3MEDB

Hiv-1 k103n reverse transcriptase in complex with tmc125
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 114
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3medB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB03
3V4IB 3KLGB 3UQSA 1FKPA 2OPQA 5DLGA 4TY9A 3GIMA 2I1RA 2RF2B 2XI2A 4URGA 1Z4UA 4WZMA 1TL1A 4QWCA 2W7PA 2ZD1A 3DRRA 4NLWA 5KG5A 4IDKB 3SI8A 3ISND 4NLGA 1T3NA 1YVFA 1TQLA 2R2TA 4TXSA 2YNIB 2YNHA 3V6KA 4ID5B 4FS2A 3M9MB 2D3UA 3M9OB 4FBUA 3FRZA 3I5CA 4WXWA 5DGBA 5KFOA 2IM1A 1S6QA 3MEEB 1CSJA 3Q8SB 5DGAA 4O3QA 3N6MA 2IMWP 4RNFA 3FFIA 3I0RB 3DI6B 2RKIB 1GX6A 4RW8B 4Y2CA 4JUZA 5KFQA 4KAIA 2FJXA 5KG1A 2D3ZA 2W9AA 1JLBB 1TV6A 3H40A 4K4XA 4ZVEA 1LW0B 3GYNA 5HP1A 1S4FA 5KT2A 4K4UA 4ECZA 4I7FA 4JV0A 1SUQA 1RT3B 4IRDA 5DQHA 4DL7A 3QO9A 2FJVA 1RTDA 3OL8A 2ASDA 5KFUA 3KLIB 1TL3B 4O4RA 5KFRA 3OLAA 3GIJA 1S10A 2D7SA 1JLFB 1JIHA 3MR3A 4DG1A 2DPJA 2JEGA 4QWDA 4K4VA 4DL2A 5C25A 5KFFA 3HVTA 3IS9B 4IR1A 4WFYA 4PUOA 1VRTB 2OPRB 1BQNB 1I6JA 5D3GA 1S9EB 3H2LA 4TYAA 5K14A 1U09A 5KFIA 2V4RA 4R5PB 2IM2A 2ASLA 2QV6A 4FBTA 2HWHA 4WFZA 4TQRA 4RUAA 1LWEA 1TKTA 2BE2A 5HBMB 4J9LA 4M95A 2FLLA 3DLEA 4LSLA 3SFGA 1UWBB 3KMSA 5KFVA 3BREA 3DLKB 3JSMB 3H4DA 5J1EA 2ZE2B 3OHAA 2C22A 3PW7A 4OL8A 3CJ4A 1HQUA 2UVWA 1IKVB 4NCGB 3HHKA 4RW9A 3ISNC 4KO0A 5J2MA 5EWFA 4G3IA 4H4OA 3TAMB 2FLNA 5KT5A 4ECSA 1S1TA 1S1XB 3LAKA 1K1QA 3DMJA 3DRPA 3MEDB 1TKZB 4RW6B 4XPCA 3CO9A 5F8HA 4EYIB 1HNIA 3DOKB 3M8QA 5C24A 5F8NA 2VA3A 3MECA 3CJ3A 4QWBA 2B43A 4IG0B 3I0SB 1N6QA 3GIIA 1S0NA 2YKNB 4ICLA 1LW2B 1JLAA 3I5AA 2E9RX 5KFZA 3FQLA 1S48A 4KHMA 2AU0A 2HAIA 3V81B 2I5JB 3T19A 3V4IA 3KLGA 1IM4A 4IH5A 4MIBA 4NRUA 3UDLA 5EWGA 1FKOB 4RNMA 2BANB 2XI3A 1RT7A 1QAIA 2R2SA 2IBKA 1S1VB 5I42B 1BQMB 2CJQA 3T5HA 3FDSA 4IOBA 2WHOA 3DM2B 3NMAA 3MF5A 2YNIA 4KHRA 4J9OA 4ID5A 4YR3A 1DTQB 4IG3B 2J6TA 3IGNA 1N5YB 3ITHB 3IGVA 4ZVHA 4O3RA 4H4MB 4Y3CA 4XO0A 2R8HA 2R8KA 3IRXB 3BSAA 4EO6A 2F8EX 5L9XA 3MEEA 5KFPA 5KG2A 2BRLA 2XCPA 3EPGA 5KFTA 5KFKA 2IM3A 4F50A 3I0RA 3DI6A 1W25A 4ZHRB 2R8GA 1JLBA 3BSOA 1EETB 4O3OA 1LW0A 5DG7A 3BR9A 3RB4A 1JXLA 3PHEA 4KFBA 1RT6B 2GC8A 4I2PB 5F8GA 3MFIA 4IRCA 1D1UA 4PQUB 2ZKUA 3KLIA 4NLXA 4R8UB 4IFVB 4DL5A 1SH0A 4IFYB 1JLFA 4MIAA 1ZTWA 3QGIA 3G86A 4NLRA 3IS9A 5HLFB 2OPRA 1BQNA 3N6LA 1S9EA 1DLOA 1DTTB 4O3NA 4DEZA 4R0EA 3QIPA 1RDRA 4R5PA 3QIDA 4EO8A 4YQWA 4IQXA 2C2EA 4MK8A 4NLYA 4ZMMA 5HBMA 4TY8B 1JLGA 2UVRA 4ED6A 2WRMA 2JC0A 2BR0A 1UWBA 1RT5B 2YKMB 1T94A 1HNVB 3DLKA 3JSMA 3QGHA 1IKYB 2DPIA 2ZE2A 2ATLA 3ICLA 3VQSA 4I2QB 3H5UA 1S97A 3M8PB 4TLRA 2E9TA 2R2RA 5T14A 1C0TB 3TAMA 4RNOA 1S1XA 2VG6B 3C6UB 3DDKA 1S6PB 3MEDA 1TKZA 3NBPB 1KHVA 4HKQA 4NLUA 3KLEB 2V4QA 3RBDA 1KLMB 2FJWA 5KG3A 3DOKA 3CIZA 3HKWA 2XC9A 4MK7A 1TP7A 4TQSA 4IG0A 2C2DA 4NLSA 3I0SA 3T1AA 2HNZB 4JV2A 3DYAA 2YKNA 3KLVA 1LW2A 4Q43A 3G6YA 1J5OA 2IAJB 3T5LA 4TYBA 2OPPB 1FK9B 5C5JA 3CVKA 3OSPA 3V81A 4F4ZA 2AQ4A 5I3UB 3IG1B 4LSNB 1ZTTA 4NLQA 2BANA 2HMIB 2ILZA 3EZUA 3I5BA 1S1VA 5I42A 1BQMA 4IKAA 4RW7B 3BQ0A 4EBCA 3DM2A 2HNDB 4RNNA 4ECTA 4XPEA 2YNGB 2E9ZA 2W9CB 4IH7A 3BQ2A 5KT3A 3G6XA 3HVAA 5KFYA 5F8JA 4G1QB 2ASJA 1DTQA 1NNDA 4IG3A 5L1JA 2BRKA 3Q8PB 2W8KA 3ITHA 4J9RA 4H4MA 5KFDA 5C42B 3H59A 5EWEA 3IRXA 4QW9A 4ED7A 2FVCA 4ZP9A 4RUCA 3LANA 4PWDB 4WE1B 1HYSB 4ED1A 1R0AB 4O4GB 3MTKA 2O5DA 3OL7A 4ECRA 3NAHA 2AGPA 2IM0A 3E01B 4MFBB 3DLGB 1C1CB 2R2UA 1RT1B 1EETA 3V6DB 3NGDA 1QAJA 4QW8A 3PR4A 4K4ZA 5FDLB 3OL9A 2JEIA 3MEGB 1LWFB 3RBEA 2V9WA 1S9FA 1RT6A 1S1WB 4I2PA 2RDIA 4MK9A 4MKBA 4KB7A 3TVKA 4F4WA 3PJXA 1HPZB 3PR5B 4PQUA 1C0UB 4WYWA 2WONB 3KHRA 2UVVA 4R8UA 4IFVA 1FKPB 3KJVB 2AX0A 5KT4A 4IFYA 4MKAA 3GQCA 3T5KA 3H5XA 4ZP7A 2JEJA 1T03B 3LP1B 4IH6A 1RTJB 1QE1B 5HLFA 3BGRB 3DRRB 5F8MA 5KG7A 5F8LA 2R8JA 3C6TB 1DTTA 3JYTB 4ZVGA 3QGGA 1JLEB 3BSCA 5KFWA 2IJNA 3PW4A 4TY8A 2RF2A 2UVUA 1EP4B 4O44B 3UPFA 2AGOA 4ED0A 2YKMA 1RTIB 1LWCB 4TN2A 1HNVA 1HQEB 1IKYA 1VRUB 4IDKA 2VG5B 5HROB 3OSNA 3KLFB 5J2QB 4I2QA 4U7CA 3M8PA 3OHBA 3SFUA 3KHLA 1C0TA 5KFJA 3KK2B 3MR6A 2WTFA 2J6UA 2VG6A 3C6UA 4O3SA 1S6PA 2OPSB 1N4LA 3NBPA 1S49A 3T5JA 3KLEA 1KLMA 3EPIA 3PVXA 2D41A 1RA6A 3RAXA 3QO9B 1JX4A 4QWAA 4B3OB 1TVRB 4URSA 4K4TA 4H54A 4NYZA 3GV8B 2RKIA 3KHHA 4RW8A 1IKWB 2HNZA 3QZ7A 2V0NA 3D5MA 3D28A 4Q44A 2R8IA 1TKXB 5CYMB 1JLCB 1RTHB 2IAJA 5C25B 2XCAA 1FK9A 1RT3A 1MU2B 3HVWA 1KHWA 2ILYA 3CDUA 5I3UA 3IG1A 5K14B 4NLPA 4ECVA 3E51A 4LSNA 3RB6A 1C2PA 1TL3A 2HMIA 3FSIA 2BE2B 1RA7A 2VA2A 2AX1A 1QUVA 5DLFA 2YNGA 1VRTA 5J1EB 5DG9A 2UUTA 2AGQA 4G1QA 4K50A 1RAJA 4RW9B 5C42A 5L1LA 3DMJB 4WE1A 3NKYA 1SV5B 1HYSA 1R0AA 1REVB 4O4GA 4K4YA 1N56A 3V6JA 3H4BA 1D0EA 3TQ1A 4NLOA 1IKVA 4NCGA 4KBIA 1C1CA 3V6DA 1RT1A 2XWYA 3H5SA 4YR2A 5KFAA 3M9NB 4F4XA 4IR9A 4Q8EA 5FDLA 1GX5A 5EDWA 4GC7A 3KLHB 2CKWA 3GV5B 3MEGA 4EYHB 4ECWA 3LALA 5EUHA 2YNFB 2IC3B 1S1WA 4RW6A 3LP2B 4J9QA 3CJ0A 1SH3A 1HPZA 1RYSA 2IJFA 1C0UA 1MMLA 2B5JB 2WONA 5KG0A 1C1BB 4ZPBA 1S9GB 3DRSB 3KJVA 4O3PA 5KFHA 3KHGA 1RT4B 1RT7B 1T03A 3LP1A 3CDWA 1RTJA 1QE1A 4NLDA 3OL6A 3KK1B 