWIA 2L4QA 4TRXA 1XWAA 4XS6A 2GZZA 4TXOB 6GSWA 1A23A 1YKCA 1B9XC 1CQHA 2CA8A 5IMDA 4F82A 3LEFA 1A2JA 4J2FA 3MWHA 2A4HA 3LORA 2KHPA 2LSTA 3GYKA 3EMPA 2YV7A 1YDKA 1AQWA 2VCZA 3KM6A 2QA2A 4ECCA 4OCEA 4KCAA 1GUHA 1AXDA 3AY8A 1GTBA 1NHOA 2EIRA 4MMMA 5J9CA 1K0OA 4HQZA 3U6VA 4ZBBA 4TR4A 3FY7A 4EDYA 2AB6A 3I43A 2M46A 1SL0B 2YJ7A 1T7PB 5G30A 1YY7A 3HY2A 4F03A 2MBTA 4LLRA 4XIHA 1AAZA 10GSA 7GSSA 1JZDA 2DBCA 2LKUA 4IHUA 1BQ7A 3ZTLA 1PN0A 1SYXA 1R5AA 2V2GA 4YQUA 5E4WA 2CT6A 5HQPA 3TRPA 2IMEA 2GS3A 3KXOA 4HZ2A 3Q19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWL A;  1XW9 A;  3TKS A;  1O85 A;  3EYT A;  1FVK A;  3KCM A;  4IJI A;  4JED A;  1Z7P A;  2PVO C;  3VLN A;  2R3X A;  3FW2 A;  5HR0 A;  3DEX A;  3GA4 A;  1H75 A;  2O8V B;  1GNW A;  1A0F A;  3V1W A;  3HVX A;  2FWH A;  4MJA A;  4EO3 A;  2B7K A;  1M0U A;  2PVQ A;  4TOP A;  2NVL A;  3I9V 2;  3GSS A;  4NV2 A;  1ZYQ B;  3DWV A;  4ZIJ A;  1PMT A;  4ZL7 A;  4TR3 A;  3IAM 2;  5AIX A;  2H6Y A;  4GQC A;  3G7J A;  1YEX A;  3IE3 A;  4X0X A;  1DE1 A;  2H1B A;  1J9B A;  1I9D A;  2TRC P;  3IRA A;  4K2D A;  1XBS A;  1ILO A;  2GT6 A;  4NXI A;  1XFL A;  5DAL B;  3GTU B;  3J7Y k;  2O85 A;  1Z5Y E;  1TRW A;  2LJR A;  1K0D A;  3ERW A;  4HU7 A;  3ERG A;  5CRW A;  2PN8 A;  1EZK A;  3H1N A;  3TJG A;  2FD3 A;  3F6D A;  3ISO A;  4BVX A;  1GNE A;  3BD2 A;  5DQY A;  4POL A;  4RQX A;  4MK3 A;  2DC5 A;  4KDX A;  4DSS B;  3KJY A;  5G2Z A;  1YQ1 A;  1S3D A;  4IVF A;  2C0E A;  4I2U A;  1WOU A;  3DD3 A;  3F63 A;  5J4U A;  2LNS A;  3GKM A;  3E9J B;  1GSY A;  2I4A A;  3HYP A;  4G19 A;  2O7K A;  4O32 A;  3QOU A;  1LU4 A;  3WD6 A;  1WMJ A;  3TJF A;  4LL4 B;  5GZZ B;  1M7T A;  3LG6 A;  2OA7 A;  3F8U A;  2C80 A;  3BJ5 A;  5HFI A;  2YCD A;  4V1A p;  4V2L A;  2PER A;  2JU5 A;  3LXT A;  1OKT A;  2RM5 A;  4HJ2 A;  2IFQ B;  2VO4 A;  4KW6 A;  3KGK A;  5IOX A;  3CSI A;  2QSI A;  3GNJ A;  1NM3 A;  3HZ8 A;  1B9Y C;  1Q4J A;  4K1F A;  3PH9 A;  2E2M A;  4ECB A;  2I81 A;  5H5Q A;  3WT1 A;  2LEG A;  1F2E A;  2RM6 A;  5KN3 A;  1XCC A;  3EE2 A;  4EXJ A;  1Z3E A;  1TW9 A;  3ZIJ A;  1Y6E A;  3IV4 A;  1K0C A;  2X64 A;  2HRN A;  4FIW A;  1FAA A;  2GQK A;  4NHW A;  4IQ1 A;  1EWX A;  2H72 A;  3KP8 A;  2JSZ A;  4WR5 A;  4OFT A;  3OR5 A;  1FO5 A;  1E2Y A;  3ZFL A;  2ON5 A;  3RPP A;  4FH8 A;  2GST A;  3L0H A;  3DRN A;  4GTU A;  2P5R A;  1OC8 A;  4MAB A;  2C0G A;  2CZ2 A;  5KN0 A;  1OAZ A;  3WYW A;  2DJ0 A;  2OKA A;  2GT5 A;  1KTE A;  1O73 A;  3GV1 A;  4IP6 A;  3D22 A;  1ML6 A;  3QAG A;  1C72 A;  1RQM A;  3VWU A;  4NMU A;  1TRS A;  1ZOF A;  3GUS A;  1B8X A;  1AQX A;  4WET A;  3QD9 A;  1M2B A;  1FVJ A;  1DSB A;  2R6K A;  1JZO A;  2AYT A;  4EE0 A;  3M8N A;  3FR6 A;  5HFG A;  2IMK A;  3QDN A;  1EEJ A;  4WKW A;  3ZYW A;  3GHA A;  2X99 A;  4KA0 A;  3L78 A;  1OVN A;  2B6M A;  2IMD A;  2H71 A;  3ZIT A;  3GX8 A;  1T1V A;  4OWY A;  4O5R A;  3CRT A;  4O92 A;  4OFM A;  4XS4 B;  3CTF A;  2RUF A;  3KZQ A;  3TOT A;  4QL7 A;  3RDW A;  3E3E A;  4IJ3 A;  3GRX A;  4CDO A;  1MDJ A;  1Y25 A;  1TDI A;  4XTS A;  4JZQ A;  1UVZ A;  3TKP A;  2YZU A;  11GS A;  1BJX A;  4JU5 A;  2HLS A;  3LGC A;  4ISD A;  1SJZ A;  2F51 A;  2YWO A;  4JE1 A;  2WZ9 A;  3ZMK A;  13GS A;  2GLR A;  1Z9H A;  2XBQ A;  1WJK A;  1V98 A;  3FHK A;  2KP1 A;  1A8Y A;  1AQV A;  2REM A;  5IO0 A;  2H8L A;  5LCZ A;  1GTU A;  4WF5 A;  3KMO A;  1GSD A;  5ECK B;  1N2A A;  3QMX A;  1V57 A;  1NHY A;  1Z6M A;  3GIX A;  5HR2 A;  1XWG A;  4GRF A;  2N5F A;  1THX A;  2FY6 A;  2IN3 A;  3TKR A;  1XVW A;  3UAR A;  1XOA A;  4TN8 A;  1THO A;  5DAK B;  3TGZ A;  2B7J A;  4HI7 A;  2CZ3 A;  3PR8 A;  2H0I A;  4BWS A;  2AAW A;  4MF5 A;  4ZL8 A;  1UC7 A;  2P0G A;  5B8B A;  4TKY A;  2CX4 A;  3G7Y A;  3GN3 A;  5LD0 A;  1F3B A;  1PL2 A;  4NV5 A;  3GX0 A;  1DE2 A;  3Q74 A;  4HUA A;  4KGI A;  3ZVJ D;  1K3L A;  5G1K A;  4IW9 A;  1AC1 A;  3WT2 A;  2MYG A;  3IC4 A;  6GSU A;  3BCI A;  1JZW A;  3HJM A;  2L6D A;  2WB9 A;  4PQ1 A;  2EC4 A;  2HYX A;  1EV4 A;  3TOU A;  5CAX A;  2H1D A;  3ME7 A;  1AUC A;  1PX6 A;  1X5C A;  1ERT A;  4JBB A;  3DVW A;  2WUL A;  1XOB A;  2GZY A;  4V1A g;  2HZE B;  3JCM L;  3DIE A;  4JR6 A;  1ERV A;  2VL2 A;  5B7C A;  1O8X A;  1SL2 B;  2OJL A;  1WRY A;  1ERW A;  3D4T A;  3IXR A;  3ZML A;  5HFK A;  3CSJ A;  4HU9 A;  4KDU A;  2NDO A;  4WEY A;  22GS A;  1ABA A;  3KMN A;  4V2N A;  4Q5N A;  5DCH A;  5ECO B;  4HOJ A;  4EVM A;  1XIY A;  2K8V A;  2Z9S A;  4ACS A;  3F3R A;  5COH A;  1OYJ A;  4POM A;  3F4T A;  2XHF A;  1NSW A;  2LRT A;  2V6O A;  1TU7 A;  4IP1 A;  1YZX A;  2YZH A;  4YH2 A;  1A24 A;  1FB6 A;  2A2S A;  3UVT A;  2B1L A;  1TI3 A;  1SD8 A;  3VFI A;  4N0Z A;  4MJB A;  2H19 A;  4MF6 A;  1B4Q A;  1K3O A;  2L4C A;  1G0T A;  4K7I A;  3UBK A;  4NPB A;  1VRS D;  3QAW A;  4K0G A;  1FW1 A;  1SKR B;  1M2A A;  4PUF C;  4IN0 A;  2YV9 A;  1K0M A;  1MDI A;  5ECN B;  1BX9 A;  5IMC A;  4ZB9 A;  3O76 A;  3RAZ A;  1HQO A;  3SWL A;  4KDY A;  1X9W B;  4ZL9 A;  2LJK A;  1JHB A;  3GKK A;  1J0F A;  3QCP A;  1I5G A;  1SL1 B;  1GSQ A;  2B3S A;  1Q98 A;  2RUE A;  9GSS A;  4HS1 A;  2AUV A;  2VCX A;  4G2E A;  1EP7 A;  2VM1 A;  2H73 A;  1GSE A;  3EU4 A;  4PUR A;  4MCU A;  3D4M A;  1UA5 A;  1IYH A;  1XWB A;  4N10 A;  4PGT A;  5DDL A;  4BPY A;  3QPM A;  5D9W A;  2OBK A;  5JWQ B;  8GSS A;  4ML1 A;  5F8B A;  2IMI A;  3GUR A;  2LUS A;  2LTK A;  1ZL9 A;  3F3Q A;  1R26 A;  4LL1 B;  1WPI A;  2MBS A;  3F6F A;  1S3A A;  1B4P A;  2FCH A;  1X9S B;  3UMA A;  1OC3 A;  4FYU A;  3ZFB A;  3G7I A;  1FOV A;  2M72 A;  3KP9 A;  4GSN A;  1QQ2 A;  1J08 A;  3DGQ A;  