3MEDB

Hiv-1 k103n reverse transcriptase in complex with tmc125
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
424
structure length
401
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p66 Reverse transcriptase
publication title Crystal Structures of HIV-1 Reverse Transcriptase with Etravirine (TMC125) and Rilpivirine (TMC278): Implications for Drug Design.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 114
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3medB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3medB03
4ED1A 4ZVHA 4IR9A 3MF5A 1K1QA 3DOLA 3V6DB 1BQMA 4DG1B 2IM1A 2OPQA 4EYIB 4ID5B 4MFBB 4IG3B 3OHBA 3KNAA 3KLGA 3KHRA 2FLNA 1D0EA 2B6AB 4KV8B 4J9LA 4K4VA 5L1KA 4WFYA 2HNZB 1J5OB 2CJQA 5D3GB 1SH3A 1C1BB 2AX0A 4KSEB 2FVSA 4ECVA 1T3NA 4QPXA 2HAIA 3C6UA 1I6JA 3KK2A 3MEEA 1FK9B 3DRPB 2DPIA 3DRRB 1TL1B 1FKPA 5DQGA 1ZTWA 3BSNA 1HMVA 1ZETA 1BQNB 4KO0A 3IRXA 4K4UA 4QWBA 4TY8B 3E01A 1JIHA 4IH6A 5DQIA 4ZHRA 3RB4A 4ED8A 1S1WB 4NLDA 2IM0A 5KG4A 4Q0BB 1EETA 1RT7A 1N48A 1S10A 2JC0A 2W8KA 3KLHA 2O5DA 5C42A 2W9CB 4IQXA 1JLEB 2XCPA 2YNGA 5KFXA 1NHVA 3NBPA 4RW7A 4KB7A 4JV1A 4OL8A 4I2PA 2OPQB 2OH2A 4IG0A 5L1IA 2WOMB 3KLGB 5L1JA 3VQSA 4R8UB 5K14A 1S9EA 2OPRA 5I3UA 2BQUA 4MK9A 4YR0A 4EBDA 4FS1A 2BRLA 3LP1B 4ZPDA 2RF2B 5EWFA 2W9AA 5KFMA 2JEGA 3LAMA 3C6UB 4RNMA 3TAMB 5J2MA 5KG7A 2ASLA 1QUVA 3MEEB 3QLHB 5CYQA 3ISNC 3BR9A 3DLGA 5JXSA 1HMVB 3ISND 4IRDA 2HNDB 2RDJA 4KO0B 1TQLA 1CSJA 3G6VA 1SH0A 1HNIB 5F8GA 4ECUA 2BQRA 3E01B 1JLQA 3I5BA 5KT6A 4K4SA 4ZPCA 3DM2A 4RUAA 4RU9A 1TKZB 4NYZA 2AGPA 5JUMA 2WHOA 4RW8A 2ILZA 1JLFB 1MMLA 3QGHA 1TV6A 5DG8A 1EETB 4TLRA 3NGDA 2R2TA 2QE5A 4F4ZA 2ASDA 5C42B 3FFIA 1S6PA 4J9SA 4I2QA 4DL3A 3NBPB 2I5JA 4RW7B 3GV7B 4RNFA 3LAKA 2WONA 3V81A 4PUOA 4ZP6A 1S6QA 3I0SB 4IG0B 3HVWA 5KFQA 3RB0A 4IRCA 4IDKA 5J1EA 3EPGA 1TVRB 5I3UB 3CDWA 4IR1A 4YMEA 1DTTB 4WZQA 4QWCA 3N6MA 3IS9A 2R8IA 5L1LA 4NRUA 2C2DA 3GV5B 5KFIA 4IH5A 3DLKA 2W7PA 2IAJB 2BANA 1WNEA 5J2MB 2WTFA 5CYQB 3FDSA 3PJWA 5KG0A 1S9FA 3V6HA 3KK1B 4KFBA 5HROB 3D28A 4URSA 4EEYA 3GIIA 3PW2A 4H4OA 2GIQA 1HQUA 5KT4A 1JLQB 4TQSA 2R8HA 3NL0A 4H4MA 1IKWB 2OPPA 5C25A 1QAJA 5F9LA 4RW8B 5F8LA 5J2PB 4WYLA 3KJVA 1NHUA 3CO9A 4ECZA 3DMJB 1QE1A 2YNFA 2ATLA 2VG7A 1C1CA 1JXLA 2UVVA 2I5JB 1DLOB 4RW4A 2WCXA 3T1AA 2WONB 4R5PB 4I7FA 4IH7A 1S6QB 4LQ9A 4NLTA 4U7CA 4KHMA 4O4GA 3IGNA 2ILYA 4MH8A 2ZE2A 1S49A 4RW9B 3HVTB 1TKXB 1RT4A 2WK4A 1XR6A 2WB4A 3CJ5A 4Y2AA 4J9OA 5KFDA 5KFOA 3ITHA 1RTIA 3KK3B 2GIRA 3GYNA 5F8NA 3M8QB 1MU2A 2GC8A 2BANB 3DRSA 4MK8A 4MKBA 1RA7A 1TKTA 4B3OA 1D1UA 3H5YA 1RYRA 2D41A 1QAIA 2BQ3A 