4RW4B 2C2RA 1XR7A 3BGRA 4KKOB 5JUMA 2OH2A 5KFMA 3BQ1A 3C6TA 3JYTA 4K4SA 1S1UB 5KFLA 3IN5A 2I5JA 1JLEA 4Q0BB 2WOMB 2BQUA 1FKOA 2W9BB 2JEFA 5CYQB 4NLTA 1EP4A 4O44A 5J2PB 4ZVFA 2VG7B 4J9NA 1RTIA 1LWCA 2WCXA 4RZRA 4EEYA 3PW0A 1HQEA 1S0MA 3CJ5A 3QYYA 2XGPA 1VRUA 5KT6A 4U6PA 3GV7B 2VG5A 1RT2B 3DOLB 5HROA 3KLFA 5J2QA 4RNHA 4WFXA 4FS1A 1HMVB 3OLBA 4DL6A 4YMEA 1RYRA 2FVRA 4MH8A 1N5YA 2EC0A 3KK2A 3KOAA 1IKXB 3CDEA 4NLVA 4J9PA 2B6AB 2OPSA 2FVSA 1T05B 5JXSA 4KFBB 2W7OA 4ED8A 5DG8A 4LQ3A 4B3OA 1TVRA 1NHUA 3H98A 1WNEA 3GIKA 4DL3A 4J9SA 4ECXA 3LP0B 4KV8B 2ALZA 1IKWA 5KT7A 3QLHB 4ZHRA 4Q8FA 1TKXA 1JLQB 5CYMA 1JLCA 1RTHA 4YP3A 1JKHB 3LAMA 5J2NB 3KK3B 1MU2A 2IA6A 1DLOB 2HNYB 3PJWA 3QIPB 5F9NA 4Q45A 2OPQB 4IRKA 2RDJA 1N48A 1JLGB 1XR5A 4NRTA 4JV1A 4ZPDA 1TL1B 4YR0A 2BQ3A 2ZD1B 4KSEB 4QPXA 5KFXA 1K1SA 1HARA 4URQU 4ZPCA 2FLPA 2YNHB 2QE5A 1XR6A 3PW5A 2GIQA 5DQIA 3UR0A 1ZETA 1RT5A 1SV5A 1S6QB 1REVA 4J9KA 4WXOA 3RB3A 5KG6A 2W8LA 3FFIB 4KE5A 4ZP8A 4Y2AA 4Y34A 2XGQA 3DYAB 4RU9A 3KLHA 1TV6B 1J5OB 3BSNA 4ED3A 2YNFA 2IC3A 5HP1B 4EBEA 3LP2A 3KNAA 4I7FB 3N6NA 1SUQB 2B5JA 2FVPA 2BQRA 2WB4A 1C1BA 1RTDB 4ECUA 1S9GA 3DRSA 4M94A 1RT4A 4K4WA 4ZP6A 5KFGA 4DG1B 3GILA 3KK1A 4RW4A 2HWIA 4LQ9A 4HYKA 3RB0A 4KKOA 3NAIA 2C28A 3HVTB 1S0OA 3KMQA 2OPPA 4PUOB 4F4YA 4ZPAA 1S1UA 5D3GB 5F8IA 3CJ2A 4QWEA 4Q0BA 4WZQA 1OS5A 2WOMA 3QZ8A 2W9BA 5CYQA 4ED2A 2J6SA 3MR5A 5KFSA 5J2PA 1LWEB 1TKTB 2VG7A 3BJYA 3DLEB 4RW7A 5KFCA 4LSLB 2HNDA 1RT2A 3DOLA 4ECYA 2W9CA 1NHVA 1HMVA 2FVQA 5L1IA 3V6HA 3Q8QB 4J9MA 3NL0A 1HQUB 5L1KA 3G6VA 2UUWA 3MFHA 4KO0B 5J2MB 1IKXA 2AWZA 4EBDA 2B6AA 4H4OB 5KFNA 1S1TB 5KG4A 1T05A 4PWDA 3DRPB 5KFBA 3MR2A 3CWJA 1HNIB 4WYLA 3M8QB 5C24B 2GIRA 3LP0A 3FQKA 3E01A 4KV8A 3DLGA 3MECB 4MFBA 3QLHA 4NZ0A 3Q8RB 4GC6A 4DL4A 3RAQA 1JLQA 2WK4A 1N6QB 4ECQA 4ICLB 2JC1A 1JLAB 1JKHA 2JLEA 1LWFA 1SH2A 3KK3A 5J2NA 5KFEA 3PZPA 4X2BA 5F9LA 5DQGA 3H5YA 2HNYA 3PW2A
chains in the Genus database with same CATH superfamily
2BX6A 1X4CA 2V34A 2NCKL 2VUGA 2W7PA 1C4CA 1YVFA 2R2TA 3T9ZA 2ACMA 4Y00A 1HWJA 3LA0A 4ZCIA 4LVOP 3M8RA 1SKRA 2FQQB 1SI9A 5KT2A 4K4UA 3ZZUA 1P9QC 4DL7A 3F44A 2FJVA 1N52B 4LF2A 2VPZB 2D7SA 2FUG9 1WACA 4PG5A 2IM2A 2BE2A 3ENVA 2LMIA 2RNEA 5J1EA 1QAXA 5K8OA 2UVWA 2OELA 4RU2A 1TUWA 2NLWA 1RCXB 2GAGC 2CPZA 1RWWB 2HW3A 1L5UA 2DGUA 4KHMA 1Y9OA 3Q8UA 1BQMB 1MG7A 1SJ4P 2MKCA 2EFNA 4H4MB 4EO6A 2GX8A 1GNKA 1H2TZ 4G1PA 2DNPA 3BSOA 1JXLA 1S7HA 4I2PB 3NXZA 3UN3A 1HL6A 1BD6A 1RBOB 2D9PA 5HLFB 1HW8A 2GVZA 2OEMA 2W2QP 3VGTA 3N6LA 4UOGA 1T94A 2ZE2A 1RKIA 2XG8A 4I2QB 1T9YA 1RWXB 2FLOA 3G8SA 3LQVA 3CD5A 1S6PB 1LK7A 4DV1J 1XNQJ 3HKWA 3PFEA 1IBMJ 1UJ4A 1TP7A 3IR5B 4B9UA 2ACYA 3I0SA 2YKNA 3ZZTA 2Z57B 5C5JA 3OSPA 4XK8C 5D15A 2CZVC 4DR1J 4CO3A 1FEHA 3MPVA 2HNDB 1GXUA 4X4RA 1DFDA 1SKWA 1U7LA 3POTB 2V68A 5GAGU 2Y1IA 3EVOA 2BDPA 1WHYA 1C0UB 4K5RA 1S99A 1FKPB 3KJVB 2XMAA 1RTJB 3BGRB 1DTTA 3A3PB 1RBLA 2IJNA 2W25A 3OHBA 2KFZA 1NK4A 1KLMA 3HZEA 3QO9B 4H54A 1X4DA 2RKIA 2WAQD 4RW8A 1P6TA 3KHHA 1A9NB 5GADI 3QZ7A 2EFQA 1Q8LA 3NGKA 3NS7B 2IMOA 4C8ZA 1JJ2R 3ILJA 1X9SA 2YNGA 4ZPTR 2WSFC 1U0SA 1U1LA 4A8YA 4WE1A 3M6UA 2V69A 1HBUB 2OAUA 2M3DA 4NCGA 3V6DA 3I9V9 5FDLA 3VV2B 2YKQA 2MZ1A 1T03A 1QE1A 1XR7A 2HVDA 3QATA 1YSJA 3FCWA 2J0XA 4JI1J 1PJ7A 3MM5B 1WDTA 2WCXA 4KHPJ 1VRUA 3W65A 3O44A 5EGYA 4PG6A 5IM0B 2I8EA 1RUSA 1WF2A 4OHYA 1IKXB 2DEJA 2LEBA 4KFBB 2W7OA 1KTQA 3JQMA 2MGZB 2KM8C 3PTWA 4UF4A 1MSWD 2YY3A 2NXJA 1RTHA 4CCHA 3FVYA 2QFJA 3K5PA 1WOSA 3PJWA 3VALA 4CZCA 4AD6A 4C8MA 3OXLA 3M8YA 2UUCF 1UWAA 1YJUA 2JLGA 2V4JB 1ZETA 5D0RA 3R2CJ 5G0RB 1FERA 4UOFA 4RU9A 4C98A 4DX8H 5CYJA 1QUPA 1YJTA 1KSPA 1CLFA 3T6JA 2L08A 3KK1A 2LKZA 3FMWA 3KMQA 2Q43A 2QYCA 4FYWB 4WZQA 3DXBA 3M6WA 4UZCA 3QZ8A 2OO4A 2MKJA 1UEUA 2HRYA 2FJBB 2XNQA 5THWA 4ELTA 2UUWA 4H4OB 4CLPA 1AFJA 5ETLA 2DY9A 4CNZA 1OYEA 3PKMA 4KV8A 1RLCL 3NNHA 3U1LA 2NQPA 3CCZA 5F9LA 2HNYA 4ZLNA 2HEKA 2C2MB 2XI2A 1TELA 2ZD1A 4NLGA 2FTRA 3HKZD 2V94A 3T9NA 2H5IB 4FS2A 4K0KJ 3G71S 3OVAA 4ZJOA 3MEEB 1CSJA 4X66F 4WTYA 4DR7F 4RNFA 1URRA 3M1VB 3HSDA 1RWPB 3HJVA 2XHWA 1Q82T 1WJ9A 1YJ9S 2KU7A 3W66A 1WORA 1XMOJ 1VFJA 3SSRA 5LSOA 1IBKJ 4I6AA 1Q53A 2QLFB 4R5PB 5LMUF 3SSQA 1N32F 1FRKA 4LSLA 5HO4A 1VQ7S 3HHKA 4U67Q 4PXCA 2VFUA 5A8WB 1AUDA 4LIRA 2AJQA 3RRGA 4O0IA 5HQ8A 1IM4A 1FKOB 2XI3A 2QA4G 2ALYB 4USUA 1S1VB 3W2VA 2Y8WA 4Y3CA 1T8EA 4WU2A 4GVLA 2KKHA 5KFKA 1LFWA 3BYPA 4DPTA 1E6YA 2HFZA 1D1UA 1FWLA 4NXNJ 5HMYA 3QGIA 2C2OB 1CQNA 4TU8A 1SC3B 2MEWA 4ZMMA 2Z58B 4N47A 1UWBA 1HNVB 3EDRB 3UD3P 4DCPB 1RE1B 3H5UA 3BM7A 5ETSA 2CJBA 4M5MA 3NBPB 5A8RA 5K20B 3TW0A 3PX4A 3DYAA 1HNWJ 2VPXB 4P74A 4F4ZA 4AXJA 3K89A 3MEKA 3DGPA 1ICEB 3QJJA 2E9ZA 4KR0B 1VJWA 5KT3A 3GG1A 1WOOA 3UWTA 5L1JA 4OZJA 1PO6A 4J9RA 5IC6B 5C42B 3H59A 4X4PA 1R0AB 3KUGA 4DQIA 4ZDNA 2BV3A 3RBEA 4MK9A 2H51B 3P96A 1W2IA 1CJTA 4QR2A 1VBYA 2XS5A 5C2CA 4ZVGA 4ALZA 2V9KA 2QSWA 4ED0A 1HQEB 2IIHA 5DDQC 2IYGA 5J2QB 3IAS9 1XNQF 3AB2B 1HWLA 3R7BB 3RU0A 3KK2B 5GMEA 3ENQA 3EPIA 2MPUA 3D28A 4Q44A 4DR1F 3WBZA 1S59A 3W5XA 