2IPA A;  5JWR B;  3MNG A;  1ON4 A;  2O89 A;  1K0A A;  3H93 A;  2OE0 A;  4HQS A;  3ZRD A;  4E8H A;  2N5A A;  4IS0 A;  3APQ A;  1OE7 A;  2DML A;  3VWX A;  5GSS A;  5B8A A;  3DYR A;  2VCW A;  3DVX A;  5IMZ A;  1GUM A;  1GTI A;  5F06 A;  1SK2 A;  5ECS A;  3HJO A;  5ECH B;  4MA9 A;  4JRR A;  4TR1 A;  4F9Z A;  1H4O A;  3P8W A;  1EV9 A;  5CNW A;  4TXV A;  1HD2 A;  5ECL B;  3HDC A;  1IYI A;  4MJE A;  1MD4 A;  3IDV A;  3U5R E;  3TRQ A;  2CVK A;  5D9X A;  1GUL A;  1F37 A;  1WWJ A;  3FKF A;  2HSH A;  3KTL A;  5EL8 A;  5C00 A;  4MZC A;  3UL3 A;  3EU3 A;  1GLP A;  4YQV A;  1T4Z A;  2ES7 A;  5B6M A;  4LMV A;  14GS A;  2AJQ B;  1X5E A;  2IWT A;  4K7O A;  5J3R A;  4KE3 A;  4OO5 A;  4PQH A;  3DML A;  4TXO A;  3L4N A;  2K18 A;  2VOC A;  3GL3 A;  3US3 A;  5J9B A;  1QXH A;  2FA4 A;  3ZZX A;  2XPE A;  4L5L A;  2B5E A;  3TJB A;  2MZC A;  4KCE A;  2YWM A;  2MMA A;  1B48 A;  4KB3 A;  1DBY A;  1PX7 A;  3BCK A;  5IO2 A;  3GL5 A;  2V41 A;  2KP2 A;  1RK4 A;  1EP8 A;  2ZNM A;  1G6Y A;  1ZMA A;  1GSF A;  1SEN A;  3VWW A;  1V9W A;  1R4W A;  2FUG 2;  3ZVJ A;  1ZGN A;  4ZB8 A;  2DJJ A;  2GQM A;  5G5F A;  2H66 A;  4GXZ A;  4RI7 A;  4QQ7 A;  4N11 A;  2GSS A;  5JCU A;  1XZO A;  2O87 A;  5KN2 A;  2FWF A;  2K6V A;  4XRA A;  5IMA A;  4IGJ A;  2CX3 A;  1XXU A;  2E0Q A;  1Z6N A;  4AF2 A;  4D73 B;  4AGS A;  2V6K A;  2B1K A;  4RUV A;  4WBJ A;  4RI6 A;  2WS2 A;  2F3M A;  3UBL A;  3M3M A;  2BTO T;  4XS1 A;  2R4V A;  4NWY A;  1GUK A;  5A4U A;  1O8W A;  2FA8 A;  3TJJ A;  4Q5F A;  5F0G A;  3L9S A;  5D9T A;  1V2A A;  4I97 A;  1TK5 B;  2EIO A;  2QGV A;  1BAY A;  4EF0 A;  4JR4 A;  3TRX A;  1SJI A;  5ECM B;  5ECP B;  2QC7 A;  1XW6 A;  3TKS C;  3EUR A;  4ULX A;  3D6I A;  1T3B A;  3J7Y b;  2ON7 A;  5G1L A;  3TJK A;  4Q5R A;  1SD9 A;  3W8S A;  1O81 A;  5ID2 B;  1GSU A;  5F07 A;  3IR4 A;  3P2A A;  3VPT A;  5CP1 A;  2LJA A;  2A4V A;  4TVE A;  5E59 A;  2D2Z A;  1PKZ A;  2E2G A;  2PGT A;  2R5G A;  2A2R A;  4ID0 A;  5D8I A;  5DAL A;  3GTU A;  1OC9 B;  4ML6 A;  4HJM A;  1WIK A;  4GSS A;  2J9H A;  3KH9 A;  1TJD A;  2CAI A;  4ZIL A;  1X9M B;  3CMI A;  3VI5 A;  5JWO B;  5H5R A;  2TRX A;  5IQY A;  4DSS A;  1QMV A;  4IEL A;  2C3N A;  5J41 A;  1YEP A;  1TK0 B;  1GL8 A;  4I6X A;  3M9K A;  4XHM A;  4GCI A;  3NIV A;  3RPN A;  2OAC A;  3GH9 A;  3GKN A;  19GS A;  5IPG A;  2FHE A;  1TXX A;  5IM9 A;  2V1M A;  3P90 A;  3MAK A;  2L57 A;  1O6J A;  3QR6 A;  4L5O A;  2L5O A;  4LA1 A;  1BED A;  1SKW B;  5GAP D;  3KD0 A;  3QFA C;  2VL9 A;  3LSZ A;  1KNG A;  3HA9 A;  2IFQ A;  4YQM A;  4YAP A;  3DKS A;  1ACV A;  4ECI A;  5EPF A;  2EIQ A;  1T00 A;  1V40 A;  1YKA A;  3C1R A;  1EEM A;  3A2W A;  2PPT A;  1SJ6 A;  1TRU A;  2H76 A;  5HR1 A;  20GS A;  1V58 A;  3KTB A;  4Q5Q A;  4K6X A;  2H75 A;  2B5X A;  3TKQ A;  5KEJ A;  2DJ1 A;  2C3Q A;  2NPB A;  1M2D A;  5CRH A;  5AIS A;  1MEK A;  3F4S A;  2KUC A;  2LS5 A;  5DVB A;  2CV4 A;  3DXB A;  4J56 E;  5FHI A;  3MSZ A;  1QK8 A;  3C71 A;  2I3Y A;  4MH3 A;  16GS A;  3WGD A;  5DQS A;  2YNX A;  2JZR A;  1XWK A;  2XC2 A;  5IIZ A;  4DSR A;  2PMT A;  2L59 A;  1PL1 A;  4POK A;  2FNO A;  1OE8 A;  4HEA 2;  1PQN A;  2MMO A;  1M99 A;  1F3A A;  4PX1 A;  4PXO A;  1TOF A;  2WDU A;  3HXS A;  2IIY A;  1ERU A;  1PD2 1;  4FO5 A;  4BWQ A;  5B6N A;  3UEM A;  2H0G A;  4O7H A;  1AIU A;  2YPM A;  3VWV A;  4GQF A;  1YF1 A;  2VUP A;  2H1A A;  2NBS A;  2RLI A;  2L5L A;  2VCV A;  3D21 A;  2HNL A;  3F0I A;  3UAP A;  5JCG A;  1CQG A;  2CVD A;  5ELA A;  2YJH A;  3I69 A;  5KN1 A;  6GST A;  2L6C A;  1KEB A;  4K7N A;  1W4V A;  3F4R A;  5ABR A;  1GH2 A;  3EC3 A;  1G7O A;  3HD5 A;  2VD1 A;  4OFN A;  3WGX A;  3EMX A;  3WGE A;  2H01 A;  2YP6 A;  1PSQ A;  4XS4 A;  3N9J A;  4KSO A;  3E0U A;  5D93 A;  4KND A;  3HKR A;  1OC9 A;  2PBJ A;  3ME8 A;  2DIZ A;  2C8U A;  2VCQ A;  2VM2 A;  3O3T A;  2PWJ A;  1DUG A;  3IOS A;  1G6W A;  1BYE A;  4MF7 A;  1EGR A;  2I9H A;  2PU9 C;  1SKS B;  3ZLP A;  1ZYE A;  3EVI A;  3Q6O A;  4HZ4 A;  2HE3 A;  2KLX A;  4L8E A;  3IHQ A;  5DJM A;  4BA7 A;  3LWA A;  2LNT A;  2WRT A;  1XPV A;  1GRX A;  3BOA A;  3A3T A;  4WXT A;  4FYC A;  1ZCP A;  3KEB A;  2VLT A;  2IL3 A;  1PA3 A;  1N8J A;  2X8C A;  3K8N A;  2X8H A;  5F05 A;  1SK0 A;  4MLY A;  2C4J A;  4H86 A;  3TCO A;  1U87 A;  2FGX A;  4DSQ A;  3LQ7 A;  2WGR A;  2OBI A;  1A8L A;  4NAX A;  4V2M A;  1VF4 A;  3VK9 A;  3VI7 A;  4BL7 A;  5G31 A;  3C1S A;  1SU9 A;  2LQQ A;  1GP1 A;  1S3C A;  3TDG A;  2XPD A;  3GMF A;  4MDC A;  3UOM A;  4ZB6 A;  2G2Q A;  3S9F A;  1VF3 A;  5CRE A;  2H70 A;  5DAK A;  17GS A;  1QFN A;  3LYP A;  1M9A A;  3UJ1 A;  1EGO A;  4WF4 A;  3HVV A;  3M9J A;  1KBN A;  2HI7 A;  3FZA A;  2RII A;  5D73 A;  1XWC A;  1TK8 B;  1GSS A;  1O7U A;  2WJU A;  2OAD A;  4K9Z A;  2MMZ A;  3LYK A;  4E8E A;  3HVS A;  1F9M A;  4G10 A;  5ECI B;  4KSM A;  1BG5 A;  3IK7 A;  2X8G A;  3W6G A;  2GSR A;  4HDE A;  1WE0 A;  2YAN A;  4ZBA A;  4BVY A;  4KH7 A;  4QL9 A;  1PRX A;  2CQ9 A;  5FWG A;  1HNC A;  3EIN A;  5J5N A;  5ECQ B;  2JAC A;  2LRC A;  3RBT A;  4DEJ A;  4KUN A;  3VUR A;  2DJ3 A;  2FWG A;  2F9S A;  1HNB A;  2OE3 A;  3Q18 A;  4I5Q A;  4PQI A;  2OE1 A;  1SK1 A;  3APS A;  4EL1 A;  2JSY A;  3A2V A;  5FT3 A;  3PIN A;  4P3Y B;  2DMM A;  1SYR A;  2HZE A;  3LXZ A;  3ERF A;  1M9B A;  1VGL A;  1YJ6 A;  2XBI A;  1A2M A;  5IPH A;  1PGT A;  5ENU A;  1A2L A;  4WBR D;  2GQL A;  1JLV A;  1EOG A;  1TRV A;  3I6A A;  1AW9 A;  4IBP A;  3GST A;  5CYY A;  5G5E A;  2J23 A;  3FRC A;  3FZ4 A;  5CRG A;  3TB2 A;  4EDZ A;  4MH2 A;  2VL2 C;  3VPQ A;  3M0F A;  4WR4 A;  2H1G A;  