5J2NA 3OL6A 5KFSA 3KMQA 1T05A 3OHAA 5DLFA 4LSLA 5KFKA 1RT1A 3FRZA 1K1SA 4WXWA 2OPPB 5C25B 1S1TA 1ZTTA 3ICLA 4J9RA 5CYMA 4J9NA 4F4YA 3BQ0A 4HYKA 4ECXA 5KG3A 2YKNA 1KHWA 3BREA 1QE1B 1XR5A 4ECRA 1T94A 3PW4A 1C1CB 3BSAA 3V6KA 2V4RA 4RW4B 2R2SA 1FKOB 4RNHA 4WYWA 4KKOA 2J6UA 4K50A 4NLXA 1JLCB 5KFZA 3QIPB 3V4IA 5KFWA 4IFVB 5KFRA 3QO9B 4ZP7A 5KFHA 5KT2A 1EP4A 4WZMA 2AX1A 3ITHB 1RTIB 1RTHA 3HVAA 4RW6B 5F8HA 4DL4A 3MECB 2FLLA 5KFJA 2R8JA 1R0AB 2JEFA 3OL7A 1N5YA 2IJFA 3C6TA 1JKHA 3M8PA 1TKTB 1IKYB 3DOKB 4B3OB 3PZPA 3HKWA 3DYAA 1KHVA 3UDLA 2HWIA 5F9NA 5J2NB 5DGBA 3GV8B 3FQLA 2IJNA 4Q8FA 3H2LA 4NCGB 2IMWP 3NMAA 3MEGA 3QGIA 3KLFA 1IKVB 3BJYA 4QWEA 3DOLB 3JSMA 1BQMB 4TY9A 5KG6A 4JV2A 2B5JA 5FDLA 4Y3CA 5KFCA 3PVXA 4NLYA 3GIMA 2JEIA 2RKIA 2YKNB 2E9RX 3RB6A 5KFUA 4M95A 3GQCA 1HNVA 2D3UA 1LW2A 2FJXA 2IC3A 2HMIA 3CJ3A 2OPSA 2UUWA 4F4WA 1RT2A 2HWHA 5KT7A 5I42A 4GC7A 4ED0A 3KK2B 3V4IB 1FKPB 2IM2A 5KFNA 1SH2A 4XPCA 4GC6A 1RTHB 3IRXB 1S0MA 2IM3A 4EYHB 2AGQA 5KFBA 3C6TB 1JLAA 1JKHB 3M8PB 3IG1A 2BE2A 5KFGA 3GILA 4ZHRB 3G6XA 3DYAB 5DG7A 5KG1A 5T14A 1REVA 3M9OB 5HBMA 4Q43A 1RT7B 3E51A 2AQ4A 3KLHB 2FJVA 1VRUA 4QWDA 4K4YA 2YNGB 3KLFB 3TVKA 3T19A 2W9BA 5J2QA 1JX4A 4R0EA 4I2PB 3JYTA 3KHGA 1JLBA 1LW0A 2RDIA 2XGQA 2FLPA 1OS5A 2B5JB 5FDLB 4NLUA 1S0OA 3EPIA 4ED3A 1S1VA 2RKIB 5K14B 3KLEA 1S9EB 2OPRB 3UPFA 3BQ2A 4DL2A 3Q8PB 2C22A 2C28A 1RT5A 3QZ7A 1HNVB 4EO6A 2HNYA 3I5AA 4ECWA 4ECYA 3LP2A 2I1RA 3RB3A 4QWAA 1S0NA 1RT2B 2J6SA 1RAJA 2FVCA 3DLGB 2XI2A 4IOBA 3RBDA 5KFLA 2QV6A 3BSOA 3NAIA 3UQSA 3DM2B 1T03A 1JLAB 3IG1B 4NLOA 2ZD1A 1LWEA 1REVB 5C24A 4ZVEA 3H4DA 5HBMB 1TV6B 1RTJA 3H5XA 4Y2CA 3FFIB 1S6PB 1VRUB 1TL3A 4I2QB 3QGGA 2R8KA 4O44A 3IN5A 1GX5A 5KT3A 3OL9A 2AGOA 3G86A 4JUZA 1LWFA 1JLBB 1LW0B 3V81B 2YNIA 4PUOB 1HYSA 4MIAA 5KFYA 3RBEA 2VA2A 1RT3A 4IDKB 1C0TA 1Z4UA 5J1EB 4K4XA 1RT5B 3IS9B 3MR3A 2HNYB 5KFFA 4ED6A 1HPZA 1TKZA 1RYSA 3OSNA 3V6DA 3DLKB 1S97A 3KHLA 4ID5A 4IG3A 3OLBA 2XCAA 3T5JA 5HP1A 3MTKA 4TYBA 4Q8EA 3H5UA 1XR7A 2B6AA 4KFBB 1LWCB 3QZ8A 4DL5A 1KLMA 2HNZA 1C1BA 2V0NA 4H4OB 3DI6A 1HQUB 2B43A 4U6PA 3MR2A 2ALZA 2C2EA 4H4MB 4NLWA 4ZP9A 4TQRA 3EZUA 3CIZA 2ZD1B 3OSPA 1FK9A 3DRPA 4M94A 3DRRA 4EBEA 3BSCA 4NRTA 3KJVB 3LALA 3SFUA 3MFHA 2VG5A 3T5HA 4IRKA 3PHEA 4ECTA 2YNFB 1TL3B 2VG7B 2ASJA 4TY8A 3QIDA 4I7FB 3MEDA 2VG6A 1RT3B 3FQKA 4J9PA 1C0TB 3UR0A 4O4GB 1S1WA 1S9GA 2ZE2B 1C0UA 1S1XA 4ZVFA 3SI8A 1RT4B 1NNDA 4ED7A 4YP3A 4RUCA 1U09A 4IKAA 2W9CA 3PW5A 1JLEA 1DTQA 3I5CA 4ICLA 1MU2B 4NLQA 5L9XA 4XO0A 4NLPA 4DL6A 3DRSB 3Q8QB 2J6TA 4LQ3A 2WOMA 5HP1B 4R8UA 4FS2A 5KFVA 5F8JA 2AU0A 3D5MA 3CVKA 1UWBA 4RNOA 1KLMB 