3ME8A

Crystal structure of putative electron transfer protein aq_2194 from aquifex aeolicus vf5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
169
structure length
169
Chain Sequence
SLGTYVPGDITLVDSYGNEFQLKNLKGKPIILSPIYTHCRAACPLITKSLLKVIPKLGTPGKDFWVITFTFDPKDTLEDIKRFQKEYGIDGKGWKVVKAKTSEDLFKLLDAIDFRFMTAGNDFIHPNVVVVLSPELQIKDYIYGVNYNYLEFVNALRLARGEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of putative electron transfer protein aq_2194 from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Electron transport
total genus 52
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3me8A00
3UEMA 3ED3A 5B6NA 5HFIA 3D22A 2HLSA 1FOVA 4IQAA 1R26A 5ECPB 3RHCA 5JCWA 3TOUA 3HVSA 1N8JA 4PNFA 1GUMA 4F9ZA 1SD8A 1F9MA 5DAKA 1IYHA 2K8SA 3F8UA 1V9WA 2LV3A 2IPAA 3ZFLA 4IELA 3DMLA 4ZBBA 4WR5A 4XHMA 2H73A 2DJKA 4MJCA 5DBQA 4QL9A 2PERA 2K8VA 3EURA 2CVKA 3PH9A 4CW9A 5G1KA 1THOA 3E9JB 3RBTA 4V1Ag 3BCIA 4Z7XA 1C72A 1U88A 3GIXA 5IIZA 2GZPA 3G9BA 11GSA 1HNBA 2VLTA 2YZHA 1M9AA 3QAVA 3CMIA 1ON4A 1FO5A 1X5CA 2FWEA 2AB6A 1PA3A 3UL3A 3EC3A 1SJ6A 1XCCA 2LNSA 2OBKA 2N5AA 3F3QA 3LYPA 1VGLA 1GSFA 5JWQB 1O8XA 1QK8A 1A0FA 1CQGA 2FA4A 4J56E 14GSA 2HI7A 2H01A 1OVNA 1TXXA 2V1MA 2B1LA 2WRTA 4OWYA 4BA7A 2F3MA 4IVFA 2VCWA 3LGCA 2YJHA 1BAYA 2A4VA 3S9FA 2CVDA 1FVKA 3FY7A 5CNWA 3KCMA 2PVOC 3H8QA 2P0GA 4MF7A 1YJ6A 1OC3A 5FT3A 5AIVA 5GAND 1J08A 3MWHA 2P5RA 2GZYA 3TB2A 1YEPA 1M0UA 2MYGA 2X8GA 5H5RA 1USBA 1TRUA 2H1GA 5FHIA 1NHOA 2C3TA 2L6CA 4F03A 2A2SA 4LMVA 1TI1A 5L71A 4N0VA 1M7TA 2XBIA 2Z9SA 1BJXA 4Q5NA 2TRCP 5KN3A 1G7OA 2GSTA 3BCKA 3M9KA 4HU7A 1HD2A 1GTAA 2EIQA 4KDUA 1G6YA 1XVQA 2XC2A 1EOHA 3IDVA 3KXOA 3P2AA 4BWSA 2OE0A 1PL2A 1FB6A 1X5DA 2OE1A 3L0HA 3P90A 4L8EA 5ECRB 2RUEA 4TN8A 5EL8A 5DCGA 3NIVA 5IO2A 5ECLB 2C0EA 4HJ2A 1M9BA 2LSTA 2ZUPA 3GUSA 3APOA 4ACSA 4WETA 2AHEA 1DE2A 16GSA 3Q6OA 4K7IA 2IWTA 1OAZA 2YP6A 4TR0A 2JSYA 5LCZA 3KH9A 3P8WA 3APSA 1T7PB 1YF1A 4ZL7A 4NXIA 3CYNA 5FWGA 4I5QA 5H5SA 1TP9A 2JZSA 1MEKA 2CX4A 4Q5RA 5F8BA 4IN0A 4OFTA 4PX1A 5JWRB 3FZAA 1FVJA 4KCEA 4PNGA 1VF3A 1E2YA 2DMLA 5HQPA 17GSA 5LD0A 3CSJA 1AAZA 2GSQA 2VCZA 2RM5A 2GVPA 3F4TA 5ECSA 4YH2A 1TI3A 2CAQA 4AGSA 4PQ1A 2H72A 5C04A 5EVOA 2AV4A 18GSA 2C4JA 4I2TA 3KTBA 2M72A 1T4YA 1NSWA 2H6ZA 4LA1A 4YQVA 3H4KA 2GGTA 4GCIA 1A0RP 3EE2A 1B48A 3C1RA 2C0GA 2PVQA 1TRVA 3AY8A 5ECNB 1GSDA 4F2IA 1K0BA 2N5FA 1KBNA 2LQOA 5E59A 4OMVA 2VL9A 5IMFA 3TKQA 3GL5A 6GSSA 4MH2A 4NV2A 2IMFA 4L0WA 2H1DA 5ID2A 3CBUA 3VWXA 4AF2A 4TW5A 3GH9A 2WULA 3FYGA 2LS5A 1ERUA 4BVXA 4Q5FA 1X5EA 2GDRA 4N30A 6GSVA 5ABRA 3HJMA 1LBKA 3ME7A 2YJ7A 1IYIA 2F51A 1U87A 4K0GA 2L57A 1A2LA 5CRHA 1RK4A 4ULXA 1Y25A 1RW1A 2B7JA 1GNEA 3RPNA 1SU9A 4HDEA 2PMTA 3QR6A 3BD2A 1FB0A 1H75A 1XW9A 1F37A 1YEXA 4GQCA 1SKRB 1O85A 1BEDA 1XOAA 2LEGA 2YOIA 3QPMA 4EDYA 2HSHA 1T3BA 2HRNA 4MPGA 3WYWA 2CZ3A 2IN3A 4MP4A 3TJJA 3Q74A 4L5LA 3HJOA 5ECKB 1TK0B 5AGYA 3DIEA 2XBQA 1XW6A 3QAGA 2H74A 5GAPD 5DJMA 1TRSA 3N9JA 3IE3A 1QXHA 1WMJA 8GSSA 4JEDA 1G0TA 2BJXA 1V98A 1I5GA 4NV5A 1ERWA 1SK1A 1ZYQB 1EP7A 3TKSA 4HI7A 4HQSA 2I1UA 1UVZA 4OCEA 4ECIA 4RQRA 1EEJA 4DSRA 2HSYA 1F6MC 2CA8A 4K0NA 5KEJA 2H0GA 4MPFA 2CV4A 4EUYA 3NOFA 4HOJA 4IQ1A 1GRXA 2VD0A 1TKDB 4BWQA 3MNGA 2RM6A 3QCPA 3KP9A 3CXGA 4GQFA 4MH3A 1NW2A 4O7HA 1KTEA 5J41A 4XIHA 1NHYA 3F63A 1KEBA 4GF0A 5DQYA 2C8UA 2WZ9A 2WDUA 3HXSA 4NWYA 4RI6A 2OACA 3PINA 3W8JA 3VK9A 4YQMA 3J7Yb 2GT5A 3I6AA 3FZ4A 1DBYA 1S3CA 4OO4A 1TW9A 1MDKA 4NAXA 4PXOA 2B6MA 1HNAA 1Y6EA 1QGVA 4HJMA 4KUNA 3UVHA 1E6BA 3EVIA 1HNCA 3KZQA 5D93A 1OC9A 1GUHA 3M8NA 4I97A 4IP1A 1M99A 3VI5A 1BG5A 1EV9A 3ZREA 5KN1A 1J0FA 1SD9A 5IMDA 1V40A 1SYXA 1YKAA 1G7EA 5D9WA 2VM1A 1JLWA 2GQLA 2LNTA 3TRQA 4CHSA 2VL2A 1VF1A 2QKEA 1ILOA 4ZBDA 3A5WA 2GQKA 3F6FA 3C7MA 3U5RE 4MDCA 5GZZB 1XFLA 2P5QA 1TK5B 2LRNA 5J9BA 2ON5A 5J3RA 1T00A 3FZ5A 4EDZA 4HUAA 4XS4A 1EGRA 3LEFA 2VCXA 5HR1A 1GSUA 2C3NA 3C71A 3M9JA 2H1BA 4IJIA 3LXTA 5G1LA 3ZZXA 1NM3A 3NZNA 2TRXA 3EYTA 3GKNA 4WKWA 4EC0A 1A8YA 5LNKe 4QL7A 1FHEA 3TJKA 2H0HA 2MBSA 5HFGA 2HZEB 2JL4A 1ABAA 3FR6A 5ENUA 2VIMA 4LMWA 2NPBA 3ZVJD 4POMA 2DJ0A 3HYPA 4X1UA 4V1Ap 2YWIA 1PRXA 3HHVA 1F3AA 5DAKB 5HR3A 5D9XA 3U6VA 3FRCA 5B7CA 4ML1A 2KP2A 2B3SA 5AISA 1BX9A 1SENA 4K8MA 2B7KA 3H1NA 2CX3A 1OKTA 2E0QA 1URMA 1K0MA 4EVMA 2OE3A 3GMFA 3UOMA 1FW1A 2ALBA 5C00A 1O8WA 3L4NA 2R5GA 2E2MA 3W8SA 1PSQA 2KOKA 2K6VA 4MCUA 3HJPA 3GKXA 1GSQA 2IFQA 5G31A 5A5KA 1O6JA 2AAWA 4RUVA 3LWAA 3VURA 4GWRA 5AN1A 1CQHA 2PU9C 4LL4B 1TJDA 2OA7A 2HXKA 2RIIA 1XWCA 1QQ2A 4MLYA 1YY7A 4AJ6A 1LJRA 3UJ1A 3ZIJA 3WGEA 3F6DA 2C0DA 2G0FA 1YZXA 5KN2A 4PUFC 1DUGA 1F2EA 1Z3EA 1V58A 3QFBC 1WJKA 2O87A 5EY6A 3LXZA 4KGIA 3IV4A 5DDLA 3KGKA 1XIYA 4I8BA 4NMUA 1TU7A 3VLNA 2B1KA 1XWGA 3KMNA 1XBSA 2PPTA 2LKUA 2VCVA 4OFNA 2R4VA 3ERGA 3TKSC 5KN0A 3GSTA 3L78A 3PGTA 2WJUA 1UA5A 3L9SA 2YWOA 1XXUA 1SL0B 3G7YA 3HD5A 3EU4A 2DSAA 2L4CA 4IGJA 3GKMA 3TOTA 3QFAC 5H5QA 3WT1A 2YANA 1AIUA 5AIXA 2YV7A 6GSXA 3HZ4A 2V6OA 2JZRA 6GSWA 4X43A 1EZKA 2MBTA 4TOPA 1FAAA 1V57A 4E8EA 4D73A 1BYEA 3F4RA 1J9BA 2LQQA 3RHBA 2H70A 4ZL8A 4TR1A 2C0FA 3O76A 2A2RA 3UMAA 1S3DA 2F9SA 5INYA 3TUEA 5B8AA 3KEBA 3E3EA 3IXRA 5A4VA 4DSQA 2FUG2 2ON7A 4POBA 4MMMA 3GHAA 1JZOA 7GSSA 4ZL9A 3HVXA 2YWNA 2H1AA 3GX0A 4KX4A 4V2LA 3FKFA 2GTUA 2DJJA 2FHEA 2R37A 3KH7A 2XPDA 1MDIA 3DEXA 3VI7A 3BJ5A 1M2DA 2YZUA 4TR1B 2B5EA 2OJLA 4KSOA 20GSA 3M0FA 3H93A 2R2JA 2HRFA 5CYYA 1JLVA 2HNLA 4K2DA 5IOXA 4HQZA 3ZVJA 2M46A 1QUWA 3EMXA 4K9ZA 1B8XA 2DJ1A 2YWMA 5A4WA 3HZ8A 1O73A 3FR3A 4JR4A 2OKAA 2FY6A 2O89A 1ZZYA 1K3LA 5ELAA 4TR4A 1WPIA 3A3TA 2PGTA 1HQOA 2LTKA 2H71A 3JCML 2FD3A 4ZILA 2CZ2A 4WR4A 1YDKA 4PURA 3APQA 2YCDA 3IRAA 2V2GA 3QOUA 1B9YC 1XWAA 4XRDA 9GSSA 1AC1A 4EL1A 1SKSB 1GTBA 5G5FA 1GULA 4IKHA 4LL1B 4OCFA 3IPZA 1W89A 1GSEA 1UN2A 4K7OA 2GLRA 1U3IA 3DYRA 4WF5A 1XVWA 2WCIA 1WRYA 3UVTA 1QFNA 1A24A 1K3YA 5CRGA 2H0IA 1K0OA 3P7XA 4J57E 2YNXA 1FG4A 1GTUA 2QGVA 3CRUA 4I2UA 5ECQB 3L9UA 3ZFBA 5IMCA 1OE7A 2VLVA 4ILFA 4P3YB 1MD4A 2VLUA 3GNJA 2GT6A 1K0AA 3MSZA 5ID2B 3OR5A 2FLSA 1GH2A 3GRXA 2DC5A 1OYJA 3VPQA 4MJAA 4O32A 4ZIJA 3ZRDA 3F0IA 1MDJA 4GLTA 3TKRA 3D0ZA 4TXOA 3QMXA 1GUKA 1K0DA 4J2FA 2YPMA 5DVBA 2MMAA 3PR8A 3ZIVA 4AJ8A 1X9SB 2J23A 5G5EA 4ZXGA 3VFIA 4E8HA 1PN9A 1XOBA 4JBBA 3VWVA 5EPFA 3RDWA 4WF4A 3O6TA 1YQ1A 2M80A 4ZB8A 4KSMA 4K1FA 2IL3A 1XWBA 4KW6A 6GSYA 1R4WA 5F06A 1EOGA 4TXOB 1T1VA 1U6TA 1ERTA 2LRTA 3UARA 2K18A 3ZLPA 4HZ2A 4ID0A 5DQSA 5IOWA 4WBRD 2MMOA 2BTOT 4IJ3A 4AJ7A 3C8EA 3KIJA 4OO5A 1X9WB 3HDCA 3F3RA 1AW9A 2ZNMA 1O7UA 2REMA 1PQNA 2NDOA 1DE1A 1G6WA 3G7JA 2HYXA 3DGQA 3VWWA 5F05A 1S3AA 1QMVA 3TCOA 4IW9A 3D6IA 2E7PA 1MTCA 3BBYA 4MZCA 5DALA 5HR0A 2HT9A 2GSSA 4N0ZA 4XS1A 2C80A 3Q19A 4MK3A 3D21A 4MA9A 1GLQA 3WD6A 1N2AA 3I9V2 5ECHB 3CSHA 3A2VA 2R6KA 3WGXA 3C73A 4GSTA 2EIOA 1XPVA 2FWGA 1JZDA 2PUKC 2TIRA 3I69A 3GH6A 5J5NA 2F8FA 3UAPA 2PWJA 3GV1A 5J9CA 4L5OA 2AJQB 2RUFA 2H6YA 2WB9A 4MJEA 3HCZA 2IMIA 3ZITA 4G19A 2H6XA 1TRWA 1B4QA 3IK7A 3HVVA 2I9HA 2DLXA 3R2QA 3ZMKA 2L5OA 1M2BA 1V2AA 4XCSA 1A2MA 2JACA 1AQXA 1PX7A 3HY2A 4FYUA 1EGOA 3RAZA 2CAIA 1OC9B 4F82A 3IK9A 4GXZA 5CREA 2KHPA 4GRFA 4YAVA 3ME8A 1AUCA 2IMEA 3TJGA 1AXDA 1GSSA 1Z7RA 12GSA 1B9XC 2AYTA 4HZ4A 5A4UA 5F0GA 3D4MA 2AUVA 2V32A 1Z9HA 3DKSA 4BPYA 2ZCTA 3DWVA 2CT6A 2I4AA 5GSTA 5DCHA 4MZWA 2GZZA 4JU5A 4RI7A 2J9HA 2GQMA 1X0RA 5CAXA 3IC4A 1GNWA 4XRAA 4XS4B 4POLA 2H66A 3D5JA 1GP1A 4GTUA 1GTIA 4PQIA 2H8LA 2X8CA 4XS6A 4ECCA 4KAEA 4N10A 4KA0A 2F8AA 3SWLA 2EC4A 4ZB6A 4BVYA 4FIWA 2H19A 1HYUA 1YF0A 4KE3A 3EMPA 5D9TA 1TTZA 2H30A 1SJZA 3F4SA 1LU4A 2L59A 2NTOA 1Z6NA 4FO5A 1R5AA 1ZYEA 4RQXA 1GL8A 3IA1A 1JZWA 4YQUA 1XZOA 2KP1A 3LFLA 2GS3A 3WGDA 2VL3A 1EWXA 2D2ZA 3GX8A 1THXA 1ZOFA 2LJKA 2FGXA 2VM2A 5HFKA 2FA8A 4DEJA 3IOSA 2B5YA 4HEA2 1GLPA 1EV4A 2JADA 2O85A 4KDXA 3QD9A 3TKSE 3J7Yk 4MF6A 4JE1A 5IMVA 2VO4A 2YN1A 3GL3A 3EWLA 3UBLA 1WOUA 2MZCA 2IFQB 4BL7A 4G10A 4NPBA 1Z6MA 3KMOA 2XHFA 1WE0A 3GSSA 2V6KA 4WEYA 3FZ9A 3C1SA 3IBHA 4G2EA 5JWOB 1Z5YE 4XTSA 2FWFA 5ECMB 1TU8A 1SK2A 3W6GA 4DSSA 1OC8A 2VAFA 3M3MA 3L9VA 1A2JA 4G9HA 3TJFA 1YKCA 2WFCA 4TR3A 4EE0A 1SL1B 19GSA 1PL1A 4O92A 3ZMLA 5DJLA 1B4PA 2I81A 2DBCA 2FWHA 2DJ3A 2PN8A 2ES7A 4K7NA 3ERWA 3TRXA 10GSA 2KUCA 2H75A 3KP8A 1X9MB 3FHKA 4V2NA 2VCTA 3DRNA 1SK0A 4WXTA 1JZRA 3FEUA 1ZCPA 3RPPA 4POKA 4CDOA 2X8HA 2DMMA 1H4OA 4DSSB 5JCUA 4OFMA 3QAWA 4ISDA 1PGTA 3ERFA 3MAKA 2K9FA 4D73B 1UC7A 4IHUA 4HU9A 3SBCA 5IPHA 5JCGA 2L4QA 5D9VA 2G2QA 3FR9A 1VRSD 1ZGNA 1SKWB 4KB3A 4TRXA 4ECJA 2HZFA 5IQYA 4I6XA 5G2ZA 2CQ9A 3D4TA 4PUAA 2WGRA 4OD7A 2VL2C 3DVWA 4JR6A 4N11A 22GSA 6GSUA 4X0XA 2KLXA 1KNGA 2NVLA 1PD21 1SL2B 4JZQA 1ML6A 1M2AA 1F3BA 3LG6A 3US3A 4MF5A 3EU3A 2DIYA 3GA4A 3IAM2 4ZBAA 3Q18A 4KCAA 6GSTA 3GKKA 2JSZA 2C3QA 3K8NA 5D73A 3N5OA 5D96A 2B5XA 1SJIA 1JHBA 3A2XA 1ZMAA 2JU5A 3E0UA 1EP8A 1XW5A 3LQ7A 1K3OA 3ZYWA 2R3XA 4TKYA 1Q98A 4ZB9A 4F0CA 3CSIA 2E2GA 4QQ7A 5D8IA 1AQVA 1K0NA 5CO3A 5B6MA 2QC7A 1WIKA 1EEMA 3GTUA 4L0UA 2H76A 3LYKA 3A2WA 4PGTA 3H79A 4ECBA 4KNDA 2IIYA 3TJBA 2XPEA 2LJAA 2RLIA 1GWCA 2IJYA 1GSYA 5E4WA 4IP6A 1XWKA 4WBJA 3F9UA 2C1YA 2X64A 3G7IA 5IMZA 2GSRA 3DVXA 2BMXA 4Q5QA 1U3AA 1W4VA 2LJRA 1OE8A 1O81A 3DD3A 3V1WA 4DVCA 4ML6A 5CRDA 3GTUB 4F0BA 3FW2A 1ST9A 3EINA 4KH7A 1Q4JA 5B8BA 5ELGA 1SYRA 4MJBA 3GURA 2DIZA 2WS2A 2MMNA 5ECIB 1T4ZA 5HR2A 5IO0A 1TK8B 1VF2A 3TDGA 3KM6A 2LUSA 2EIRA 1PX6A 1K0CA 5G30A 4FH8A 3HA9A 3FK8A 1ZL9A 1A8LA 2DJ2A 4TVEA 5F07A 3GYKA 2IMKA 4MABA 5GSSA 2O7KA 4GSNA 3HKRA 4NHWA 1PMTA 13GSA 2FCHA 3I43A 5IM9A 2L5LA 3M1GA 4EKZA 3GN3A 2LRCA 2P31A 5CRWA 3CTGA 3O3TA 3TRPA 3UBKA 4K6XA 1I9DA 4YAPA 1PKWA 3IAS2 4LLRA 5COHA 4JRRA 3ZL5A 1ACVA 3ZTLA 4HS1A 2CVBA 2VUPA 2HFDA 5IPGA 3KTLA 2NBSA 4KDYA 3WT2A 4EO3A 4FYCA 3ISOA 3LJRA 3DXBA 2N5BA 3CRTA 1VF4A 2V41A 3KJYA 2X99A 3GFKA 1TOFA 5J4UA 1RQMA 4GSSA 2VOCA 4IBPA 1PKZA 2VD1A 4O5RA 4IS0A 4EXJA 3KD0A 1A23A 3CTFA 2L6DA 2MMZA 1JFUA 3MDKA 3VWUA 2HE3A 4TXVA 1ERVA 4H86A 1BQ7A 2I3YA 4V2MA 3TGZA 4EF0A 3QDNA 1AQWA 2O8VB 1WP0A 5DALB 2PBJA 4MZBA 1Z7PA 5CP1A 3UIWA 3VPTA 1T8EB 2VCQA 1R5PA 1OKDA 4FYBA 1TDIA 4NHZA 2JZTA 1MD3A 5IMAA 3LORA 3IHQA 1DSBA 5ECOB 2FNOA 3TKPA 2QSIA 2IMDA 2OBIA 1R7HA 3LSZA 3IR4A 1WWJA 2HZEA 3BOAA 2OADA 4PQHA 2YV9A