4CW9 A;  3C8E A;  4PNF A;  1FHE A;  5D96 A;  1PN9 A;  4KX4 A;  1USB A;  1URM A;  2DJK A;  2LRN A;  3A2X A;  2H6Z A;  2ALB A;  2PUK C;  2P31 A;  5INY A;  2R37 A;  1R5P A;  3H4K A;  3FR9 A;  2TIR A;  3FZ9 A;  3TKS E;  5IMV A;  1LJR A;  4X43 A;  2C0F A;  5HR3 A;  4GWR A;  5H5S A;  2HXK A;  1OKD A;  2GDR A;  6GSY A;  4POB A;  3H8Q A;  3HJP A;  1TP9 A;  2VAF A;  4EC0 A;  1EOH A;  4N30 A;  1XW5 A;  2G0F A;  2QKE A;  3D0Z A;  3PGT A;  1GWC A;  2H0H A;  1VF2 A;  6GSS A;  3KH7 A;  1UN2 A;  3FYG A;  1MTC A;  1JFU A;  3W8J A;  4MZB A;  3D5J A;  3F9U A;  4XRD A;  3HZ4 A;  1T8E B;  4PNG A;  2M80 A;  3L9V A;  3L9U A;  3IPZ A;  1ST9 A;  2HZF A;  2FLS A;  4K0N A;  1K3Y A;  4N0V A;  2NTO A;  2YN1 A;  2ZUP A;  2DLX A;  3CYN A;  1TU8 A;  5D9V A;  2C0D A;  2IMF A;  2VL3 A;  1QGV A;  2ZCT A;  3H79 A;  3QFB C;  3GKX A;  4DVC A;  1Z7R A;  1X5D A;  2P5Q A;  2F8F A;  2VLV A;  2IJY A;  2C3T A;  5ELG A;  4K8M A;  2WCI A;  3FZ5 A;  5AGY A;  1T4Y A;  2VD0 A;  5DCG A;  1RW1 A;  2HSY A;  4ILF A;  1HNA A;  3G9B A;  2YOI A;  3C7M A;  1U3A A;  5A4V A;  1A0R P;  1F6M C;  2FWE A;  4AJ6 A;  2K9F A;  2I1U A;  5EVO A;  3IBH A;  2BMX A;  3A5W A;  4L0W A;  3ED3 A;  2DSA A;  5AIV A;  4XCS A;  5ECR B;  3CXG A;  5DBQ A;  4F0B A;  3FR3 A;  6GSX A;  3CSH A;  2H30 A;  4RQR A;  2DIY A;  3ZRE A;  1WP0 A;  4I2T A;  2JZS A;  3NOF A;  5A5K A;  4Z7X A;  2H6X A;  1TTZ A;  4LMW A;  3LFL A;  4J57 E;  3RHC A;  4GLT A;  2E7P A;  4OO4 A;  4KAE A;  5GST A;  2AV4 A;  1U88 A;  5IMF A;  4I8B A;  2GSQ A;  4GST A;  4MJC A;  2F8A A;  4TR0 A;  1ZZY A;  3ZL5 A;  4F2I A;  3R2Q A;  4AJ8 A;  3HHV A;  5A4W A;  3BBY A;  1E6B A;  1TI1 A;  2GGT A;  3SBC A;  2JL4 A;  1YF0 A;  3P7X A;  4TW5 A;  5C04 A;  3MDK A;  2LQO A;  1MDK A;  3GFK A;  1FB0 A;  1TKD B;  2KOK A;  3HCZ A;  4G9H A;  4AJ7 A;  18GS A;  2VLU A;  3CBU A;  3GH6 A;  1NW2 A;  3NZN A;  4MP4 A;  3APO A;  5CO3 A;  3CRU A;  3KIJ A;  2VIM A;  2BJX A;  4CHS A;  2GVP A;  2H74 A;  2GTU A;  4EUY A;  1JLW A;  1GLQ A;  3FK8 A;  2HT9 A;  4ZXG A;  2LV3 A;  1PKW A;  1X0R A;  2R2J A;  1HYU A;  3IK9 A;  2VCT A;  3UIW A;  4D73 A;  1FG4 A;  4IKH A;  2CAQ A;  3UVH A;  1G7E A;  1XVQ A;  3RHB A;  5LNK e;  4MPG A;  2JZT A;  4MZW A;  5EY6 A;  4TR1 B;  5AN1 A;  1U3I A;  2CVB A;  2HRF A;  4NHZ A;  1QUW A;  2K8S A;  4OMV A;  4ECJ A;  3IAS 2;  3C73 A;  4FYB A;  2C1Y A;  4OCF A;  3TUE A;  3O6T A;  2N5B A;  2GZP A;  5DJL A;  1JZR A;  6GSV A;  1LBK A;  4ZBD A;  2B5Y A;  4IQA A;  4PUA A;  3CTG A;  3QAV A;  1R7H A;  1W89 A;  2HFD A;  1K0N A;  4GF0 A;  1VF1 A;  12GS A;  2MMN A;  5L71 A;  2AHE A;  3LJR A;  5ID2 A;  2JAD A;  3ZIV A;  2WFC A;  5CRD A;  1GTA A;  1K0B A;  3M1G A;  2DJ2 A;  2YWN A;  3IA1 A;  4YAV A;  4X1U A;  1U6T A;  4EKZ A;  2V32 A;  5GAN D;  4F0C A;  3N5O A;  4L0U A;  4MPF A;  1MD3 A;  5IOW A;  3FEU A;  5JCW A;  4OD7 A;  2YWI A;  2L4Q A;  4TRX A;  1XWA A;  4XS6 A;  2GZZ A;  4TXO B;  6GSW A;  1A23 A;  1YKC A;  1B9X C;  1CQH A;  2CA8 A;  5IMD A;  4F82 A;  3LEF A;  1A2J A;  4J2F A;  3MWH A;  3LOR A;  2KHP A;  2LST A;  3GYK A;  3EMP A;  2YV7 A;  1YDK A;  1AQW A;  2VCZ A;  3KM6 A;  4ECC A;  4OCE A;  4KCA A;  1GUH A;  1AXD A;  3AY8 A;  1GTB A;  1NHO A;  2EIR A;  4MMM A;  5J9C A;  1K0O A;  4HQZ A;  3U6V A;  4ZBB A;  4TR4 A;  3FY7 A;  4EDY A;  2AB6 A;  3I43 A;  2M46 A;  1SL0 B;  2YJ7 A;  1T7P B;  5G30 A;  1YY7 A;  3HY2 A;  4F03 A;  2MBT A;  4LLR A;  4XIH A;  1AAZ A;  10GS A;  7GSS A;  1JZD A;  2DBC A;  2LKU A;  4IHU A;  1BQ7 A;  3ZTL A;  1SYX A;  1R5A A;  2V2G A;  4YQU A;  5E4W A;  2CT6 A;  5HQP A;  3TRP A;  2IME A;  2GS3 A;  3KXO A;  4HZ2 A;  3Q19 A; 
#chains in the Genus database with same CATH topology
 3EWL A;  1XW9 A;  3TKS A;  2R0C A;  1O85 A;  3EYT A;  1FVK A;  3KCM A;  4IJI A;  4A5P A;  4JED A;  1Z7P A;  2PVO C;  3VLN A;  2R3X A;  3FW2 A;  5HR0 A;  3DEX A;  3GA4 A;  1H75 A;  2O8V B;  1GNW A;  1A0F A;  3V1W A;  3HVX A;  2FWH A;  4MJA A;  4EO3 A;  2B7K A;  1M0U A;  2PVQ A;  4TOP A;  2NVL A;  3I9V 2;  3GSS A;  4NV2 A;  1ZYQ B;  3DWV A;  4ZIJ A;  1PMT A;  4ZL7 A;  4TR3 A;  3IAM 2;  5AIX A;  2H6Y A;  4GQC A;  3G7J A;  1YEX A;  3IE3 A;  4X0X A;  1DE1 A;  2H1B A;  1J9B A;  1I9D A;  2TRC P;  3IRA A;  4K2D A;  1XBS A;  1ILO A;  2GT6 A;  4NXI A;  1XFL A;  5DAL B;  3GTU B;  3J7Y k;  2O85 A;  1Z5Y E;  1TRW A;  4BIK A;  2LJR A;  1K0D A;  3ERW A;  4HU7 A;  3ERG A;  5CRW A;  2PN8 A;  1EZK A;  3H1N A;  3TJG A;  2FD3 A;  3F6D A;  3ISO A;  4BVX A;  1GNE A;  3BD2 A;  5DQY A;  4POL A;  4RQX A;  4MK3 A;  2DC5 A;  4KDX A;  4CY8 A;  4DSS B;  3KJY A;  5G2Z A;  1YQ1 A;  1S3D A;  4IVF A;  2C0E A;  4I2U A;  1WOU A;  3DD3 A;  3F63 A;  5J4U A;  2LNS A;  3GKM A;  3E9J B;  1GSY A;  2I4A A;  3HYP A;  4G19 A;  2O7K A;  4O32 A;  3QOU A;  1LU4 A;  3WD6 A;  1WMJ A;  3TJF A;  4LL4 B;  5GZZ B;  1M7T A;  3LG6 A;  2OA7 A;  3F8U A;  2C80 A;  3BJ5 A;  5HFI A;  2YCD A;  4V1A p;  4V2L A;  2PER A;  2JU5 A;  3LXT A;  1OKT A;  2RM5 A;  4HJ2 A;  2IFQ B;  2VO4 A;  4KW6 A;  3KGK A;  5IOX A;  3CSI A;  2QSI A;  3GNJ A;  1NM3 A;  3HZ8 A;  1B9Y C;  4K2X A;  1Q4J A;  4K1F A;  3PH9 A;  2E2M A;  1PFO A;  4ECB A;  2I81 A;  5H5Q A;  3WT1 A;  2LEG A;  1F2E A;  2RM6 A;  5KN3 A;  1XCC A;  3EE2 A;  4EXJ A;  1Z3E A;  1TW9 A;  4PTS A;  3ZIJ A;  1Y6E A;  3IV4 A;  1K0C A;  2X64 A;  2HRN A;  4FIW A;  1FAA A;  2GQK A;  4NHW A;  5KOW A;  4IQ1 A;  1EWX A;  2H72 A;  3KP8 A;  2JSZ A;  4WR5 A;  1M3J A;  4OFT A;  3OR5 A;  1FO5 A;  1E2Y A;  3ZFL A;  2ON5 A;  3RPP A;  1M3I A;  4FH8 A;  2GST A;  3L0H A;  3DRN A;  4GTU A;  3EPT A;  2P5R