1YVFA 1T05B 4ECSA 4LSLB 3DI6B 3LP1A 4G1QA 2RF2A 2D3ZA 1RT1B 3NKYA 3GIKA 2W8LA 4ZPBA 4ZMMA 1S1TB 4RZRA 3T5LA 3TAMA 2VA3A 5CYMB 3LP0A 3QLHA 2C2RA 4FBUA 5KFEA 2FVPA 4MK7A 2VG5B 2HNDA 4TN2A 3PR5B 4JV0A 1HNIA 3TQ1A 4Q45A 1IKXA 4J9KA 4NLSA 2IA6A 4ZP8A 4DEZA 2XGPA 4KKOB 3MEDB 2VG6B 4MKAA 5KFPA 5KG5A 4KHRA 1S9GB 3T5KA 1C0UB 1JLFA 1S1XB 3IGVA 4H54A 4WXOA 3PR4A 2ZKUA 2JC1A 1EP4B 2R8GA 4K4WA 2F8EX 4KAIA 3MR5A 2D7SA 2YKMA 4IFYA 1DTQB 3OL8A 4ICLB 2EC0A 1N5YB 4O4RA 3RAXA 5EDWA 4O3PA 3I0SA 4Q44A 3KLVA 2UVUA 4RNNA 5KT5A 4J9MA 3M9MB 1N56A 4LSNA 1TVRA 1IM4A 2CKWA 1UWBB 1DTTA 3H98A 3CWJA 4G1QB 3I0RA 3MEGB 4ZPAA 3FSIA 4K4TA 3N6NA 3JSMB 4J9QA 2IAJA 3LP0B 3LANA 5DG9A 4FBTA 3KHHA 2FVRA 3KK1A 3SFGA 5HROA 4K4ZA 4O3RA 1S1UA 2UVRA 1LW2B 4TXSA 3G6YA 3CJ2A 1IKXB 2IC3B 3BGRA 2HMIB 2V9WA 3KOAA 4O3SA 2OPSB 3PJXA 4PQUA 1IKWA 5C5JA 2JEJA 1SV5A 5I42B 3H5SA 3BQ1A 2E9TA 3H40A 5J2PA 4NLGA 4WE1A 4QW8A 5DQHA 5KFAA 5EWGA 4YR2A 3DMJA 2DPJA 3CDEA 5HLFA 1N6QA 1S48A 3OLAA 5EUHA 3KMSA 2YKMB 4IFYB 1DLOA 2WRMA 5EWEA 4R5PA 4X2BA 1HQEA 2BE2B 4F50A 1SUQA 4LSNB 4PWDA 3H4BA 4RW9A 4HKQA 3HVTA 1TKXA 1GX6A 2YNHA 4G3IA 4EO8A 4TYAA 3PW0A 3I0RB 3KK3A 4ECQA 2FJWA 5J2QB 3M8QA 2UUTA 1VRTA 2W9BB 3N6LA 1TP7A 4F4XA 3JYTB 3KLIA 4NZ0A 5KFTA 4KE5A 2W7OA 1S1VB 3DLEA 1JLGA 1RTDA 3KLEB 1W25A 4URQU 4O3QA 4WFXA 4ED2A 5F8IA 4DL7A 4EBCA 1S1UB 1C2PA 1RT6A 3BGRB 4O3OA 3LP2B 1LWCA 4URGA 3Q8RB 2XC9A 1HARA 4PQUB 3CDUA 3HHKA 4DG1A 2BR0A 1SV5B 3CJ4A 2R2UA 4MFBA 3MFIA 4WE1B 2R2RA 4O3NA 4NLVA 4KV8A 5HLFB 4XPEA 1N6QB 1J5OA 5D3GA 3RAQA 2E9ZA 2FVQA 1FKOA 2XWYA 1T03B 1HQEB 3QYYA 3V6JA 2IBKA 1JLCA 1SUQB 5F8MA 4PWDB 1LWEB 5KG2A 3QIPA 5C24B 1TL1A 4IFVA 2UVWA 3QO9A 2YNHB 2XI3A 1RTJB 3NAHA 1BQNA 4ZVGA 3M9NB 3CJ0A 2V4QA 5DGAA 1RA6A 4QW9A 4RW6A 3H59A 3MECA 3GIJA 4O44B 1R0AA 5DLGA 1VRTB 1LWFB 3Q8SB 3PW7A 3KLIB 1HYSB 2YNIB 2BRKA 3DOKA 1IKYA 3DDKA 1N4LA 4YR3A 3MR6A 3DLEB 1RTDB 1JLGB 2AWZA 1S4FA 4NLRA 4Y34A 4MIBA 4YQWA 4Q0BA 4KBIA 1RDRA 4WFZA 2JLEA 4NCGA 1RT6B 1HPZB 1IKVA
chains in the Genus database with same CATH superfamily
1BQMA 1N0VC 2Q6BA 1TFWA 1U7LA 2D3O1 2CJQA 3J7YI 2RD5C 3MEEA 1FK9B 1TL1B 4C3KA 3KG1A 4USUA 3H42A 4AQYJ 2CRLA 1Q81T 1O0PA 3C19A 3OR1B 2XMKA 2PT0A 5C2GA 2PI5A 1NU4A 2MZSA 5K14A 3RGIA 1FX4A 4EBDA 1BY9A 2B3TB 2W9AA 3N01A 3ISNC 2GW8A 3FRYA 1R6YA 2NYIA 3E01B 3I5BA 2DCLA 2F8MA 3QGHA 5D0GA 5C42B 3HSDA 3WHIA 3TA1A 1MWQA 3TARA 4ZIWA 3CDWA 4BWMA 4MYTA 1XMOF 2P9GA 3DLKA 2EBGA 5J2MB 1RABB 5CYQB 2OEMA 3PJWA 2QMWA 2HG4A 4LFAF 4H4OA 3KYLA 1HQUA 5HL7Q 2R8HA 1IKWB 1HQ2A 1X4DA 1DY3A 5IFMA 2R7TA 3GP9A 2OUGA 2ATLA 3BPSP 1C1CA 1Q86T 2Z2ZA 4LQ9A 5T7LA 1REGX 