chains in the Genus database with same CATH superfamily
3UEMA 3ED3A 5B6NA 5HFIA 3D22A 2HLSA 1FOVA 4IQAA 1R26A 5ECPB 3RHCA 5JCWA 3TOUA 3HVSA 1N8JA 4PNFA 1GUMA 4F9ZA 1SD8A 3MYDA 1F9MA 5DAKA 1IYHA 2K8SA 3F8UA 1V9WA 2LV3A 2IPAA 3ZFLA 4IELA 3DMLA 4ZBBA 4WR5A 4XHMA 2H73A 2DJKA 4MJCA 5DBQA 4QL9A 2PERA 2K8VA 3EURA 2CVKA 3PH9A 4CW9A 5G1KA 1THOA 3E9JB 3RBTA 4V1Ag 3BCIA 4Z7XA 1C72A 1U88A 3GIXA 5IIZA 2GZPA 3G9BA 3MIXA 11GSA 1HNBA 2VLTA 2YZHA 4A5PA 1M9AA 3QAVA 3CMIA 1ON4A 1FO5A 1X5CA 4K5RA 2FWEA 2AB6A 1PA3A 3UL3A 3EC3A 1SJ6A 1XCCA 2LNSA 2OBKA 2N5AA 3F3QA 3LYPA 1VGLA 1GSFA 5JWQB 1O8XA 1QK8A 1A0FA 1CQGA 2FA4A 4J56E 14GSA 2HI7A 2H01A 1OVNA 4BVYB 1TXXA 2V1MA 2B1LA 2WRTA 4OWYA 4BA7A 2F3MA 4IVFA 2A2PA 2VCWA 3LGCA 2YJHA 1BAYA 2A4VA 3S9FA 2CVDA 1FVKA 3FY7A 5CNWA 3KCMA 2PVOC 3H8QA 2P0GA 4MF7A 1YJ6A 1OC3A 5FT3A 5AIVA 5GAND 1J08A 3MWHA 2P5RA 2GZYA 3TB2A 1YEPA 1M0UA 2MYGA 2X8GA 5H5RA 1USBA 1TRUA 2H1GA 5FHIA 1NHOA 2C3TA 2L6CA 4F03A 2A2SA 4LMVA 3PPUA 1TI1A 5L71A 4N0VA 1M7TA 2XBIA 2Z9SA 1BJXA 4Q5NA 2TRCP 4EIQA 5KN3A 1G7OA 2GSTA 3BCKA 3M9KA 4HU7A 1HD2A 1GTAA 2EIQA 4KDUA 1G6YA 1XVQA 2XC2A 1EOHA 3IDVA 3KXOA 3P2AA 4BWSA 2OE0A 4Z2TA 4Z2UA 1PL2A 1FB6A 1X5DA 2OE1A 3L0HA 3P90A 4L8EA 5ECRB 2RUEA 4TN8A 5EL8A 5DCGA 3NIVA 5IO2A 5ECLB 2C0EA 4HJ2A 1M9BA 2LSTA 2ZUPA 3GUSA 3APOA 4ACSA 4WETA 2AHEA 1DE2A 16GSA 3Q6OA 4K7IA 2IWTA 1OAZA 2YP6A 4TR0A 2JSYA 5LCZA 3KH9A 1ZYNA 2DKIA 3P8WA 3APSA 1T7PB 1YF1A 4ZL7A 4NXIA 3CYNA 5FWGA 4I5QA 5H5SA 1TP9A 2JZSA 1MEKA 2CX4A 4Q5RA 5F8BA 4IN0A 4OFTA 4PX1A 5JWRB 3FZAA 1FVJA 4KCEA 4PNGA 1VF3A 1E2YA 2DMLA 5HQPA 17GSA 5LD0A 3CSJA 1AAZA 2GSQA 2VCZA 2RM5A 2GVPA 3F4TA 5ECSA 4YH2A 1TI3A 2CAQA 4AGSA 4PQ1A 2H72A 5C04A 5EVOA 2AV4A 18GSA 2C4JA 4I2TA 3KTBA 2M72A 1T4YA 1NSWA 2H6ZA 4LA1A 4YQVA 3H4KA 2GGTA 4GCIA 1A0RP 3EE2A 1B48A 3C1RA 2C0GA 2PVQA 1TRVA 3AY8A 5ECNB 1GSDA 4F2IA 1K0BA 2N5FA 1KBNA 2LQOA 5E59A 4OMVA 2VL9A 5IMFA 3TKQA 3GL5A 6GSSA 4MH2A 4NV2A 2IMFA 4L0WA 2H1DA 5ID2A 3CBUA 3VWXA 4AF2A 4TW5A 4BIKA 3GH9A 2WULA 3FYGA 2LS5A 5KOWA 1ERUA 4BVXA 4Q5FA 1X5EA 2GDRA 4N30A 6GSVA 5ABRA 3HJMA 1LBKA 3ME7A 2YJ7A 1IYIA 2F51A 1U87A 4K0GA 2L57A 1A2LA 5CRHA 1RK4A 4ULXA 1Y25A 1RW1A 2B7JA 1GNEA 3RPNA 1SU9A 4HDEA 2PMTA 3QR6A 3BD2A 1FB0A 1H75A 1XW9A 1F37A 1YEXA 4GQCA 1SKRB 1O85A 1BEDA 1XOAA 4BVXB 2LEGA 2YOIA 3QPMA 1M3JA 4EDYA 2HSHA 1T3BA 2HRNA 4MPGA 3WYWA 2CZ3A 2IN3A 4MP4A 3TJJA 4G0KA 3Q74A 4L5LA 3HJOA 5ECKB 1TK0B 5AGYA 3DIEA 2XBQA 1XW6A 3QAGA 2H74A 5GAPD 5DJMA 1TRSA 3N9JA 3IE3A 1QXHA 1WMJA 8GSSA 4JEDA 1G0TA 2BJXA 1V98A 1I5GA 4NV5A 1ERWA 1SK1A 1ZYQB 1EP7A 3TKSA 4HI7A 4HQSA 2I1UA 1UVZA 4OCEA 4ECIA 4RQRA 1EEJA 4DSRA 2HSYA 1F6MC 2CA8A 4K0NA 5KEJA 2H0GA 4MPFA 2CV4A 4EUYA 4YKFA 3NOFA 4HOJA 4IQ1A 1GRXA 2VD0A 1TKDB 4BWQA 3FMWA 3MNGA 2RM6A 3QCPA 3KP9A 3CXGA 4GQFA 4MH3A 1NW2A 4O7HA 1KTEA 2DKHA 5J41A 4XIHA 1NHYA 3F63A 1KEBA 4GF0A 5DQYA 2C8UA 2WZ9A 2WDUA 3HXSA 4RI6A 4NWYA 2OACA 3PINA 3W8JA 3VK9A 4YQMA 4FQUA 3J7Yb 2GT5A 3I6AA 3FZ4A 5BMUA 1DBYA 1S3CA 4OO4A 1TW9A 1MDKA 4NAXA 4PXOA 2B6MA 1HNAA 1Y6EA 1QGVA 4HJMA 4KUNA 3UVHA 1E6BA 3EVIA 1HNCA 3KZQA 5D93A 1OC9A 1GUHA 3M8NA 4I97A 4IP1A 1M99A 3VI5A 1BG5A 1EV9A 3ZREA 5KN1A 1J0FA 1SD9A 5IMDA 1V40A 1SYXA 1YKAA 1G7EA 5D9WA 2VM1A 1JLWA 2GQLA 2LNTA 3TRQA 4CHSA 2VL2A 1VF1A 2QKEA 1ILOA 4ZBDA 3A5WA 2GQKA 3F6FA 3C7MA 3U5RE 4MDCA 5GZZB 1XFLA 2P5QA 1TK5B 2LRNA 5J9BA 2ON5A 5J3RA 4K5SA 1T00A 3FZ5A 4EDZA 4HUAA 4XS4A 1EGRA 3LEFA 2VCXA 5HR1A 1GSUA 2C3NA 3C71A 3M9JA 2H1BA 4IJIA 3LXTA 5G1LA 3ZZXA 1NM3A 3NZNA 2TRXA 3EYTA 3GKNA 4WKWA 4EC0A 1A8YA 5LNKe 4QL7A 1FHEA 4YKGA 3TJKA 2H0HA 2MBSA 2QA1A 5HFGA 2HZEB 2JL4A 1ABAA 3FR6A 5ENUA 2VIMA 4LMWA 2NPBA 3ZVJD 4POMA 2DJ0A 3HYPA 4X1UA 4V1Ap 2YWIA 1PRXA 3HHVA 1F3AA 5DAKB 5HR3A 5D9XA 3U6VA 3FRCA 5B7CA 4ML1A 2KP2A 2B3SA 5AISA 1BX9A 1SENA 4K8MA 2B7KA 3H1NA 2CX3A 1OKTA 2E0QA 1URMA 1K0MA 4EVMA 2OE3A 3GMFA 3UOMA 1FW1A 2ALBA 5C00A 1O8WA 3L4NA 2R5GA 2E2MA 3W8SA 1PSQA 2KOKA 3IC8A 2K6VA 4MCUA 3HJPA 3GKXA 1GSQA 2IFQA 5G31A 5A5KA 1O6JA 2AAWA 4RUVA 3LWAA 3VURA 4GWRA 5AN1A 1CQHA 2PU9C 4LL4B 1TJDA 2OA7A 2HXKA 2RIIA 1XWCA 1QQ2A 4MLYA 1YY7A 4AJ6A 1LJRA 3UJ1A 3ZIJA 3WGEA 3F6DA 2C0DA 2G0FA 1YZXA 5KN2A 4PUFC 1DUGA 1F2EA 1Z3EA 1V58A 3QFBC 1WJKA 2O87A 5EY6A 3LXZA 4KGIA 3IV4A 5DDLA 3KGKA 1XIYA 4I8BA 4NMUA 1TU7A 3VLNA 2B1KA 1XWGA 3KMNA 4USSA 1XBSA 2PPTA 2LKUA 2VCVA 4OFNA 2R4VA 3ERGA 3TKSC 5KN0A 3IHGA 3GSTA 3L78A 3PGTA 2WJUA 1UA5A 3L9SA 2YWOA 1XXUA 1SL0B 3G7YA 3HD5A 3EU4A 2DSAA 2L4CA 4IGJA 3GKMA 3TOTA 3QFAC 5H5QA 3WT1A 2YANA 1AIUA 5AIXA 4K2XA 2YV7A 6GSXA 3HZ4A 2V6OA 2JZRA 6GSWA 4X43A 1EZKA 2MBTA 4TOPA 1FAAA 1V57A 4E8EA 4D73A 1BYEA 3F4RA 1J9BA 2LQQA 3RHBA 2H70A 4ZL8A 4TR1A 2C0FA 3O76A 2A2RA 3UMAA 1S3DA 2F9SA 5INYA 3TUEA 5B8AA 3KEBA 4EIPA 3E3EA 3IXRA 5A4VA 4DSQA 2FUG2 2ON7A 4POBA 4MMMA 3GHAA 1JZOA 7GSSA 4ZL9A 3HVXA 2YWNA 2H1AA 3GX0A 4KX4A 4V2LA 3FKFA 2GTUA 2DJJA 2FHEA 2R37A 3KH7A 2XPDA 1MDIA 3DEXA 3VI7A 3BJ5A 1M2DA 2YZUA 4TR1B 2B5EA 4KSOA 2OJLA 20GSA 3M0FA 3H93A 2R2JA 2HRFA 5CYYA 1JLVA 2HNLA 4K2DA 5IOXA 4HQZA 3ZVJA 2M46A 1QUWA 3EMXA 4K9ZA 1B8XA 2DJ1A 2YWMA 5A4WA 3HZ8A 1O73A 3FR3A 4JR4A 2OKAA 2FY6A 2O89A 1ZZYA 1K3LA 5ELAA 1M3IA 4TR4A 1WPIA 3A3TA 2PGTA 1HQOA 2LTKA 2H71A 3JCML 2FD3A 4ZILA 2CZ2A 4WR4A 1YDKA 4PURA 3APQA 2YCDA 3IRAA 2V2GA 3QOUA 1B9YC 1XWAA 4XRDA 9GSSA 1AC1A 4EL1A 1SKSB 1GTBA 5G5FA 1GULA 4IKHA 4LL1B 4OCFA 3IPZA 1W89A 1GSEA 1UN2A 4K7OA 2GLRA 1U3IA 3DYRA 4WF5A 1XVWA 2WCIA 1WRYA 3UVTA 1QFNA 1A24A 1K3YA 5CRGA 2H0IA 1K0OA 3P7XA 4J57E 2YNXA 1FG4A 1GTUA 2QGVA 3CRUA 4I2UA 5ECQB 3L9UA 3ZFBA 5IMCA 1OE7A 2VLVA 4ILFA 4P3YB 1MD4A 2VLUA 3GNJA 2GT6A 1K0AA 3MSZA 5ID2B 3OR5A 2FLSA 1GH2A 3GRXA 2DC5A 1OYJA 3VPQA 4HSCX 4MJAA 4O32A 4ZIJA 3ZRDA 3F0IA 1MDJA 2R0GA 4GLTA 3TKRA 3D0ZA 4TXOA 3QMXA 1GUKA 1K0DA 4J2FA 2YPMA 5DVBA 2MMAA 3PR8A 3ZIVA 4AJ8A 1X9SB 2J23A 5G5EA 4ZXGA 4PTSA 3VFIA 4E8HA 1PN9A 1XOBA 4JBBA 3VWVA 5EPFA 3RDWA 4WF4A 3O6TA 1YQ1A 2M80A 4ZB8A 4KSMA 1S3RA 4K1FA 2IL3A 1XWBA 4KW6A 6GSYA 1R4WA 5F06A 1EOGA 4ICYA 4TXOB 1T1VA 1U6TA 5KOXA 1ERTA 2LRTA 3UARA 2K18A 3ZLPA 4HZ2A 4ID0A 5DQSA 5IOWA 2HSMA 4WBRD 2MMOA 2BTOT 4IJ3A 4AJ7A 3C8EA 3KIJA 4OO5A 1X9WB 3HDCA 3F3RA 1AW9A 2ZNMA 1O7UA 2REMA 1PQNA 2NDOA 1DE1A 1G6WA 3G7JA 2HYXA 3DGQA 3VWWA 5F05A 1S3AA 1QMVA 3TCOA 4IW9A 3D6IA 2E7PA 1MTCA 3BBYA 4MZCA 5DALA 3EPTA 5HR0A 2HT9A 2GSSA 4N0ZA 4XS1A 2C80A 3Q19A 4MK3A 3D21A 4MA9A 1GLQA 3WD6A 1N2AA 3I9V2 5ECHB 3CSHA 3A2VA 2R6KA 3WGXA 3C73A 4GSTA 2EIOA 4CY8A 1XPVA 2FWGA 4CY6A 1JZDA 2PUKC 2TIRA 3I69A 3GH6A 5J5NA 2F8FA 3UAPA 2PWJA 3GV1A 5J9CA 4L5OA 2AJQB 2RUFA 2H6YA 2WB9A 4MJEA 3HCZA 2IMIA 3ZITA 4G19A 2H6XA 1TRWA 1B4QA 3IK7A 3HVVA 2I9HA 2DLXA 3R2QA 3ZMKA 2L5OA 1M2BA 1V2AA 4XCSA 1A2MA 2JACA 1AQXA 1PX7A 3HY2A 4FYUA 4G0LA 1EGOA 3RAZA 2CAIA 1OC9B 4F82A 3IK9A 4GXZA 5CREA 2KHPA 4GRFA 4YAVA 3ME8A 1AUCA 2IMEA 3TJGA 1AXDA 1GSSA 1Z7RA 4G0IA 12GSA 1B9XC 4O5UA 2AYTA 4HZ4A 5A4UA 5F0GA 3D4MA 2AUVA 2V32A 1Z9HA 3DKSA 4BPYA 2ZCTA 3DWVA 2CT6A 2I4AA 5GSTA 5DCHA 4MZWA 2GZZA 4JU5A 4RI7A 2J9HA 2GQMA 1X0RA 5CAXA 3IC4A 1GNWA 4XRAA 4XS4B 4POLA 2H66A 3D5JA 1GP1A 2QA2A 4GTUA 1GTIA 4PQIA 2H8LA 1XG8A 2X8CA 4XS6A 4ECCA 4KAEA 4N10A 4KA0A 2F8AA 3SWLA 3LW9A 2EC4A 5BRTA 4ZB6A 4BVYA 4FIWA 2H19A 1HYUA 1YF0A 4KE3A 3EMPA 5D9TA 1TTZA 2H30A 1SJZA 3F4SA 1LU4A 2L59A 2NTOA 1Z6NA 4FO5A 1R5AA 1ZYEA 4RQXA 1GL8A 3IA1A 1JZWA 4YQUA 1XZOA 2KP1A 3LFLA 2GS3A 3WGDA 2VL3A 1EWXA 2D2ZA 3GX8A 1THXA 1ZOFA 2LJKA 2FGXA 2VM2A 5HFKA 2FA8A 4DEJA 3IOSA 2B5YA 4HEA2 1GLPA 1EV4A 2JADA 2R0PA 2O85A 4KDXA 3QD9A 3TKSE 3J7Yk 4MF6A 4JE1A 5IMVA 2VO4A 2YN1A 3GL3A 3EWLA 3UBLA 1WOUA 2MZCA 2IFQB 4BL7A 4G10A 4NPBA 1Z6MA 3KMOA 2XHFA 1WE0A 3GSSA 2V6KA 4WEYA 3FZ9A 3C1SA 3IBHA 4G2EA 5JWOB 1Z5YE 4XTSA 2FWFA 5ECMB 1FOHA 1TU8A 1SK2A 3W6GA 2A4HA 4DSSA 1OC8A 2VAFA 3M3MA 3L9VA 1A2JA 4G9HA 3TJFA 1YKCA 4BL7B 2WFCA 4TR3A 4EE0A 1SL1B 19GSA 1PL1A 4O92A 3ZMLA 5DJLA 1B4PA 2I81A 2DBCA 2FWHA 2DJ3A 2PN8A 2ES7A 4K7NA 3ERWA 3TRXA 10GSA 2KUCA 2H75A 3KP8A 1X9MB 1ZYPA 3FHKA 4V2NA 2VCTA 3DRNA 1SK0A 4WXTA 1JZRA 3FEUA 1ZCPA 4O5QA 3RPPA 4POKA 4CDOA 2X8HA 2DMMA 1H4OA 4DSSB 5JCUA 4OFMA 3QAWA 4ISDA 1PGTA 3ERFA 3MAKA 2K9FA 4D73B 1UC7A 4IHUA 4HU9A 3SBCA 5IPHA 5JCGA 2L4QA 5D9VA 2G2QA 3FR9A 1VRSD 1ZGNA 1SKWB 4KB3A 4TRXA 4ECJA 2HZFA 5IQYA 4I6XA 5G2ZA 2CQ9A 4MNNA 3D4TA 4PUAA 2WGRA 4OD7A 2VL2C 3DVWA 4JR6A 4N11A 22GSA 6GSUA 4X0XA 2KLXA 1KNGA 2NVLA 1PD21 1SL2B 4JZQA 1ML6A 1M2AA 1F3BA 3LG6A 3US3A 4MF5A 3EU3A 2DIYA 4Z2RA 3GA4A 3IAM2 4ZBAA 3Q18A 4KCAA 6GSTA 