A;  1OC8 A;  4MAB A;  2C0G A;  2CZ2 A;  5KN0 A;  1OAZ A;  3WYW A;  2DJ0 A;  2OKA A;  2GT5 A;  1KTE A;  1O73 A;  3LW9 A;  3GV1 A;  4IP6 A;  3D22 A;  1ML6 A;  3QAG A;  1C72 A;  1RQM A;  3VWU A;  4NMU A;  1TRS A;  1ZOF A;  3GUS A;  1B8X A;  1AQX A;  4WET A;  3QD9 A;  1M2B A;  1FVJ A;  1DSB A;  2R6K A;  1JZO A;  2AYT A;  4EE0 A;  3M8N A;  3FR6 A;  5HFG A;  4ICY A;  2IMK A;  3QDN A;  1EEJ A;  4WKW A;  3ZYW A;  3GHA A;  2X99 A;  4KA0 A;  3L78 A;  1OVN A;  2B6M A;  2IMD A;  2H71 A;  3ZIT A;  3GX8 A;  1T1V A;  4OWY A;  4O5R A;  3CRT A;  4O92 A;  4OFM A;  4XS4 B;  3CTF A;  2RUF A;  3KZQ A;  3TOT A;  4QL7 A;  3RDW A;  3E3E A;  4IJ3 A;  3GRX A;  4CDO A;  1MDJ A;  1Y25 A;  1TDI A;  4XTS A;  4JZQ A;  1UVZ A;  3TKP A;  2YZU A;  5BRT A;  11GS A;  1BJX A;  4JU5 A;  2HLS A;  3LGC A;  4ISD A;  1SJZ A;  2F51 A;  2YWO A;  4JE1 A;  2WZ9 A;  3ZMK A;  13GS A;  2GLR A;  1Z9H A;  2XBQ A;  1WJK A;  1V98 A;  3FHK A;  2KP1 A;  1A8Y A;  1AQV A;  2REM A;  5IO0 A;  2H8L A;  5LCZ A;  4K5R A;  1GTU A;  4WF5 A;  3KMO A;  1GSD A;  5ECK B;  4BL7 B;  1N2A A;  3QMX A;  1V57 A;  1NHY A;  1Z6M A;  3GIX A;  5HR2 A;  1XWG A;  2HRA A;  4GRF A;  2N5F A;  1THX A;  2FY6 A;  2HRK A;  2IN3 A;  3TKR A;  1XVW A;  3UAR A;  1XOA A;  4TN8 A;  1THO A;  5DAK B;  3TGZ A;  2B7J A;  4HI7 A;  2CZ3 A;  3PR8 A;  2H0I A;  4BWS A;  2AAW A;  4MF5 A;  4ZL8 A;  1UC7 A;  2P0G A;  5B8B A;  4TKY A;  2CX4 A;  3G7Y A;  3GN3 A;  5LD0 A;  1F3B A;  1PL2 A;  4NV5 A;  3GX0 A;  1DE2 A;  3Q74 A;  4HUA A;  4KGI A;  3ZVJ D;  1K3L A;  5G1K A;  4IW9 A;  1AC1 A;  4BVY B;  3WT2 A;  2MYG A;  3IC4 A;  6GSU A;  3BCI A;  4EIP A;  1JZW A;  3HJM A;  2L6D A;  2WB9 A;  4PQ1 A;  2EC4 A;  2HYX A;  1EV4 A;  3TOU A;  5CAX A;  2H1D A;  3ME7 A;  1AUC A;  1PX6 A;  1X5C A;  1ERT A;  4JBB A;  3DVW A;  2WUL A;  1XOB A;  2GZY A;  4V1A g;  2HZE B;  3JCM L;  3DIE A;  4JR6 A;  1ERV A;  2VL2 A;  5B7C A;  1O8X A;  1SL2 B;  2OJL A;  1WRY A;  1ERW A;  3D4T A;  3IXR A;  3ZML A;  5HFK A;  3CSJ A;  4HU9 A;  4KDU A;  2NDO A;  4WEY A;  2A2P A;  22GS A;  1ABA A;  3KMN A;  4V2N A;  4Q5N A;  5DCH A;  5ECO B;  4HOJ A;  4EVM A;  1XIY A;  2K8V A;  2Z9S A;  4ACS A;  3F3R A;  5COH A;  1OYJ A;  4POM A;  3F4T A;  2XHF A;  1NSW A;  2LRT A;  2V6O A;  1TU7 A;  4IP1 A;  1YZX A;  2YZH A;  4YH2 A;  1A24 A;  1FB6 A;  2A2S A;  3UVT A;  2B1L A;  1TI3 A;  1SD8 A;  3VFI A;  4N0Z A;  4MJB A;  2H19 A;  4MF6 A;  1B4Q A;  1K3O A;  4HSC X;  2L4C A;  1G0T A;  4K7I A;  3UBK A;  4NPB A;  1VRS D;  3QAW A;  4K0G A;  1FW1 A;  1SKR B;  1M2A A;  4PUF C;  4IN0 A;  2YV9 A;  1K0M A;  1MDI A;  5ECN B;  1BX9 A;  5IMC A;  4ZB9 A;  3O76 A;  3RAZ A;  1HQO A;  3SWL A;  4KDY A;  1X9W B;  4ZL9 A;  2LJK A;  1JHB A;  3GKK A;  1J0F A;  3QCP A;  1I5G A;  1SL1 B;  1GSQ A;  2X4A A;  2B3S A;  1Q98 A;  2RUE A;  9GSS A;  4HS1 A;  5BMU A;  2AUV A;  2VCX A;  4G2E A;  1EP7 A;  2VM1 A;  2H73 A;  1GSE A;  3EU4 A;  4PUR A;  4MCU A;  3D4M A;  1UA5 A;  1IYH A;  1XWB A;  4N10 A;  4PGT A;  5DDL A;  4BPY A;  3QPM A;  5D9W A;  2OBK A;  5JWQ B;  8GSS A;  4ML1 A;  5F8B A;  2IMI A;  3GUR A;  2LUS A;  2LTK A;  4YKF A;  1ZL9 A;  3F3Q A;  1R26 A;  4LL1 B;  1WPI A;  2MBS A;  3F6F A;  1S3A A;  1B4P A;  2FCH A;  1X9S B;  3UMA A;  1OC3 A;  4FYU A;  3ZFB A;  3G7I A;  1FOV A;  2M72 A;  3KP9 A;  4GSN A;  1QQ2 A;  1J08 A;  3DGQ A;  2IPA A;  5JWR B;  3MNG A;  1ON4 A;  2O89 A;  1K0A A;  3H93 A;  2OE0 A;  4HQS A;  3ZRD A;  4E8H A;  2N5A A;  4IS0 A;  3APQ A;  1OE7 A;  2DML A;  3VWX A;  5GSS A;  5B8A A;  3DYR A;  2VCW A;  3DVX A;  5IMZ A;  1GUM A;  1GTI A;  5F06 A;  1SK2 A;  5ECS A;  3HJO A;  5ECH B;  4MA9 A;  4JRR A;  4TR1 A;  4F9Z A;  1H4O A;  3P8W A;  1EV9 A;  5CNW A;  4MNN A;  4TXV A;  1HD2 A;  5ECL B;  3HDC A;  1IYI A;  4MJE A;  1MD4 A;  3IDV A;  3U5R E;  3TRQ A;  2CVK A;  5D9X A;  1GUL A;  1F37 A;  1WWJ A;  3FKF A;  2HSH A;  3KTL A;  5EL8 A;  5C00 A;  4MZC A;  3UL3 A;  3EU3 A;  1GLP A;  4YQV A;  1T4Z A;  2ES7 A;  5B6M A;  4LMV A;  14GS A;  2AJQ B;  1X5E A;  2IWT A;  4K7O A;  5J3R A;  4KE3 A;  4OO5 A;  4PQH A;  3DML A;  4TXO A;  3L4N A;  2K18 A;  2VOC A;  3GL3 A;  3US3 A;  5J9B A;  1QXH A;  2FA4 A;  3ZZX A;  2XPE A;  4L5L A;  2B5E A;  3TJB A;  2MZC A;  4KCE A;  2YWM A;  2MMA A;  1B48 A;  4KB3 A;  1DBY A;  1PX7 A;  3BCK A;  5IO2 A;  3GL5 A;  2V41 A;  2KP2 A;  1RK4 A;  1EP8 A;  2ZNM A;  1G6Y A;  1ZMA A;  1GSF A;  1SEN A;  3VWW A;  1V9W A;  1R4W A;  2FUG 2;  3ZVJ A;  1ZGN A;  4ZB8 A;  2DJJ A;  2GQM A;  4YKG A;  5G5F A;  2H66 A;  4GXZ A;  4RI7 A;  4QQ7 A;  4N11 A;  2GSS A;  5JCU A;  1XZO A;  2O87 A;  5KN2 A;  2FWF A;  2K6V A;  4XRA A;  5IMA A;  4IGJ A;  2CX3 A;  1XXU A;  2E0Q A;  1Z6N A;  4AF2 A;  4D73 B;  4AGS A;  2V6K A;  2B1K A;  4RUV A;  4WBJ A;  4RI6 A;  2WS2 A;  2F3M A;  3UBL A;  3M3M A;  2BTO T;  4XS1 A;  2R4V A;  4NWY A;  1GUK A;  5A4U A;  1O8W A;  1S3R A;  2FA8 A;  1ZYN A;  3TJJ A;  4Q5F A;  5F0G A;  3L9S A;  5D9T A;  1V2A A;  4I97 A;  1TK5 B;  2EIO A;  2QGV A;  1BAY A;  4EF0 A;  4JR4 A;  3TRX A;  1SJI A;  5ECM B;  5ECP B;  2QC7 A;  1XW6 A;  3TKS C;  3EUR A;  4ULX A;  3D6I A;  1T3B A;  3J7Y b;  2ON7 A;  5G1L A;  3TJK A;  4Q5R A;  1SD9 A;  3W8S A;  1O81 A;  5ID2 B;  1GSU A;  5F07 A;  3IR4 A;  3P2A A;  3VPT A;  5CP1 A;  2LJA A;  2A4V A;  4TVE A;  5E59 A;  2D2Z A;  1PKZ A;  2E2G A;  2PGT A;  2R5G A;  2A2R A;  4ID0 A;  5D8I A;  5DAL A;  3GTU A;  2DKH A;  4G0L A;  1OC9 B;  4ML6 A;  4HJM A;  2R0G A;  1WIK A;  4GSS A;  2J9H A;  3KH9 A;  1TJD A;  2CAI A;  4ZIL A;  1X9M B;  3CMI A;  3VI5 A;  5JWO B;  5H5R A;  2TRX A;  5IQY