3NS5A 2HVDA 4DOZA 4MH8A 2ZNYA 3M4XA 4LF8J 3C8YA 2ZHBA 2HVZA 1X7VA 3W63A 1ZOTA 2DTJA 2DD8S 5HN0A 1RKJA 2XS7A 4OYIA 4A8QA 1RP5A 1X5TA 3W64A 1UEVA 4YFUA 2J0QD 5KT2A 3C14B 5KFJA 1N32J 1VQ9S 1Y11A 3KUGA 3NGKA 1CJVB 4CIOA 3MHYA 3KLFA 3BJYA 4LRCA 2IVFB 3QJJA 1ZH5A 2HEKA 4LR8A 2KYZA 1NB7A 2C2ZB 1D8YA 4OX9J 4ER8A 2I8EA 3PJ9A 2VOPA 5KFNA 4XPCA 5ITHA 1VQ6S 5GMKa 1CULA 3M8PB 3IG1A 1KTQA 1VQLS 2QLJB 1ZZFA 1UEUA 4KYZA 2AQ4A 1YITS 3JYTA 1S0OA 3CCSS 2C22A 5DDPC 1O6XA 3H0PA 4KRWA 2MPUA 2KT2A 1SJFA 2DNQA 1S59A 3QGGA 1UJ5A 4MIAA 4H4KA 2JJ4D 4NI2A 5HMYA 3GFYA 4DUZF 3QBCA 4OHZA 1R31A 3HT3A 1U1LA 4FXWA 3ZC4A 1KLMA 2B43A 2VH7A 3ET6B 1M5HA 4Q5VA 1FXDA 2IFXA 4LRDA 4MIWA 2VPWB 1S1WA 1P27B 3WC0A 3CCUS 1C0UA 4ZVFA 3S6EA 3PW5A 4RBVA 4LQ3A 3VALA 2WOMA 3HVRA 2XMAA 3D5MA 1UWBA 1YVFA 4Y0FA 3DI6B 4C9DA 1RT1B 2RAQA 4ZMMA 3EXYA 1UKUA 1Q53A 2QSWA 2XMUA 2ZBIA 3I96A 1RLDA 4KGVB 1S1XB 4WXOA 4EFAC 4DR4F 1WC6A 2QMUB 2UV8A 1R27B 4JI6F 5EDWA 4O3PA 2KZZA 2DISA 3FMBA 4OHWA 5BR8J 3MEGB 1EX8A 4DR5J 4DN0A 2IAJA 3LP0B 4LSZB 4FBTA 4KPYA 3SFGA 3SBMA 1CC7A 2AZ3A 5CZXA 3HM9A 2UVRA 3KG0A 3B6BA 3OPKA 5HQLA 1T9WA 2HQCA 2XY6A 5EWGA 2U1AA 2MB0B 3AOCA 2HGMA 3KK3A 3R9LA 3HHLA 2C2MB 1UVIA 5B0EA 4B9MA 1VQ7S 4PXCA 1S1UB 3ILLA 4QIGA 1PSDA 3EDRB 3FK4A 2OKQA 1FEHA 4KV8A 2ZZTA 5HLFB 4B3TJ 4Y2MA 4DV5J 3RAQA 3SQGB 1MWYA 1QJHA 2WVEA 4PWDB 2WVCA 5DGAA 3THPA 3KLIB 2MJNA 9RUBA 3VWSA 4ILLA 1EB0A 2DHSA 1HPZB 4ZVHA 3DOLA 2IM1A 4ID5B 3OHBA 3KHRA 4OHYA 2MJUA 3CJKA 2MYFA 2Z2LA 3VGUA 2M0GB 4CLYA 3G8QA 3H90A 3IRXA 3D6TB 2FUG9 2XMJA 3PACA 2A6MA 2FC8A 1KDNA 4NLDA 4YB6A 4IQXA 2W9CB 1J27A 5ETVA 2C3UA 4OL8A 5DDRC 4DSJA 4R8UB 2W4DA 2UXDF 2IRUA 2W01A 2CAJA 4D3HA 2V6AA 3LAMA 2KXFA 4IRDA 2RDJA 1HW8A 4HL9A 4AL6A 1VCTA 2ZBRA 1G1XA 3NGDA 1EETB 3FFIA 4J9SA 1E6YB 2I5JA 3L9ZA 3OVAA 1NH8A 1MG7A 3K5MA 4YMEA 1HR0J 5SZTA 4Z7YA 1Q78A 3CJ8A 2W7PA 3M8RA 2HHXA 2OP5A 2ZC3A 4EEYA 5K8NA 4OYMA 2AMCB 1FTCA 4H4MA 1MW7A 3IAM9 2OPPA 5F8LA 3M8YA 4U95A 1QE1A 4AXIA 1OPZA 1DLOB 5F0UA 2WONB 4I7FA 2XMVA 5CQGA 3WX4A 1Q7LB 4DSEA 5E41A 2YKOA 1MU2A 3W3SA 3ZTQA 2BQ3A 3U1MA 5IM0A 5DLFA 2CPHA 1OPIA 4CLZA 5B0BA 1BHNA 2MLXA 4JI5J 4XDCA 2YKNA 3GONA 1UPPA 2AJ2A 4RNHA 4F0MA 1HW9A 1JMTA 3MMBB 3O6QA 3HVAA 1RTHA 1FFGB 2JEFA 4B3MJ 3QPIA 1NPKA 1RHQB 3DNCA 2ZM6F 1UWAA 4M5DB 4LFCJ 4S0MA 1BWVA 2JEIA 2V8PA 2RKIA 2V8GA 4USJC 3CCES 3DDNA 1FKPB 3CEDA 1SH2A 4GC6A 1MROB 3MUVP 3DU5A 1JKHB 2BE2A 2CPIA 2CQHA 4W4MA 1AT1B 4FNHA 3TZZA 1FDBA 4KY3A 5J2QA 4LF6J 4R0EA 1EQMA 3KHGA 1JLBA 3KDOA 3BQ2A 5DDOC 3GU0A 1F5BA 4ECYA 4WP9A 3D3BJ 1U0HA 3OTBA 1AFJA 1GTHA 5IWAJ 1TR0A 1P1LA 3R5CA 4DCPB 1SVDA 5KFYA 1XJWB 3R6LB 3EGVA 