3GKKA 2JSZA 2C3QA 3K8NA 5D73A 3N5OA 5D96A 2B5XA 1SJIA 1JHBA 3A2XA 1ZMAA 2UZ8A 2JU5A 3E0UA 1EP8A 1XW5A 3LQ7A 1K3OA 3ZYWA 2HRAA 2R3XA 4TKYA 1Q98A 4ZB9A 4F0CA 3CSIA 2HRKA 2E2GA 4QQ7A 5D8IA 1AQVA 1K0NA 5CO3A 5B6MA 2QC7A 1WIKA 1EEMA 3GTUA 4L0UA 2H76A 2X49A 3LYKA 3A2WA 4PGTA 3H79A 4ECBA 4KNDA 2IIYA 3TJBA 2XPEA 2LJAA 2RLIA 1GWCA 2IJYA 1GSYA 5E4WA 4IP6A 1XWKA 4WBJA 3F9UA 2C1YA 2X64A 3G7IA 5IMZA 2GSRA 3DVXA 2BMXA 4Q5QA 1U3AA 1W4VA 2LJRA 1OE8A 1O81A 3DD3A 3V1WA 4DVCA 4ML6A 5CRDA 3GTUB 4F0BA 3FW2A 3R3EA 1ST9A 3EINA 4KH7A 1Q4JA 5B8BA 5ELGA 1SYRA 4MJBA 3GURA 2DIZA 2WS2A 2MMNA 5ECIB 1T4ZA 5HR2A 5IO0A 1TK8B 1VF2A 3TDGA 3KM6A 2LUSA 2EIRA 3A5IA 1PX6A 1K0CA 5G30A 4FH8A 3HA9A 3FK8A 1ZL9A 1A8LA 2DJ2A 4TVEA 5F07A 3GYKA 2IMKA 4MABA 5GSSA 2O7KA 4GSNA 3HKRA 4NHWA 1PMTA 13GSA 2FCHA 3I43A 5IM9A 2L5LA 3M1GA 4EKZA 3GN3A 2LRCA 2P31A 5CRWA 3CTGA 3O3TA 3TRPA 3UBKA 4K6XA 1I9DA 4YAPA 1PKWA 3IAS2 4LLRA 5COHA 1PFOA 4JRRA 3ZL5A 1ACVA 3ZTLA 4HS1A 2CVBA 2X4AA 2VUPA 2HFDA 5IPGA 2R0CA 3KTLA 2NBSA 4KDYA 3WT2A 4EO3A 4FYCA 3ISOA 3LJRA 3DXBA 2N5BA 3CRTA 1VF4A 2V41A 3KJYA 2X99A 3GFKA 1TOFA 5J4UA 1RQMA 4GSSA 2VOCA 4IBPA 1PKZA 2VD1A 4O5RA 4IS0A 4EXJA 3KD0A 1A23A 3CTFA 2L6DA 2MMZA 1JFUA 3MDKA 3VWUA 2HE3A 4TXVA 4X4JA 1ERVA 4H86A 1BQ7A 2I3YA 4V2MA 3TGZA 4EF0A 3QDNA 1AQWA 3CQFA 2O8VB 1WP0A 5DALB 3HVNA 2PBJA 4MZBA 1Z7PA 5CP1A 3UIWA 3VPTA 1T8EB 2VCQA 1R5PA 1OKDA 4FYBA 1TDIA 4NHZA 2JZTA 1MD3A 5IMAA 3LORA 3IHQA 1DSBA 5ECOB 2FNOA 3TKPA 2QSIA 2IMDA 2OBIA 1R7HA 3LSZA 4KF9A 3IR4A 1WWJA 1PN0A 2HZEA 3BOAA 2OADA 4PQHA 2YV9A
chains in the Genus database with same CATH topology
3UEMA 3ED3A 5B6NA 5HFIA 3D22A 2HLSA 1FOVA 4IQAA 1R26A 5ECPB 3RHCA 5JCWA 3TOUA 3HVSA 1N8JA 4PNFA 1GUMA 4F9ZA 1SD8A 3MYDA 1F9MA 5DAKA 1IYHA 2K8SA 3F8UA 1V9WA 2LV3A 2IPAA 3ZFLA 4IELA 3DMLA 4ZBBA 4WR5A 4XHMA 2H73A 2DJKA 4MJCA 5DBQA 4QL9A 2PERA 2K8VA 3EURA 2CVKA 3PH9A 4CW9A 5G1KA 1THOA 3E9JB 3RBTA 4V1Ag 3BCIA 4Z7XA 1C72A 1U88A 3GIXA 5IIZA 2GZPA 3G9BA 3MIXA 11GSA 1HNBA 2VLTA 2YZHA 4A5PA 1M9AA 3QAVA 3CMIA 1ON4A 1FO5A 1X5CA 4K5RA 2FWEA 2AB6A 1PA3A 3UL3A 3EC3A 1SJ6A 1XCCA 2LNSA 2OBKA 2N5AA 3F3QA 3LYPA 1VGLA 1GSFA 5JWQB 1O8XA 1QK8A 1A0FA 1CQGA 2FA4A 4J56E 14GSA 2HI7A 2H01A 1OVNA 4BVYB 1TXXA 2V1MA 2B1LA 2WRTA 4OWYA 4BA7A 2F3MA 4IVFA 2A2PA 2VCWA 3LGCA 2YJHA 1BAYA 2A4VA 3S9FA 2CVDA 1FVKA 3FY7A 5CNWA 3KCMA 2PVOC 3H8QA 2P0GA 4MF7A 1YJ6A 1OC3A 5FT3A 5AIVA 5GAND 1J08A 3MWHA 2P5RA 2GZYA 3TB2A 1YEPA 1M0UA 2MYGA 2X8GA 5H5RA 1USBA 1TRUA 2H1GA 5FHIA 1NHOA 2C3TA 2L6CA 4F03A 2A2SA 4LMVA 3PPUA 1TI1A 5L71A 4N0VA 1M7TA 2XBIA 2Z9SA 1BJXA 4Q5NA 2TRCP 4EIQA 5KN3A 1G7OA 2GSTA 3BCKA 3M9KA 4HU7A 1HD2A 1GTAA 2EIQA 4KDUA 1G6YA 1XVQA 2XC2A 1EOHA 3IDVA 3KXOA 3P2AA 4BWSA 2OE0A 4Z2TA 4Z2UA 1PL2A 1FB6A 1X5DA 2OE1A 3L0HA 3P90A 4L8EA 5ECRB 2RUEA 4TN8A 5EL8A 5DCGA 3NIVA 5IO2A 5ECLB 2C0EA 4HJ2A 1M9BA 2LSTA 2ZUPA 3GUSA 3APOA 4ACSA 4WETA 2AHEA 1DE2A 16GSA 3Q6OA 4K7IA 2IWTA 1OAZA 2YP6A 4TR0A 2JSYA 5LCZA 3KH9A 1ZYNA 2DKIA 3P8WA 3APSA 1T7PB 1YF1A 4ZL7A 4NXIA 3CYNA 5FWGA 4I5QA 5H5SA 1TP9A 2JZSA 1MEKA 2CX4A 4Q5RA 5F8BA 4IN0A 4OFTA 4PX1A 5JWRB 3FZAA 1FVJA 4KCEA 4PNGA 1VF3A 1E2YA 2DMLA 5HQPA 17GSA 5LD0A 3CSJA 1AAZA 2GSQA 2VCZA 2RM5A 2GVPA 3F4TA 5ECSA 4YH2A 1TI3A 2CAQA 4AGSA 4PQ1A 2H72A 5C04A 5EVOA 2AV4A 18GSA 2C4JA 4I2TA 3KTBA 2M72A 1T4YA 1NSWA 2H6ZA 4LA1A 4YQVA 3H4KA 2GGTA 4GCIA 1A0RP 3EE2A 1B48A 3C1RA 2C0GA 2PVQA 1TRVA 3AY8A 5ECNB 1GSDA 4F2IA 1K0BA 2N5FA 1KBNA 2LQOA 5E59A 4OMVA 2VL9A 5IMFA 3TKQA 3GL5A 6GSSA 4MH2A 4NV2A 2IMFA 4L0WA 2H1DA 5ID2A 3CBUA 3VWXA 4AF2A 4TW5A 3GH9A 2WULA 3FYGA 2LS5A 5KOWA 1ERUA 4BVXA 4Q5FA 1X5EA 2GDRA 4N30A 6GSVA 5ABRA 3HJMA 1LBKA 3ME7A 2YJ7A 1IYIA 2F51A 1U87A 4K0GA 2L57A 1A2LA 5CRHA 1RK4A 4ULXA 1Y25A 1RW1A 2B7JA 1GNEA 3RPNA 1SU9A 4HDEA 2PMTA 3QR6A 3BD2A 1FB0A 1H75A 1XW9A 1F37A 1YEXA 4GQCA 1SKRB 1O85A 1BEDA 1XOAA 4BVXB 2LEGA 2YOIA 3QPMA 4EDYA 2HSHA 1T3BA 2HRNA 4MPGA 3WYWA 2CZ3A 2IN3A 4MP4A 3TJJA 4G0KA 3Q74A 4L5LA 3HJOA 5ECKB 1TK0B 5AGYA 3DIEA 2XBQA 1XW6A 3QAGA 2H74A 5GAPD 5DJMA 1TRSA 3N9JA 3IE3A 1QXHA 1WMJA 8GSSA 4JEDA 1G0TA 2BJXA 1V98A 1I5GA 4NV5A 1ERWA 1SK1A 1ZYQB 1EP7A 3TKSA 4HI7A 4HQSA 2I1UA 1UVZA 4OCEA 4ECIA 4RQRA 1EEJA 4DSRA 2HSYA 1F6MC 2CA8A 4K0NA 5KEJA 2H0GA 4MPFA 2CV4A 4EUYA 4YKFA 3NOFA 4HOJA 4IQ1A 1GRXA 2VD0A 1TKDB 4BWQA 3FMWA 3MNGA 2RM6A 3QCPA 3KP9A 3CXGA 4GQFA 4MH3A 1NW2A 4O7HA 1KTEA 2DKHA 5J41A 4XIHA 1NHYA 3F63A 1KEBA 4GF0A 5DQYA 2C8UA 2WZ9A 2WDUA 3HXSA 4RI6A 4NWYA 2OACA 3PINA 3W8JA 3VK9A 4YQMA 4FQUA 3J7Yb 2GT5A 3I6AA 3FZ4A 5BMUA 1DBYA 1S3CA 4OO4A 1TW9A 1MDKA 4NAXA 4PXOA 2B6MA 1HNAA 1Y6EA 1QGVA 4HJMA 4KUNA 3UVHA 1E6BA 3EVIA 1HNCA 3KZQA 5D93A 1OC9A 1GUHA 3M8NA 4I97A 4IP1A 1M99A 3VI5A 1BG5A 1EV9A 3ZREA 5KN1A 1J0FA 1SD9A 5IMDA 1V40A 1SYXA 1YKAA 1G7EA 5D9WA 2VM1A 1JLWA 2GQLA 2LNTA 3TRQA 4CHSA 2VL2A 1VF1A 2QKEA 1ILOA 4ZBDA 3A5WA 2GQKA 3F6FA 3C7MA 3U5RE 4MDCA 5GZZB 1XFLA 2P5QA 1TK5B 2LRNA 5J9BA 2ON5A 5J3RA 4K5SA 1T00A 3FZ5A 4EDZA 4HUAA 4XS4A 1EGRA 3LEFA 2VCXA 5HR1A 1GSUA 2C3NA 3C71A 3M9JA 2H1BA 4IJIA 3LXTA 5G1LA 3ZZXA 1NM3A 3NZNA 2TRXA 3EYTA 3GKNA 4WKWA 4EC0A 1A8YA 5LNKe 4QL7A 1FHEA 4YKGA 3TJKA 2H0HA 2MBSA 2QA1A 5HFGA 2HZEB 2JL4A 1ABAA 3FR6A 5ENUA 2VIMA 4LMWA 2NPBA 3ZVJD 4POMA 2DJ0A 3HYPA 4X1UA 4V1Ap 2YWIA 1PRXA 3HHVA 1F3AA 5DAKB 5HR3A 5D9XA 3U6VA 3FRCA 5B7CA 4ML1A 2KP2A 2B3SA 5AISA 1BX9A 1SENA 4K8MA 2B7KA 3H1NA 2CX3A 1OKTA 2E0QA 1URMA 1K0MA 4EVMA 2OE3A 3GMFA 3UOMA 1FW1A 2ALBA 5C00A 1O8WA 3L4NA 2R5GA 2E2MA 3W8SA 1PSQA 2KOKA 3IC8A 2K6VA 4MCUA 3HJPA 3GKXA 1GSQA 2IFQA 5G31A 5A5KA 1O6JA 2AAWA 4RUVA 3LWAA 3VURA 4GWRA 5AN1A 1CQHA 2PU9C 4LL4B 1TJDA 2OA7A 2HXKA 2RIIA 1XWCA 1QQ2A 4MLYA 1YY7A 4AJ6A 1LJRA 3UJ1A 3ZIJA 3WGEA 3F6DA 2C0DA 2G0FA 1YZXA 5KN2A 4PUFC 1DUGA 1F2EA 1Z3EA 1V58A 3QFBC 1WJKA 2O87A 5EY6A 3LXZA 4KGIA 3IV4A 5DDLA 3KGKA 1XIYA 4I8BA 4NMUA 1TU7A 3VLNA 2B1KA 1XWGA 3KMNA 4USSA 1XBSA 2PPTA 2LKUA 2VCVA 4OFNA 2R4VA 3ERGA 3TKSC 5KN0A 3IHGA 3GSTA 3L78A 3PGTA 2WJUA 1UA5A 3L9SA 2YWOA 1XXUA 1SL0B 3G7YA 3HD5A 3EU4A 2DSAA 2L4CA 4IGJA 3GKMA 3TOTA 3QFAC 5H5QA 3WT1A 2YANA 1AIUA 5AIXA 4K2XA 2YV7A 6GSXA 3HZ4A 2V6OA 2JZRA 6GSWA 4X43A 1EZKA 2MBTA 4TOPA 1FAAA 1V57A 4E8EA 4D73A 1BYEA 3F4RA 1J9BA 2LQQA 3RHBA 2H70A 4ZL8A 4TR1A 2C0FA 3O76A 2A2RA 3UMAA 1S3DA 2F9SA 5INYA 3TUEA 5B8AA 3KEBA 4EIPA 3E3EA 3IXRA 5A4VA 4DSQA 2FUG2 2ON7A 4POBA 4MMMA 3GHAA 1JZOA 7GSSA 4ZL9A 3HVXA 2YWNA 2H1AA 3GX0A 4KX4A 4V2LA 3FKFA 2GTUA 2DJJA 2FHEA 2R37A 3KH7A 2XPDA 1MDIA 3DEXA 3VI7A 3BJ5A 1M2DA 2YZUA 4TR1B 2B5EA 2OJLA 4KSOA 20GSA 3M0FA 3H93A 2R2JA 2HRFA 5CYYA 1JLVA 2HNLA 4K2DA 5IOXA 4HQZA 3ZVJA 2M46A 1QUWA 3EMXA 4K9ZA 1B8XA 2DJ1A 2YWMA 5A4WA 3HZ8A 1O73A 3FR3A 4JR4A 2OKAA 2FY6A 2O89A 1ZZYA 1K3LA 5ELAA 4TR4A 1WPIA 3A3TA 2PGTA 1HQOA 2LTKA 2H71A 3JCML 2FD3A 4ZILA 2CZ2A 4WR4A 1YDKA 4PURA 3APQA 2YCDA 3IRAA 2V2GA 3QOUA 1B9YC 1XWAA 4XRDA 9GSSA 1AC1A 4EL1A 1SKSB 1GTBA 5G5FA 1GULA 4IKHA 4LL1B 4OCFA 3IPZA 1W89A 1GSEA 1UN2A 4K7OA 2GLRA 1U3IA 3DYRA 4WF5A 1XVWA 2WCIA 1WRYA 3UVTA 1QFNA 1A24A 1K3YA 5CRGA 2H0IA 1K0OA 3P7XA 4J57E 2YNXA 1FG4A 1GTUA 2QGVA 3CRUA 4I2UA 5ECQB 3L9UA 3ZFBA 5IMCA 1OE7A 2VLVA 4ILFA 4P3YB 1MD4A 2VLUA 3GNJA 2GT6A 1K0AA 3MSZA 5ID2B 3OR5A 2FLSA 1GH2A 3GRXA 2DC5A 1OYJA 3VPQA 4MJAA 4O32A 4ZIJA 3ZRDA 3F0IA 1MDJA 2R0GA 4GLTA 3TKRA 3D0ZA 4TXOA 3QMXA 1GUKA 1K0DA 4J2FA 2YPMA 5DVBA 2MMAA 3PR8A 3ZIVA 4AJ8A 1X9SB 2J23A 5G5EA 4ZXGA 4PTSA 3VFIA 4E8HA 1PN9A 1XOBA 4JBBA 3VWVA 5EPFA 3RDWA 4WF4A 3O6TA 1YQ1A 2M80A 4ZB8A 4KSMA 4K1FA 2IL3A 1XWBA 4KW6A 6GSYA 1R4WA 5F06A 1EOGA 4ICYA 4TXOB 1T1VA 1U6TA 5KOXA 1ERTA 2LRTA 3UARA 2K18A 3ZLPA 4HZ2A 4ID0A 5DQSA 5IOWA 2HSMA 4WBRD 2MMOA 2BTOT 4IJ3A 4AJ7A 3C8EA 3KIJA 4OO5A 1X9WB 3HDCA 3F3RA 1AW9A 2ZNMA 1O7UA 2REMA 1PQNA 2NDOA 1DE1A 1G6WA 3G7JA 2HYXA 3DGQA 3VWWA 5F05A 1S3AA 1QMVA 3TCOA 4IW9A 3D6IA 2E7PA 1MTCA 3BBYA 4MZCA 5DALA 3EPTA 5HR0A 2HT9A 2GSSA 4N0ZA 4XS1A 2C80A 3Q19A 4MK3A 3D21A 4MA9A 1GLQA 3WD6A 1N2AA 3I9V2 5ECHB 3CSHA 3A2VA 2R6KA 3WGXA 3C73A 4GSTA 2EIOA 4CY8A 1XPVA 2FWGA 4CY6A 1JZDA 2PUKC 2TIRA 3I69A 3GH6A 5J5NA 2F8FA 3UAPA 2PWJA 3GV1A 5J9CA 4L5OA 2AJQB 2RUFA 2H6YA 2WB9A 4MJEA 3HCZA 2IMIA 3ZITA 4G19A 2H6XA 1TRWA 1B4QA 3IK7A 3HVVA 2I9HA 2DLXA 3R2QA 3ZMKA 2L5OA 1M2BA 1V2AA 4XCSA 1A2MA 2JACA 1AQXA 1PX7A 3HY2A 4FYUA 4G0LA 1EGOA 3RAZA 2CAIA 1OC9B 4F82A 3IK9A 4GXZA 5CREA 2KHPA 4GRFA 4YAVA 3ME8A 1AUCA 2IMEA 3TJGA 1AXDA 1GSSA 1Z7RA 4G0IA 12GSA 1B9XC 4O5UA 2AYTA 4HZ4A 5A4UA 5F0GA 3D4MA 2AUVA 2V32A 1Z9HA 3DKSA 4BPYA 2ZCTA 3DWVA 2CT6A 2I4AA 5GSTA 5DCHA 4MZWA 2GZZA 4JU5A 4RI7A 2J9HA 2GQMA 1X0RA 5CAXA 3IC4A 1GNWA 4XRAA 4XS4B 4POLA 2H66A 3D5JA 1GP1A 2QA2A 4GTUA 1GTIA 4PQIA 2H8LA 2X8CA 4XS6A 4ECCA 4KAEA 4N10A 4KA0A 2F8AA 3SWLA 3LW9A 2EC4A 5BRTA 4ZB6A 4BVYA 4FIWA 2H19A 1HYUA 1YF0A 4KE3A 3EMPA 5D9TA 1TTZA 2H30A 1SJZA 3F4SA 1LU4A 2L59A 2NTOA 1Z6NA 4FO5A 1R5AA 1ZYEA 4RQXA 1GL8A 3IA1A 1JZWA 4YQUA 1XZOA 2KP1A 3LFLA 2GS3A 3WGDA 2VL3A 1EWXA 2D2ZA 3GX8A 1THXA 1ZOFA 2LJKA 2FGXA 2VM2A 5HFKA 2FA8A 4DEJA 3IOSA 2B5YA 4HEA2 1GLPA 1EV4A 2JADA 2R0PA 2O85A 4KDXA 3QD9A 3TKSE 3J7Yk 4MF6A 4JE1A 5IMVA 2VO4A 2YN1A 3GL3A 3EWLA 3UBLA 1WOUA 2MZCA 2IFQB 4BL7A 4G10A 4NPBA 1Z6MA 3KMOA 2XHFA 1WE0A 3GSSA 2V6KA 4WEYA 3FZ9A 3C1SA 3IBHA 4G2EA 5JWOB 1Z5YE 4XTSA 2FWFA 5ECMB 1FOHA 1TU8A 1SK2A 3W6GA 2A4HA 4DSSA 1OC8A 2VAFA 3M3MA 3L9VA 1A2JA 4G9HA 3TJFA 