A;  4DSS A;  1QMV A;  4IEL A;  2C3N A;  5J41 A;  3A5I A;  1YEP A;  1TK0 B;  1GL8 A;  4I6X A;  3M9K A;  4XHM A;  4GCI A;  3NIV A;  3RPN A;  2OAC A;  4Z2R A;  3GH9 A;  3GKN A;  19GS A;  5IPG A;  2FHE A;  1TXX A;  5IM9 A;  2V1M A;  3P90 A;  3MAK A;  2L57 A;  1O6J A;  3QR6 A;  4L5O A;  2L5O A;  4LA1 A;  4FQU A;  1BED A;  4Z2T A;  1SKW B;  5GAP D;  3KD0 A;  3QFA C;  2VL9 A;  3LSZ A;  1KNG A;  3HA9 A;  2IFQ A;  4YQM A;  4YAP A;  3DKS A;  1ACV A;  4ECI A;  5EPF A;  2EIQ A;  1T00 A;  1V40 A;  1YKA A;  3C1R A;  1EEM A;  3A2W A;  2PPT A;  2HSM A;  3R3E A;  1SJ6 A;  1TRU A;  2H76 A;  5HR1 A;  20GS A;  1V58 A;  3KTB A;  4Q5Q A;  4K6X A;  2H75 A;  2B5X A;  3TKQ A;  5KEJ A;  2DJ1 A;  2C3Q A;  2NPB A;  1M2D A;  5CRH A;  5AIS A;  1MEK A;  3F4S A;  2KUC A;  2LS5 A;  5DVB A;  1ZYP A;  2CV4 A;  3DXB A;  4J56 E;  5FHI A;  3MSZ A;  1QK8 A;  3C71 A;  2I3Y A;  4MH3 A;  16GS A;  3WGD A;  5DQS A;  3IHG A;  2YNX A;  2JZR A;  1XWK A;  2XC2 A;  5IIZ A;  4DSR A;  4G0K A;  2PMT A;  4O5Q A;  2L59 A;  4POK A;  1PL1 A;  2FNO A;  1OE8 A;  4HEA 2;  1PQN A;  2MMO A;  1M99 A;  1F3A A;  4PX1 A;  4PXO A;  1TOF A;  2WDU A;  3HXS A;  2IIY A;  1ERU A;  1PD2 1;  4FO5 A;  4BWQ A;  5B6N A;  3UEM A;  2H0G A;  4O7H A;  1AIU A;  2YPM A;  3VWV A;  4GQF A;  1YF1 A;  2VUP A;  2H1A A;  2NBS A;  2RLI A;  2L5L A;  2VCV A;  3D21 A;  4BVX B;  2HNL A;  3F0I A;  3UAP A;  5JCG A;  1CQG A;  2CVD A;  5ELA A;  2YJH A;  3I69 A;  5KN1 A;  6GST A;  2L6C A;  1KEB A;  4K7N A;  1W4V A;  3F4R A;  5ABR A;  1FOH A;  1GH2 A;  3EC3 A;  1G7O A;  3HD5 A;  2VD1 A;  4OFN A;  3WGX A;  3EMX A;  3WGE A;  2H01 A;  2YP6 A;  1PSQ A;  4XS4 A;  3N9J A;  4KSO A;  3E0U A;  5D93 A;  4KND A;  3HKR A;  1OC9 A;  2PBJ A;  3ME8 A;  2DIZ A;  2C8U A;  2VCQ A;  2VM2 A;  3O3T A;  2PWJ A;  1DUG A;  3IOS A;  1G6W A;  1BYE A;  4MF7 A;  1EGR A;  2I9H A;  2PU9 C;  1SKS B;  3ZLP A;  2QA1 A;  1ZYE A;  3EVI A;  3Q6O A;  4HZ4 A;  2HE3 A;  2KLX A;  4L8E A;  3IHQ A;  5DJM A;  4BA7 A;  3LWA A;  2LNT A;  2WRT A;  1XPV A;  1GRX A;  3BOA A;  3A3T A;  4WXT A;  4FYC A;  1ZCP A;  3KEB A;  2VLT A;  2IL3 A;  1PA3 A;  1N8J A;  2X8C A;  3K8N A;  2X8H A;  5F05 A;  1SK0 A;  4MLY A;  2C4J A;  4H86 A;  3TCO A;  1U87 A;  2FGX A;  4DSQ A;  3LQ7 A;  2WGR A;  2OBI A;  1A8L A;  4NAX A;  4V2M A;  1VF4 A;  3VK9 A;  3VI7 A;  4BL7 A;  5G31 A;  3C1S A;  1SU9 A;  2LQQ A;  1GP1 A;  1S3C A;  3TDG A;  2XPD A;  3GMF A;  4MDC A;  3UOM A;  3MIX A;  4ZB6 A;  2G2Q A;  3S9F A;  1VF3 A;  5CRE A;  2H70 A;  5DAK A;  17GS A;  1QFN A;  3LYP A;  1M9A A;  3UJ1 A;  1EGO A;  4WF4 A;  3HVV A;  3M9J A;  1KBN A;  2HI7 A;  3FZA A;  2RII A;  5D73 A;  1XWC A;  1TK8 B;  1GSS A;  1O7U A;  2WJU A;  2OAD A;  4K9Z A;  2MMZ A;  3LYK A;  4E8E A;  3HVS A;  1F9M A;  4G10 A;  5ECI B;  4KSM A;  1BG5 A;  3IK7 A;  2X8G A;  3W6G A;  2GSR A;  4HDE A;  1WE0 A;  2YAN A;  4ZBA A;  4BVY A;  4KH7 A;  4QL9 A;  1PRX A;  2CQ9 A;  5FWG A;  1HNC A;  3EIN A;  5J5N A;  5ECQ B;  2JAC A;  2LRC A;  3RBT A;  4DEJ A;  4KUN A;  3CQF A;  3VUR A;  2DJ3 A;  2FWG A;  2F9S A;  1HNB A;  2OE3 A;  3Q18 A;  4I5Q A;  4PQI A;  2OE1 A;  1SK1 A;  3APS A;  4EL1 A;  2JSY A;  3A2V A;  5FT3 A;  3PIN A;  4P3Y B;  2DMM A;  4O5U A;  1SYR A;  2HZE A;  3LXZ A;  2R0P A;  3ERF A;  1M9B A;  5KOX A;  1VGL A;  1YJ6 A;  2XBI A;  1A2M A;  5IPH A;  1PGT A;  5ENU A;  1A2L A;  4WBR D;  2GQL A;  1JLV A;  1EOG A;  1TRV A;  3I6A A;  1AW9 A;  4IBP A;  3GST A;  5CYY A;  5G5E A;  2J23 A;  4CY6 A;  3FRC A;  3FZ4 A;  5CRG A;  3TB2 A;  4EDZ A;  4MH2 A;  2VL2 C;  3VPQ A;  3M0F A;  4WR4 A;  2H1G A;  4CW9 A;  3C8E A;  4PNF A;  1FHE A;  5D96 A;  1PN9 A;  4KX4 A;  1USB A;  1URM A;  2DJK A;  2LRN A;  3A2X A;  2H6Z A;  2ALB A;  2PUK C;  2P31 A;  5INY A;  2R37 A;  1R5P A;  3H4K A;  3FR9 A;  2TIR A;  3FZ9 A;  3TKS E;  5IMV A;  1LJR A;  4X43 A;  2C0F A;  5HR3 A;  4GWR A;  5H5S A;  2HXK A;  1OKD A;  2GDR A;  6GSY A;  4POB A;  3H8Q A;  3HJP A;  1TP9 A;  2VAF A;  4K5S A;  4EC0 A;  1EOH A;  4N30 A;  1XW5 A;  2G0F A;  2QKE A;  3D0Z A;  3PGT A;  1GWC A;  2H0H A;  1VF2 A;  6GSS A;  3KH7 A;  1UN2 A;  3FYG A;  1MTC A;  1JFU A;  3W8J A;  4MZB A;  3D5J A;  3F9U A;  4XRD A;  3HZ4 A;  1T8E B;  4PNG A;  2M80 A;  3L9V A;  3L9U A;  3IPZ A;  1ST9 A;  2HZF A;  2FLS A;  4K0N A;  1K3Y A;  4N0V A;  2NTO A;  2YN1 A;  2ZUP A;  2DLX A;  3CYN A;  1TU8 A;  4USS A;  2C0D A;  5D9V A;  2IMF A;  2VL3 A;  1QGV A;  2ZCT A;  3H79 A;  3QFB C;  3GKX A;  4DVC A;  1Z7R A;  1X5D A;  2P5Q A;  2F8F A;  2VLV A;  2DKI A;  2IJY A;  2C3T A;  5ELG A;  4K8M A;  2WCI A;  3MYD A;  3FZ5 A;  5AGY A;  1XG8 A;  1T4Y A;  2VD0 A;  5DCG A;  1RW1 A;  2HSY A;  4ILF A;  1HNA A;  3G9B A;  2YOI A;  3C7M A;  1U3A A;  5A4V A;  1A0R P;  1F6M C;  2FWE A;  4AJ6 A;  2K9F A;  2I1U A;  5EVO A;  3IBH A;  2BMX A;  3A5W A;  4L0W A;  3ED3 A;  2DSA A;  5AIV A;  4XCS A;  5ECR B;  3CXG A;  5DBQ A;  4F0B A;  3FR3 A;  6GSX A;  3CSH A;  2H30 A;  4X4J A;  4RQR A;  2DIY A;  3ZRE A;  1WP0 A;  4I2T A;  2JZS A;  3NOF A;  5A5K A;  4Z7X A;  2H6X A;  1TTZ A;  4LMW A;  3LFL A;  4J57 E;  3RHC A;  4GLT A;  2E7P A;  2UZ8 A;  4OO4 A;  4KAE A;  5GST A;  2AV4 A;  1U88 A;  5IMF A;  4I8B A;  3PPU A;  2GSQ A;  4GST A;  4MJC A;  4G0I A;  4TR0 A;  2F8A A;  1ZZY A;  3ZL5 A;  4F2I A;  3R2Q A;  4AJ8 A;  3HHV A;  5A4W A;  3BBY A;  1E6B A;  1TI1 A;  2GGT A;  3SBC A;  2JL4 A;  1YF0 A;  3P7X A;  4TW5 A;  5C04 A;  3MDK A;  2LQO A;  1MDK A;  3GFK A;  1FB0 A;  1TKD B;  2KOK A;  3HCZ A;  4G9H A;  3FMW A;  18GS A;  2VLU A;  3CBU A;  3GH6 A;  4AJ7 A;  1NW2 A;  3NZN A;  