3IWLA 4X62J 3IS9B 2K7JA 5KFFA 1KSPA 3KJQB 2QYCA 4U8YA 5IV4A 3V6DA 4ITSA 1GH8A 1SCJB 3R1LA 4Q8EA 1XR7A 4Y00A 3M2RB 2KRRA 4GKKJ 1HNXJ 5G4DA 3AXMA 4NLWA 5EN1A 1EARA 4LFBJ 2EFOA 4ECTA 1F9HA 3EJMA 1ZS6A 3WBZA 3FQKA 2XLJA 2RDDA 5GADI 4ICLA 1NK7A 3Q8QB 2BM0A 2BJ3A 2ZBQA 2CXEA 4W98A 4OZNA 4X66J 1VC6A 3HLUA 5CAAA 2KHCA 5KG5A 5ADZA 3CD5A 2BM1A 4Q44A 3PEJA 2R7QA 2R7WA 4DR3J 3CXCR 2FJBB 1H74A 2VBZA 1L3TA 3RG6A 2CA9A 4PWWA 2Y0SD 2B0GA 2RRBA 3BGRA 2HMIB 3I32A 3J80U 2QYGA 3VAMA 3HSZA 3DMJA 3K58A 2QC3A 1MN9A 4USTA 2ZITA 4HKQA 2MXYA 2LA4A 3MCNA 1VQ8S 2HW3A 3O2IA 1VQKS 3ZFVA 2RQMA 2W7OA 3DLEA 3IP0A 2DNLA 2QLWA 1RWPB 1H6KX 4DX7A 5CHCB 2A10A 4OYPA 4KH0B 3CD7A 3MMCB 2LEPA 2WVFA 3GIJA 3C16B 2L3MA 3DOKA 5GAGU 5CCLA 1TTHB 2E5JA 3WDOA 3CPWR 3W60A 2MQMA 3MF5A 2QRRA 1XNQJ 1NDCA 2XNRA 2AF6A 3C15B 3DN9A 1R3NA 4DSIA 3DRPB 1URNA 3NS7B 4KO0A 2ZH9A 3VAFA 1JIHA 2EVZA 4P72A 3W1YC 1CJTB 5KG4A 2NZ4A 1N48A 1S10A 4CTAB 3KDNA 4KB7A 4I2PA 4I4BA 3KXDA 3QAEA 1KVJA 1JNRB 2UUAF 4LF7J 1R6VA 4RUHA 8RUCA 4P2SA 2ASLA 5E3PA 3T3FA 3ISND 1GFWB 2LQBA 1F60B 2LQ5A 2Y8YA 2OO4A 4K4SA 1G6BA 4PG5A 1M5KC 5IT9U 3JQMA 3OVBA 3LAKA 2P6TA 3R5GA 4HDGA 4E0DA 5I3UB 2DGUA 3NP5A 2HBQB 1YI2S 4FYDA 1VYAA 3BKUA 1X5PA 2DGVA 2DNPA 4E2FB 1IBCB 2Y8WA 2ATCB 5U47A 2VDHA 4JI4F 3NL0A 3D1OA 2OTLS 4HR2A 1WACA 2KG0A 2XWXA 3CO9A 2JFDA 4DV1F 1ZPWX 3T1AA 2QGFB 3IGNA 4ELTA 1SC3B 2VC1A 4A8SA 3I9ZA 4USHA 4Y2AA 2JSXA 2IA0A 5KFSA 1Y7PA 3X1LB 3FRZA 1CQNA 4J9RA 1S1TA 3MOJB 3R1HA 4HH0A 3BREA 1CEZA 2JVRA 2KTQA 3BN7A 3O44A 4NLXA 3W5ZA 3U7JA 1UETA 5KFHA 4ZP7A 5DM7Q 3T41A 3JSBA 4LF5J 3F73A 2HWIA 5H9FJ 2RRAA 1RXOB 3QGIA 3EYZA 4H4KC 5FDLA 5AXLA 2IMOA 5KFUA 3PKMA 1DFDA 2E1PA 3GB0A 4EUVA 1PCAA 3ENVA 4WFAQ 5KFGA 2V4JA 3T1YF 3VHQA 1FF2A 3T19A 4ILRA 2XNQA 2FLOA 2M88A 5HANA 3I5AA 3H7HB 4PPDA 3EX7B 2BJ1A 3US5A 2POKA 1NPRA 2PO4A 2QV6A 5AJ3J 1FXRA 4P7TA 3OJUA 1QY7A 5A2QU 4UZCA 1U25A 3Q83A 2XBPA 4I2QB 2O1PA 3BKTA 2AGOA 1HYSA 2W7AA 3VAJA 2ADCA 2M52A 1E6VA 1DQ9A 4FF4A 1WF0A 1XBWA 3WIVA 2C42A 4KFBB 3CCWA 1FRHA 2CNLB 2DGQA 3DXBA 3CIZA 1FK9A 4NRTA 5EX3A 2V2QA 1J2VA 1RT3B 6FDRA 3BBFA 3OR1A 2BOPA 3I5CA 4DL6A 1CJUB 3HHLC 1DQAA 2XZWA 4RR5A 4RZRA 4ERDA 4PR6A 4FPRA 2J7UA 2P6SA 2XGPA 2W4PA 5A6PA 4WKYA 2K2PA 2F8EX 3ETOA 1XNRF 1DZ5A 4C48A 2UUBJ 4O4RA 4DV4J 2UVUA 2HRTA 3R2CJ 2I0XA 1YHQS 2HHHJ 2HPUA 1NK6A 3FMWA 3FCVA 2UUCF 1T8EA 1IKWA 1ROFA 5I42B 4WK3A 2J0SD 3A13A 4C8MA 4BHQA 4CLPA 5HK4A 2F9DA 1HQEA 4DUTA 1RBAA 1FRJA 2Q6CA 5ETQA 4YY3F 4F4XA 3CCQS 3A4TA 4ZVOB 3IWNC 4Y6IA 2KB2A 4ES2A 3HXMA 4URQU 4EBCA 3QRRA 3IAS9 4LRFA 1S79A 4URGA 3CNQP 2AYMA 1KEKA 4XPEA 4KJIA 3MCMA 1J5OA 1KBRA 3V6JA 