1UA0A 1VC0A 2UU9F 6FDRA 1DHMA 5DG9A 2HRTA 3BGFA 4W98A 4LRBA 3U1MA 3CIMA 4K4YA 2FY1A 1D0EA 5FLXU 4DFMA 1IUJA 5HJXA 4IR9A 3D0HE 4GC7A 5ETNA 2YNFB 2JNJA 3LP2B 3KJFB 5LJ3Y 5IT9Y 4OZ2A 1NDPA 1RT4B 3CDWA 1KBRA 2ZH6A 4FPIA 3VAMA 1WKLA 2IFXA 2XO6A 5J2PB 2VG7B 1YWXA 1RTIA 5KT6A 1R0CB 5IQ6A 4UOCA 1RYRA 2FVRA 2E1PA 4QCLA 3OFGA 5HMZA 2BKOA 1VQSA 4N41A 3HHNB 2GMLA 2R7VA 2JRSA 2CPEA 1QLNA 2BW7A 4CLSA 2FHOB 4IO1A 3J81Y 4OQJA 2R4FA 3A1YG 4C8KA 2UUBF 1MN7A 5DDPC 3W9JA 2W4DA 4M8LA 4X65J 1TL5A 2Y9HA 4AXIA 4LF4J 3AA9A 1JXEA 4FKYA 3C15A 2KT2A 1WKJA 3OD2A 3UN2A 1S0VA 3B8HA 4JI1F 2BKNA 2VQFJ 4KHPF 4KYZA 1IR0A 1X4AA 3BS9A 5L8RC 4M5LA 3MURP 1U6ZA 2DT9A 2HVIA 3UNGC 5RUBA 4ZVUB 3C14A 4NL5A 2GAHC 1T3OA 4MFBA 2QIFA 2CPIA 1JLQA 4JYAJ 4M5IA 2E1CA 3H5YA 3RW6A 3GIMA 3OV7A 1N34J 2DGSA 1K8AT 1K73T 4NI2A 2X3DA 4DFKA 2D3UA 2RUSA 1RBAA 3IBCB 2J8AA 1FJEB 1HD1A 3PNIA 3QGPA 3FFIA 3D7SB 3RJMB 4DS5A 2NXCA 4CDIA 3OLAA 1AROP 2DPJA 4K8RA 4ZCMA 5KFFA 4IR1A 1VRTB 4HACA 2CYYA 5CH7B 1VGYA 4DV3J 4OX9J 3W62A 4X4UA 4LF6F 3BREA 2ZE2B 3CCRS 4O0NA 3CJ4A 4QJVA 3A13A 4DPYA 4E2FB 4ECSA 3RZAA 5F8HA 3L09A 1BLUA 3I0SB 3GIIA 3GJTB 2YKNB 4ICLA 2MKYA 3FQLA 3R6GB 1N5QA 3W60A 4LFCJ 3V4IA 1NB7A 4L76A 4PPZA 2HHHF 2RUGA 2Z8QA 1N5YB 3ET6A 2V50A 4O3RA 3B82A 2MZSA 3DI6A 3GPAA 2ZH9A 4CLWA 5J1PA 3ZC4A 3CMAS 4LF1A 2WW8A 1XMOF 2H3EB 1IR2A 5EX0A 2CWXA 1Y7PA 4DX5A 3GMGA 1DTTB 3ZZZA 3W9IA 4EUVA 5ETOA 5LL6d 1AYEA 4C8NA 2EK1A 2NSCA 3JSMA 3QGHA 2G1HA 3ICLA 3VQSA 4DV2F 2R2RA 2DXFA 5D4NA 3KYLA 4RWXA 1KLMB 4B3TJ 1VISA 1B99A 4Z37A 4FXDA 2AQ4A 2XLKA 5HMWA 5BXIA 3OT9A 3M8SA 1AUSL 5I42A 3AJ1A 1IXKA 4ILMA 2YNGB 1B64A 2W2NP 2DCLA 5KFDA 1VS3A 1FTCA 2XMVA 2Y1RI 4WE1B 3MOJB 3OFFA 3HF5A 2QA4S 3V6DB 1QAJA 1PAEX 5FDLB 2V9WA 2QJ3A 2W2MP 2MYFA 3PJXA 4YB7A 2UVVA 2PA3A 1I3OB 2L9WA 3T5KA 1T03B 2GVDA 1QE1B 3I6PA 2XLJA 1M5PC 2EFGA 3JTPA 1A6LA 5AJ3J 4NPOA 4PZVA 4N8OA 1IKYA 1VRUB 1SL0A 1FFSB 4P71A 1N54B 4DLGA 2Z0GA 2MJUA 1YKWA 3MR6A 2VG6A 1B7FA 2RQMA 1SIZA 4YN3B 3MPDA 1RTHB 5C25B 2HGNA 3MD1A 3E51A 3QT7A 2B0GA 2HMIA 4DV6J 3DN9A 2RS2A 1IBLJ 2ATCB 2VA2A 3AXKA 2V8VA 5DLFA 1U02A 1Q5YA 2OFGX 4Q2LA 4ELVA 3L95X 4DF8A 2DR7A 2QL5B 3D66A 1YBAA 3M6VA 2XS2A 1IKVA 3H5SA 3PHTA 4E98A 2ASJA 5ETQA 4P72A 4J9QA 2H9ZA 3IBFB 4JI4F 3TNVA 3UCUP 1HNXF 2C2RA 3KK1B 3R7SB 2F8MA 3FCHA 1JLEA 4DUZF 5FIIA 2VC1A 2R7TA 3LPYA 2DIUA 1MNEA 2ZZMA 5DG8A 4OYAA 3BF4A 3H98A 1WNEA 2BXJA 3A3OB 4KV8B 1SIWB 3K5OA 3MMBB 1KVJA 2IA6A 2HNYB 3D67A 3HD1A 3B54A 2FGCA 2ZD1B 4QPXA 1K1SA 2VL1A 2BJ3A 6AT1B 3SDEA 4FDFA 5CCMA 2FLPA 1LEOA 3L9ZA 3EGZA 1NK9A 4ID8A 2FVPA 3R6LB 4M94A 4HI1A 2H1YA 1GTHA 2E5LJ 2C28A 2HWIA 4KKOA 3QMQA 3H42A 1UZHA 2R42A 1MROA 1ULRA 4I6YA 3BJYA 4LSLB 2GQQA 3ENWA 1X5TA 2W9CA 1NHVA 2FVQA 4B3MF 4MIWA 1X5OA 1PIEA 4M5DA 5KFNA 2W2OP 2CPYA 1V6HA 2GV1A 2GJFA 4WYLA 4XIUA 2PEHA 2DHHA 4X84A 4J9VA 2JC1A 5F0UA 3K5MA 1U2FA 3PW2A 1RHRB 2QTWA 2OPQA 4NLWA 2W24A 1OPIA 2YNHA 2PE8A 3GFYA 2XHCA 1SJ3P 2IM1A 1EKRA 2FC9A 4Y2CA 4W90B 1E6YB 2HLUA 4OI6A 4ECZA 2PFFB 2VQFF 2WBRA 3SSSA 1T9UA 1JQGA 3J81j 3TA2A 4L73A 1K9MT 5K14A 1U09A 2ASLA 2C42A 2OI2A 1ZBTA 1UWBB 5CXTA 2L3MA 1O0PA 2QL7B 4AFFA 1RWNB 4CWBA 1VQLS 5KT5A 2BYCA 3IM9A 3DFEA 4EYIB 5A8RB 1HNIA 3GFZA 3DC2A 1RHJB 1M5HA 4JB8B 2MXYA 4C6AA 3VAGA 1N34F 2HAIA 3NRBA 2EBGA 5B7WA 4XDCA 1Q4RA 3DGPB 2A10A 3R9LA 1PSDA 3Q83A 4J9OA 1HIYA 5L9XA 2DGTA 3EPGA 3I0RA 1UCNA 4J5OA 1JLBA 1ZZFA 3AOAA 4PAAA 1Q7LB 3F41A 4WP8A 1YTYA 3EXYA 4MIAA 1CJTB 4DV3F 3D1OA 1S9EA 1DLOA 4R0EA 4BS2A 2CNKB 4USMA 2EC0A 1RT5B 5EHHA 5LMNF 1NDLA 3Q8VA 3PX0A 1ZAWA 3W2WA 3PO4A 2I0XA 1F3FA 1KHVA 4HKQA 3ZZPA 1BHNA 2B9WA 1I94J 2KHCA 1TMMA 4LFCF 3K17A 3MI7X 3UI3A 2KO1A 2ZC4A 1HR0F 2BANA 2CQPA 3G8TA 3DM2A 4Y65A 4ECTA 1X31C 1VRQC 3G6XA 1VQMS 4OJ3A 1X0PA 3CCSS 1CVJA 1KFSA 4FF1A 4USHA 1KDNA 2FVCA 3D6MB 2DRBA 3AOCA 4RBVA 3MM7A 2MKSA 3TVKA 3PR5B 4PQUA 6FD1A 4ZIVA 1N33J 1P1LA 1B0VA 2VB6A 4OJHA 2NR0A 4E8UA 3F73A 1G6BA 1RTIB 2UXDF 4IDKA 4GO5X 2C3UA 4MT1A 2VICA 1C0TA 4LF8F 3T5JA 3D4JA 1ZPWX 4QIVA 2JLFA 1M5KC 2HQ3A 3MOZA 5I3UA 3LGMA 1H2UX 4CLLA 3GIRA 1NSKL 2WW4A 3LW5C 1YK9A 1N36J 4OYOA 4EK2A 4NX9A 3VHQA 5B0EA 3TQ1A 1U24A 1HHSA 1WKKA 1RCOB 2ADCA 3GV5B 5D6GA 8RUCA 1RYSA 4HHHA 1T7PA 3TWZA 1B7YB 1H2VZ 2J9EA 2K8GA 4AE5A 3J7ZT 2I5JA 4B9MA 3T1YF 1IWGA 2FIUA 5L9NA 4YY3J 4X4OA 1JNRB 1VQ5S 4LRFA 1UJ5A 1ZA1B 3KOAA 2XYPB 4PCQA 2BW2A 2PSZA 2VHGA 3D1QA 3C14B 2VFVA 3EVMA 2DHXA 4DSIA 1GT8A 1JLQB 4DV6F 1BY9A 3UR3C 2M4MA 1VQNS 1KR4A 4X64J 1BQXA 2MZQA 2ERRA 4URQU 4DZ6A 3CCJS 4N5SA 3PV8A 4NI2B 1K0TA 1FJGJ 1R89A 2AIRB 1Y0HA 4J9KA 3AB4B 1CEZA 3FFIB 4Y34A 1OJ4A 5DJBA 4CH1A 3BSNA 2B5JA 2XY7A 4ECUA 4B9NA 2E29A 4LQ9A 4HEA9 1U8WA 1CJVB 4HACB 5F8IA 4Q0BA 4TKTA 5CYQA 2M7SA 5KFSA 3FZ2A 3MUMP 2R7WA 1Y10A 4J9MA 3DHWC 3S8SA 2AWZA 1M5SA 5KFBA 2D9OA 3CWJA 3Q22A 1RU1A 3RAQA 2WK4A 1HFEL 4ICLB 2DD8S 1SH2A 5DQGA 4P7VA 4F2RA 2P9EA 3V4IB 2CQIA 4TY9A 1O8BA 2RF2B 2C2ZB 2CUYA 3HXMA 5IWAF 1TK8A 3ET6B 3I5CA 3EZ5A 2XO7A 2IRYA 1KQFB 3N6MA 3I55S 3ZFVA 3DI6B 4ZCLA 1SUQA 1SJRA 4U8YA 1LXNA 5KFUA 1IJFB 2C3OA 1MWYA 