1YKCA 4BL7B 2WFCA 4TR3A 4EE0A 1SL1B 19GSA 1PL1A 4O92A 3ZMLA 5DJLA 1B4PA 2I81A 2DBCA 2FWHA 2DJ3A 2PN8A 2ES7A 4K7NA 3ERWA 3TRXA 10GSA 2KUCA 2H75A 3KP8A 1X9MB 1ZYPA 3FHKA 4V2NA 2VCTA 3DRNA 1SK0A 4WXTA 1JZRA 3FEUA 1ZCPA 4O5QA 3RPPA 4POKA 4CDOA 2X8HA 2DMMA 1H4OA 4DSSB 5JCUA 4OFMA 3QAWA 4ISDA 1PGTA 3ERFA 3MAKA 2K9FA 4D73B 1UC7A 4IHUA 4HU9A 3SBCA 5IPHA 5JCGA 2L4QA 5D9VA 2G2QA 3FR9A 1VRSD 1ZGNA 1SKWB 4KB3A 4TRXA 4ECJA 2HZFA 5IQYA 4I6XA 5G2ZA 2CQ9A 4MNNA 3D4TA 4PUAA 2WGRA 4OD7A 2VL2C 3DVWA 4JR6A 4N11A 22GSA 6GSUA 4X0XA 2KLXA 1KNGA 2NVLA 1PD21 1SL2B 4JZQA 1ML6A 1M2AA 1F3BA 3LG6A 3US3A 4MF5A 3EU3A 2DIYA 4Z2RA 3GA4A 3IAM2 4ZBAA 3Q18A 4KCAA 6GSTA 3GKKA 2JSZA 2C3QA 3K8NA 5D73A 3N5OA 5D96A 2B5XA 1SJIA 1JHBA 3A2XA 1ZMAA 2UZ8A 2JU5A 3E0UA 1EP8A 1XW5A 3LQ7A 1K3OA 3ZYWA 2HRAA 2R3XA 4TKYA 1Q98A 4ZB9A 4F0CA 3CSIA 2HRKA 2E2GA 4QQ7A 5D8IA 1AQVA 1K0NA 5CO3A 5B6MA 2QC7A 1WIKA 1EEMA 3GTUA 4L0UA 2H76A 2X49A 3LYKA 3A2WA 4PGTA 3H79A 4ECBA 4KNDA 2IIYA 3TJBA 2XPEA 2LJAA 2RLIA 1GWCA 2IJYA 1GSYA 5E4WA 4IP6A 1XWKA 4WBJA 3F9UA 2C1YA 2X64A 3G7IA 5IMZA 2GSRA 3DVXA 2BMXA 4Q5QA 1U3AA 1W4VA 2LJRA 1OE8A 1O81A 3DD3A 3V1WA 4DVCA 4ML6A 5CRDA 3GTUB 4F0BA 3FW2A 3R3EA 1ST9A 3EINA 4KH7A 1Q4JA 5B8BA 5ELGA 1SYRA 4MJBA 3GURA 2DIZA 2WS2A 2MMNA 5ECIB 1T4ZA 5HR2A 5IO0A 1TK8B 1VF2A 3TDGA 3KM6A 2LUSA 2EIRA 3A5IA 1PX6A 1K0CA 5G30A 4FH8A 3HA9A 3FK8A 1ZL9A 1A8LA 2DJ2A 4TVEA 5F07A 3GYKA 2IMKA 4MABA 5GSSA 2O7KA 4GSNA 3HKRA 4NHWA 1PMTA 13GSA 2FCHA 3I43A 5IM9A 2L5LA 3M1GA 4EKZA 3GN3A 2LRCA 2P31A 5CRWA 3CTGA 3O3TA 3TRPA 3UBKA 4K6XA 1I9DA 4YAPA 1PKWA 3IAS2 4LLRA 5COHA 4JRRA 3ZL5A 1ACVA 3ZTLA 4HS1A 2CVBA 2X4AA 2VUPA 2HFDA 5IPGA 2R0CA 3KTLA 2NBSA 4KDYA 3WT2A 4EO3A 4FYCA 3ISOA 3LJRA 3DXBA 2N5BA 3CRTA 1VF4A 2V41A 3KJYA 2X99A 3GFKA 1TOFA 5J4UA 1RQMA 4GSSA 2VOCA 4IBPA 1PKZA 2VD1A 4O5RA 4IS0A 4EXJA 3KD0A 1A23A 3CTFA 2L6DA 2MMZA 1JFUA 3MDKA 3VWUA 2HE3A 4TXVA 4X4JA 1ERVA 4H86A 1BQ7A 2I3YA 4V2MA 3TGZA 4EF0A 3QDNA 1AQWA 2O8VB 1WP0A 5DALB 2PBJA 4MZBA 1Z7PA 5CP1A 3UIWA 3VPTA 1T8EB 2VCQA 1R5PA 1OKDA 4FYBA 1TDIA 4NHZA 2JZTA 1MD3A 5IMAA 3LORA 3IHQA 1DSBA 5ECOB 2FNOA 3TKPA 2QSIA 2IMDA 2OBIA 1R7HA 3LSZA 4KF9A 3IR4A 1WWJA 1PN0A 2HZEA 3BOAA 2OADA 4PQHA 2YV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEM A;  3ED3 A;  5B6N A;  5HFI A;  3D22 A;  2HLS A;  1FOV A;  4IQA A;  1R26 A;  5ECP B;  3RHC A;  5JCW A;  3TOU A;  3HVS A;  1N8J A;  4PNF A;  1GUM A;  4F9Z A;  1SD8 A;  1F9M A;  5DAK A;  1IYH A;  2K8S A;  3F8U A;  1V9W A;  2LV3 A;  2IPA A;  3ZFL A;  4IEL A;  3DML A;  4ZBB A;  4WR5 A;  4XHM A;  2H73 A;  2DJK A;  4MJC A;  5DBQ A;  4QL9 A;  2PER A;  2K8V A;  3EUR A;  2CVK A;  3PH9 A;  4CW9 A;  5G1K A;  1THO A;  3E9J B;  3RBT A;  4V1A g;  3BCI A;  4Z7X A;  1C72 A;  1U88 A;  3GIX A;  5IIZ A;  2GZP A;  3G9B A;  11GS A;  1HNB A;  2VLT A;  2YZH A;  1M9A A;  3QAV A;  3CMI A;  1ON4 A;  1FO5 A;  1X5C A;  2FWE A;  2AB6 A;  1PA3 A;  3UL3 A;  3EC3 A;  1SJ6 A;  1XCC A;  2LNS A;  2OBK A;  2N5A A;  3F3Q A;  3LYP A;  1VGL A;  1GSF A;  5JWQ B;  1O8X A;  1QK8 A;  1A0F A;  1CQG A;  2FA4 A;  4J56 E;  14GS A;  2HI7 A;  2H01 A;  1OVN A;  1TXX A;  2V1M A;  2B1L A;  2WRT A;  4OWY A;  4BA7 A;  2F3M A;  4IVF A;  2VCW A;  3LGC A;  2YJH A;  1BAY A;  2A4V A;  3S9F A;  2CVD A;  1FVK A;  3FY7 A;  5CNW A;  3KCM A;  2PVO C;  3H8Q A;  2P0G A;  4MF7 A;  1YJ6 A;  1OC3 A;  5FT3 A;  5AIV A;  5GAN D;  1J08 A;  3MWH A;  2P5R A;  2GZY A;  3TB2 A;  1YEP A;  1M0U A;  2MYG A;  2X8G A;  5H5R A;  1USB A;  1TRU A;  2H1G A;  5FHI A;  1NHO A;  2C3T A;  2L6C A;  4F03 A;  2A2S A;  4LMV A;  1TI1 A;  5L71 A;  4N0V A;  1M7T A;  2XBI A;  2Z9S A;  1BJX A;  4Q5N A;  2TRC P;  5KN3 A;  1G7O A;  2GST A;  3BCK A;  3M9K A;  4HU7 A;  1HD2 A;  1GTA A;  2EIQ A;  4KDU A;  1G6Y A;  1XVQ A;  2XC2 A;  1EOH A;  3IDV A;  3KXO A;  3P2A A;  4BWS A;  2OE0 A;  1PL2 A;  1FB6 A;  1X5D A;  2OE1 A;  3L0H A;  3P90 A;  4L8E A;  5ECR B;  2RUE A;  4TN8 A;  5EL8 A;  5DCG A;  3NIV A;  5IO2 A;  5ECL B;  2C0E A;  4HJ2 A;  1M9B A;  2LST A;  2ZUP A;  3GUS A;  3APO A;  4ACS A;  4WET A;  2AHE A;  1DE2 A;  16GS A;  3Q6O A;  4K7I A;  2IWT A;  1OAZ A;  2YP6 A;  4TR0 A;  2JSY A;  5LCZ A;  3KH9 A;  3P8W A;  3APS A;  1T7P B;  1YF1 A;  4ZL7 A;  4NXI A;  3CYN A;  5FWG A;  4I5Q A;  5H5S A;  1TP9 A;  2JZS A;  1MEK A;  2CX4 A;  4Q5R A;  5F8B A;  4IN0 A;  4OFT A;  4PX1 A;  5JWR B;  3FZA A;  1FVJ A;  4KCE A;  4PNG A;  1VF3 A;  1E2Y A;  2DML A;  5HQP A;  17GS A;  5LD0 A;  3CSJ A;  1AAZ A;  2GSQ A;  2VCZ A;  2RM5 A;  2GVP A;  3F4T A;  5ECS A;  4YH2 A;  1TI3 A;  2CAQ A;  4AGS A;  4PQ1 A;  2H72 A;  5C04 A;  5EVO A;  2AV4 A;  18GS A;  2C4J A;  4I2T A;  3KTB A;  2M72 A;  1T4Y A;  1NSW A;  2H6Z A;  4LA1 A;  4YQV A;  3H4K A;  2GGT A;  4GCI A;  1A0R P;  3EE2 A;  1B48 A;  3C1R A;  2C0G A;  2PVQ A;  1TRV A;  3AY8 A;  5ECN B;  1GSD A;  4F2I A;  1K0B A;  2N5F A;  1KBN A;  2LQO A;  5E59 A;  4OMV A;  2VL9 A;  5IMF A;  3TKQ A;  3GL5 A;  6GSS A;  4MH2 A;  4NV2 A;  2IMF A;  4L0W A;  2H1D A;  5ID2 A;  3CBU A;  3VWX A;  4AF2 A;  4TW5 A;  3GH9 A;  2WUL A;  3FYG A;  2LS5 A;  1ERU A;  4BVX A;  4Q5F A;  1X5E A;  2GDR A;  4N30 A;  6GSV A;  5ABR A;  3HJM A;  1LBK A;  3ME7 A;  2YJ7 A;  1IYI A;  2F51 A;  1U87 A;  4K0G A;  2L57 A;  1A2L A;  5CRH A;  1RK4 A;  4ULX A;  1Y25 A;  1RW1 A;  2B7J A;  1GNE A;  3RPN A;  1SU9 A;  4HDE A;  2PMT A;  3QR6 A;  3BD2 A;  1FB0 A;  1H75 A;  1XW9 A;  1F37 A;  1YEX A;  4GQC A;  1SKR B;  1O85 A;  1BED A;  1XOA A;  2LEG A;  2YOI A;  3QPM A;  4EDY A;  2HSH A;  1T3B A;  2HRN A;  4MPG A;  3WYW A;  2CZ3 A;  2IN3 A;  4MP4 A;  3TJJ A;  3Q74 A;  4L5L A;  3HJO A;  5ECK B;  1TK0 B;  5AGY A;  3DIE A;  2XBQ A;  1XW6 A;  3QAG A;  2H74 A;  5GAP D;  5DJM A;  1TRS A;  3N9J A;  3IE3 A;  1QXH A;  1WMJ A;  8GSS A;  4JED A;  1G0T A;  2BJX A;  1V98 A;  1I5G A;  4NV5 A;  1ERW A;  1SK1 A;  1ZYQ B;  1EP7 A;  3TKS A;  4HI7 A;  4HQS A;  2I1U A;  1UVZ A;  4OCE A;  4ECI A;  4RQR A;  1EEJ A;  4DSR A;  2HSY A;  1F6M C;  2CA8 A;  4K0N A;  5KEJ A;  2H0G A;  4MPF A;  2CV4 A;  4EUY A;  3NOF A;  4HOJ A;  4IQ1 A;  1GRX A;  2VD0 A;  1TKD B;  4BWQ A;  3MNG A;  2RM6 A;  3QCP A;  3KP9 A;  3CXG A;  4GQF A;  4MH3 A;  1NW2 A;  4O7H A;  1KTE A;  5J41 A;  4XIH A;  1NHY A;  3F63 A;  1KEB A;  4GF0 A;  5DQY A;  2C8U A;  2WZ9 A;  2WDU A;  3HXS A;  4NWY A;  4RI6 A;  2OAC A;  3PIN A;  3W8J A;  3VK9 A;  4YQM A;  3J7Y b;  2GT5 A;  3I6A A;  3FZ4 A;  1DBY A;  1S3C A;  4OO4 A;  1TW9 A;  1MDK A;  4NAX A;  4PXO A;  2B6M A;  1HNA A;  1Y6E A;  1QGV A;  4HJM A;  4KUN A;  3UVH A;  1E6B A;  3EVI A;  1HNC A;  3KZQ A;  5D93 A;  1OC9 A;  1GUH A;  3M8N A;  4I97 A;  4IP1 A;  1M99 A;  3VI5 A;  1BG5 A;  1EV9 A;  3ZRE A;  5KN1 A;  1J0F A;  1SD9 A;  5IMD A;  1V40 A;  1SYX A;  1YKA A;  1G7E A;  5D9W A;  2VM1 A;  1JLW A;  2GQL A;  2LNT A;  3TRQ A;  4CHS A;  2VL2 A;  1VF1 A;  2QKE A;  1ILO A;  4ZBD A;  3A5W A;  2GQK A;  3F6F A;  3C7M A;  3U5R E;  4MDC A;  5GZZ B;  1XFL A;  2P5Q A;  1TK5 B;  2LRN A;  5J9B A;  2ON5 A;  5J3R A;  1T00 A;  3FZ5 A;  4EDZ A;  4HUA A;  4XS4 A;  1EGR A;  3LEF A;  2VCX A;  5HR1 A;  1GSU A;  2C3N A;  3C71 A;  3M9J A;  2H1B A;  4IJI A;  3LXT A;  5G1L A;  3ZZX A;  1NM3 A;  3NZN A;  2TRX A;  3EYT A;  3GKN A;  4WKW A;  4EC0 A;  1A8Y A;  5LNK e;  4QL7 A;  1FHE A;  3TJK A;  2H0H A;  2MBS A;  5HFG A;  2HZE B;  2JL4 A;  1ABA A;  3FR6 A;  5ENU A;  2VIM A;  4LMW A;  2NPB A;  3ZVJ D;  4POM A;  2DJ0 A;  3HYP A;  4X1U A;  4V1A p;  2YWI A;  1PRX A;  3HHV A;  1F3A A;  5DAK B;  5HR3 A;  5D9X A;  3U6V A;  3FRC A;  5B7C A;  4ML1 A;  2KP2 A;  2B3S A;  5AIS A;  1BX9 A;  1SEN A;  4K8M A;  2B7K A;  3H1N A;  2CX3 A;  1OKT A;  2E0Q A;  1URM A;  1K0M A;  4EVM A;  2OE3 A;  3GMF A;  3UOM A;  1FW1 A;  2ALB A;  5C00 A;  1O8W A;  3L4N A;  2R5G A;  2E2M A;  3W8S A;  1PSQ A;  2KOK A;  2K6V A;  4MCU A;  3HJP A;  3GKX A;  1GSQ A;  2IFQ A;  5G31 A;  5A5K A;  1O6J A;  2AAW A;  4RUV A;  3LWA A;  3VUR A;  4GWR A;  5AN1 A;  1CQH A;  2PU9 C;  4LL4 B;  1TJD A;  2OA7 A;  2HXK A;  2RII A;  1XWC A;  1QQ2 A;  4MLY A;  1YY7 A;  4AJ6 A;  1LJR A;  3UJ1 A;  3ZIJ A;  3WGE A;  3F6D A;  2C0D A;  2G0F A;  1YZX A;  5KN2 A;  4PUF C;  1DUG A;  1F2E A;  1Z3E A;  1V58 A;  3QFB C;  1WJK A;  2O87 A;  5EY6 A;  3LXZ A;  4KGI A;  3IV4 A;  5DDL A;  3KGK A;  1XIY A;  4I8B A;  4NMU A;  1TU7 A;  3VLN A;  2B1K A;  1XWG A;  3KMN A;  1XBS A;  2PPT A;  2LKU A;  2VCV A;  4OFN A;  2R4V A;  3ERG A;  3TKS C;  5KN0 A;  3GST A;  3L78 A;  3PGT A;  2WJU A;  1UA5 A;  3L9S A;  2YWO A;  1XXU A;  1SL0 B;  3G7Y A;  3HD5 A;  3EU4 A;  2DSA A;  2L4C A;  4IGJ A;  3GKM A;  3TOT A;  3QFA C;  5H5Q A;  3WT1 A;  2YAN A;  1AIU A;  5AIX A;  2YV7 A;  6GSX A;  3HZ4 A;  2V6O A;  2JZR A;  6GSW A;  4X43 A;  1EZK A;  2MBT A;  4TOP A;  1FAA A;  1V57 A;  4E8E A;  4D73 A;  1BYE A;  3F4R A;  1J9B A;  2LQQ A;  3RHB A;  2H70 A;  4ZL8 A;  4TR1 A;  2C0F A;  3O76 A;  2A2R A;  3UMA A;  1S3D A;  2F9S A;  5INY A;  3TUE A;  5B8A A;  3KEB A;  3E3E A;  3IXR A;  5A4V A;  4DSQ A;  2FUG 2;  2ON7 A;  4POB A;  4MMM A;  3GHA A;  1JZO A;  7GSS A;  4ZL9 A;  3HVX A;  2YWN A;  2H1A A;  3GX0 A;  4KX4 A;  4V2L A;  3FKF A;  2GTU A;  2DJJ A;  2FHE A;  2R37 A;  3KH7 A;  2XPD A;  1MDI A;  3DEX A;  3VI7 A;  3BJ5 A;  1M2D A;  2YZU A;  4TR1 