5IT9Y 3MWBA 3PRVA 4OQJA 3D4JA 1NDKA 2PE8A 1KD1T 2AWZA 5SUHA 2A3JA 3NS6A 3HD1A 2DY9A 2EW9A 3K5LA 3PO4A 4ID8A 1TKDA 4IR9A 1K1QA 3EWGA 3KLGA 3BPDA 2NUHA 2L41A 3KUHA 2ROEA 3HKZD 5HJYA 2DPIA 1ZTWA 2C2KB 2CNKB 2GMHA 5DQIA 3GMGA 2NREA 2GO8A 2LXUA 1P1TA 4B02A 4NYOA 4DS4A 4JI2J 2L08A 4YR0A 2RF2B 2RHQB 4DSLA 2BEFA 1H7WA 2IBOA 1QUVA 2QA1A 1V9OA 1UPMB 3N28A 1UVNA 4ECUA 1HBMA 3BDPA 5DG8A 2ASDA 3GV7B 1VLOA 1GNKA 1TVRB 1DTTB 3MXHP 3QT7A 1SKUB 4CM2A 2D3OR 2GIQA 5KT4A 2QTWA 4CLFA 2QT7A 4B9LA 2MQLA 1SKRA 4N41A 1N36J 3ET6A 1YJRA 3LW5C 1S57A 9ATCB 1X5OA 1LV5A 4K5SA 4AL5A 1S7HA 3RBZA 2CQ0A 3OL6A 1T02A 3IBCB 1RT1A 2RQ4A 1YRUA 3ICLA 4RU2A 2XMWA 2X3DA 4ECXA 3MR7A 2V4RA 4C8YA 3ENAA 2DNRA 4IFVB 5A2QY 2B9EA 2MZQA 4F26A 3MM8B 3GCXP 2H51B 2EG1A 3HKWA 3SDEB 3FQLA 3NMAA 3MEGA 3ILOA 2ZKTA 2XO7A 4LF2A 2GQQA 2LECA 3R5JB 2RNEA 2J9CA 2V50A 2LMIA 2YWWA 4CP5A 2HWHA 2JVOA 1NSQA 2B4OA 5DO2A 3DLHA 1SPBP 3JQKA 4IYQA 5IOLA 3S8SA 1DAXA 2B5JB 2CFXA 2OSQA 3K59A 2AHOB 1GQEA 3R8YA 4OJ1A 1I5OB 4BDPA 4RBTA 2AW0A 2YTCA 4NLOA 2VFUA 2M3DA 5HBMB 1TV6B 4KQZA 3H5XA 4TU9A 3FUYA 1TL3A 2DNHA 2Y1IA 1NJIT 4I67A 2OEKA 5EGYA 3PV8A 4IDKB 1KFDA 1RWUA 2RUGA 2J7KA 1HPZA 1FJCA 4ID5A 3IBWA 4MKVA 3NY0A 5HP1A 1L3KA 3LUYA 3HP6A 3MR2A 4NMLA 2OI2A 1FWKA 3OSPA 4A8OA 1HWIA 3QQCD 1H2TZ 4PPZA 2FJAB 2EFVA 4AQYF 2LFVA 4NWBA 5L9NA 4BC9A 4DF8A 4IKAA 2W9CA 3G71S 1OMSA 3DRSB 5D15A 4R8UA 2M9KA 2MHNA 1D09B 1G3OA 3UR3C 4FBUA 4R25A 2H3EB 2VG5B 2KN4A 1IKXA 1YJWS 4MKAA 3IGVA 4NYPA 1VRQC 1ICEB 4PEOA 2JC1A 4E98A 1Q79A 1N5YB 2HVEA 4PYDA 5GAHI 4BWJA 2QG9B 1LK5A 3FBFA 3FEYB 4O3RA 4QR1A 2N3LA 3RRHA 3RAMA 4PXDA 3IC1A 1DLOA 3EM1A 3LGNA 4G65A 3S7RA 2NZCA 2C1EB 1QSSA 2XULA 4LF8F 3K57A 1R89A 4ECQA 1RTDA 1JLGA 1HIYA 4DL7A 1ZYQA 3UD3P 2LDYA 3QAUA 4WE1B 4F3OA 2FGCA 1R7IA 3NCPA 4TVAB 3UN5A 2OLWA 2UVWA 1YX2A 3M8SA 4F8RA 2UXBJ 4P2MA 1N32F 4JI0J 1UA1A 5A8KB 3OD2A 4YR3A 4QYZK 5HMZA 4OIXA 1RWNB 4MIBA 4P2XA 2DNKA 3O8WA 1LWCB 2OFHX 3TO8A 4ZLPA 1S6OA 1Z2ZA 1KVKA 1D0EA 3B8HA 1RAIB 4N76A 2HNZB 5ETOA 2R7XA 4DR7J 4OX9F 4DR1F 3ZZUA 1FKPA 1BQNB 1FNMA 1MN7A 2AZ1A 1MROA 2KT5A 4QWBA 3CULA 3P5TL 2RB7A 2PDAA 4ZJLA 5F0WA 4ED8A 2FTRA 4Q0BB 3CC2S 1JLEB 2V69A 2Z2YB 5KFXA 1NHVA 1S4EA 1O5JA 3G8SA 1J5EJ 2XYGB 2VF3A 4FS1A 2Q1LA 5KFMA 3FBEA 3MEEB 2MQPA 4WIIA 4RU9A 3TR5A 2ILZA 3Q23A 4TLRA 4PWUA 1FRIA 3AT1B 4RNFA 2MQ8A 3IS9A 1PAUB 1AB8A 5L1LA 4FZVA 3BO2A 3CJTA 4ZPVR 3MURP 3P4UB 5CXTA 1VLYA 2YPYA 1M90T 4ANEA 5B09A 2MDAA 2HQ3A 4R5PB 4NZ7A 5B0CA 2WK4A 1YJTA 2NXCA 2R42A 2MKJA 1LKZA 3RW7A 3J7YU 1RU1A 3V2UC 1T9UA 4X4NA 2D41A 5AE3A 3KMQA 4G6VB 5D4PA 2AT1B 2CQ1A 3W2WB 4WXWA 3UCUP 4UW2A 1U1KA 3N5BA 