4TYAA 4OZLA 2ZOFA 3DDIA 1PC5A 2VPWB 3JSMB 2G2ZA 4I64A 3QRRA 4CH0S 2W4PA 3QT5A 4G3IA 4OI0A 3GP9A 4LREA 2AYEA 4TNOA 2HBZB 5F8NA 3T1HF 2B43A 2CQ1A 4HL9A 5KFZA 1F2HA 1UETA 2AU0A 3HZGA 5A2QU 5H9EK 1D8ZA 2B9EA 5I42B 1LWXA 2EI5A 4LF5J 4C8LA 2Y8YA 4Y28C 4DI6A 5KG2A 2DXDA 4LFBJ 2BE7D 3RR8A 2BJ1A 3K5LA 4P2MA 2MKKA 2J7UA 3K8VA 3LWMA 1RXOB 2HRUA 1NJXA 3BKUA 4CH7A 1P1TA 5JJBA 3HCXA 3VCDA 1IKYB 2KFYA 1YIJS 4DFJA 2E9TA 4TLRA 1N8RT 3WX4A 2G0JA 3BGOP 3NNCA 1CBKA 2VG6B 2HQFA 1T9TA 2FJWA 3TRGA 1FT8A 1NH7A 1AZSA 3MMCA 4U95A 2HMIB 3EZUA 1NKBA 4U7UD 5GMDA 4XPEA 2OKQA 3HVAA 5F8JA 2AJ2A 2BOAA 2RRBA 5JVHQ 4YS2A 5IZHA 2ZHOA 4F26A 1X9MA 4ZPWR 1GQEA 1FXDA 4FXVA 3ZTPA 1LWFB 3M8WA 1SL2A 2F4FA 1ITPA 1NO8A 1SB6A 4DR3F 5KTQA 1NXIA 5CABA 2DNQA 1JLEB 2OEKA 1SQFA 4TY8A 3QT6A 2RB7A 3M6XA 1VBXA 4JI2J 4AT1B 2LEAA 3I56S 1K47A 4WPAA 1DQ9A 4FF2A 3CMES 3CD7A 1Y5NB 1ZAXA 3OJSA 3FSIA 3KKFA 3SDEB 5I4MA 1KTVA 1J27A 1XK8A 4O4GA 2B56A 1ZM2A 3FEYB 1TU0B 1S7IA 2KXHA 2RQCA 2FHMA 2XZDB 2B4UA 3OBIA 2GJ2A 1HPZA 1GXLA 1DZ5A 4JI5J 5AXNA 2Y0BB 1XMQF 4KKOB 1DJ0A 2YQ1A 3MM8A 5B09A 1MROB 2YPZA 3IA0A 1O6XA 2VG5A 3ZNUA 2GZOA 1F5CA 3AT1B 4M5DB 3CULA 1X5PA 3TO8A 4WJBA 1NHUA 1NRKA 1I5OB 1S6OA 5CYMA 2MY8A 3QJPA 1G4CA 4P2FA 2EK6A 4Q45A 1IBCB 2OPQB 1U25A 5DM6Q 5D4OA 4USKA 5LXRA 4DJBA 2YNHB 1V3RA 2VKZG 1UP1A 1REVA 1XC9A 2X51A 2GS8A 3DU5A 3BGUA 4P10A 2IRXA 3CTRA 4I69A 1KVKA 5U47A 4AUKA 1TL4A 3N6NA 2G1DA 4N8NA 4Y2KA 3IWXA 4FNIA 1R8AA 4DV4J 4DN9A 1VJQA 2RSQA 3TZYA 3BV8A 2J0WA 2J6SA 2CNLB 3MR5A 3UD5A 4I56A 1VLYA 3MD3A 5L1IA 3QFWA 4YDDB 4EBDA 3NGTA 1IR1A 4P2XA 1HNIB 2HIQA 3PIPQ 1X8DA 2HVHA 1GMWA 4DSFA 5KFEA 4FNHA 2HK2A 3Q23A 3H4DA 3P4UB 3UQSA 4DV5J 2Q6BA 4DX6A 4DL0C 2DNZA 2KTQA 2OUGA 3Q8SB 2GW8A 3M30A 3I0RB 3QT8A 4C0BA 1JLBB 1KONA 5DM7Q 3AQOA 1Z2LA 2ASDA 3OJUA 1Q8BA 4QWDA 4NCAA 2HFSA 2ZWPA 1S9EB 4PG7A 1TKDA 3IP0A 2HWHA 1ZM4A 1LWEA 3SFGA 3R8YA 2YWGA 1FRJA 2LP4A 1V5IB 4MTPA 5D78A 3W2WB 3CDAA 2DH7A 3J80U 1AB8A 5HQLA 2VOPA 3UDLA 2B3TB 4PYDA 4YB5A 2BANB 4JI3J 1RT7A 2KN4A 3LPEA 4J91A 2VQEJ 3DM2B 5D8HB 3CDBA 2MDAA 1YBTA 5E33A 1HNZJ 1Q1KA 2BRLA 4DQRA 4Y6IA 2AEMA 3QWUA 1F5AA 4ZHRB 2BOPA 3MM7B 2AW0A 4P2SA 4PQUB 3FZBA 2O01C 2ZVSA 1FNXH 2EFVA 4UT4A 4O3NA 3QIPA 3FBEA 2X1GA 3VZIA 1C0TB 3HSZA 4S0MA 3KJNB 4C2MA 3MCOA 4JV2A 1KOOA 1J5OA 4OI1A 5I3UB 1QD1A 4IOAQ 3M4XA 2MQNA 4G1IA 1UFLA 1U45A 3B78A 1DTQA 2LECA 5HANA 1ZZNA 2CG4A 2HHXA 2NZCA 3CJKA 4DQSA 4IOCQ 4LRDA 3A3NB 3TOQA 4MKBA 4USTA 3R27A 4M5HA 2KYZA 2DEIA 2B4PA 2AD9A 1GMUA 1A7GE 2DKOB 4NEYA 2E5HA 4ED5A 4U7CA 3JSRA 2HFVA 3O3LA 2RAQA 1S49A 3KLEA 1VHIA 4NYZA 2HNZA 4MYTA 2V8HA 2OJ3A 3IAM9 5M2UA 3BEGB 1UVJA 4IUFA 2AGQA 4HH0A 3M2RA 2E66A 3FJ2A 4RW9B 4ZVSB 3V4MA 3MAAA 3THTA 4C11A 4YR2A 2XWYA 4X4QA 4Q8EA 2CKWA 4YEAA 5LSLA 5T7LA 2UP1A 2B5JB 4ZPBA 4DV0J 3W7BA 2QN6B 3MR7A 1XTZA 3SIPB 1TMJA 2FJDB 4Q0BB 5CYQB 2KXNB 1KP6A 2MTLA 4RZRA 2XGPA 3GSDA 3KLFA 2DVIA 2DHSA 3I31A 2V2ZA 2GMHA 3HT3A 3ZZ0A 2CFXA 1IKWA 4F25A 2K3IA 5F9NA 1FWPA 4F2SA 3DLBA 2FD2A 1BXNA 4ZPCA 2P8IA 1YHQS 2SXLA 1FO1A 5IS2A 1SV5A 1LV5A 5IT4A 3CCVS 2KI2A 4DCOB 3BH6B 1X0FA 4JI5F 1SUQB 1P27B 1OO0B 1KKHA 2YX1A 5KFGA 4LF9F 3S01A 3FBFA 4LBIA 3C8YA 2KG1A 5HMXA 1EB0A 1OS5A 5HAOA 1XNRJ 2W9BA 4ED2A 3QNWB 5KFCA 1RADB 2MMYA 2AF6A 3NL0A 2IRUA 3PDNA 4LFAJ 1T05A 1PBAA 3BDPA 2BEFA 2Y3YA 3SFUA 5IXUA 4ZS6A 2JLEA 3TANA 3ZXWA 3PIOQ 3HVRA 3R1HA 1HBOA 2DNGA 2W2PP 3SI8A 3ISND 4LJMA 1TQLA 4TXSA 3D54A 3V6KA 4O23A 4CLTA 2CJKA 1WTFA 1D9FA 2DIVA 4DZDA 1JXVA 3AOBA 1XWLA 3RG6A 2N7YA 5HJYA 1RHQB 4ZVEA 3GYNA 4DV4F 3NP5A 1FD8A 4P6QA 3G8QA 2ZKTA 2XMMA 2QV6A 2F8HA 1NDCA 3OHAA 2A3JA 5IT9U 4KH1B 4L3KA 3CD6S 3CW2C 4KO0A 3DLLQ 3F0NA 1D3WA 3LAKA 1RHUB 3MM9A 4RW6B 2VOOA 4ZPVR 1WEYA 2EVZA 4DFPA 4ETXA 2DR6A 1AZSB 3HHDA 4L74A 3HHLD 4OJGA 3MMCB 3RR7A 1TAUA 2G0IA 1QAIA 1UFKA 2NXUA 3FDSA 1WEXA 3MMAA 1RU2A 2PC6A 2KDOA 2DHGA 2NXEA 2G2YA 4NA2A 2ZZNA 3BR9A 2IYIA 3PO5A 4USWA 5HK4A 2ZKUA 4OYMA 4WP3A 1SH0A 3R5CA 2KRRA 1WSVA 3GWCA 2H5JB 4QYRA 1HBNA 4NXMF 2VIHA 2NS1B 2FZGB 2ABYA 4TY8B 4ED6A 2FZCB 3CUNA 2DRAA 3AODA 4YB1P 3NWGA 1UVNA 2RS8A 2XSJA 3N01A 4RNOA 1S1XA 3FCVA 2V4QA 2GJIA 2VBXA 2X1FA 4AQYJ 4JOUA 4DBQA 3VGVA 2PMHA 3TYTA 3OTOF 4Q2MA 2VD3A 3ULHA 3MDFA 3FNNA 3IRXA 2FYXA 4RUCA 4PWDB 2Y0SD 4O4GB 3OL7A 3ZTQA 7AT1B 1EIYB 2IM0A 1RAEB 3DLGB 2KVQE 2LU2A 3EM1A 4KGMA 3GZ7A 3TZXA 4F4WA 1HPZB 3GFXA 3KHRA 2KZMA 3N79A 4OHZA 1VQ4S 5F8LA 4M5NA 5FLXY 1JK9B 3MM8B 1YRTA 3GONA 1U2CA 3CSKA 2VG5B 1H3DA 1FRIA 2M9KA 2OMLA 4B08A 4QYZJ 2B7CB 3E2EA 4K4TA 2CJ9A 2ZBRA 1DARA 3SQOP 2AYMA 3D5MA 5CYMB 2UV8G 4DX7A 3GG0A 1U47A 4ECVA 1OY9A 1MLAA 5GAGI 4F3QA 1PILA 4HTIA 1S12A 2UUTA 3M2VA 3TZWA 4DF4A 1UPPA 1FVSA 3DMJB 2HBYB 1REVB 1N56A 3NGUA 2EG1A 4PYAA 1GX5A 1P9YA 3LALA 3GYGA 4ZN3A 3L7OA 2QA2A 2QO3A 3UO0A 2X1AA 1UMJA 3MPUB 4W92B 5GAEI 1ZAVA 4QPTA 2OH2A 3LWLA 3JYTA 1WG1A 1B3TA 4PEOA 3B4MA 1UW4A 2JEFA 4J9NA 2YBVA 1APSA 1EAYC 3FK4A 3GV7B 2RE1A 2Z2LA 4WFXA 4YMEA 4J9PA 2OPSA 4BC9A 4X62J 2F4VJ 2F1FA 5K5MA 1WF0A 1XERA 3NS5A 2RH3A 3ZO7A 5F41A 1N48A 1HHQA 1JJHA 4YR0A 