B;  2B5E A;  2OJL A;  4KSO A;  20GS A;  3M0F A;  3H93 A;  2R2J A;  2HRF A;  5CYY A;  1JLV A;  2HNL A;  4K2D A;  5IOX A;  4HQZ A;  3ZVJ A;  2M46 A;  1QUW A;  3EMX A;  4K9Z A;  1B8X A;  2DJ1 A;  2YWM A;  5A4W A;  3HZ8 A;  1O73 A;  3FR3 A;  4JR4 A;  2OKA A;  2FY6 A;  2O89 A;  1ZZY A;  1K3L A;  5ELA A;  4TR4 A;  1WPI A;  3A3T A;  2PGT A;  1HQO A;  2LTK A;  2H71 A;  3JCM L;  2FD3 A;  4ZIL A;  2CZ2 A;  4WR4 A;  1YDK A;  4PUR A;  3APQ A;  2YCD A;  3IRA A;  2V2G A;  3QOU A;  1B9Y C;  1XWA A;  4XRD A;  9GSS A;  1AC1 A;  4EL1 A;  1SKS B;  1GTB A;  5G5F A;  1GUL A;  4IKH A;  4LL1 B;  4OCF A;  3IPZ A;  1W89 A;  1GSE A;  1UN2 A;  4K7O A;  2GLR A;  1U3I A;  3DYR A;  4WF5 A;  1XVW A;  2WCI A;  1WRY A;  3UVT A;  1QFN A;  1A24 A;  1K3Y A;  5CRG A;  2H0I A;  1K0O A;  3P7X A;  4J57 E;  2YNX A;  1FG4 A;  1GTU A;  2QGV A;  3CRU A;  4I2U A;  5ECQ B;  3L9U A;  3ZFB A;  5IMC A;  1OE7 A;  2VLV A;  4ILF A;  4P3Y B;  1MD4 A;  2VLU A;  3GNJ A;  2GT6 A;  1K0A A;  3MSZ A;  5ID2 B;  3OR5 A;  2FLS A;  1GH2 A;  3GRX A;  2DC5 A;  1OYJ A;  3VPQ A;  4MJA A;  4O32 A;  4ZIJ A;  3ZRD A;  3F0I A;  1MDJ A;  4GLT A;  3TKR A;  3D0Z A;  4TXO A;  3QMX A;  1GUK A;  1K0D A;  4J2F A;  2YPM A;  5DVB A;  2MMA A;  3PR8 A;  3ZIV A;  4AJ8 A;  1X9S B;  2J23 A;  5G5E A;  4ZXG A;  3VFI A;  4E8H A;  1PN9 A;  1XOB A;  4JBB A;  3VWV A;  5EPF A;  3RDW A;  4WF4 A;  3O6T A;  1YQ1 A;  2M80 A;  4ZB8 A;  4KSM A;  4K1F A;  2IL3 A;  1XWB A;  4KW6 A;  6GSY A;  1R4W A;  5F06 A;  1EOG A;  4TXO B;  1T1V A;  1U6T A;  1ERT A;  2LRT A;  3UAR A;  2K18 A;  3ZLP A;  4HZ2 A;  4ID0 A;  5DQS A;  5IOW A;  4WBR D;  2MMO A;  2BTO T;  4IJ3 A;  4AJ7 A;  3C8E A;  3KIJ A;  4OO5 A;  1X9W B;  3HDC A;  3F3R A;  1AW9 A;  2ZNM A;  1O7U A;  2REM A;  1PQN A;  2NDO A;  1DE1 A;  1G6W A;  3G7J A;  2HYX A;  3DGQ A;  3VWW A;  5F05 A;  1S3A A;  1QMV A;  3TCO A;  4IW9 A;  3D6I A;  2E7P A;  1MTC A;  3BBY A;  4MZC A;  5DAL A;  5HR0 A;  2HT9 A;  2GSS A;  4N0Z A;  4XS1 A;  2C80 A;  3Q19 A;  4MK3 A;  3D21 A;  4MA9 A;  1GLQ A;  3WD6 A;  1N2A A;  3I9V 2;  5ECH B;  3CSH A;  3A2V A;  2R6K A;  3WGX A;  3C73 A;  4GST A;  2EIO A;  1XPV A;  2FWG A;  1JZD A;  2PUK C;  2TIR A;  3I69 A;  3GH6 A;  5J5N A;  2F8F A;  3UAP A;  2PWJ A;  3GV1 A;  5J9C A;  4L5O A;  2AJQ B;  2RUF A;  2H6Y A;  2WB9 A;  4MJE A;  3HCZ A;  2IMI A;  3ZIT A;  4G19 A;  2H6X A;  1TRW A;  1B4Q A;  3IK7 A;  3HVV A;  2I9H A;  2DLX A;  3R2Q A;  3ZMK A;  2L5O A;  1M2B A;  1V2A A;  4XCS A;  1A2M A;  2JAC A;  1AQX A;  1PX7 A;  3HY2 A;  4FYU A;  1EGO A;  3RAZ A;  2CAI A;  1OC9 B;  4F82 A;  3IK9 A;  4GXZ A;  5CRE A;  2KHP A;  4GRF A;  4YAV A;  3ME8 A;  1AUC A;  2IME A;  3TJG A;  1AXD A;  1GSS A;  1Z7R A;  12GS A;  1B9X C;  2AYT A;  4HZ4 A;  5A4U A;  5F0G A;  3D4M A;  2AUV A;  2V32 A;  1Z9H A;  3DKS A;  4BPY A;  2ZCT A;  3DWV A;  2CT6 A;  2I4A A;  5GST A;  5DCH A;  4MZW A;  2GZZ A;  4JU5 A;  4RI7 A;  2J9H A;  2GQM A;  1X0R A;  5CAX A;  3IC4 A;  1GNW A;  4XRA A;  4XS4 B;  4POL A;  2H66 A;  3D5J A;  1GP1 A;  4GTU A;  1GTI A;  4PQI A;  2H8L A;  2X8C A;  4XS6 A;  4ECC A;  4KAE A;  4N10 A;  4KA0 A;  2F8A A;  3SWL A;  2EC4 A;  4ZB6 A;  4BVY A;  4FIW A;  2H19 A;  1HYU A;  1YF0 A;  4KE3 A;  3EMP A;  5D9T A;  1TTZ A;  2H30 A;  1SJZ A;  3F4S A;  1LU4 A;  2L59 A;  2NTO A;  1Z6N A;  4FO5 A;  1R5A A;  1ZYE A;  4RQX A;  1GL8 A;  3IA1 A;  1JZW A;  4YQU A;  1XZO A;  2KP1 A;  3LFL A;  2GS3 A;  3WGD A;  2VL3 A;  1EWX A;  2D2Z A;  3GX8 A;  1THX A;  1ZOF A;  2LJK A;  2FGX A;  2VM2 A;  5HFK A;  2FA8 A;  4DEJ A;  3IOS A;  2B5Y A;  4HEA 2;  1GLP A;  1EV4 A;  2JAD A;  2O85 A;  4KDX A;  3QD9 A;  3TKS E;  3J7Y k;  4MF6 A;  4JE1 A;  5IMV A;  2VO4 A;  2YN1 A;  3GL3 A;  3EWL A;  3UBL A;  1WOU A;  2MZC A;  2IFQ B;  4BL7 A;  4G10 A;  4NPB A;  1Z6M A;  3KMO A;  2XHF A;  1WE0 A;  3GSS A;  2V6K A;  4WEY A;  3FZ9 A;  3C1S A;  3IBH A;  4G2E A;  5JWO B;  1Z5Y E;  4XTS A;  2FWF A;  5ECM B;  1TU8 A;  1SK2 A;  3W6G A;  4DSS A;  1OC8 A;  2VAF A;  3M3M A;  3L9V A;  1A2J A;  4G9H A;  3TJF A;  1YKC A;  2WFC A;  4TR3 A;  4EE0 A;  1SL1 B;  19GS A;  1PL1 A;  4O92 A;  3ZML A;  5DJL A;  1B4P A;  2I81 A;  2DBC A;  2FWH A;  2DJ3 A;  2PN8 A;  2ES7 A;  4K7N A;  3ERW A;  3TRX A;  10GS A;  2KUC A;  2H75 A;  3KP8 A;  1X9M B;  3FHK A;  4V2N A;  2VCT A;  3DRN A;  1SK0 A;  4WXT A;  1JZR A;  3FEU A;  1ZCP A;  3RPP A;  4POK A;  4CDO A;  2X8H A;  2DMM A;  1H4O A;  4DSS B;  5JCU A;  4OFM A;  3QAW A;  4ISD A;  1PGT A;  3ERF A;  3MAK A;  2K9F A;  4D73 B;  1UC7 A;  4IHU A;  4HU9 A;  3SBC A;  5IPH A;  5JCG A;  2L4Q A;  5D9V A;  2G2Q A;  3FR9 A;  1VRS D;  1ZGN A;  1SKW B;  4KB3 A;  4TRX A;  4ECJ A;  2HZF A;  5IQY A;  4I6X A;  5G2Z A;  2CQ9 A;  3D4T A;  4PUA A;  2WGR A;  4OD7 A;  2VL2 C;  3DVW A;  4JR6 A;  4N11 A;  22GS A;  6GSU A;  4X0X A;  2KLX A;  1KNG A;  2NVL A;  1PD2 1;  1SL2 B;  4JZQ A;  1ML6 A;  1M2A A;  1F3B A;  3LG6 A;  3US3 A;  4MF5 A;  3EU3 A;  2DIY A;  3GA4 A;  3IAM 2;  4ZBA A;  3Q18 A;  4KCA A;  6GST A;  3GKK A;  2JSZ A;  2C3Q A;  3K8N A;  5D73 A;  3N5O A;  5D96 A;  2B5X A;  1SJI A;  1JHB A;  3A2X A;  1ZMA A;  2JU5 A;  3E0U A;  1EP8 A;  1XW5 A;  3LQ7 A;  1K3O A;  3ZYW A;  2R3X A;  4TKY A;  1Q98 A;  4ZB9 A;  4F0C A;  3CSI A;  2E2G A;  4QQ7 A;  5D8I A;  1AQV A;  1K0N A;  5CO3 A;  5B6M A;  2QC7 A;  1WIK A;  1EEM A;  3GTU A;  4L0U A;  2H76 A;  3LYK A;  3A2W A;  4PGT A;  3H79 A;  4ECB A;  4KND A;  2IIY A;  3TJB A;  2XPE A;  2LJA A;  2RLI A;  1GWC A;  2IJY A;  1GSY A;  5E4W A;  4IP6 A;  1XWK A;  4WBJ A;  3F9U A;  2C1Y A;  2X64 A;  3G7I A;  5IMZ A;  2GSR A;  3DVX A;  2BMX A;  4Q5Q A;  1U3A A;  1W4V A;  2LJR A;  1OE8 A;  1O81 A;  3DD3 A;  3V1W A;  4DVC A;  4ML6 A;  5CRD A;  3GTU B;  4F0B A;  3FW2 A;  1ST9 A;  3EIN A;  4KH7 A;  1Q4J A;  5B8B A;  5ELG A;  1SYR A;  4MJB A;  3GUR A;  2DIZ A;  2WS2 A;  2MMN A;  5ECI B;  1T4Z A;  5HR2 A;  5IO0 A;  1TK8 B;  1VF2 A;  3TDG A;  3KM6 A;  2LUS A;  2EIR A;  1PX6 A;  1K0C A;  5G30 A;  4FH8 A;  3HA9 A;  3FK8 A;  1ZL9 A;  1A8L A;  2DJ2 A;  4TVE A;  5F07 A;  3GYK A;  2IMK A;  4MAB A;  5GSS A;  2O7K A;  4GSN A;  3HKR A;  4NHW A;  1PMT A;  13GS A;  2FCH A;  3I43 A;  5IM9 A;  2L5L A;  3M1G A;  4EKZ A;  3GN3 A;  2LRC A;  2P31 A;  5CRW A;  3CTG A;  3O3T A;  3TRP A;  3UBK A;  4K6X A;  1I9D A;  4YAP A;  1PKW A;  3IAS 2;  4LLR A;  5COH A;  4JRR A;  3ZL5 A;  1ACV A;  3ZTL A;  4HS1 A;  2CVB A;  2VUP A;  2HFD A;  5IPG A;  3KTL A;  2NBS A;  4KDY A;  3WT2 A;  4EO3 A;  4FYC A;  3ISO A;  3LJR A;  3DXB A;  2N5B A;  3CRT A;  1VF4 A;  2V41 A;  3KJY A;  2X99 A;  3GFK A;  1TOF A;  5J4U A;  1RQM A;  4GSS A;  2VOC A;  4IBP A;  1PKZ A;  2VD1 A;  4O5R A;  4IS0 A;  4EXJ A;  3KD0 A;  1A23 A;  3CTF A;  2L6D A;  2MMZ A;  1JFU A;  3MDK A;  3VWU A;  2HE3 A;  4TXV A;  1ERV A;  4H86 A;  1BQ7 A;  2I3Y A;  4V2M A;  3TGZ A;  4EF0 A;  3QDN A;  1AQW A;  2O8V B;  1WP0 A;  5DAL B;  2PBJ A;  4MZB A;  1Z7P A;  5CP1 A;  3UIW A;  3VPT A;  1T8E B;  2VCQ A;  1R5P A;  1OKD A;  4FYB A;  1TDI A;  4NHZ A;  2JZT A;  1MD3 A;  5IMA A;  3LOR A;  3IHQ A;  1DSB A;  5ECO B;  2FNO A;  3TKP A;  2QSI A;  2IMD A;  2OBI A;  1R7H A;  3LSZ A;  3IR4 A;  1WWJ A;  2HZE A;  3BOA A;  2OAD A;  4PQH A;  2YV9 A; 
#chains in the Genus database with same CATH topology
 3UEM A;  3ED3 A;  5B6N A;  5HFI A;  3D22 A;  2HLS A;  1FOV A;  4IQA A;  1R26 A;  5ECP B;  3RHC A;  5JCW A;  3TOU A;  3HVS A;  1N8J A;  4PNF A;  1GUM A;  4F9Z A;  1SD8 A;  3MYD A;  1F9M A;  5DAK A;  1IYH A;  2K8S A;  3F8U A;  1V9W A;  2LV3 A;  2IPA A;  3ZFL A;  4IEL A;  3DML A;  4ZBB A;  4WR5 A;  4XHM A;  2H73 A;  2DJK A;  4MJC A;  5DBQ A;  4QL9 A;  2PER A;  2K8V A;  3EUR A;  2CVK A;  3PH9 A;  4CW9 A;  5G1K A;  1THO A;  3E9J B;  3RBT A;  4V1A g;  3BCI A;  4Z7X A;  1C72 A;  1U88 A;  3GIX A;  5IIZ A;  2GZP A;  3G9B A;  3MIX A;  11GS A;  1HNB A;  2VLT A;  2YZH A;  4A5P A;  1M9A A;  3QAV A;  3CMI A;  1ON4 A;  1FO5 A;  1X5C A;  4K5R A;  2FWE A;  2AB6 A;  1PA3 A;  3UL3 A;  3EC3 A;  1SJ6 A;  1XCC A;  2LNS A;  2OBK A;  2N5A A;  3F3Q A;  3LYP A;  1VGL A;  1GSF A;  5JWQ B;  1O8X A;  1QK8 A;  1A0F A;  1CQG A;  2FA4 A;  4J56 E;  14GS A;  2HI7 A;  2H01 A;  1OVN A;  4BVY B;  1TXX A;  2V1M A;  2B1L A;  2WRT A;  4OWY A;  4BA7 A;  2F3M A;  4IVF A;  2A2P A;  2VCW A;  3LGC A;  2YJH A;  1BAY A;  2A4V A;  3S9F A;  2CVD A;  1FVK A;  3FY7 A;  5CNW A;  3KCM A;  2PVO C;  3H8Q A;  2P0G A;  4MF7 A;  1YJ6 A;  1OC3 A;  5FT3 A;  5AIV A;  5GAN D;  1J08 A;  3MWH A;  2P5R A;  2GZY A;  3TB2 A;  1YEP A;  1M0U A;  2MYG A;  2X8G A;  5H5R A;  1USB A;  1TRU A;  2H1G A;  5FHI A;  1NHO A;  2C3T A;  2L6C A;  4F03 A;  2A2S A;  4LMV A;  3PPU A;  1TI1 A;  5L71 A;  4N0V A;  1M7T A;  2XBI A;  2Z9S A;  1BJX A;  4Q5N A;  2TRC P;  4EIQ A;  5KN3 A;  1G7O A;  2GST A;  3BCK A;  3M9K A;  4HU7 A;  1HD2 A;  1GTA A;  2EIQ A;  4KDU A;  1G6Y A;  1XVQ A;  2XC2 A;  1EOH A;  3IDV A;  3KXO A;  3P2A A;  4BWS A;  2OE0 A;  4Z2T A;  4Z2U A;  1PL2 A;  1FB6 A;  1X5D A;  2OE1 A;  3L0H A;  3P90 A;  4L8E A;  5ECR B;  2RUE A;  4TN8 A;  5EL8 A;  5DCG A;  3NIV A;  5IO2 A;  5ECL B;  2C0E A;  4HJ2 A;  1M9B A;  2LST A;  2ZUP A;  3GUS A;  3APO A;  4ACS A;  4WET A;  2AHE A;  1DE2 A;  16GS A;  3Q6O A;  4K7I A;  2IWT A;  1OAZ A;  2YP6 A;  4TR0 A;  