4MP4 A;  3APO A;  5CO3 A;  3CRU A;  3KIJ A;  2VIM A;  2BJX A;  4CHS A;  2GVP A;  2H74 A;  2GTU A;  4EUY A;  1JLW A;  1GLQ A;  3FK8 A;  2HT9 A;  4ZXG A;  2LV3 A;  1PKW A;  1X0R A;  2R2J A;  1HYU A;  3IK9 A;  2VCT A;  3UIW A;  4D73 A;  1FG4 A;  4KF9 A;  4IKH A;  2CAQ A;  3UVH A;  1G7E A;  1XVQ A;  3RHB A;  5LNK e;  4MPG A;  2JZT A;  4MZW A;  5EY6 A;  4TR1 B;  5AN1 A;  1U3I A;  2CVB A;  2HRF A;  4NHZ A;  1QUW A;  2K8S A;  4OMV A;  4ECJ A;  3IC8 A;  3IAS 2;  3C73 A;  4FYB A;  2C1Y A;  4OCF A;  3TUE A;  3O6T A;  2N5B A;  2GZP A;  5DJL A;  2X49 A;  1JZR A;  6GSV A;  1LBK A;  4ZBD A;  2B5Y A;  4IQA A;  4PUA A;  3CTG A;  3QAV A;  1R7H A;  1W89 A;  2HFD A;  1K0N A;  4GF0 A;  1VF1 A;  12GS A;  2MMN A;  5L71 A;  2AHE A;  3LJR A;  5ID2 A;  2JAD A;  3ZIV A;  2WFC A;  4Z2U A;  5CRD A;  1GTA A;  1K0B A;  3M1G A;  2DJ2 A;  2YWN A;  3IA1 A;  4YAV A;  4X1U A;  4EIQ A;  1U6T A;  4EKZ A;  2V32 A;  5GAN D;  4F0C A;  3N5O A;  4L0U A;  4MPF A;  1MD3 A;  5IOW A;  3FEU A;  5JCW A;  4OD7 A;  2YWI A;  2L4Q A;  4TRX A;  1XWA A;  4XS6 A;  2GZZ A;  4TXO B;  6GSW A;  1A23 A;  1YKC A;  1B9X C;  1CQH A;  2CA8 A;  5IMD A;  4F82 A;  3LEF A;  1A2J A;  4J2F A;  3MWH A;  2A4H A;  3LOR A;  2KHP A;  2LST A;  3GYK A;  3EMP A;  2YV7 A;  1YDK A;  1AQW A;  2VCZ A;  3KM6 A;  2QA2 A;  4ECC A;  4OCE A;  4KCA A;  1GUH A;  1AXD A;  3AY8 A;  1GTB A;  1NHO A;  2EIR A;  4MMM A;  5J9C A;  1K0O A;  4HQZ A;  3U6V A;  4ZBB A;  4TR4 A;  3FY7 A;  4EDY A;  2AB6 A;  3I43 A;  2M46 A;  1SL0 B;  2YJ7 A;  1T7P B;  5G30 A;  1YY7 A;  3HY2 A;  4F03 A;  2MBT A;  4LLR A;  4XIH A;  1AAZ A;  10GS A;  7GSS A;  1JZD A;  2DBC A;  2LKU A;  4IHU A;  1BQ7 A;  3HVN A;  3ZTL A;  1PN0 A;  1SYX A;  1R5A A;  2V2G A;  4YQU A;  5E4W A;  2CT6 A;  5HQP A;  3TRP A;  2IME A;  2GS3 A;  3KXO A;  4HZ2 A;  3Q19 A; 
#chains in the Genus database with same CATH homology
 3EWL A;  1XW9 A;  3TKS A;  2R0C A;  1O85 A;  3EYT A;  1FVK A;  3KCM A;  4IJI A;  4A5P A;  4JED A;  1Z7P A;  2PVO C;  3VLN A;  2R3X A;  3FW2 A;  5HR0 A;  3DEX A;  3GA4 A;  1H75 A;  2O8V B;  1GNW A;  1A0F A;  3V1W A;  3HVX A;  2FWH A;  4MJA A;  4EO3 A;  2B7K A;  1M0U A;  2PVQ A;  4TOP A;  2NVL A;  3I9V 2;  3GSS A;  4NV2 A;  1ZYQ B;  3DWV A;  4ZIJ A;  1PMT A;  4ZL7 A;  4TR3 A;  3IAM 2;  5AIX A;  2H6Y A;  4GQC A;  3G7J A;  1YEX A;  3IE3 A;  4X0X A;  1DE1 A;  2H1B A;  1J9B A;  1I9D A;  2TRC P;  3IRA A;  4K2D A;  1XBS A;  1ILO A;  2GT6 A;  4NXI A;  1XFL A;  5DAL B;  3GTU B;  3J7Y k;  2O85 A;  1Z5Y E;  1TRW A;  2LJR A;  1K0D A;  3ERW A;  4HU7 A;  3ERG A;  5CRW A;  2PN8 A;  1EZK A;  3H1N A;  3TJG A;  2FD3 A;  3F6D A;  3ISO A;  4BVX A;  1GNE A;  3BD2 A;  5DQY A;  4POL A;  4RQX A;  4MK3 A;  2DC5 A;  4KDX A;  4CY8 A;  4DSS B;  3KJY A;  5G2Z A;  1YQ1 A;  1S3D A;  4IVF A;  2C0E A;  4I2U A;  1WOU A;  3DD3 A;  3F63 A;  5J4U A;  2LNS A;  3GKM A;  3E9J B;  1GSY A;  2I4A A;  3HYP A;  4G19 A;  2O7K A;  4O32 A;  3QOU A;  1LU4 A;  3WD6 A;  1WMJ A;  3TJF A;  4LL4 B;  5GZZ B;  1M7T A;  3LG6 A;  2OA7 A;  3F8U A;  2C80 A;  3BJ5 A;  5HFI A;  2YCD A;  4V1A p;  4V2L A;  2PER A;  2JU5 A;  3LXT A;  1OKT A;  2RM5 A;  4HJ2 A;  2IFQ B;  2VO4 A;  4KW6 A;  3KGK A;  5IOX A;  3CSI A;  2QSI A;  3GNJ A;  1NM3 A;  3HZ8 A;  1B9Y C;  4K2X A;  1Q4J A;  4K1F A;  3PH9 A;  2E2M A;  4ECB A;  2I81 A;  5H5Q A;  3WT1 A;  2LEG A;  1F2E A;  2RM6 A;  5KN3 A;  1XCC A;  3EE2 A;  4EXJ A;  1Z3E A;  1TW9 A;  4PTS A;  3ZIJ A;  1Y6E A;  3IV4 A;  1K0C A;  2X64 A;  2HRN A;  4FIW A;  1FAA A;  2GQK A;  4NHW A;  5KOW A;  4IQ1 A;  1EWX A;  2H72 A;  3KP8 A;  2JSZ A;  4WR5 A;  4OFT A;  3OR5 A;  1FO5 A;  1E2Y A;  3ZFL A;  2ON5 A;  3RPP A;  4FH8 A;  2GST A;  3L0H A;  3DRN A;  4GTU A;  3EPT A;  2P5R A;  1OC8 A;  4MAB A;  2C0G A;  2CZ2 A;  5KN0 A;  1OAZ A;  3WYW A;  2DJ0 A;  2OKA A;  2GT5 A;  1KTE A;  1O73 A;  3LW9 A;  3GV1 A;  4IP6 A;  3D22 A;  1ML6 A;  3QAG A;  1C72 A;  1RQM A;  3VWU A;  4NMU A;  1TRS A;  1ZOF A;  3GUS A;  1B8X A;  1AQX A;  4WET A;  3QD9 A;  1M2B A;  1FVJ A;  1DSB A;  2R6K A;  1JZO A;  2AYT A;  4EE0 A;  3M8N A;  3FR6 A;  5HFG A;  4ICY A;  2IMK A;  3QDN A;  1EEJ A;  4WKW A;  3ZYW A;  3GHA A;  2X99 A;  4KA0 A;  3L78 A;  1OVN A;  2B6M A;  2IMD A;  2H71 A;  3ZIT A;  3GX8 A;  1T1V A;  4OWY A;  4O5R A;  3CRT A;  4O92 A;  4OFM A;  4XS4 B;  3CTF A;  2RUF A;  3KZQ A;  3TOT A;  4QL7 A;  3RDW A;  3E3E A;  4IJ3 A;  3GRX A;  4CDO A;  1MDJ A;  1Y25 A;  1TDI A;  4XTS A;  4JZQ A;  1UVZ A;  3TKP A;  2YZU A;  5BRT A;  11GS A;  1BJX A;  4JU5 A;  2HLS A;  3LGC A;  4ISD A;  1SJZ A;  2F51 A;  2YWO A;  4JE1 A;  2WZ9 A;  3ZMK A;  13GS A;  2GLR A;  1Z9H A;  2XBQ A;  1WJK A;  1V98 A;  3FHK A;  2KP1 A;  1A8Y A;  1AQV A;  2REM A;  5IO0 A;  2H8L A;  5LCZ A;  4K5R A;  1GTU A;  4WF5 A;  3KMO A;  1GSD A;  5ECK B;  4BL7 B;  1N2A A;  3QMX A;  1V57 A;  1NHY A;  1Z6M A;  3GIX A;  5HR2 A;  1XWG A;  2HRA A;  4GRF A;  2N5F A;  1THX A;  2FY6 A;  2HRK A;  2IN3 A;  3TKR A;  1XVW A;  3UAR A;  1XOA A;  4TN8 A;  1THO A;  5DAK B;  3TGZ A;  2B7J A;  4HI7 A;  2CZ3 A;  3PR8 A;  2H0I A;  4BWS A;  2AAW A;  4MF5 A;  4ZL8 A;  1UC7 A;  2P0G A;  5B8B A;  4TKY A;  2CX4 A;  3G7Y A;  3GN3 A;  5LD0 A;  1F3B A;  1PL2 A;  4NV5 A;  3GX0 A;  1DE2 A;  3Q74 A;  4HUA A;  4KGI A;  3ZVJ D;  1K3L A;  5G1K A;  4IW9 A;  1AC1 A;  4BVY B;  3WT2 A;  2MYG A;  3IC4 A;  6GSU A;  3BCI A;  4EIP A;  1JZW A;  3HJM A;  2L6D A;  2WB9 A;  4PQ1 A;  2EC4 A;  2HYX A;  1EV4 A;  3TOU A;  5CAX A;  2H1D A;  3ME7 A;  1AUC A;  1PX6 A;  1X5C A;  1ERT A;  4JBB A;  3DVW A;  2WUL A;  1XOB A;  2GZY A;  