5ETRA 3HO1A 4BWJA 2NYHA 3OTCA 2WB1D 4LR9A 3RB3A 2M8HA 3M30B 2U1AA 4KTQA 2OFHX 3R2DJ 3KLHA 5HVFA 4ANEA 3O5TB 1TR0A 1XEZA 3GILA 4MMOA 3MM6A 4HYKA 1S0OA 2OPPA 2E1AA 2ROPA 1TUVA 2B8PA 4NMLA 1FRXA 1X60A 4UZBA 1LWEB 3VQTA 2CQCA 3MR2A 3AJ2A 2KHDA 5E3AA 3E01A 4OI4A 4JI8J 1AT1B 3PZPA 3KK3A 3OXGA 1FKAF 3R5BA 1VK8A 3G6ES 4GKKF 2CNOB 4UY85 1YX2A 4A8OA 3M9OB 3IC1A 4FBUA 5KAKA 5DGBA 4EMDA 3UCZP 4OLPA 4OV6A 4CLYA 3EUNA 2DNMA 3JTOA 1D9AA 5HP1A 2FHJD 1T9WA 3W3SA 1RT3B 5BR8F 1RAOA 1TL3B 4DUYJ 3PYGA 4DG1A 4DR2F 2HGLA 2KYXA 3HFVA 2FLLA 2UUAF 1NAQA 2AKWB 3NGRA 1WTBA 3ISNC 5J2MA 2GGPA 3CO9A 5SZTA 4CQ1A 1EX8A 3MCMA 4ETZA 1S0NA 4JI0J 1SKSA 3TAQA 2DGWA 2VFTA 5JVGQ 1S48A 1RZMA 2C3YA 2QA1A 4A8SA 3KLGA 4NRUA 5EWGA 2QX0A 4PXEA 2XMTA 2QGFB 4LSZB 2JZ5A 5GAEU 2F7VA 1DTQB 4ITSA 2JWNA 1NK0A 3TP2A 2R8HA 2L48A 2NYIA 4BC7A 3CJKB 1S76D 1IJEB 2OSQA 3KLIA 1KVIA 1BWEA 2GO9A 4FYVB 1ZTWA 1OPZA 4DV7J 3UDCA 3TUPA 1NZ8A 4MK8A 3HHLC 5FD1A 2WRMA 4A48A 4LF7J 1GH8A 2XZTB 3W5YA 2VBZA 3H8YA 1NBEB 3NEKA 3TAPA 1FVQA 3TEGA 2ZJQQ 2DISA 2EG2A 2XY5A 3KLEB 5D77A 2N82B 1KN6A 4AL7A 2C2DA 2HNZB 3ZTRA 4JV5J 5DETA 3C46A 2ZM6F 3M2RB 4CYUB 3M7VA 2AGPA 1JNZB 2DGQA 3MAAB 4C11B 5L46A 5EX3A 1EETA 3TVYA 5B0AA 2WSCC 3PR4A 5T7LB 1Q7YT 3CF5Q 5ITHA 3CMQA 3KG1A 4U7UK 2AZ1A 1KD1T 4IH6A 3CC4S 3DRRB 2MB0B 5KG7A 1QVFR 4C3KA 3QGGA 4C9DA 3BSCA 3DHXA 5DDRC 2UVUA 3AD9C 2WVBA 3AFGA 3KLFB 3I9ZA 2DR9A 4UW2A 1UA1A 3HFZB 5AE1A 3MUVP 3C6UA 4O3SA 4DR4F 3SQGA 3C66A 1HD0A 1WF1A 3UVJA 1IKWB 4B3SJ 3PY8A 2IDEA 5AXMA 2DNLA 1UFWA 1T9XA 2E44A 2GNKA 2C2NA 4JI6J 4G1QA 3P8BB 4HT7A 1SV5B 1HYSA 1NKCA 2ZH7A 3H4BA 4NLOA 2HHQA 2MKIA 3QBCA 1KNZA 3BBFA 2HQIA 1SH3A 9RUBA 2YWKA 1YRUA 2LQ5A 3LP1A 2NPIA 2UXBJ 4B3RF 3VGUA 2QLXA 1W2BR 2BQUA 2W9BB 3NNAA 1EP4A 2M70A 1HBMA 3QYYA 3OLBA 2LU1A 1T05B 2F9JA 4DSEA 1ROFA 1TUGB 1B4SA 2VC0A 4WKRA 5KT7A 3VZHA 2HGMA 4YP3A 1EQMA 3CO0P 3BN7A 4CM2A 3QRQA 1HI8A 5LSRA 1JLGB 2KT5A 1HI1A 2BQ3A 3RRHA 2CRLA 2QE5A 5HI7A 5T41A 4A8FA 1SCJB 2J7WA 2V8PA 2D74B 2XMKA 1D9DA 2FZKB 1G7CB 4ED3A 4F4AA 1V9OA 5CD4H 4YDXA 5E41A 2E5IA 1EARA 3CJ8A 4LUBA 4ZJLA 2E5GA 1R31A 2DHAA 2H4WB 1VLOA 3LOUA 5C7PA 2HNDA 2N4DA 3OPKA 2U2FA 4KO0B 3EJMA 2B6AA 1TTHB 2QSFA 3U7JA 3MM9B 4HHJA 4CLZA 3K58A 4WTOB 3O8WA 1S57A 4ECQA 1CULA 1G2EA 1FKPA 1Z4UA 5KG5A 1MMDA 2MQMA 3EVWA 3MMAB 1NLKL 2ZFHA 2HS0A 3VAHA 2KB2A 4F8RA 1R0BG 4N77A 2YKPA 4FVMA 4LMZA 2QZ8A 2C2KB 4KAIA 4DR6J 4RPFA 5D4PA 4I7FA 1D8YA 2EC2A 3QO9A 3HSJA 5DO2A 3CJTA 2F63A 1JIHA 3MR3A 2JEGA 3IO1A 4HHUA 1RWUA 1YZ6A 3DLEA 3LGNA 2BABA 3CNQP 3HX9A 3VAKA 2EWHA 2LLZA 2XSJB 1S1XB 4LBHA 1OWXA 4L6V3 4WFBQ 4C97A 1U8SA 4EZ9A 2E9RX 4F7VA 3VWSA 5MAOA 2I9SA 1U1RA 2AP6A 3MAQA 2R7SA 2ZDOA 4U96A 2WHOA 4DV1F 3MF5A 2KZZA 1IBMF 4E0DA 2GQCA 3IRXB 1MWQA 2XCPA 2XS7A 2HHVA 2RRAA 3EYZA 1UPMB 5IM0A 4ZVTB 2HZCA 5DG7A 4KFBA 4QBUA 3WQPA 1R8CA 3WZ0A 4F0KA 2WVDA 2QFIA 1Q16B 1MMNA 2UVRA 2VF3A 3N9UC 4NOHA 4OI2A 2O1PA 5T14A 2V4JA 3I4HX 1O5JA 3WHIA 1FFGB 2KJVA 2CQ3A 2ZHBA 3D9BA 2D1CA 3T5LA 4FPRA 4A4JA 4NLQA 4CLFA 1UEKA 1X4FA 4RW7B 4UUXA 5L38A 5MLCV 3ITHA 1QTNB 2DB1A 4ED7A 4ZP9A 1EQ0A 1Q78A 1NK5A 1CPZA 2R2UA 2HHWA 4ANCA 3M32A 3OL9A 2CG8A 1S9FA 1NJIT 4IFVA 5IFMA 4MKAA 4RWWA 2KJWA 3HHEA 3DRXA 3JYTB 4KGVB 3PXGa 2OMOA 3GFHA 4B17A 3NCRA 1UTAA 3R5AA 3AD8C 1U6FA 5KFJA 2OPSB 1N4LA 4RX6A 3PVXA 2FPHX 1RA6A 2HS3A 2ZBIA 3IWLA 1F9FA 3GV8B 1QM9A 2LFVA 2GFFA 2CVIA 3TA0A 2E7VA 1DQ8A 1N0VC 3N0VA 1Q79A 2BE2B 1MWZA 1QUVA 5J1EB 3MPWA 2KFNA 2J9CA 2XMUA 2ZUGA 1SJ1A 3KLHB 2A18A 1DBDA 5KG0A 4HDHA 1RISA 1SJFA 3MM6B 2NPFA 5KFMA 3FC9A 4K4SA 9ATCB 1FKOA 4ZVFA 2BJEA 4OYZA 4J37A 5G4DA 4U6PA 4PG4A 2IVFB 3L7UA 2RIJA 1REGX 4B3SF 4ECXA 1WUUA 1TFYA 4OYXA 1RB0A 1WEZA 2GVZB 3KK3B 4RBTA 1YJVA 1VQKS 1QDUB 3TX0A 3OFEA 3RBZA 5ADZA 2IY5B 4JV1A 3J7AN 1M5OC 3NMRA 2HWTA 1XQIA 1UEVA 4F02A 4M63A 4OYIA 1WD6A 2JFDA 5D4LA 5HP1B 4EBEA 3N5FA 3KNAA 1ELOA 1NPRA 4PWWA 3PACA 2OEJA 1S9GA 2BBEA 1YZ7A 3PEJA 1QTMA 4DG1B 4RW4A 1NKEA 4K0KF 3NAIA 1FI4A 1FX2A 2MSSA 2BJ7A 4KH0B 1LXJA 3KWMA 1OYDA 2ZHAA 3MUTP 3L4BC 2GO8A 1U1NA 1YRXA 3MFHA 5J2MB 2GGPB 3Q86A 1NMEB 2UUCJ 3A4TA 3Q8RB 1IBKF 2NXNA 3QLHA 4NZ0A 5DRKA 1UVIA 2XM3A 2HLTA 3N4WA 3KLGB 4CT9A 3W8PA 1VQYA 1G3OA 1HKAA 3THPA 3BDEA 2QMWA 3FBBA 3C16A 5DGAA 1GEHA 3JSYA 1Y00A 2RKIB 4RW8B 2D3ZA 3MPYA 2BJ9A 2HZVA 3CJSA 3KLIB 1PYOB 4O4RA 2BACA 5KFRA 5H9FK 3JQJA 3HVTA 2KM8B 4C7QA 2OTLS 5KFIA 3CPWR 3R5JB 3RW7A 3DU6A 5FJ4A 4NCGB 1OSCA 4NXNF 3G2XA 3VGSA 1K1QA 2VV5A 4X66J 2JVRA 4K5SA 3AHPA 2FHKA 4NASA 4DR7J 1PYTA 5AT1B 3BR8A 2LCWA 1WHWA 1U2RA 2CJQA 3CXCR 3NMAA 1FRHA 3TA1A 2P9GA 3IGNA 5GVQA 3IGVA 2V6AA 1LOUA 5K8MA 2ROGA 3DGVA 1HNWF 1KQGB 4WWSA 4I6WA 5LMUJ 4AL5A 1N32J 2ZH2A 1H98A 1EETB 4L75A 1LW0A 4CO0A 1EZZB 2PT0A 2R3VA 4IRCA 3GJQB 2RMLA 1FWKA 3WIUA 4FYYB 2M0GB 1BQNA 1SJQA 4ZVRB 1SPBP 4EO8A 4EU0A 2FGOA 5E2QA 2LA6A 3CB4A 3G96A 2ATLA 4H4KC 3C6UB 2M52A 1TKZA 1S10A 5IOLA 3SQGB 2MLXA 3UVJB 2NZ4A 2OP5A 4IG0A 2VDHA 2DH9A 1VQOS 4N76A 1R27B 1ACMB 1OSDA 3CVKA 1PKUA 1LQ9A 1ZTTA 1PYSB 4K7QA 4WP9A 2RILA 4EBCA 3P5TL 4IH7A 1U6BA 4G1QB 