3MAAB 1C1CB 2QL5B 2MKHA 1FKOB 4DMZA 2CQ4A 1ZM2A 5CA5A 5MAOA 3V4IA 3MPUB 2YWEA 1SJ1A 2AX1A 1R0AB 2GVDA 2YWKA 4ZCKA 4FXVA 5BR8F 4AT1B 4DR5F 2ZH3A 4QU6A 4JV2A 1U45A 1KN6A 2CQ3A 4X65J 5GAGI 4B9VA 4DQPA 1URRA 2HMIA 1RHMB 3H2UB 1Y00A 4OYWA 3MDFA 5C7PA 4NPOA 4ZHRB 2AJ4A 1DJ0A 3EVWA 3ZZRA 4U96A 4USIA 3KLHB 4K4YA 3KLFB 2RDIA 2XGQA 3D6HB 1OS5A 3CIMA 3BEGB 4I6YA 3RW6A 4X4UA 1H2VZ 1U1QA 3FZBA 3R6GB 4DFKA 4N56A 2FVCA 2XI2A 1VDHA 4B3TF 3IFEA 3UO0A 1CULB 3I82A 3IG1B 3T6BA 5L38A 3OJSA 2HRUA 4WPAA 2ZWOA 1G7CB 1X9MA 2PMHA 4ZVRB 3SMZA 1M1GA 2R3VA 1CJKA 2NS1B 1GAOA 1SKSA 2XB2D 5K8MA 2KM8B 5E7OB 4NXNJ 2DNMA 1YGYA 3DRPA 3KJVB 4ZVQB 2HS4A 1GXLA 4JI7J 3BS9A 1OQ3A 4L74A 4O4GB 1N5TA 2A2CA 4NI2B 1VJQA 4CTAA 2OD6A 5D0HA 3WC2A 4WF9Q 1OSCA 2AU0A 1GXTA 1KLMB 3WZ0A 4LSLB 3HHLD 3MI7X 2HVIA 4CH7A 3KFWX 1FRKA 2WSFC 4OI3A 3KWMA 3BB5A 4WTOB 1RACB 2E1CA 1TUGB 3T5KA 1C0UB 2YX1A 1FDAA 1SL0A 1NLKL 4IFYA 4GO5X 3PIPQ 5D8HB 2CKWA 1UWBB 2LU2A 2I9SA 1HR0F 1EHWA 2LEAA 2QFJA 4CO5A 1U6FA 3CUNA 1QSYA 2IYGA 2CPEA 3CJ2A 2IC3B 3H5SA 5D77A 4A46A 2YKAA 3PHTA 3ZZTA 3TVYA 3HFVA 1HI8A 5EWEA 3FNNA 2AEJA 4F50A 1IBKJ 3GSIA 3PW0A 1HBNB 1FNOA 1SJ4P 3N6LA 2FJEB 1S1VB 2BACA 5DS7A 5JJBA 1TK8A 3ADAC 4ELVA 4JI5F 1ZAWA 1UVMA 2NXJA 3K0JA 5FIIA 2E9ZA 3K8VA 1RUSA 4O0NA 1FI4A 2BJ9A 2DRAA 3M9NB 3UNGC 1YBUA 4B3MF 3UNYA 2Z0GA 1RAHB 4EMDA 1RDRA 3GFHA 4LFCF 2LLZA 1TKZB 2F5GA 4L3NA 4KV8B 1X4BA 2FVSA 4CLLA 1NRKA 1BUXA 5LJ3Y 4NXMJ 3DC2A 4USVA 4CH1A 2DGWA 4DZ6A 4OYOA 2QEXS 2B8QA 4ZVPB 1KC8T 2V2ZA 2CWXA 1L5UA 4LF6F 3Q24A 1OYEA 1XERA 1K9MT 3JTPA 4DU8A 2VASA 4B3SJ 2BJEA 5F8GA 3TWZA 1JLQA 1XC9A 4IO9Q 2G4BA 2AGPA 1LFWA 5IWAF 4ZIVA 3J81U 5ETSA 2QE5A 2J0XA 4I2QA 5A8WA 4IRCA 4X62F 4C8OA 4J5OA 4F4KA 3CGIA 1EKRA 3KK1B 4KFBA 2WW4A 4F02A 4GKKF 1HNXF 4FVCA 4CLKA 4NE9C 2UP1A 5F9LA 1QDUB 5J2PB 2K3KA 4LFBF 2I5JB 1NJYA 1XWLA 2ZH1A 2L9NA 4FVMA 2BE7D 2XSFA 2ZHOA 5H9EK 1RTIA 2AEFA 3W61A 2ALYB 3D66A 3WQPA 1CJUA 1WHXA 4N77A 1LQ9A 2OPPB 2XYPB 1KRPA 4X66F 1QE1B 3TOQA 2MTLA 2BOAA 4JBCA 5KFZA 3BKFA 3EDQB 3QO9B 5LSRA 3MECB 4NA3A 3BBBA 3BYPA 1P8GA 4DR3F 4Q8FA 4Q7AA 5IT0A 3IM8A 4QWEA 3MM9B 3K5NA 1X4FA 3EVMA 4QQBA 3GIMA 2YKNB 2ZH8A 3KJFB 1HNVA 2DNNA 2KL8A 5I42A 2BKNA 1SJ3P 2A6OA 4HT7A 1FHTA 1RTHB 5KFBA 3W5XA 3R27A 1REVA 1N5QA 2HS0A 5IV3A 1JJHA 3TVKA 2DR5A 1Y9OA 4C0OC 2FLPA 1BGXT 1PKUA 1TAUA 2RKIB 2LU1A 1S9EB 1RT5A 3W66A 1QD1A 5KOXA 2HYIB 1CC8A 4QIVA 3RBXA 4QWAA 3AJ2A 3DLGB 3FCWA 4UT4A 2UU9J 1TU0B 3H4DA 1M5VC 3IN5A 1JLBB 3V81B 4AFFA 2HBRB 2D69A 3C2PA 3RR8A 4UY85 4J7CA 3MM7B 4FN5A 2DRDA 1KQSR 1VIOA 2XY7A 1XNQF 3OFEA 2BW2A 2XHWA 2NPFA 2ABYA 4OZLA 4F3QA 1BQXA 3PDNA 1DQ8A 2V0NA 