2JSY A;  5LCZ A;  3KH9 A;  1ZYN A;  2DKI A;  3P8W A;  3APS A;  1T7P B;  1YF1 A;  4ZL7 A;  4NXI A;  3CYN A;  5FWG A;  4I5Q A;  5H5S A;  1TP9 A;  2JZS A;  1MEK A;  2CX4 A;  4Q5R A;  5F8B A;  4IN0 A;  4OFT A;  4PX1 A;  5JWR B;  3FZA A;  1FVJ A;  4KCE A;  4PNG A;  1VF3 A;  1E2Y A;  2DML A;  5HQP A;  17GS A;  5LD0 A;  3CSJ A;  1AAZ A;  2GSQ A;  2VCZ A;  2RM5 A;  2GVP A;  3F4T A;  5ECS A;  4YH2 A;  1TI3 A;  2CAQ A;  4AGS A;  4PQ1 A;  2H72 A;  5C04 A;  5EVO A;  2AV4 A;  18GS A;  2C4J A;  4I2T A;  3KTB A;  2M72 A;  1T4Y A;  1NSW A;  2H6Z A;  4LA1 A;  4YQV A;  3H4K A;  2GGT A;  4GCI A;  1A0R P;  3EE2 A;  1B48 A;  3C1R A;  2C0G A;  2PVQ A;  1TRV A;  3AY8 A;  5ECN B;  1GSD A;  4F2I A;  1K0B A;  2N5F A;  1KBN A;  2LQO A;  5E59 A;  4OMV A;  2VL9 A;  5IMF A;  3TKQ A;  3GL5 A;  6GSS A;  4MH2 A;  4NV2 A;  2IMF A;  4L0W A;  2H1D A;  5ID2 A;  3CBU A;  3VWX A;  4AF2 A;  4TW5 A;  4BIK A;  3GH9 A;  2WUL A;  3FYG A;  2LS5 A;  5KOW A;  1ERU A;  4BVX A;  4Q5F A;  1X5E A;  2GDR A;  4N30 A;  6GSV A;  5ABR A;  3HJM A;  1LBK A;  3ME7 A;  2YJ7 A;  1IYI A;  2F51 A;  1U87 A;  4K0G A;  2L57 A;  1A2L A;  5CRH A;  1RK4 A;  4ULX A;  1Y25 A;  1RW1 A;  2B7J A;  1GNE A;  3RPN A;  1SU9 A;  4HDE A;  2PMT A;  3QR6 A;  3BD2 A;  1FB0 A;  1H75 A;  1XW9 A;  1F37 A;  1YEX A;  4GQC A;  1SKR B;  1O85 A;  1BED A;  1XOA A;  4BVX B;  2LEG A;  2YOI A;  3QPM A;  1M3J A;  4EDY A;  2HSH A;  1T3B A;  2HRN A;  4MPG A;  3WYW A;  2CZ3 A;  2IN3 A;  4MP4 A;  3TJJ A;  4G0K A;  3Q74 A;  4L5L A;  3HJO A;  5ECK B;  1TK0 B;  5AGY A;  3DIE A;  2XBQ A;  1XW6 A;  3QAG A;  2H74 A;  5GAP D;  5DJM A;  1TRS A;  3N9J A;  3IE3 A;  1QXH A;  1WMJ A;  8GSS A;  4JED A;  1G0T A;  2BJX A;  1V98 A;  1I5G A;  4NV5 A;  1ERW A;  1SK1 A;  1ZYQ B;  1EP7 A;  3TKS A;  4HI7 A;  4HQS A;  2I1U A;  1UVZ A;  4OCE A;  4ECI A;  4RQR A;  1EEJ A;  4DSR A;  2HSY A;  1F6M C;  2CA8 A;  4K0N A;  5KEJ A;  2H0G A;  4MPF A;  2CV4 A;  4EUY A;  4YKF A;  3NOF A;  4HOJ A;  4IQ1 A;  1GRX A;  2VD0 A;  1TKD B;  4BWQ A;  3FMW A;  3MNG A;  2RM6 A;  3QCP A;  3KP9 A;  3CXG A;  4GQF A;  4MH3 A;  1NW2 A;  4O7H A;  1KTE A;  2DKH A;  5J41 A;  4XIH A;  1NHY A;  3F63 A;  1KEB A;  4GF0 A;  5DQY A;  2C8U A;  2WZ9 A;  2WDU A;  3HXS A;  4RI6 A;  4NWY A;  2OAC A;  3PIN A;  3W8J A;  3VK9 A;  4YQM A;  4FQU A;  3J7Y b;  2GT5 A;  3I6A A;  3FZ4 A;  5BMU A;  1DBY A;  1S3C A;  4OO4 A;  1TW9 A;  1MDK A;  4NAX A;  4PXO A;  2B6M A;  1HNA A;  1Y6E A;  1QGV A;  4HJM A;  4KUN A;  3UVH A;  1E6B A;  3EVI A;  1HNC A;  3KZQ A;  5D93 A;  1OC9 A;  1GUH A;  3M8N A;  4I97 A;  4IP1 A;  1M99 A;  3VI5 A;  1BG5 A;  1EV9 A;  3ZRE A;  5KN1 A;  1J0F A;  1SD9 A;  5IMD A;  1V40 A;  1SYX A;  1YKA A;  1G7E A;  5D9W A;  2VM1 A;  1JLW A;  2GQL A;  2LNT A;  3TRQ A;  4CHS A;  2VL2 A;  1VF1 A;  2QKE A;  1ILO A;  4ZBD A;  3A5W A;  2GQK A;  3F6F A;  3C7M A;  3U5R E;  4MDC A;  5GZZ B;  1XFL A;  2P5Q A;  1TK5 B;  2LRN A;  5J9B A;  2ON5 A;  5J3R A;  4K5S A;  1T00 A;  3FZ5 A;  4EDZ A;  4HUA A;  4XS4 A;  1EGR A;  3LEF A;  2VCX A;  5HR1 A;  1GSU A;  2C3N A;  3C71 A;  3M9J A;  2H1B A;  4IJI A;  3LXT A;  5G1L A;  3ZZX A;  1NM3 A;  3NZN A;  2TRX A;  3EYT A;  3GKN A;  4WKW A;  4EC0 A;  1A8Y A;  5LNK e;  4QL7 A;  1FHE A;  4YKG A;  3TJK A;  2H0H A;  2MBS A;  2QA1 A;  5HFG A;  2HZE B;  2JL4 A;  1ABA A;  3FR6 A;  5ENU A;  2VIM A;  4LMW A;  2NPB A;  3ZVJ D;  4POM A;  2DJ0 A;  3HYP A;  4X1U A;  4V1A p;  2YWI A;  1PRX A;  3HHV A;  1F3A A;  5DAK B;  5HR3 A;  5D9X A;  3U6V A;  3FRC A;  5B7C A;  4ML1 A;  2KP2 A;  2B3S A;  5AIS A;  1BX9 A;  1SEN A;  4K8M A;  2B7K A;  3H1N A;  2CX3 A;  1OKT A;  2E0Q A;  1URM A;  1K0M A;  4EVM A;  2OE3 A;  3GMF A;  3UOM A;  1FW1 A;  2ALB A;  5C00 A;  1O8W A;  3L4N A;  2R5G A;  2E2M A;  3W8S A;  1PSQ A;  2KOK A;  3IC8 A;  2K6V A;  4MCU A;  3HJP A;  3GKX A;  1GSQ A;  2IFQ A;  5G31 A;  5A5K A;  1O6J A;  2AAW A;  4RUV A;  3LWA A;  3VUR A;  4GWR A;  5AN1 A;  1CQH A;  2PU9 C;  4LL4 B;  1TJD A;  2OA7 A;  2HXK A;  2RII A;  1XWC A;  1QQ2 A;  4MLY A;  1YY7 A;  4AJ6 A;  1LJR A;  3UJ1 A;  3ZIJ A;  3WGE A;  3F6D A;  2C0D A;  2G0F A;  1YZX A;  5KN2 A;  4PUF C;  1DUG A;  1F2E A;  1Z3E A;  1V58 A;  3QFB C;  1WJK A;  2O87 A;  5EY6 A;  3LXZ A;  4KGI A;  3IV4 A;  5DDL A;  3KGK A;  1XIY A;  4I8B A;  4NMU A;  1TU7 A;  3VLN A;  2B1K A;  1XWG A;  3KMN A;  4USS A;  1XBS A;  2PPT A;  2LKU A;  2VCV A;  4OFN A;  2R4V A;  3ERG A;  3TKS C;  5KN0 A;  3IHG A;  3GST A;  3L78 A;  3PGT A;  2WJU A;  1UA5 A;  3L9S A;  2YWO A;  1XXU A;  1SL0 B;  3G7Y A;  3HD5 A;  3EU4 A;  2DSA A;  2L4C A;  4IGJ A;  3GKM A;  3TOT A;  3QFA C;  5H5Q A;  3WT1 A;  2YAN A;  1AIU A;  5AIX A;  4K2X A;  2YV7 A;  6GSX A;  3HZ4 A;  2V6O A;  2JZR A;  6GSW A;  4X43 A;  1EZK A;  2MBT A;  4TOP A;  1FAA A;  1V57 A;  4E8E A;  4D73 A;  1BYE A;  3F4R A;  1J9B A;  2LQQ A;  3RHB A;  2H70 A;  4ZL8 A;  4TR1 A;  2C0F A;  3O76 A;  2A2R A;  3UMA A;  1S3D A;  2F9S A;  5INY A;  3TUE A;  5B8A A;  3KEB A;  4EIP A;  3E3E A;  3IXR A;  5A4V A;  4DSQ A;  2FUG 2;  2ON7 A;  4POB A;  4MMM A;  3GHA A;  1JZO A;  7GSS A;  4ZL9 A;  3HVX A;  2YWN A;  2H1A A;  3GX0 A;  4KX4 A;  4V2L A;  3FKF A;  2GTU A;  2DJJ A;  2FHE A;  2R37 A;  3KH7 A;  2XPD A;  1MDI A;  3DEX A;  3VI7 A;  3BJ5 A;  1M2D A;  2YZU A;  4TR1 B;  2B5E A;  4KSO A;  2OJL A;  20GS A;  3M0F A;  3H93 A;  2R2J A;  2HRF A;  5CYY A;  1JLV A;  2HNL A;  4K2D A;  5IOX A;  4HQZ A;  3ZVJ A;  2M46 A;  1QUW A;  3EMX A;  4K9Z A;  1B8X A;  2DJ1 A;  2YWM A;  5A4W A;  3HZ8 A;  1O73 A;  3FR3 A;  4JR4 A;  2OKA A;  2FY6 A;  2O89 A;  1ZZY A;  1K3L A;  5ELA A;  1M3I A;  4TR4 A;  1WPI A;  3A3T A;  2PGT A;  1HQO A;  2LTK A;  2H71 A;  3JCM L;  2FD3 A;  4ZIL A;  2CZ2 A;  4WR4 A;  1YDK A;  4PUR A;  3APQ A;  2YCD A;  3IRA A;  2V2G A;  3QOU A;  1B9Y C;  1XWA A;  4XRD A;  9GSS A;  1AC1 A;  4EL1 A;  1SKS B;  1GTB A;  5G5F A;  1GUL A;  4IKH A;  4LL1 B;  4OCF A;  3IPZ A;  1W89 A;  1GSE A;  1UN2 A;  4K7O A;  2GLR A;  1U3I A;  3DYR A;  4WF5 A;  1XVW A;  2WCI A;  1WRY A;  3UVT A;  1QFN A;  1A24 A;  1K3Y A;  5CRG A;  2H0I A;  1K0O A;  3P7X A;  4J57 E;  2YNX A;  1FG4 A;  1GTU A;  2QGV A;  3CRU A;  4I2U A;  5ECQ B;  3L9U A;  3ZFB A;  5IMC A;  1OE7 A;  2VLV A;  4ILF A;  4P3Y B;  1MD4 A;  2VLU A;  3GNJ A;  2GT6 A;  1K0A A;  3MSZ A;  5ID2 B;  3OR5 A;  2FLS A;  1GH2 A;  3GRX A;  2DC5 A;  1OYJ A;  3VPQ A;  4HSC X;  4MJA A;  4O32 A;  4ZIJ A;  3ZRD A;  3F0I A;  1MDJ A;  2R0G A;  4GLT A;  3TKR A;  3D0Z A;  4TXO A;  3QMX A;  1GUK A;  1K0D A;  4J2F A;  2YPM A;  5DVB A;  2MMA A;  3PR8 A;  3ZIV A;  4AJ8 A;  1X9S B;  2J23 A;  5G5E A;  4ZXG A;  4PTS A;  3VFI A;  4E8H A;  1PN9 A;  1XOB A;  4JBB A;  3VWV A;  5EPF A;  3RDW A;  4WF4 A;  3O6T A;  1YQ1 A;  2M80 A;  4ZB8 A;  4KSM A;  1S3R A;  4K1F A;  2IL3 A;  1XWB A;  4KW6 A;  6GSY A;  1R4W A;  5F06 A;  1EOG A;  4ICY A;  4TXO B;  1T1V A;  1U6T A;  5KOX A;  1ERT A;  2LRT A;  3UAR A;  2K18 A;  3ZLP A;  4HZ2 A;  4ID0 A;  5DQS A;  5IOW A;  2HSM A;  4WBR D;  2MMO A;  2BTO T;  4IJ3 A;  4AJ7 A;  3C8E A;  3KIJ A;  4OO5 A;  1X9W B;  3HDC A;  3F3R A;  1AW9 A;  2ZNM A;  1O7U A;  2REM A;  1PQN A;  2NDO A;  1DE1 A;  1G6W A;  3G7J A;  2HYX A;  3DGQ A;  3VWW A;  5F05 A;  1S3A A;  1QMV A;  3TCO A;  4IW9 A;  3D6I A;  2E7P A;  1MTC A;  3BBY A;  4MZC A;  5DAL A;  3EPT A;  5HR0 A;  2HT9 A;  2GSS A;  4N0Z A;  4XS1 A;  2C80 A;  3Q19 A;  4MK3 A;  3D21 A;  4MA9 A;  1GLQ A;  3WD6 A;  1N2A A;  3I9V 2;  5ECH B;  3CSH A;  3A2V A;  2R6K A;  3WGX A;  3C73 A;  4GST A;  2EIO A;  4CY8 A;  1XPV A;  2FWG A;  4CY6 A;  1JZD A;  2PUK C;  2TIR A;  3I69 A;  3GH6 A;  5J5N A;  2F8F A;  3UAP A;  2PWJ A;  3GV1 A;  5J9C A;  4L5O A;  2AJQ B;  2RUF A;  2H6Y A;  2WB9 A;  4MJE A;  3HCZ A;  2IMI A;  3ZIT A;  4G19 A;  2H6X A;  1TRW A;  1B4Q A;  3IK7 A;  3HVV A;  2I9H A;  2DLX A;  3R2Q A;  3ZMK A;  2L5O A;  1M2B A;  1V2A A;  4XCS A;  1A2M A;  2JAC A;  1AQX A;  1PX7 A;  3HY2 A;  4FYU A;  4G0L A;  1EGO A;  3RAZ A;  2CAI A;  1OC9 B;  4F82 A;  3IK9 A;  4GXZ A;  5CRE A;  2KHP A;  4GRF A;  4YAV A;  3ME8 A;  1AUC A;  2IME A;  3TJG A;  1AXD A;  1GSS A;  1Z7R A;  4G0I A;  12GS A;  1B9X C;  4O5U A;  2AYT A;  4HZ4 A;  5A4U A;  5F0G A;  3D4M A;  2AUV A;  2V32 A;  1Z9H A;  3DKS A;  4BPY A;  2ZCT A;  3DWV A;  2CT6 A;  2I4A A;  5GST A;  5DCH A;  4MZW A;  2GZZ A;  4JU5 A;  4RI7 A;  2J9H A;  2GQM A;  1X0R A;  5CAX A;  3IC4 A;  1GNW A;  4XRA A;  4XS4 B;  4POL A;  2H66 A;  3D5J A;  1GP1 A;  2QA2 A;  4GTU A;  1GTI A;  4PQI A;  2H8L A;  1XG8 A;  2X8C A;  4XS6 A;  4ECC A;  4KAE A;  4N10 A;  4KA0 A;  2F8A A;  3SWL A;  3LW9 A;  2EC4 A;  5BRT A;  4ZB6 A;  4BVY A;  4FIW A;  2H19 A;  1HYU A;  1YF0 A;  4KE3 A;  3EMP A;  5D9T A;  1TTZ A;  2H30 A;  1SJZ A;  3F4S A;  1LU4 A;  2L59 A;  2NTO A;  1Z6N A;  4FO5 A;  1R5A A;  1ZYE A;  4RQX A;  1GL8 A;  3IA1 A;  1JZW A;  4YQU A;  1XZO A;  2KP1 A;  3LFL A;  2GS3 A;  3WGD A;  2VL3 A;  1EWX A;  2D2Z A;  3GX8 A;  1THX A;  1ZOF A;  2LJK A;  2FGX A;  2VM2 A;  5HFK A;  2FA8 A;  4DEJ A;  3IOS A;  2B5Y A;  4HEA 2;  1GLP A;  1EV4 A;  2JAD A;  2R0P A;  2O85 A;  4KDX A;  3QD9 A;  3TKS E;  3J7Y k;  4MF6 A;  4JE1 A;  5IMV A;  2VO4 A;  2YN1 A;  3GL3 A;  3EWL A;  3UBL A;  1WOU A;  2MZC A;  2IFQ B;  4BL7 A;  4G10 A;  4NPB