2ZBPA 1T0TV 3I4PA 1SC1B 2BMBA 4QW9A 1FRMA 1HYSB 4ED1A 2KT3A 3IWNC 3NGDA 4K4ZA 1H7XA 4KT0C 4KB7A 4Z7CA 1IM6A 1YGYA 4WYWA 1KEKA 5F3TA 4IFYA 3GQCA 2EKNA 3LP1B 1M0SA 3I32A 1HW9A 2VJVA 1H72C 1EP4B 2CPXA 2AGOA 2YKMA 2AJ0A 1HBMB 3OSNA 2HVEA 2QEXS 5B0GA 4NCBA 1UVKA 3IM8A 3DCAA 4RLEA 3C3LA 2V2KA 4M5GA 2EFOA 3EGWB 4BCAA 1RGVA 2CVEA 3P49B 3CCMS 1WG4A 1SKUB 2CNNB 1VRTA 2FB0A 2I2YA 1VOMA 3NWRA 3NKYA 3W61A 3OXFA 1RK8A 3RAMA 3M9NB 3V2UC 4CT8A 4EYHB 3BB5A 4GVBA 2QT7A 2ASYA 2MQ8A 3CJ0A 5GAHI 2PFDA 3ENAA 4OIXA 2Y1LB 4X65F 3W2VB 3BQ1A 1FDAA 4LF4F 2JJ4D 1YJNS 4NYOA 4I67A 1GXTA 5BYQA 3W64A 1N5YA 2UU9J 4NLVA 3AY0A 2B6AB 1QAYA 5JXSA 1NSPA 1M5VC 2XBPA 2B7BB 4WU3A 1CULB 4NA1A 3LAMA 4Y0FA 3J7YI 4PRFA 3GR0A 2AT1B 2RDJA 1HARA 2LEPA 3D3BJ 2HYIB 2H65B 4UOHA 3T41A 4QU7A 1BUXA 4JYAF 2BE9B 1R8BA 2V67A 1X7VA 2W8LA 4WIQA 5AE3A 3DYAB 5M2PA 1HI0P 1FXLA 3WX8A 4I7FB 3CC2S 3FUYA 3JXOA 4D3HA 4I68A 1U4BA 3RB0A 3BKTA 4F4YA 4C0HA 3RBXA 3VR1A 2WOMA 2H48B 2D3O1 5E0OA 3DLEB 4L3NA 3DOLA 1HMVA 1WC6A 2UUBJ 5EN1A 1TK0A 3NCPA 3LP0A 1YLXA 4OX9F 1DY3A 2MQOA 5J2NA 1FESA 2M88A 3Q8YA 5D0GA 2K7KA 2A6MA 2QLJB 3J80Y 5A0YA 1WSRA 4RR5A 3CCQS 4FP9A 4ZLLA 1GX6A 5KFQA 1TV6A 2HBRB 4DSLA 3MMJA 4U9RA 3CJRA 1NJZA 5C25A 4WFAQ 1ZM9A 3FEZA 4HLBA 2MQPA 3SBMA 4A8QA 4RUAA 1TKTA 2CDRB 4XDDA 5LM7E 3Q89A 1NPKA 3PW7A 1HQUA 2JVOA 3QAEA 1RACB 1BC6A 1S1TA 5B0FA 2MY7A 3WIVA 3QFHA 3MECA 3CJ3A 1LNQA 4NWBA 1KC8T 4BDPA 2CQDA 1FTRA 1PAUB 1RWVB 4B9TA 5LJ5Y 2XZWA 5GAHU 3UN5A 2I6WA 3AH6A 4B3TF 2POKA 3ITHB 3NGSA 3BSAA 5KFPA 3D6TB 5KFTA 1E6VA 1SQEA 3K7RA 2VZ9A 4LF6J 1WDDA 3M32B 2DRDA 3PHEA 2AHOB 4P52A 2A2CA 1QY7A 1F2GA 4IFVB 1DRZA 2R9LA 3IS9A 3MMBA 2NSBA 2XYHB 4G65A 2OPRA 4IQXA 1H38A 3DLKA 3SZ2A 3J7YU 3D68A 4EI2A 1OIAA 1NB2A 3TAMA 3DDKA 2YKOA 3C15B 4YHHJ 2HHHJ 3LO3A 2LQ9A 4CLKA 4MJKA 3HDSA 4WKYA 3DLJA 4TQSA 4NLSA 5AJ3F 3QAUA 4C8YA 5AE2A 2VBWA 3KUHA 4DXLA 2DK2A 2ILZA 3I5BA 4RNNA 2ADBA 5GADU 4EFAC 2W8KA 5EWEA 2E5JA 3RYLA 4XAKA 3HD2A 3LH2S 3MTKA 2EFPA 3NAHA 4FN5A 4MFBB 3U27A 2VU5A 2M8DB 1IBLF 1YJRA 2BM1A 4XTTA 3AXMA 1N5SA 4DV2J 3Q2TC 1CQMA 2ZJPQ 2N3LA 2AX0A 2F5GA 3H5XA 1RLDA 2RDDA 4LR8A 4A46A 5H9FJ 2CIMA 1O51A 2ZC3A 4ZVQB 2XLIA 2CQHA 1YI2S 3D0IE 4OYWA 1FDBA 3DRYA 2J6UA 2J9DA 3JAMU 2J5AA 3QJLA 4QWAA 1LK5A 4QR1A 2ZVIA 2IAJA 2ZH5A 2RHSB 2ZJRQ 1V5VA 3HVWA 2CADA 4NLPA 2DJWA 2OGUA 2JFKA 4HH1A 2QG9B 1RA7A 3RTVA 1QSLA 2EKYA 3SMZA 2O66A 2W01A 1FE4A 1RWKB 5M2RA 1FCAA 4ZIWA 2LQJA 2KRBA 3V6JA 1DAXA 4MKYA 4ANDA 1T02A 3GB0A 1SC6A 3HLUA 4K2JA 4UQTA 5EUHA 3VVUA 3ILIA 1XIQA 1S9GB 3KHGA 4NLDA 3OL6A 4RW4B 4KGXB 1U1OA 3F56A 4FZVA 3CCTA 2KH9A 1Y4ZB 1S0MA 2K2PA 4ED4A 4RNHA 2XQCA 4MH8A 2R7OA 1NEEA 1RAHB 2E5LF 2GHVC 1IVZA 2N3OA 3R7NB 1YITS 3UDEA 3QLHB 3EWGA 4JP8A 4PR6A 1UVMA 4IRKA 3B6BA 3FGVA 4JI4J 3KDOA 1URNA 1XR6A 1HNXJ 5DDOC 3VAIA 3PW5A 3SCLE 1RT5A 3ISZA 3C16B 2P9CA 4DUZJ 1JJ4A 4Y2AA 2XGQA 2YQ0A 3JB9k 1IQTA 5KOWA 3HVTB 3ZZRA 4UQGA 4W4MA 1UL3A 4FYXB 1RT2A 3V5RA 4X4NA 1CG2A 1F9HA 1VI7A 4DCJB 4BLGA 1SL1A 4DOZA 4GC6A 2RQ4A 2K06A 3KG4A 2MZJA 2GVDB 2V8DA 3JTNA 2PO4A 1YDLA 4X2BA 1RAIB 5DLGA 5GMKa 4WZMA 1TL1A 2DGVA 3IR6B 3Q24A 1L3TA 2V63A 3P6YC 5HQMA 2MSTA 2A0FB 2EEYA 1S6QA 2IMWP 4ATNA 2FJXA 2W9AA 4NZ6A 4K4XA 1LW0B 1S4FA 5D0HA 4IRDA 4P73A 4CP5A 3EZOA 4B3MJ 1RTDA 3UFCX 3W9HA 2XYGB 2OIHA 3I82A 3BO4A 2K1RA 4LRCA 1Q95G 2B8QA 1H6KX 1BQNB 3H2LA 1W26A 2O3DA 1TZ0A 4WCEQ 2BM0A 4J90A 1U1PA 2PMZD 1HWKA 4KGKA 1IKVB 1RABB 5CZVA 3AD7C 2HG4A 1TKZB 4RJVA 2RRNA 1HQ2A 5BYSA 3EGNA 4IG0B 5JMNA 2Z30B 5IC4B 5C2GA 4IH5A 2IBKA 1GK8A 1GAOA 3T5HA 2YNIA 4KHRA 4YR3A 4V1Ak 1I94F 4FYDA 1RHKB 4HR2A 1FEEA 2HK3A 1NM2A 5E3RA 2XWXA 2IVMA 5ETKA 1WHXA 4DL5A 4IFYB 3EICA 1U1QA 2CZ9A 2I38A 1Y5IB 3TJAA 3R1LA 5B0CA 3D2WA 2Z2YB 3PYFA 3H2UB 3RUBL 2YKMB 1ZA2B 1S72S 2LQBA 3CCLS 2Q3PA 4DR5J 3W8GA 1N33F 5KG3A 3DOKA 1P8GA 4ZKAA 4A8XA 2PA8D 3T1AA 1RWOB 1LW2A 4Q43A 2YXLA 2DNNA 3V81A 2UZAA 4MAKA 3BQ0A 3ETMA 2W9CB 1VDHA 2NUHA 1CJVA 1S77D 3Q2SC 3LGHA 2IA0A 4WBFA 1RHMB 1ZH5A 2CJYB 5LMNJ 3TR5A 4GVBB 2CAJA 2RD5C 1N36F 2CXEA 2JH3A 2H4YB 4B9LA 3VVTA 2RU3A 2XEXA 1EKSA 2RF2A 1JJCB 3UPFA 4TN2A 5E3CA 4GO7X 4F67A 1HR0J 4YHHF 3M8PA 5CA5A 3KHLA 1EHWA 3SEOA 4DQPA 3NOGA 2ZH4A 5AXKA 4URSA 4DWIA 4PKDB 4C48A 2R8IA 3W1YC 4YY3F 2P6TA 2Z2MA 4CTAA 3LTOA 5K14B 1C2PA 2RHQB 4DDFA 1IWAA 2AX1A 4DQQA 4QQBA 1Q8IA 4OX6A 4B02A 5HVGA 1FE0A 4KPCA 2HIYA 3TVZA 3VF0B 1X5SA 4CNYA 4C4WA 4R0JA 1RJJA 2UXDJ 2QYGA 1GFWB 5EDWA 4ECWA 4X64F 2Q79A 4RO0A 2AJ1A 2BZ2A 4YUDA 2D69A 4LF8J 3HM9A 2HHSA 1FJGF 2YKAA 5CHCB 1NHKL 1AA1B 5JUMA 1WC5A 3IN5A 2WOMB 2ZNZA 4NLTA 2CPJA 2ROEA 4ZITA 4O44A 4NMXA 4EEYA 2RT3A 4P9SA 3GJSB 3DOLB 3PM9A 1HMVB 4ER8A 3EXCX 2HS4A 3JSBA 3R5DA 1K44A 4ENOA 2LDIA 1H73A 4B3OA 3KUEA 3QQCD 3G9CA 4J9SA 1V3SA 3LP0B 3S6EA 2ALZA 2J8SA 3FKBA 3OR2A 2PN6A 1Y5LB 1UJ6A 1N5TA 5J2NB 2GA7A 1UZDA 1DLOB 3CT9A 1F60B 2CPDA 2FDNA 3WDOA 3LF0A 3EX7B 5KFXA 2CQBA 5A0YB 2PI5A 4QYZK 4WK3A 1FF2A 4WXOA 5KG6A 3T1YJ 4J9UE 2J9DE 2H5EA 4KE5A 5LOQA 1I51B 2KG0A 1TV6B 5IV4A 2BQRA 2IPOB 2QL9B 1WG5A 1S1UA 3GYXB 5IV3A 1TKTB 3P3DA 