4V1A g;  2HZE B;  3JCM L;  3DIE A;  4JR6 A;  1ERV A;  2VL2 A;  5B7C A;  1O8X A;  1SL2 B;  2OJL A;  1WRY A;  1ERW A;  3D4T A;  3IXR A;  3ZML A;  5HFK A;  3CSJ A;  4HU9 A;  4KDU A;  2NDO A;  4WEY A;  2A2P A;  22GS A;  1ABA A;  3KMN A;  4V2N A;  4Q5N A;  5DCH A;  5ECO B;  4HOJ A;  4EVM A;  1XIY A;  2K8V A;  2Z9S A;  4ACS A;  3F3R A;  5COH A;  1OYJ A;  4POM A;  3F4T A;  2XHF A;  1NSW A;  2LRT A;  2V6O A;  1TU7 A;  4IP1 A;  1YZX A;  2YZH A;  4YH2 A;  1A24 A;  1FB6 A;  2A2S A;  3UVT A;  2B1L A;  1TI3 A;  1SD8 A;  3VFI A;  4N0Z A;  4MJB A;  2H19 A;  4MF6 A;  1B4Q A;  1K3O A;  2L4C A;  1G0T A;  4K7I A;  3UBK A;  4NPB A;  1VRS D;  3QAW A;  4K0G A;  1FW1 A;  1SKR B;  1M2A A;  4PUF C;  4IN0 A;  2YV9 A;  1K0M A;  1MDI A;  5ECN B;  1BX9 A;  5IMC A;  4ZB9 A;  3O76 A;  3RAZ A;  1HQO A;  3SWL A;  4KDY A;  1X9W B;  4ZL9 A;  2LJK A;  1JHB A;  3GKK A;  1J0F A;  3QCP A;  1I5G A;  1SL1 B;  1GSQ A;  2X4A A;  2B3S A;  1Q98 A;  2RUE A;  9GSS A;  4HS1 A;  5BMU A;  2AUV A;  2VCX A;  4G2E A;  1EP7 A;  2VM1 A;  2H73 A;  1GSE A;  3EU4 A;  4PUR A;  4MCU A;  3D4M A;  1UA5 A;  1IYH A;  1XWB A;  4N10 A;  4PGT A;  5DDL A;  4BPY A;  3QPM A;  5D9W A;  2OBK A;  5JWQ B;  8GSS A;  4ML1 A;  5F8B A;  2IMI A;  3GUR A;  2LUS A;  2LTK A;  4YKF A;  1ZL9 A;  3F3Q A;  1R26 A;  4LL1 B;  1WPI A;  2MBS A;  3F6F A;  1S3A A;  1B4P A;  2FCH A;  1X9S B;  3UMA A;  1OC3 A;  4FYU A;  3ZFB A;  3G7I A;  1FOV A;  2M72 A;  3KP9 A;  4GSN A;  1QQ2 A;  1J08 A;  3DGQ A;  2IPA A;  5JWR B;  3MNG A;  1ON4 A;  2O89 A;  1K0A A;  3H93 A;  2OE0 A;  4HQS A;  3ZRD A;  4E8H A;  2N5A A;  4IS0 A;  3APQ A;  1OE7 A;  2DML A;  3VWX A;  5GSS A;  5B8A A;  3DYR A;  2VCW A;  3DVX A;  5IMZ A;  1GUM A;  1GTI A;  5F06 A;  1SK2 A;  5ECS A;  3HJO A;  5ECH B;  4MA9 A;  4JRR A;  4TR1 A;  4F9Z A;  1H4O A;  3P8W A;  1EV9 A;  5CNW A;  4MNN A;  4TXV A;  1HD2 A;  5ECL B;  3HDC A;  1IYI A;  4MJE A;  1MD4 A;  3IDV A;  3U5R E;  3TRQ A;  2CVK A;  5D9X A;  1GUL A;  1F37 A;  1WWJ A;  3FKF A;  2HSH A;  3KTL A;  5EL8 A;  5C00 A;  4MZC A;  3UL3 A;  3EU3 A;  1GLP A;  4YQV A;  1T4Z A;  2ES7 A;  5B6M A;  4LMV A;  14GS A;  2AJQ B;  1X5E A;  2IWT A;  4K7O A;  5J3R A;  4KE3 A;  4OO5 A;  4PQH A;  3DML A;  4TXO A;  3L4N A;  2K18 A;  2VOC A;  3GL3 A;  3US3 A;  5J9B A;  1QXH A;  2FA4 A;  3ZZX A;  2XPE A;  4L5L A;  2B5E A;  3TJB A;  2MZC A;  4KCE A;  2YWM A;  2MMA A;  1B48 A;  4KB3 A;  1DBY A;  1PX7 A;  3BCK A;  5IO2 A;  3GL5 A;  2V41 A;  2KP2 A;  1RK4 A;  1EP8 A;  2ZNM A;  1G6Y A;  1ZMA A;  1GSF A;  1SEN A;  3VWW A;  1V9W A;  1R4W A;  2FUG 2;  3ZVJ A;  1ZGN A;  4ZB8 A;  2DJJ A;  2GQM A;  4YKG A;  5G5F A;  2H66 A;  4GXZ A;  4RI7 A;  4QQ7 A;  4N11 A;  2GSS A;  5JCU A;  1XZO A;  2O87 A;  5KN2 A;  2FWF A;  2K6V A;  4XRA A;  5IMA A;  4IGJ A;  2CX3 A;  1XXU A;  2E0Q A;  1Z6N A;  4AF2 A;  4D73 B;  4AGS A;  2V6K A;  2B1K A;  4RUV A;  4WBJ A;  4RI6 A;  2WS2 A;  2F3M A;  3UBL A;  3M3M A;  2BTO T;  4XS1 A;  2R4V A;  4NWY A;  1GUK A;  5A4U A;  1O8W A;  2FA8 A;  1ZYN A;  3TJJ A;  4Q5F A;  5F0G A;  3L9S A;  5D9T A;  1V2A A;  4I97 A;  1TK5 B;  2EIO A;  2QGV A;  1BAY A;  4EF0 A;  4JR4 A;  3TRX A;  1SJI A;  5ECM B;  5ECP B;  2QC7 A;  1XW6 A;  3TKS C;  3EUR A;  4ULX A;  3D6I A;  1T3B A;  3J7Y b;  2ON7 A;  5G1L A;  3TJK A;  4Q5R A;  1SD9 A;  3W8S A;  1O81 A;  5ID2 B;  1GSU A;  5F07 A;  3IR4 A;  3P2A A;  3VPT A;  5CP1 A;  2LJA A;  2A4V A;  4TVE A;  5E59 A;  2D2Z A;  1PKZ A;  2E2G A;  2PGT A;  2R5G A;  2A2R A;  4ID0 A;  5D8I A;  5DAL A;  3GTU A;  2DKH A;  4G0L A;  1OC9 B;  4ML6 A;  4HJM A;  2R0G A;  1WIK A;  4GSS A;  2J9H A;  3KH9 A;  1TJD A;  2CAI A;  4ZIL A;  1X9M B;  3CMI A;  3VI5 A;  5JWO B;  5H5R A;  2TRX A;  5IQY A;  4DSS A;  1QMV A;  4IEL A;  2C3N A;  5J41 A;  3A5I A;  1YEP A;  1TK0 B;  1GL8 A;  4I6X A;  3M9K A;  4XHM A;  4GCI A;  3NIV A;  3RPN A;  2OAC A;  4Z2R A;  3GH9 A;  3GKN A;  19GS A;  5IPG A;  2FHE A;  1TXX A;  5IM9 A;  2V1M A;  3P90 A;  3MAK A;  2L57 A;  1O6J A;  3QR6 A;  4L5O A;  2L5O A;  4LA1 A;  4FQU A;  1BED A;  4Z2T A;  1SKW B;  5GAP D;  3KD0 A;  3QFA C;  2VL9 A;  3LSZ A;  1KNG A;  3HA9 A;  2IFQ A;  4YQM A;  4YAP A;  3DKS A;  1ACV A;  4ECI A;  5EPF A;  2EIQ A;  1T00 A;  1V40 A;  1YKA A;  3C1R A;  1EEM A;  3A2W A;  2PPT A;  2HSM A;  3R3E A;  1SJ6 A;  1TRU A;  2H76 A;  5HR1 A;  20GS A;  1V58 A;  3KTB A;  4Q5Q A;  4K6X A;  2H75 A;  2B5X A;  3TKQ A;  5KEJ A;  2DJ1 A;  2C3Q A;  2NPB A;  1M2D A;  5CRH A;  5AIS A;  1MEK A;  3F4S A;  2KUC A;  2LS5 A;  5DVB A;  1ZYP A;  2CV4 A;  3DXB A;  4J56 E;  5FHI A;  3MSZ A;  1QK8 A;  3C71 A;  2I3Y A;  4MH3 A;  16GS A;  3WGD A;  5DQS A;  3IHG A;  2YNX A;  2JZR A;  1XWK A;  2XC2 A;  5IIZ A;  4DSR A;  4G0K A;  2PMT A;  4O5Q A;  2L59 A;  4POK A;  1PL1 A;  2FNO A;  1OE8 A;  4HEA 2;  1PQN A;  2MMO A;  1M99 A;  1F3A A;  4PX1 A;  4PXO A;  1TOF A;  2WDU A;  3HXS A;  2IIY A;  1ERU A;  1PD2 1;  4FO5 A;  4BWQ A;  5B6N A;  3UEM A;  2H0G A;  4O7H A;  1AIU A;  2YPM A;  3VWV A;  4GQF A;  1YF1 A;  2VUP A;  2H1A A;  2NBS A;  2RLI A;  2L5L A;  2VCV A;  3D21 A;  4BVX B;  2HNL A;  3F0I A;  3UAP A;  5JCG A;  1CQG A;  2CVD A;  5ELA A;  2YJH A;  3I69 A;  5KN1 A;  6GST A;  2L6C A;  1KEB A;  4K7N A;  1W4V A;  3F4R A;  5ABR A;  1FOH A;  1GH2 A;  3EC3 A;  1G7O A;  3HD5 A;  2VD1 A;  4OFN A;  3WGX A;  3EMX A;  3WGE A;  2H01 A;  2YP6 A;  1PSQ A;  4XS4 A;  3N9J A;  4KSO A;  3E0U A;  5D93 A;  4KND A;  3HKR A;  1OC9 A;  2PBJ A;  3ME8 A;  2DIZ A;  2C8U A;  2VCQ A;  2VM2 A;  3O3T A;  2PWJ A;  1DUG A;  3IOS A;  1G6W A;  1BYE A;  4MF7 A;  1EGR A;  