A;  1Z6M A;  3KMO A;  2XHF A;  1WE0 A;  3GSS A;  2V6K A;  4WEY A;  3FZ9 A;  3C1S A;  3IBH A;  4G2E A;  5JWO B;  1Z5Y E;  4XTS A;  2FWF A;  5ECM B;  1FOH A;  1TU8 A;  1SK2 A;  3W6G A;  2A4H A;  4DSS A;  1OC8 A;  2VAF A;  3M3M A;  3L9V A;  1A2J A;  4G9H A;  3TJF A;  1YKC A;  4BL7 B;  2WFC A;  4TR3 A;  4EE0 A;  1SL1 B;  19GS A;  1PL1 A;  4O92 A;  3ZML A;  5DJL A;  1B4P A;  2I81 A;  2DBC A;  2FWH A;  2DJ3 A;  2PN8 A;  2ES7 A;  4K7N A;  3ERW A;  3TRX A;  10GS A;  2KUC A;  2H75 A;  3KP8 A;  1X9M B;  1ZYP A;  3FHK A;  4V2N A;  2VCT A;  3DRN A;  1SK0 A;  4WXT A;  1JZR A;  3FEU A;  1ZCP A;  4O5Q A;  3RPP A;  4POK A;  4CDO A;  2X8H A;  2DMM A;  1H4O A;  4DSS B;  5JCU A;  4OFM A;  3QAW A;  4ISD A;  1PGT A;  3ERF A;  3MAK A;  2K9F A;  4D73 B;  1UC7 A;  4IHU A;  4HU9 A;  3SBC A;  5IPH A;  5JCG A;  2L4Q A;  5D9V A;  2G2Q A;  3FR9 A;  1VRS D;  1ZGN A;  1SKW B;  4KB3 A;  4TRX A;  4ECJ A;  2HZF A;  5IQY A;  4I6X A;  5G2Z A;  2CQ9 A;  4MNN A;  3D4T A;  4PUA A;  2WGR A;  4OD7 A;  2VL2 C;  3DVW A;  4JR6 A;  4N11 A;  22GS A;  6GSU A;  4X0X A;  2KLX A;  1KNG A;  2NVL A;  1PD2 1;  1SL2 B;  4JZQ A;  1ML6 A;  1M2A A;  1F3B A;  3LG6 A;  3US3 A;  4MF5 A;  3EU3 A;  2DIY A;  4Z2R A;  3GA4 A;  3IAM 2;  4ZBA A;  3Q18 A;  4KCA A;  6GST A;  3GKK A;  2JSZ A;  2C3Q A;  3K8N A;  5D73 A;  3N5O A;  5D96 A;  2B5X A;  1SJI A;  1JHB A;  3A2X A;  1ZMA A;  2UZ8 A;  2JU5 A;  3E0U A;  1EP8 A;  1XW5 A;  3LQ7 A;  1K3O A;  3ZYW A;  2HRA A;  2R3X A;  4TKY A;  1Q98 A;  4ZB9 A;  4F0C A;  3CSI A;  2HRK A;  2E2G A;  4QQ7 A;  5D8I A;  1AQV A;  1K0N A;  5CO3 A;  5B6M A;  2QC7 A;  1WIK A;  1EEM A;  3GTU A;  4L0U A;  2H76 A;  2X49 A;  3LYK A;  3A2W A;  4PGT A;  3H79 A;  4ECB A;  4KND A;  2IIY A;  3TJB A;  2XPE A;  2LJA A;  2RLI A;  1GWC A;  2IJY A;  1GSY A;  5E4W A;  4IP6 A;  1XWK A;  4WBJ A;  3F9U A;  2C1Y A;  2X64 A;  3G7I A;  5IMZ A;  2GSR A;  3DVX A;  2BMX A;  4Q5Q A;  1U3A A;  1W4V A;  2LJR A;  1OE8 A;  1O81 A;  3DD3 A;  3V1W A;  4DVC A;  4ML6 A;  5CRD A;  3GTU B;  4F0B A;  3FW2 A;  3R3E A;  1ST9 A;  3EIN A;  4KH7 A;  1Q4J A;  5B8B A;  5ELG A;  1SYR A;  4MJB A;  3GUR A;  2DIZ A;  2WS2 A;  2MMN A;  5ECI B;  1T4Z A;  5HR2 A;  5IO0 A;  1TK8 B;  1VF2 A;  3TDG A;  3KM6 A;  2LUS A;  2EIR A;  3A5I A;  1PX6 A;  1K0C A;  5G30 A;  4FH8 A;  3HA9 A;  3FK8 A;  1ZL9 A;  1A8L A;  2DJ2 A;  4TVE A;  5F07 A;  3GYK A;  2IMK A;  4MAB A;  5GSS A;  2O7K A;  4GSN A;  3HKR A;  4NHW A;  1PMT A;  13GS A;  2FCH A;  3I43 A;  5IM9 A;  2L5L A;  3M1G A;  4EKZ A;  3GN3 A;  2LRC A;  2P31 A;  5CRW A;  3CTG A;  3O3T A;  3TRP A;  3UBK A;  4K6X A;  1I9D A;  4YAP A;  1PKW A;  3IAS 2;  4LLR A;  5COH A;  1PFO A;  4JRR A;  3ZL5 A;  1ACV A;  3ZTL A;  4HS1 A;  2CVB A;  2X4A A;  2VUP A;  2HFD A;  5IPG A;  2R0C A;  3KTL A;  2NBS A;  4KDY A;  3WT2 A;  4EO3 A;  4FYC A;  3ISO A;  3LJR A;  3DXB A;  2N5B A;  3CRT A;  1VF4 A;  2V41 A;  3KJY A;  2X99 A;  3GFK A;  1TOF A;  5J4U A;  1RQM A;  4GSS A;  2VOC A;  4IBP A;  1PKZ A;  2VD1 A;  4O5R A;  4IS0 A;  4EXJ A;  3KD0 A;  1A23 A;  3CTF A;  2L6D A;  2MMZ A;  1JFU A;  3MDK A;  3VWU A;  2HE3 A;  4TXV A;  4X4J A;  1ERV A;  4H86 A;  1BQ7 A;  2I3Y A;  4V2M A;  3TGZ A;  4EF0 A;  3QDN A;  1AQW A;  3CQF A;  2O8V B;  1WP0 A;  5DAL B;  3HVN A;  2PBJ A;  4MZB A;  1Z7P A;  5CP1 A;  3UIW A;  3VPT A;  1T8E B;  2VCQ A;  1R5P A;  1OKD A;  4FYB A;  1TDI A;  4NHZ A;  2JZT A;  1MD3 A;  5IMA A;  3LOR A;  3IHQ A;  1DSB A;  5ECO B;  2FNO A;  3TKP A;  2QSI A;  2IMD A;  2OBI A;  1R7H A;  3LSZ A;  4KF9 A;  3IR4 A;  1WWJ A;  1PN0 A;  2HZE A;  3BOA A;  2OAD A;  4PQH A;  2YV9 A; 
#chains in the Genus database with same CATH homology
 3UEM A;  3ED3 A;  5B6N A;  5HFI A;  3D22 A;  2HLS A;  1FOV A;  4IQA A;  1R26 A;  5ECP B;  3RHC A;  5JCW A;  3TOU A;  3HVS A;  1N8J A;  4PNF A;  1GUM A;  4F9Z A;  1SD8 A;  3MYD A;  1F9M A;  5DAK A;  1IYH A;  2K8S A;  3F8U A;  1V9W A;  2LV3 A;  2IPA A;  3ZFL A;  4IEL A;  3DML A;  4ZBB A;  4WR5 A;  4XHM A;  2H73 A;  2DJK A;  4MJC A;  5DBQ A;  4QL9 A;  2PER A;  2K8V A;  3EUR A;  2CVK A;  3PH9 A;  4CW9 A;  5G1K A;  1THO A;  3E9J B;  3RBT A;  4V1A g;  3BCI A;  4Z7X A;  1C72 A;  1U88 A;  3GIX A;  5IIZ A;  2GZP A;  3G9B A;  3MIX A;  11GS A;  1HNB A;  2VLT A;  2YZH A;  4A5P A;  1M9A A;  3QAV A;  3CMI A;  1ON4 A;  1FO5 A;  1X5C A;  4K5R A;  2FWE A;  2AB6 A;  1PA3 A;  3UL3 A;  3EC3 A;  1SJ6 A;  1XCC A;  2LNS A;  2OBK A;  2N5A A;  3F3Q A;  3LYP A;  1VGL A;  1GSF A;  5JWQ B;  1O8X A;  1QK8 A;  1A0F A;  1CQG A;  2FA4 A;  4J56 E;  14GS A;  2HI7 A;  2H01 A;  1OVN A;  4BVY B;  1TXX A;  2V1M A;  2B1L A;  2WRT A;  4OWY A;  4BA7 A;  2F3M A;  4IVF A;  2A2P A;  2VCW A;  3LGC A;  2YJH A;  1BAY A;  2A4V A;  3S9F A;  2CVD A;  1FVK A;  3FY7 A;  5CNW A;  3KCM A;  2PVO C;  3H8Q A;  2P0G A;  4MF7 A;  1YJ6 A;  1OC3 A;  5FT3 A;  5AIV A;  5GAN D;  1J08 A;  3MWH A;  2P5R A;  2GZY A;  3TB2 A;  1YEP A;  1M0U A;  2MYG A;  2X8G A;  5H5R A;  1USB A;  1TRU A;  2H1G A;  5FHI A;  1NHO A;  2C3T A;  2L6C A;  4F03 A;  2A2S A;  4LMV A;  3PPU A;  1TI1 A;  5L71 A;  4N0V A;  1M7T A;  2XBI A;  2Z9S A;  1BJX A;  4Q5N A;  2TRC P;  4EIQ A;  5KN3 A;  1G7O A;  2GST A;  3BCK A;  3M9K A;  4HU7 A;  1HD2 A;  1GTA A;  2EIQ A;  4KDU A;  1G6Y A;  1XVQ A;  2XC2 A;  1EOH A;  3IDV A;  3KXO A;  3P2A A;  4BWS A;  2OE0 A;  4Z2T A;  4Z2U A;  1PL2 A;  1FB6 A;  1X5D A;  2OE1 A;  3L0H A;  3P90 A;  4L8E A;  5ECR B;  2RUE A;  4TN8 A;  5EL8 A;  5DCG A;  3NIV A;  5IO2 A;  5ECL B;  2C0E A;  4HJ2 A;  1M9B A;  2LST A;  2ZUP A;  3GUS A;  3APO A;  4ACS A;  4WET A;  2AHE A;  1DE2 A;  16GS A;  3Q6O A;  4K7I A;  2IWT A;  1OAZ A;  2YP6 A;  4TR0 A;  2JSY A;  5LCZ A;  3KH9 A;  1ZYN A;  2DKI A;  3P8W A;  3APS A;  1T7P B;  1YF1 A;  4ZL7 A;  4NXI A;  3CYN A;  5FWG A;  4I5Q A;  5H5S A;  1TP9 A;  2JZS A;  1MEK A;  2CX4 A;  4Q5R A;  5F8B A;  4IN0 A;  4OFT A;  4PX1 A;  5JWR B;  3FZA A;  1FVJ A;  4KCE A;  4PNG A;  1VF3 A;  1E2Y A;  2DML A;  5HQP A;  17GS A;  5LD0 A;  3CSJ A;  1AAZ A;  2GSQ A;  2VCZ A;  2RM5 A;  2GVP A;  3F4T A;  5ECS A;  4YH2 A;  1TI3 A;  2CAQ A;  4AGS A;  4PQ1 A;  2H72 A;  5C04 A;  5EVO A;  2AV4 A;  18GS A;  2C4J A;  4I2T A;  3KTB A;  2M72 A;  1T4Y A;  1NSW A;  2H6Z A;  4LA1 A;  4YQV A;  3H4K A;  2GGT A;  4GCI A;  1A0R P;  3EE2 A;  1B48 A;  3C1R A;  2C0G A;  2PVQ A;  1TRV A;  3AY8 A;  5ECN B;  1GSD A;  4F2I A;  1K0B A;  2N5F A;  1KBN A;  2LQO A;  5E59 A;  4OMV A;  2VL9 A;  5IMF A;  3TKQ A;  3GL5 A;  6GSS A;  4MH2 A;  4NV2 A;  2IMF A;  4L0W A;  2H1D A;  5ID2 A;  3CBU A;  3VWX A;  4AF2 A;  4TW5 A;  3GH9 A;  2WUL A;  3FYG A;  2LS5 A;  5KOW A;  1ERU A;  4BVX A;  4Q5F A;  1X5E A;  2GDR A;  4N30 A;  6GSV A;  5ABR A;  3HJM A;  1LBK A;  3ME7 A;  2YJ7 A;  1IYI A;  2F51 A;  1U87 A;  4K0G A;  2L57 A;  1A2L A;  5CRH A;  1RK4 A;  4ULX A;  1Y25 A;  1RW1 A;  2B7J A;  1GNE A;  3RPN A;  1SU9 A;  4HDE A;  2PMT A;  3QR6 A;  3BD2 A;  1FB0 A;  1H75 A;  1XW9 A;  1F37 A;  1YEX A;  4GQC A;  1SKR B;  1O85 A;  1BED A;  1XOA A;  4BVX B;  2LEG A;  2YOI A;  3QPM A;  4EDY A;  2HSH A;  1T3B A;  2HRN A;  4MPG A;  3WYW A;  2CZ3 A;  2IN3 A;  4MP4 A;  3TJJ A;  4G0K A;  3Q74 A;  4L5L A;  3HJO A;  5ECK B;  1TK0 B;  5AGY A;  3DIE A;  2XBQ A;  1XW6 A;  3QAG A;  2H74 A;  5GAP D;  5DJM A;  1TRS A;  3N9J A;  3IE3 A;  1QXH A;  1WMJ A;  8GSS A;  4JED A;  1G0T A;  2BJX A;  1V98 A;  1I5G A;  4NV5 A;  1ERW A;  1SK1 A;  1ZYQ B;  1EP7 A;  3TKS A;  4HI7 A;  4HQS A;  2I1U A;  1UVZ A;  4OCE A;  4ECI A;  4RQR A;  1EEJ A;  4DSR A;  2HSY A;  1F6M C;  2CA8 A;  4K0N A;  5KEJ A;  2H0G A;  4MPF A;  2CV4 A;  4EUY A;  4YKF A;  3NOF A;  4HOJ A;  4IQ1 A;  1GRX A;  2VD0 A;  1TKD B;  4BWQ A;  3FMW A;  3MNG A;  2RM6 A;  3QCP A;  3KP9 A;  3CXG A;  4GQF A;  4MH3 A;  1NW2 A;  4O7H A;  1KTE A;  2DKH A;  5J41 A;  4XIH A;  1NHY A;  3F63 A;  1KEB A;  4GF0 A;  5DQY A;  2C8U A;  2WZ9 A;  2WDU A;  3HXS A;  4RI6 A;  4NWY A;  2OAC A;  3PIN A;  3W8J A;  3VK9 A;  4YQM A;  4FQU A;  3J7Y b;  2GT5 A;  3I6A A;  3FZ4 A;  5BMU A;  1DBY A;  1S3C A;  4OO4 A;  1TW9 A;  1MDK A;  4NAX A;  4PXO A;  2B6M A;  1HNA A;  1Y6E A;  1QGV A;  4HJM A;  4KUN A;  3UVH A;  1E6B A;  3EVI A;  1HNC A;  3KZQ A;  5D93 A;  1OC9 A;  1GUH A;  3M8N A;  4I97 A;  4IP1 A;  1M99 A;  3VI5 A;  1BG5 A;  1EV9 A;  3ZRE A;  5KN1 A;  1J0F A;  1SD9 A;  5IMD A;  1V40 A;  1SYX A;  1YKA A;  1G7E A;  5D9W A;  2VM1 A;  1JLW A;  2GQL A;  2LNT A;  3TRQ A;  4CHS A;  2VL2 A;  1VF1 A;  2QKE A;  1ILO A;  4ZBD A;  3A5W A;  2GQK A;  3F6F A;  3C7M A;  3U5R E;  4MDC A;  5GZZ B;  1XFL A;  2P5Q A;  1TK5 B;  2LRN A;  5J9B A;  2ON5 A;  5J3R A;  4K5S A;  1T00 A;  3FZ5 A;  4EDZ A;  4HUA A;  4XS4 A;  1EGR A;  3LEF A;  2VCX A;  5HR1 A;  1GSU A;  2C3N A;  3C71 A;  3M9J A;  2H1B A;  4IJI A;  3LXT A;  5G1L A;  3ZZX A;  1NM3 A;  3NZN A;  2TRX A;  3EYT A;  3GKN A;  4WKW A;  4EC0 A;  1A8Y A;  5LNK e;  4QL7 A;  1FHE A;  4YKG A;  3TJK A;  2H0H A;  2MBS A;  2QA1 A;  5HFG A;  2HZE B;  2JL4 A;  1ABA A;  3FR6 A;  5ENU A;  2VIM A;  4LMW A;  2NPB A;  3ZVJ D;  4POM A;  2DJ0 A;  3HYP A;  4X1U A;  4V1A p;  2YWI A;  1PRX A;  3HHV A;  1F3A A;  5DAK B;  5HR3 A;  5D9X A;  3U6V A;  3FRC A;  5B7C A;  4ML1 A;  2KP2 A;  2B3S A;  5AIS A;  1BX9 A;  1SEN A;  4K8M A;  2B7K A;  