2HAFA 3GTYX 1LFPA 4F0MA 4OX7A 1HQUB 3G6VA 2PGCA 1X9WA 1S1TB 5HL7Q 3GLJA 4OZNA 4DL4A 3MECB 4D3GA 4OZ3A 2CQ0A 4BHQA 1LWFA 4BWMA 2X3GA 3MXHP 4KRWA 3PRVA 2I1RA 4URGA 2HPUA 3UNYA 4ES2A 4IDKB 2FY8A 1N5VA 5D0EA 1T3NA 2G9OA 4M5KA 3ILLA 3CGIA 3M9MB 3TUZC 2VODA 3K2YA 4O3QA 1E6VB 2C3MA 4OX8A 1Z1ZA 5DQHA 2J0QD 4LF5F 1BGXT 3BYRA 3L3CA 1F0XA 4MKVA 3IS9B 2CJXB 2OPRB 1I6JA 3FSXA 4LFBF 1R43A 4FBTA 4WFZA 3KDNA 4ZVOB 4TQRA 1S6UA 5KFVA 3DLKB 3ZZYA 4OL8A 2HSEB 4OYPA 3TAMB 2RU9A 5ETPA 3A8IA 3DRPA 3NCQA 5IWAJ 2QRRA 5K9FA 2DBBA 2PI4A 2ZEJA 2I5JB 4IQMA 4RBUA 4MIBA 4DU7A 4X4VA 4HI2A 2DGOA 5BJRA 4DPXA 2J6TA 1OMSA 3H2VE 2HHUA 3P45B 1Y3JA 1W25A 2JHEA 1FHTA 3EE3A 1BMQB 5F8GA 4CI0B 4HTJA 4ZA1A 2BKPA 4NLXA 1WC3A 4NLRA 4AL6A 4OHWA 3T1HJ 1K0VA 3QIDA 4M1KA 2WVFA 2C2EA 4NLYA 5HBMA 2BR0A 3S7RA 4WF9Q 1RTZA 4HT5A 2R7RA 2ZH1A 4M5JA 4ES3A 3MEDA 3WC0A 4MK7A 2DNRA 3O2IA 3BN4A 3G6YA 2IAJB 1WC4A 2N4CA 4TYBA 3CC7S 3OTEA 4JI2F 1ZOTA 1VYAA 3T6BA 4I4BA 3TUIC 2ZNYA 1NNDA 5HVHA 3FMBA 1VBKA 2KVIA 2R7QA 1KRPA 3SCJE 2W7AA 3US5A 4K2XA 2Q66A 3PFOA 3PCOB 4R8UA 1VIXA 5KT4A 4ZP7A 5CZXA 5F8MA 2YX7A 2R8JA 4IYQA 4Y2IA 4DR5F 2EBEA 3BPDA 3BBCA 3TARA 1BWVA 3C19A 4FF3A 1KS2A 2R7UA 4TVAB 4PG8A 2IBOA 4ERDA 4FKXA 3KXDA 1H0HB 4HDGA 3KG0A 4ZVPB 2XSFA 4DPOA 1RP5A 5E3PA 4F04B 3EMTA 4K50A 1AFIA 3ELHA 3MCNA 4DR3J 2IHR1 4ZOSA 3OQ2A 1L3KA 1C1CA 4V19X 2HBQB 2APOA 1NZAA 3OUYA 2IJFA 1MMLA 2UV8A 2K7JA 3AJDA 1DURA 2BJDA 1XJWB 3K57A 1D09B 2ZOMA 1S79A 3CJ5A 4LRAA 4FS1A 1RT2B 1T95A 3D6FB 3GCXP 2O67A 3CDEA 2XB2D 1C4AA 2CPFA 2KXFA 4RL1A 2LQ8A 4ED8A 4C3MA 3PJ9A 4ES1A 4Q8FA 4ZHRA 1R7IA 4DSJA 1TKXA 2MLYA 1Q86T 1Z2ZA 2DY1A 1YBUA 4OJ1A 3H0PA 1TL1B 3DKDA 1FFWB 2B9YA 1XMQJ 3TEHB 1S6QB 4OHXA 2CPHA 1RAGB 1CJUA 3CJQA 4U8VA 1YJ7A 1Q0NA 3BO2A 2OD6A 4DV5F 2IC3A 2J7KA 3T3FA 2WB4A 1C1BA 1RTDB 3GU0A 3DRSA 5F3ZA 2DGXA 2K1RB 4K4WA 3BO3A 3G82A 2HFUA 1FJCA 1VQ8S 1R8PA 2DCUB 3H20A 4QWEA 5LT5A 8ATCB 2HFOA 4OZ0A 2JDJA 3Q8QB 1RKJA 4F36A 3J81U 4YFUA 2CQ2A 4USJC 1AXQA 4HVZA 1VK3A 2A1BA 2GIRA 3UW1A 3PX6A 2AV5A 1MW7A 5I3QA 3PKYA 1F1BB 4KGZB 4OI3A 1QJHA 3DXSX 2UXCJ 4A8KA 1SXLA 3OFHA 3ZTOA 4QWCA 4IO9Q 5K8PA 1FXRA 2YNIB 5DZ6A 2PD1A 3IR7B 1L3SA 4B9SA 5KG1A 3H40A 2IDLA 3S1TA 4JI3F 3EDQB 2VQEF 1HNZF 1F3VA 2OD4A 4K4VA 3R5GA 2NREA 2X1BA 4ELUA 4WFYA 4PUOA 5D3GA 3ZZOA 1FRLA 2V4RA 4J9LA 3KMSA 5LXYA 2C22A 5EWFA 4RW9A 2J0SD 2FLNA 2BVZA 3I87A 1Y3KA 3W5ZA 3DOKB 5C24A 4UY8T 2VA3A 4WIIA 4JI7J 2VKRA 4RUBA 1LW2B 1JLAA 3UD4P 2DO4A 3V81B 1NU4A 3M8ZA 3Q0AA 4QR0A 1PGZA 1S5ZA 3PEHA 2Z4PA 4P7TA 4ID5A 2HZAA 4CO2A 1SVDA 2WZ1A 2F8EX 1PG5B 4CO5A 1U0HA 1YG0A 1J5EJ 2HQDA 1R6YA 5IT0A 2CJAA 1JLFA 1QSYA 4L72B 1W7WA 3BKFA 4GKJJ 4OLOA 2PMWA 1KQSR 1B0TA 3IMQJ 3QSYB 4TLQA 2G13A 4OV1A 1GMWD 4QIEA 1V3ZA 3D1HA 2LXUA 4PPDA 3M8PB 2HQCA 2AYGA 2COLA 2E7XA 4P75A 3SXLA 4F4KA 4DPUA 3QSIA 4CTAB 3C2PA 1F9EB 3A8JA 2GMJA 4IKAA 4QIFA 3KNGA 5KFYA 2AYBA 2YH1A 4IG3A 3Q8PB 1FJ7A 3K0JA 2DXEA 2O5DA 2F65A 4QW8A 1XMBA 4C0OC 1RT6A 4ZN1A 4WK1A 2FJEB 4B9VA 1NJYA 5E5NA 5KOXA 1TFWA 4Y2MA 4O44B 1M1GA 2E7WA 1H74A 1KFDA 2PEBA 4OZ1A 3J7Z5 1NK6A 1OY8A 4DV0F 3N28A 5CCLA 1NPPA 2MQQA 4CO4A 3SCIE 4Z7YA 3RAXA 1JX4A 4B3OB 2V0NA 1VQ9S 3OR2B 3ONQA 3HFKA 4OHVA 2XNRA 1FK9A 3ETOA 1AW0A 3K59A 3IG1A 4F3MA 4LSNA 4RKUC 4F0HA 3X1LB 3SCKE 5A8KA 1CS4A 2LDYA 3M05A 4DUTA 5HN0A 2VH7A 1RT1A 1WC1A 4F4XA 3DOMA 3MEGA 4AYBD 4RW6A 1S1WA 3CCUS 2WONA 2OSRA 1RT7B 3A8EA 4DS4A 4OZ5A 2HFNA 3C6TA 3IRWP 1S1UB 1TL7A 5KFLA 1N0UA 2WVEA 1LWCA 3SV4A 5HROA 3NLCA 2VASA 4DL6A 2KL8A 3FRYA 4EGLA 1F5BA 4CO1A 3A8KA 1TVRA 3TQEA 1VBZA 1XNRF 1JLCA 5B08A 1MU2A 1R6VA 2BA9A 1RWMB 3QIPB 2ZOGA 1XR5A 4N56A 4NRTA 2V8GA 4LFAF 1X4HA 2XMJA 3OVBA 5DQIA 3UR0A 2QC3A 5ETMA 4DU8A 3QPIA 3HHLA 3OR1A 2ZBQA 1J5OB 4UUWA 3KJQB 2XY6A 3MWBA 4FVCA 4N7TA 3HP6A 3H90A 1HWUA 2OHDA 3QRPA 4ECYA 3H25A 2K3KA 3V6HA 1S4EA 1JB0C 5L1KA 3GCWP 3GSIA 3R3TA 1NDKA 2AJ4A 5KG4A 1TK5A 4PWDA 3DRPB 4PXDA 2DR5A 3DLGA 3OW2R 1JKHA 1VQ6S 4PXBA 4X4SA 3WC2A 2VFRA 5B0BA 4R25A 4F3OA 4ILRA 1I1GA 4LF9J 3AAWB 1SQGA 3FRZA 4WXWA 3KTQA 2R7XA 1T9VA 1CJKA 1FNMA 2MQLA 1Q5VA 2DO0A 3M2UA 1NUEA 4JV0A 3G4SS 2Q6CA 3KFWX 3GIJA 1Q8KA 4EZ6A 4USVA 3H7HB 2NUUG 5HBMB 3EGVA 3IBWA 3HMJG 4FXWA 8AT1B 4PABA 5H1SV 3TJ8A 2BUNA 3E3XA 3DMJA 3MEDB 1L3UA 3M8QA 2BJ8A 2UXCF 1N6QA 1ZM3A 4QZVB 3D0GE 1HLWA 3NY0A 1U1MA 1JMTA 3T19A 1RAAB 2FC8A 4RNMA 2R2SA 1CC7A 5SUHA 4IOBA 7FDRA 2HHTA 4ZVHA 2YTCA 2ZITA 3HJFA 4AQYF 2VJUA 2IM3A 2YWFA 1JWWA 2R8GA 4O3OA 2AZ3A 3RB4A 5I3PA 1ZPVA 2F40A 3VTIA 3MFIA 1RQ0A 2B4VA 1IN0A 4A8MP 4R8UB 1VC6A 3MTJA 3PRBA 1RDRA 2G2OA 3BZQA 4MYUA 2JC0A 1SBRA 1NK8A 4JI7F 3E8OA 3RBDA 2HKEA 3CIZA 4QU6A 2XULA 5A76A 4C8OA 3IFEA 1UVLA 3DDNA 4QOTA 3KLVA 3VAFA 2HHPA 4DLEA 1KLNA 1BQMA 2Z2ZA 2DNKA 3DNCA 4LBPA 3RRKA 5K8NA 3HK2A 4I1TA 3ZNJ1 2BRKA 4H4MA 2B51A 4PQAA 3LANA 3NS6A 1J5EF 4NXMJ 4YB6A 2MZRA 1C1CB 3NG8A 5ETTA 4I2PA 2MKHA 2RDIA 2F3JA 3ILOA 5ETVA 3OUYB 4GKJF 1NSAA 1N88A 1HBOB 5HLFA 1H7WA 1KWMA 5KFWA 3U1NA 2RVJA 1SC4B 4I2QA 3OTOJ 4X4TA 3HPOA 3DLHA 4Z2XA 1XN9A 2CZ4A 2LXFA 1S6PA 1OQ6A 2JSXA 1VIOA 