2I9H A;  2PU9 C;  1SKS B;  3ZLP A;  2QA1 A;  1ZYE A;  3EVI A;  3Q6O A;  4HZ4 A;  2HE3 A;  2KLX A;  4L8E A;  3IHQ A;  5DJM A;  4BA7 A;  3LWA A;  2LNT A;  2WRT A;  1XPV A;  1GRX A;  3BOA A;  3A3T A;  4WXT A;  4FYC A;  1ZCP A;  3KEB A;  2VLT A;  2IL3 A;  1PA3 A;  1N8J A;  2X8C A;  3K8N A;  2X8H A;  5F05 A;  1SK0 A;  4MLY A;  2C4J A;  4H86 A;  3TCO A;  1U87 A;  2FGX A;  4DSQ A;  3LQ7 A;  2WGR A;  2OBI A;  1A8L A;  4NAX A;  4V2M A;  1VF4 A;  3VK9 A;  3VI7 A;  4BL7 A;  5G31 A;  3C1S A;  1SU9 A;  2LQQ A;  1GP1 A;  1S3C A;  3TDG A;  2XPD A;  3GMF A;  4MDC A;  3UOM A;  3MIX A;  4ZB6 A;  2G2Q A;  3S9F A;  1VF3 A;  5CRE A;  2H70 A;  5DAK A;  17GS A;  1QFN A;  3LYP A;  1M9A A;  3UJ1 A;  1EGO A;  4WF4 A;  3HVV A;  3M9J A;  1KBN A;  2HI7 A;  3FZA A;  2RII A;  5D73 A;  1XWC A;  1TK8 B;  1GSS A;  1O7U A;  2WJU A;  2OAD A;  4K9Z A;  2MMZ A;  3LYK A;  4E8E A;  3HVS A;  1F9M A;  4G10 A;  5ECI B;  4KSM A;  1BG5 A;  3IK7 A;  2X8G A;  3W6G A;  2GSR A;  4HDE A;  1WE0 A;  2YAN A;  4ZBA A;  4BVY A;  4KH7 A;  4QL9 A;  1PRX A;  2CQ9 A;  5FWG A;  1HNC A;  3EIN A;  5J5N A;  5ECQ B;  2JAC A;  2LRC A;  3RBT A;  4DEJ A;  4KUN A;  3VUR A;  2DJ3 A;  2FWG A;  2F9S A;  1HNB A;  2OE3 A;  3Q18 A;  4I5Q A;  4PQI A;  2OE1 A;  1SK1 A;  3APS A;  4EL1 A;  2JSY A;  3A2V A;  5FT3 A;  3PIN A;  4P3Y B;  2DMM A;  4O5U A;  1SYR A;  2HZE A;  3LXZ A;  2R0P A;  3ERF A;  1M9B A;  5KOX A;  1VGL A;  1YJ6 A;  2XBI A;  1A2M A;  5IPH A;  1PGT A;  5ENU A;  1A2L A;  4WBR D;  2GQL A;  1JLV A;  1EOG A;  1TRV A;  3I6A A;  1AW9 A;  4IBP A;  3GST A;  5CYY A;  5G5E A;  2J23 A;  4CY6 A;  3FRC A;  3FZ4 A;  5CRG A;  3TB2 A;  4EDZ A;  4MH2 A;  2VL2 C;  3VPQ A;  3M0F A;  4WR4 A;  2H1G A;  4CW9 A;  3C8E A;  4PNF A;  1FHE A;  5D96 A;  1PN9 A;  4KX4 A;  1USB A;  1URM A;  2DJK A;  2LRN A;  3A2X A;  2H6Z A;  2ALB A;  2PUK C;  2P31 A;  5INY A;  2R37 A;  1R5P A;  3H4K A;  3FR9 A;  2TIR A;  3FZ9 A;  3TKS E;  5IMV A;  1LJR A;  4X43 A;  2C0F A;  5HR3 A;  4GWR A;  5H5S A;  2HXK A;  1OKD A;  2GDR A;  6GSY A;  4POB A;  3H8Q A;  3HJP A;  1TP9 A;  2VAF A;  4K5S A;  4EC0 A;  1EOH A;  4N30 A;  1XW5 A;  2G0F A;  2QKE A;  3D0Z A;  3PGT A;  1GWC A;  2H0H A;  1VF2 A;  6GSS A;  3KH7 A;  1UN2 A;  3FYG A;  1MTC A;  1JFU A;  3W8J A;  4MZB A;  3D5J A;  3F9U A;  4XRD A;  3HZ4 A;  1T8E B;  4PNG A;  2M80 A;  3L9V A;  3L9U A;  3IPZ A;  1ST9 A;  2HZF A;  2FLS A;  4K0N A;  1K3Y A;  4N0V A;  2NTO A;  2YN1 A;  2ZUP A;  2DLX A;  3CYN A;  1TU8 A;  4USS A;  2C0D A;  5D9V A;  2IMF A;  2VL3 A;  1QGV A;  2ZCT A;  3H79 A;  3QFB C;  3GKX A;  4DVC A;  1Z7R A;  1X5D A;  2P5Q A;  2F8F A;  2VLV A;  2DKI A;  2IJY A;  2C3T A;  5ELG A;  4K8M A;  2WCI A;  3MYD A;  3FZ5 A;  5AGY A;  1T4Y A;  2VD0 A;  5DCG A;  1RW1 A;  2HSY A;  4ILF A;  1HNA A;  3G9B A;  2YOI A;  3C7M A;  1U3A A;  5A4V A;  1A0R P;  1F6M C;  2FWE A;  4AJ6 A;  2K9F A;  2I1U A;  5EVO A;  3IBH A;  2BMX A;  3A5W A;  4L0W A;  3ED3 A;  2DSA A;  5AIV A;  4XCS A;  5ECR B;  3CXG A;  5DBQ A;  4F0B A;  3FR3 A;  6GSX A;  3CSH A;  2H30 A;  4X4J A;  4RQR A;  2DIY A;  3ZRE A;  1WP0 A;  4I2T A;  2JZS A;  3NOF A;  5A5K A;  4Z7X A;  2H6X A;  1TTZ A;  4LMW A;  3LFL A;  4J57 E;  3RHC A;  4GLT A;  2E7P A;  2UZ8 A;  4OO4 A;  4KAE A;  5GST A;  2AV4 A;  1U88 A;  5IMF A;  4I8B A;  3PPU A;  2GSQ A;  4GST A;  4MJC A;  4G0I A;  4TR0 A;  2F8A A;  1ZZY A;  3ZL5 A;  4F2I A;  3R2Q A;  4AJ8 A;  3HHV A;  5A4W A;  3BBY A;  1E6B A;  1TI1 A;  2GGT A;  3SBC A;  2JL4 A;  1YF0 A;  3P7X A;  4TW5 A;  5C04 A;  3MDK A;  2LQO A;  1MDK A;  3GFK A;  1FB0 A;  1TKD B;  2KOK A;  3HCZ A;  4G9H A;  3FMW A;  18GS A;  2VLU A;  3CBU A;  3GH6 A;  4AJ7 A;  1NW2 A;  3NZN A;  4MP4 A;  3APO A;  5CO3 A;  3CRU A;  3KIJ A;  2VIM A;  2BJX A;  4CHS A;  2GVP A;  2H74 A;  2GTU A;  4EUY A;  1JLW A;  1GLQ A;  3FK8 A;  2HT9 A;  4ZXG A;  2LV3 A;  1PKW A;  1X0R A;  2R2J A;  1HYU A;  3IK9 A;  2VCT A;  3UIW A;  4D73 A;  1FG4 A;  4KF9 A;  4IKH A;  2CAQ A;  3UVH A;  1G7E A;  1XVQ A;  3RHB A;  5LNK e;  4MPG A;  2JZT A;  4MZW A;  5EY6 A;  4TR1 B;  5AN1 A;  1U3I A;  2CVB A;  2HRF A;  4NHZ A;  1QUW A;  2K8S A;  4OMV A;  4ECJ A;  3IC8 A;  3IAS 2;  3C73 A;  4FYB A;  2C1Y A;  4OCF A;  3TUE A;  3O6T A;  2N5B A;  2GZP A;  5DJL A;  2X49 A;  1JZR A;  6GSV A;  1LBK A;  4ZBD A;  2B5Y A;  4IQA A;  4PUA A;  3CTG A;  3QAV A;  1R7H A;  1W89 A;  2HFD A;  1K0N A;  4GF0 A;  1VF1 A;  12GS A;  2MMN A;  5L71 A;  2AHE A;  3LJR A;  5ID2 A;  2JAD A;  3ZIV A;  2WFC A;  4Z2U A;  5CRD A;  1GTA A;  1K0B A;  3M1G A;  2DJ2 A;  2YWN A;  3IA1 A;  4YAV A;  4X1U A;  4EIQ A;  1U6T A;  4EKZ A;  2V32 A;  5GAN D;  4F0C A;  3N5O A;  4L0U A;  4MPF A;  1MD3 A;  5IOW A;  3FEU A;  5JCW A;  4OD7 A;  2YWI A;  2L4Q A;  4TRX A;  1XWA A;  4XS6 A;  2GZZ A;  4TXO B;  6GSW A;  1A23 A;  1YKC A;  1B9X C;  1CQH A;  2CA8 A;  5IMD A;  4F82 A;  3LEF A;  1A2J A;  4J2F A;  3MWH A;  2A4H A;  3LOR A;  2KHP A;  2LST A;  3GYK A;  3EMP A;  2YV7 A;  1YDK A;  1AQW A;  2VCZ A;  3KM6 A;  2QA2 A;  4ECC A;  4OCE A;  4KCA A;  1GUH A;  1AXD A;  3AY8 A;  1GTB A;  1NHO A;  2EIR A;  4MMM A;  5J9C A;  1K0O A;  4HQZ A;  3U6V A;  4ZBB A;  4TR4 A;  3FY7 A;  4EDY A;  2AB6 A;  3I43 A;  2M46 A;  1SL0 B;  2YJ7 A;  1T7P B;  5G30 A;  1YY7 A;  3HY2 A;  4F03 A;  2MBT A;  4LLR A;  4XIH A;  1AAZ A;  10GS A;  7GSS A;  1JZD A;  2DBC A;  2LKU A;  4IHU A;  1BQ7 A;  3ZTL A;  1PN0 A;  1SYX A;  1R5A A;  2V2G A;  4YQU A;  5E4W A;  2CT6 A;  5HQP A;  3TRP A;  2IME A;  2GS3 A;  3KXO A;  4HZ2 A;  3Q19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...