3H1N A;  2CX3 A;  1OKT A;  2E0Q A;  1URM A;  1K0M A;  4EVM A;  2OE3 A;  3GMF A;  3UOM A;  1FW1 A;  2ALB A;  5C00 A;  1O8W A;  3L4N A;  2R5G A;  2E2M A;  3W8S A;  1PSQ A;  2KOK A;  3IC8 A;  2K6V A;  4MCU A;  3HJP A;  3GKX A;  1GSQ A;  2IFQ A;  5G31 A;  5A5K A;  1O6J A;  2AAW A;  4RUV A;  3LWA A;  3VUR A;  4GWR A;  5AN1 A;  1CQH A;  2PU9 C;  4LL4 B;  1TJD A;  2OA7 A;  2HXK A;  2RII A;  1XWC A;  1QQ2 A;  4MLY A;  1YY7 A;  4AJ6 A;  1LJR A;  3UJ1 A;  3ZIJ A;  3WGE A;  3F6D A;  2C0D A;  2G0F A;  1YZX A;  5KN2 A;  4PUF C;  1DUG A;  1F2E A;  1Z3E A;  1V58 A;  3QFB C;  1WJK A;  2O87 A;  5EY6 A;  3LXZ A;  4KGI A;  3IV4 A;  5DDL A;  3KGK A;  1XIY A;  4I8B A;  4NMU A;  1TU7 A;  3VLN A;  2B1K A;  1XWG A;  3KMN A;  4USS A;  1XBS A;  2PPT A;  2LKU A;  2VCV A;  4OFN A;  2R4V A;  3ERG A;  3TKS C;  5KN0 A;  3IHG A;  3GST A;  3L78 A;  3PGT A;  2WJU A;  1UA5 A;  3L9S A;  2YWO A;  1XXU A;  1SL0 B;  3G7Y A;  3HD5 A;  3EU4 A;  2DSA A;  2L4C A;  4IGJ A;  3GKM A;  3TOT A;  3QFA C;  5H5Q A;  3WT1 A;  2YAN A;  1AIU A;  5AIX A;  4K2X A;  2YV7 A;  6GSX A;  3HZ4 A;  2V6O A;  2JZR A;  6GSW A;  4X43 A;  1EZK A;  2MBT A;  4TOP A;  1FAA A;  1V57 A;  4E8E A;  4D73 A;  1BYE A;  3F4R A;  1J9B A;  2LQQ A;  3RHB A;  2H70 A;  4ZL8 A;  4TR1 A;  2C0F A;  3O76 A;  2A2R A;  3UMA A;  1S3D A;  2F9S A;  5INY A;  3TUE A;  5B8A A;  3KEB A;  4EIP A;  3E3E A;  3IXR A;  5A4V A;  4DSQ A;  2FUG 2;  2ON7 A;  4POB A;  4MMM A;  3GHA A;  1JZO A;  7GSS A;  4ZL9 A;  3HVX A;  2YWN A;  2H1A A;  3GX0 A;  4KX4 A;  4V2L A;  3FKF A;  2GTU A;  2DJJ A;  2FHE A;  2R37 A;  3KH7 A;  2XPD A;  1MDI A;  3DEX A;  3VI7 A;  3BJ5 A;  1M2D A;  2YZU A;  4TR1 B;  2B5E A;  2OJL A;  4KSO A;  20GS A;  3M0F A;  3H93 A;  2R2J A;  2HRF A;  5CYY A;  1JLV A;  2HNL A;  4K2D A;  5IOX A;  4HQZ A;  3ZVJ A;  2M46 A;  1QUW A;  3EMX A;  4K9Z A;  1B8X A;  2DJ1 A;  2YWM A;  5A4W A;  3HZ8 A;  1O73 A;  3FR3 A;  4JR4 A;  2OKA A;  2FY6 A;  2O89 A;  1ZZY A;  1K3L A;  5ELA A;  4TR4 A;  1WPI A;  3A3T A;  2PGT A;  1HQO A;  2LTK A;  2H71 A;  3JCM L;  2FD3 A;  4ZIL A;  2CZ2 A;  4WR4 A;  1YDK A;  4PUR A;  3APQ A;  2YCD A;  3IRA A;  2V2G A;  3QOU A;  1B9Y C;  1XWA A;  4XRD A;  9GSS A;  1AC1 A;  4EL1 A;  1SKS B;  1GTB A;  5G5F A;  1GUL A;  4IKH A;  4LL1 B;  4OCF A;  3IPZ A;  1W89 A;  1GSE A;  1UN2 A;  4K7O A;  2GLR A;  1U3I A;  3DYR A;  4WF5 A;  1XVW A;  2WCI A;  1WRY A;  3UVT A;  1QFN A;  1A24 A;  1K3Y A;  5CRG A;  2H0I A;  1K0O A;  3P7X A;  4J57 E;  2YNX A;  1FG4 A;  1GTU A;  2QGV A;  3CRU A;  4I2U A;  5ECQ B;  3L9U A;  3ZFB A;  5IMC A;  1OE7 A;  2VLV A;  4ILF A;  4P3Y B;  1MD4 A;  2VLU A;  3GNJ A;  2GT6 A;  1K0A A;  3MSZ A;  5ID2 B;  3OR5 A;  2FLS A;  1GH2 A;  3GRX A;  2DC5 A;  1OYJ A;  3VPQ A;  4MJA A;  4O32 A;  4ZIJ A;  3ZRD A;  3F0I A;  1MDJ A;  2R0G A;  4GLT A;  3TKR A;  3D0Z A;  4TXO A;  3QMX A;  1GUK A;  1K0D A;  4J2F A;  2YPM A;  5DVB A;  2MMA A;  3PR8 A;  3ZIV A;  4AJ8 A;  1X9S B;  2J23 A;  5G5E A;  4ZXG A;  4PTS A;  3VFI A;  4E8H A;  1PN9 A;  1XOB A;  4JBB A;  3VWV A;  5EPF A;  3RDW A;  4WF4 A;  3O6T A;  1YQ1 A;  2M80 A;  4ZB8 A;  4KSM A;  4K1F A;  2IL3 A;  1XWB A;  4KW6 A;  6GSY A;  1R4W A;  5F06 A;  1EOG A;  4ICY A;  4TXO B;  1T1V A;  1U6T A;  5KOX A;  1ERT A;  2LRT A;  3UAR A;  2K18 A;  3ZLP A;  4HZ2 A;  4ID0 A;  5DQS A;  5IOW A;  2HSM A;  4WBR D;  2MMO A;  2BTO T;  4IJ3 A;  4AJ7 A;  3C8E A;  3KIJ A;  4OO5 A;  1X9W B;  3HDC A;  3F3R A;  1AW9 A;  2ZNM A;  1O7U A;  2REM A;  1PQN A;  2NDO A;  1DE1 A;  1G6W A;  3G7J A;  2HYX A;  3DGQ A;  3VWW A;  5F05 A;  1S3A A;  1QMV A;  3TCO A;  4IW9 A;  3D6I A;  2E7P A;  1MTC A;  3BBY A;  4MZC A;  5DAL A;  3EPT A;  5HR0 A;  2HT9 A;  2GSS A;  4N0Z A;  4XS1 A;  2C80 A;  3Q19 A;  4MK3 A;  3D21 A;  4MA9 A;  1GLQ A;  3WD6 A;  1N2A A;  3I9V 2;  5ECH B;  3CSH A;  3A2V A;  2R6K A;  3WGX A;  3C73 A;  4GST A;  2EIO A;  4CY8 A;  1XPV A;  2FWG A;  4CY6 A;  1JZD A;  2PUK C;  2TIR A;  3I69 A;  3GH6 A;  5J5N A;  2F8F A;  3UAP A;  2PWJ A;  3GV1 A;  5J9C A;  4L5O A;  2AJQ B;  2RUF A;  2H6Y A;  2WB9 A;  4MJE A;  3HCZ A;  2IMI A;  3ZIT A;  4G19 A;  2H6X A;  1TRW A;  1B4Q A;  3IK7 A;  3HVV A;  2I9H A;  2DLX A;  3R2Q A;  3ZMK A;  2L5O A;  1M2B A;  1V2A A;  4XCS A;  1A2M A;  2JAC A;  1AQX A;  1PX7 A;  3HY2 A;  4FYU A;  4G0L A;  1EGO A;  3RAZ A;  2CAI A;  1OC9 B;  4F82 A;  3IK9 A;  4GXZ A;  5CRE A;  2KHP A;  4GRF A;  4YAV A;  3ME8 A;  1AUC A;  2IME A;  3TJG A;  1AXD A;  1GSS A;  1Z7R A;  4G0I A;  12GS A;  1B9X C;  4O5U A;  2AYT A;  4HZ4 A;  5A4U A;  5F0G A;  3D4M A;  2AUV A;  2V32 A;  1Z9H A;  3DKS A;  4BPY A;  2ZCT A;  3DWV A;  2CT6 A;  2I4A A;  5GST A;  5DCH A;  4MZW A;  2GZZ A;  4JU5 A;  4RI7 A;  2J9H A;  2GQM A;  1X0R A;  5CAX A;  3IC4 A;  1GNW A;  4XRA A;  4XS4 B;  4POL A;  2H66 A;  3D5J A;  1GP1 A;  2QA2 A;  4GTU A;  1GTI A;  4PQI A;  2H8L A;  2X8C A;  4XS6 A;  4ECC A;  4KAE A;  4N10 A;  4KA0 A;  2F8A A;  3SWL A;  3LW9 A;  2EC4 A;  5BRT A;  4ZB6 A;  4BVY A;  4FIW A;  2H19 A;  1HYU A;  1YF0 A;  4KE3 A;  3EMP A;  5D9T A;  1TTZ A;  2H30 A;  1SJZ A;  3F4S A;  1LU4 A;  2L59 A;  2NTO A;  1Z6N A;  4FO5 A;  1R5A A;  1ZYE A;  4RQX A;  1GL8 A;  3IA1 A;  1JZW A;  4YQU A;  1XZO A;  2KP1 A;  3LFL A;  2GS3 A;  3WGD A;  2VL3 A;  1EWX A;  2D2Z A;  3GX8 A;  1THX A;  1ZOF A;  2LJK A;  2FGX A;  2VM2 A;  5HFK A;  2FA8 A;  4DEJ A;  3IOS A;  2B5Y A;  4HEA 2;  1GLP A;  1EV4 A;  2JAD A;  2R0P A;  2O85 A;  4KDX A;  3QD9 A;  3TKS E;  3J7Y k;  4MF6 A;  4JE1 A;  5IMV A;  2VO4 A;  2YN1 A;  3GL3 A;  3EWL A;  3UBL A;  1WOU A;  2MZC A;  2IFQ B;  4BL7 A;  4G10 A;  4NPB A;  1Z6M A;  3KMO A;  2XHF A;  1WE0 A;  3GSS A;  2V6K A;  4WEY A;  3FZ9 A;  3C1S A;  3IBH A;  4G2E A;  5JWO B;  1Z5Y E;  4XTS A;  2FWF A;  5ECM B;  1FOH A;  1TU8 A;  1SK2 A;  3W6G A;  2A4H A;  4DSS A;  1OC8 A;  2VAF A;  3M3M A;  3L9V A;  1A2J A;  4G9H A;  3TJF A;  1YKC A;  4BL7 B;  2WFC A;  4TR3 A;  4EE0 A;  1SL1 B;  19GS A;  1PL1 A;  4O92 A;  3ZML A;  5DJL A;  1B4P A;  2I81 A;  2DBC A;  2FWH A;  2DJ3 A;  2PN8 A;  2ES7 A;  4K7N A;  3ERW A;  3TRX A;  10GS A;  2KUC A;  2H75 A;  3KP8 A;  1X9M B;  1ZYP A;  3FHK A;  4V2N A;  2VCT A;  3DRN A;  1SK0 A;  4WXT A;  1JZR A;  3FEU A;  1ZCP A;  4O5Q A;  3RPP A;  4POK A;  4CDO A;  2X8H A;  2DMM A;  1H4O A;  4DSS B;  5JCU A;  4OFM A;  3QAW A;  4ISD A;  1PGT A;  3ERF A;  3MAK A;  2K9F A;  4D73 B;  1UC7 A;  4IHU A;  4HU9 A;  3SBC A;  5IPH A;  5JCG A;  2L4Q A;  5D9V A;  2G2Q A;  3FR9 A;  1VRS D;  1ZGN A;  1SKW B;  4KB3 A;  4TRX A;  4ECJ A;  2HZF A;  5IQY A;  4I6X A;  5G2Z A;  2CQ9 A;  4MNN A;  3D4T A;  4PUA A;  2WGR A;  4OD7 A;  2VL2 C;  3DVW A;  4JR6 A;  4N11 A;  22GS A;  6GSU A;  4X0X A;  2KLX A;  1KNG A;  2NVL A;  1PD2 1;  1SL2 B;  4JZQ A;  1ML6 A;  1M2A A;  1F3B A;  3LG6 A;  3US3 A;  4MF5 A;  3EU3 A;  2DIY A;  4Z2R A;  3GA4 A;  3IAM 2;  4ZBA A;  3Q18 A;  4KCA A;  6GST A;  3GKK A;  2JSZ A;  2C3Q A;  3K8N A;  5D73 A;  3N5O A;  5D96 A;  2B5X A;  1SJI A;  1JHB A;  3A2X A;  1ZMA A;  2UZ8 A;  2JU5 A;  3E0U A;  1EP8 A;  1XW5 A;  3LQ7 A;  1K3O A;  3ZYW A;  2HRA A;  2R3X A;  4TKY A;  1Q98 A;  4ZB9 A;  4F0C A;  3CSI A;  2HRK A;  2E2G A;  4QQ7 A;  5D8I A;  1AQV A;  1K0N A;  5CO3 A;  5B6M A;  2QC7 A;  1WIK A;  1EEM A;  3GTU A;  4L0U A;  2H76 A;  2X49 A;  3LYK A;  3A2W A;  4PGT A;  3H79 A;  4ECB A;  4KND A;  2IIY A;  3TJB A;  2XPE A;  2LJA A;  2RLI A;  1GWC A;  2IJY A;  1GSY A;  5E4W A;  4IP6 A;  1XWK A;  4WBJ A;  3F9U A;  2C1Y A;  2X64 A;  3G7I A;  5IMZ A;  2GSR A;  3DVX A;  2BMX A;  4Q5Q A;  1U3A A;  1W4V A;  2LJR A;  1OE8 A;  1O81 A;  3DD3 A;  3V1W A;  4DVC A;  4ML6 A;  5CRD A;  3GTU B;  4F0B A;  3FW2 A;  3R3E A;  1ST9 A;  3EIN A;  4KH7 A;  1Q4J A;  5B8B A;  5ELG A;  1SYR A;  4MJB A;  3GUR A;  2DIZ A;  2WS2 A;  2MMN A;  5ECI B;  1T4Z A;  5HR2 A;  5IO0 A;  1TK8 B;  1VF2 A;  3TDG A;  3KM6 A;  2LUS A;  2EIR A;  3A5I A;  1PX6 A;  1K0C A;  5G30 A;  4FH8 A;  3HA9 A;  3FK8 A;  1ZL9 A;  1A8L A;  2DJ2 A;  4TVE A;  5F07 A;  3GYK A;  2IMK A;  4MAB A;  5GSS A;  2O7K A;  4GSN A;  3HKR A;  4NHW A;  1PMT A;  13GS A;  2FCH A;  3I43 A;  5IM9 A;  2L5L A;  3M1G A;  4EKZ A;  3GN3 A;  2LRC A;  2P31 A;  5CRW A;  3CTG A;  3O3T A;  3TRP A;  3UBK A;  4K6X A;  1I9D A;  4YAP A;  1PKW A;  3IAS 2;  4LLR A;  5COH A;  4JRR A;  3ZL5 A;  1ACV A;  3ZTL A;  4HS1 A;  2CVB A;  2X4A A;  2VUP A;  2HFD A;  5IPG A;  2R0C A;  3KTL A;  2NBS A;  4KDY A;  3WT2 A;  4EO3 A;  4FYC A;  3ISO A;  3LJR A;  3DXB A;  2N5B A;  3CRT A;  1VF4 A;  2V41 A;  3KJY A;  2X99 A;  3GFK A;  1TOF A;  5J4U A;  1RQM A;  4GSS A;  2VOC A;  4IBP A;  1PKZ A;  2VD1 A;  4O5R A;  4IS0 A;  4EXJ A;  3KD0 A;  1A23 A;  3CTF A;  2L6D A;  2MMZ A;  1JFU A;  3MDK A;  3VWU A;  2HE3 A;  4TXV A;  4X4J A;  1ERV A;  4H86 A;  1BQ7 A;  2I3Y A;  4V2M A;  3TGZ A;  4EF0 A;  3QDN A;  1AQW A;  2O8V B;  1WP0 A;  5DAL B;  2PBJ A;  4MZB A;  1Z7P A;  5CP1 A;  3UIW A;  3VPT A;  1T8E B;  2VCQ A;  1R5P A;  1OKD A;  4FYB A;  1TDI A;  4NHZ A;  2JZT A;  1MD3 A;  5IMA A;  3LOR A;  3IHQ A;  1DSB A;  5ECO B;  2FNO A;  3TKP A;  2QSI A;  2IMD A;  2OBI A;  1R7H A;  3LSZ A;  4KF9 A;  3IR4 A;  1WWJ A;  1PN0 A;  2HZE A;  3BOA A;  2OAD A;  4PQH A;  2YV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...