2D41A 2YWWA 3J7A1 2L9DA 2W4CA 3UDVA 1TKXB 2G4BA 2LYVA 4RUHA 2DYAA 2RJZA 2XCAA 1VQPS 1RT3A 2AJFE 2J76E 2ZWOA 1KHWA 3CDUA 4ZJQA 2Z56B 1TL3A 3FBCA 3FEXB 4X62F 2RQKA 3AQPA 2F4VF 4ILLA 3MHYA 5L39A 2VBYA 3POTA 5L1LA 3AA8A 2AEFA 1CJUB 2WBMA 2P2CB 2IC3B 1C0UA 1C1BB 3DRSB 3KJVA 2AMCB 4O3PA 1RTJA 4UTGA 3G82B 1F6TA 3BGRA 3TZZA 1HWIA 1NCLA 1A0OB 4GRSA 3UE2A 2FHJA 2HVZA 1VMBA 2OTJS 2Y1JA 3RGIA 2FVSA 2QLWA 3D6HB 4LQ3A 1WC0A 1ZYQA 1Y11A 4DL3A 3MGJA 1R8HA 2V5HG 1Q81T 2VPYB 4ZLPA 1HBNB 1FD2A 3TUJC 4ZPDA 3JS9A 2VDIA 3HT0A 4LT6A 4A8WA 1GMVA 2A2DA 4WFNQ 2GIQA 2Q1LA 1X4GA 4JI8F 4KQZA 4FF4A 1HBUA 4EWTA 2CQ4A 4ZLJA 1EJ7L 4ZP8A 1M1KT 1X4EA 2LVWA 5B0DA 2PDAA 2V2VA 3QWPA 2WSEC 2PIIA 2MJNA 4DN0A 4ZP6A 2XMWA 4PUOB 2B9XA 1UKUA 5D3GB 3CJ2A 1U26A 2A6OA 3MM5A 4OMFG 5H9EJ 2C1EB 2LXIA 4CIOA 1IKXA 1T11A 2F9DA 4DUYF 2IJRA 2VONA 4CYUA 3OTDA 1WI8A 2MGZA 5E3QA 5C24B 2P6SA 1UW9A 4KY3A 1JLAB 2B4OA 3P5BP 2ZUAA 2YWEA 1RI7A 3CD0A 2CQGA 4G6VB 3DRRA 1PC4A 2W1BA 4ID5B 3GE9A 1M1HA 1WELA 5KFOA 5G0RA 4JI0F 4OYBA 3GJRB 2DNYA 2OLWA 1X4BA 1VHFA 4JUZA 3THVA 1U0HB 2ZDPA 1WOPA 3R97A 1FNOA 3HSGA 3TX8A 4NE9C 3OL8A 3VAJA 5E7OB 1JLFB 4DL2A 4JBCA 4TU7A 4TU9A 2G0CA 3M2VB 2MHEA 2QMXA 3HI9A 4BBYA 2X7IA 4M95A 4C3LA 2H54B 2HQGA 4GKKJ 4LR7A 4H4OA 1WI6A 3IXQA 4DV7F 4XPCA 4KJIA 5J1NA 1KQKA 4QWBA 1YJWS 2D3OR 2N7CA 5HSPA 3I5AA 2YWHA 3I96A 2IVYA 4LF7F 3BH7B 2JOQA 2YQ3A 3ADAC 5DZ7A 2JX2A 2GHPA 4QIGA 3FSYA 5BR8J 4IG3B 4DR2J 1TAQA 2R8KA 4XO0A 3MEEA 2FJAB 3NOCA 2GCFA 3ZTSA 4F50A 4JV5F 3M1VA 1RSCA 2UUAJ 2ZBCA 1RT6B 2GC8A 2L9NA 2DH8A 2WVCA 1FX4A 3G86A 3PYDA 2M5YA 3BPSP 4DEZA 4R5PA 1R3NA 4YQWA 1G1XA 1NJWA 1JLGA 2DPIA 4KC5A 3BBBA 3O6QA 1XBWA 3PG9A 1OQ3A 1S97A 1VR6A 3BGLA 2AEJA 3L7PA 3GIKA 4NLUA 2XC9A 5A8WA 2LA4A 2MZTA 4Q5VA 2OPPB 1LKZA 1FK9B 3N5BA 4PWUA 3IG1B 5F0WA 1FDDA 4LSNB 7FD1A 1FA0A 3JAMY 1S1VA 1L3VA 3BQ2A 1U1KA 1PBUA 3D3CJ 3U02A 4USIA 4DHVA 4CRJA 5A8KB 2E1RA 1RAFB 1YQHA 2XTJP 1CS4B 4ECRA 3E01B 1RT1B 3PYEA 4K59A 3DOMB 3MEGB 5CAAA 2JEIA 2DITA 3G87A 1S1WB 3W63A 4JI6F 3O1LA 2WONB 4NEZA 2JEJA 2ZZTA 3C6TB 1TL7B 1HHTP 3UCGA 2EPIA 4I0WA 4LVNP 3SYZA 3PW4A 1VCTA 1U49A 1LWCB 4DSKA 1HNVA 3LUYA 2YH0A 1IQZA 5HROB 1UAWA 3PRDA 2ZM6J 2MHNA 4A47A 4OFZA 4ZCKA 1B70B 2WTFA 2YPYA 3NBPA 4NA3A 2UXBF 1TVRB 3CEDA 5AXLA 1PJ6A 1J2VA 1JLCB 5BYRA 2GIFA 2QMUB 2ZH8A 1MU2B 2ILYA 1PCAA 3RB6A 4NZ7A 2YX4A 5CQGA 1NH8A 3TI0A 2HURA 3B4DA 1RAJA 4CLUA 1B0PA 5C42A 4Q7AA 2M2BA 1R0AA 5A6WA 3K8WA 4KBIA 3HHLB 3OTBA 3OR1B 2V2QA 2MLZA 4GMKA 5KFAA 2VFSA 3MZIA 4QIWD 5KFHA 4DR4J 1WWHA 2CDQA 3GR1A 1KOHA 4ZK7M 1VC5A 3PW0A 1HQEA 3MAHA 2GHWA 5J2QA 5A2QY 2QLBB 3OVSA 4KPYA 4CM0A 2EW9A 2DR8A 2CA9A 3KK2A 2L41A 4V19J 4DPWA 3SV3A 2C3PA 1HA1A 1JKHB 1GTEA 3X3UA 5CD4A 2P5VA 4KSEB 1M90T 1WHVA 1MN9A 4LIWA 4B3RJ 3JQKA 2E1MC 1PJ5A 1CJKB 5A6PA 4NYPA 3M2UB 2YNFA 4KIAA 3LP2A 3A12A 1ZS6A 4H4KA 1NSQA 3TJ9A 2ZH3A 2CWKA 1BE4A 1FDNA 1RT4A 1NK7A 1CC8A 4J7CA 2GQ2A 2JL9A 2EXUA 3CCWA 4ZPAA 1QSSA 3K5NA 1DQAA 4DMZA 5HATA 5J2PA 2VG7A 4DR6F 4RW7A 2DNHA 3HULA 3CE8A 2YVSA 1QVGR 1OY6A 5IQQA 3MCSA 1U48A 2DTJA 3M8QB 3FQKA 5DS7A 4YOEA 1N6QB 3CCES 2DNOA
chains in the Genus database with same CATH topology
3MXHP 2P9EA 3V4IB 2CQIA 4KRWA 1FKPA 4TY9A 2I1RA 1O8BA 2RF2B 4URGA 1X4CA 1Z4UA 2HPUA 2VUGA 2W7PA 4ES2A 5KG5A 4IDKB 1N5VA 1C4CA 1MMDA 2MQMA 1T3NA 1YVFA 2G9OA 3HXMA 2R2TA 3T9ZA 5IWAF 3MMAB 3CGIA 4Y00A 3M9MB 2ZFHA 3TUZC 1TK8A 2HS0A 3I5CA 3VAHA 1HWJA 2KB2A 3EZ5A 4F8RA 4N77A 2XO7A 2IRYA 2VODA 3K2YA 2YKPA 4FVMA 1KQFB 4LMZA 4O3QA 1E6VB 2QZ8A 3N6MA 3I55S 3ZFVA 4ZCIA 3DI6B 4LVOP 3M8RA 1SKRA 1SI9A 4KAIA 2C3MA 4OX8A 5D4PA 5KT2A 3ZZUA 4K4UA 1Z1ZA 4I7FA 4ZCLA 1SUQA 5DQHA 2J0QD 1SJRA 1P9QC 1D8YA 4DL7A 3F44A 4LF5F 3QO9A 2FJVA 1BGXT 1LXNA 5DO2A 3L3CA 1N52B 5KFUA 1F0XA 1IJFB 2VPZB 2D7SA 1JIHA 3MR3A 2FUG9 2C3OA 2JEGA 3IS9B 3IO1A 1MWYA 1WACA 1RWUA 2OPRB 1I6JA 3FSXA 4TYAA 4LFBF 1R43A 4OZLA 4PG5A 2IM2A 4FBTA 4WFZA 4TQRA 2ZOFA 2BE2A 1PC5A 2VPWB 3DLEA 1S6UA 5KFVA 3DLKB 3JSMB 3ENVA 2LMIA 2RNEA 4I64A 5J1EA 3LGNA 2BABA 3ZZYA 4OL8A 4CH0S 1QAXA 2W4PA 5K8OA 2UVWA 3HX9A 3VAKA 2EWHA 2LLZA 2XSJB 3TAMB 4RU2A 2RU9A 4OI0A 4G3IA 2NLWA 1S1XB 3DRPA 1OWXA 2CPZA 2AYEA 4L6V3 3NCQA 4TNOA 5F8NA 4WFBQ 2QRRA 4C97A 3T1HF 2B43A 5K9FA 2CQ1A 1U8SA 4HL9A 4EZ9A 2HW3A 1L5UA 2DBBA 2E9RX 5KFZA 2DGUA 2PI4A 1UETA 4KHMA 2AU0A 3HZGA 3VWSA 2I5JB 4IQMA 4RBUA 2I9SA 5MAOA 4MIBA 1U1RA 2AP6A 3MAQA 1Y9OA 2R7SA 1D8ZA 4X4VA 2ZDOA 5I42B 1BQMB 4HI2A 2WHOA 2EI5A 1SJ4P 2DGOA 4C8LA 2MKCA 4DV1F 3MF5A 2KZZA 4Y28C 5BJRA 2J6TA 2EFNA 1IBMF 4E0DA 2GQCA 4H4MB 3IRXB 3H2VE 4EO6A 2GX8A 2HHUA 1GNKA 5KG2A 2XCPA 2XS7A 2HHVA 3RR8A 1Y3JA 2RRAA 3EYZA 1W25A 1H2TZ 2JHEA 5IM0A 3K5LA 4G1PA 2DNPA 2MKKA 1FHTA 3BSOA 2HZCA 5DG7A 1JXLA 1S7HA 4KFBA 2J7UA 4QBUA 4I2PB 5F8GA 3K8VA 4CI0B 4HTJA 4ZA1A 3LWMA 1HL6A 4NLXA 1R8CA 1BD6A 3WZ0A 2HRUA 2D9PA 1NJXA 4NLRA 4AL6A 4CH7A 5HLFB 1HW8A 4OHWA 3N6LA 1K0VA 3QIDA 4M1KA 1Q16B 1P1TA 2C2EA 4NLYA 1MMNA 5JJBA 5HBMA 2UVRA 3N9UC 2BR0A 3S7RA 4WF9Q 1T94A 3VCDA 1IKYB 4NOHA 2KFYA 2ZE2A 1RKIA 1YIJS 2XG8A 4OI2A 4I2QB