4JB8B 3T9ZA 3EZUA 2VPYB 1M0SA 3BSCA 3MD1A 2K7KA 3MFHA 3NCQA 2F4FA 3NMRA 2ZJRQ 2VG6A 3GR1A 4WFBQ 1BXNA 3VZHA 1H98A 2VQFJ 3ZZZA 2KVIA 4LF7F 2RF2A 4OV1A 4LF4J 3A1YG 1B4SA 2V9KA 3IRWP 4A8YA 1ZM9A 2Z8QA 2K3IA 3VAGA 2EFPA 3BN4A 2DBBA 5MLCV 1VJWA 4ICLB 3RAXA 1TVRA 1DTTA 3H98A 3CWJA 5D78A 3I0RA 3S1TA 2HLTA 2QJ3A 1B0VA 1UCNA 5GAEU 1VK8A 4DFMA 3GLJA 1HBUA 1N88A 4ETZA 4DV2J 3Q2SC 2V9WA 1F6TA 5A8RA 2KYXA 3UN2A 3C66A 2XSJB 2M8HA 5H1SV 2FHJD 2YNHA 3CF5Q 4TYAA 3D0HE 3AA9A 3N9UC 3BGOP 1XMBA 3VQTA 1EAYC 5BYQA 4L73A 3OTDA 1RT6A 3BGRB 3ISZA 2XC9A 2JLGA 2R2UA 1VC0A 5GADU 4ZPTR 1RWOB 2BKOA 4HHHA 3DRYA 2XWYA 3OFGA 1JXVA 3TZXA 4GKJJ 3J81Y 4IFVA 1VI7A 4NL5A 2WB1D 5HJXA 4LF5F 3DLEB 1ZM3A 3SDEA 2MQQA 4C0BA 5CH7B 2FLNA 1LOUA 2E1MC 2V2VA 1Y5IB 1FJEB 4OHXA 2AX0A 3V5RA 1OWXA 4LF9J 1SQFA 3C6UA 1O51A 3D9BA 1CPZA 2GNKA 4ZKAA 1YRTA 1YZ6A 1A0OB 2YQ0A 4OFZA 1WOPA 2NSBA 3H8YA 5E3AA 2XCPA 1RISA 5M2RA 3TUIC 2W24A 4MK9A 4KGKA 4CWBA 3U02A 3L09A 3RJMB 4NCAA 1I1GA 1U0SA 1U1NA 3MPYA 1KLNA 2XMTA 4KO0B 4PAAA 1SH0A 5AJ3F 2WW8A 4DV0J 1C4AA 5JUMA 3GJRB 3NNHA 1TV6A 1WWHA 4DQQA 4DV6J 3AD8C 1S6QA 4IDKA 4WZQA 2LKZA 2W2NP 1WTFA 3GV5B 1KS2A 1H2UX 2L9DA 3CMAS 4B17A 4UUWA 4K8RA 2OEJA 1VHFA 1PYTA 4ECZA 2CQPA 2BYCA 4DV7J 4U7CA 4WU3A 4HT5A 5LM7E 2FZGB 3P49B 3DRSA 4WBFA 3AHPA 1SB6A 3DLBA 5J2NA 3MMAA 2QFIA 3ELHA 1Q8BA 4CO1A 1N34J 2G2YA 4K50A 3QWPA 3NNCA 3A8EA 5C2CA 5KFWA 1RSCA 2M7SA 2F63A 5HATA 3MPDA 2FLLA 2UUBF 1N5YA 4DV4F 3UFCX 1FXLA 4MT1A 4ZN1A 4LJMA 2E5HA 2B9WA 2IJNA 5A0YA 1M5SA 2HHHF 4M5HA 1NKCA 2EFNA 1HA1A 3EE3A 5HO4A 5BYRA 3DKDA 4LT6A 1JK9B 4WKRA 4I68A 1S0MA 3BDEA 2AGQA 2HURA 3W9HA 1LK7A 3GILA 1RT7B 4ES1A 5JMNA 4YOEA 1JX4A 3DDIA 2RHSB 3DFEA 1FJ7A 5FDLB 4FKYA 4P71A 5CD4H 4DV3J 4J9UE 2I1RA 5M2PA 4TU8A 1S0NA 2J6SA 2OAUA 1RAJA 3AB4B 1T9TA 4L3KA 4HHUA 3CMES 2ZD1A 2V4JB 4A48A 3PG9A 4QYRA 2Q79A 3UE2A 4Y2CA 1S6PB 1U6ZA 1Y3JA 2MY7A 3G86A 4DLEA 3RBEA 1WHWA 5A8KA 1C0TA 2HFSA 2C2NA 1ZAVA 3LGHA 2FB0A 1SIWB 1S97A 1B7YB 4TYBA 3H5UA 2HNZA 4K2JA 3W5YA 1X4AA 1RHJB 3E2EA 2G2OA 2X51A 2EK1A 3SCLE 3T5HA 4UOGA 5IT4A 1TK5A 2HAFA 1RAGB 2NXUA 4JI1F 2O3DA 4ED7A 3H25A 1JLEA 2MZJA 1IBMJ 1Y4ZB 1S7IA 2DGXA 3FKBA 4JI2F 2D3ZA 5F3TA 1SBRA 3PIOQ 3QSYB 4TN2A 1KQFB 4JV0A 1N5VA 1FRXA 3QJLA 4J9KA 3HHEA 4A8MP 2JH3A 2YVSA 1PAEX 1UJ4A 1BE4A 3HCXA 1EP4B 2C3MA 4BCAA 2MSSA 2F4VJ 5KT5A 3M9MB 1HD1A 3M2UB 1P9YA 2GGPA 3CCMS 3CCRS 2JLFA 4FYXB 3AQOA 3JSMB 3HJVA 2AJ1A 4NCBA 3UCGA 3SXLA 4C4WA 3NGTA 4LBPA 1H0HB 3TW0A 2GQ2A 2HHUA 1ZAXA 1N36F 4R5PA 3QT5A 4X2BA 1OSDA 4RWXA 1NSKL 4G3IA 4GMKA 3BH7B 4ZVSB 2CQGA 2E1AA 3RTVA 1S76D 2V68A 4FKXA 1IVZA 4DS5A 3W2WA 2N4DA 2RRNA 2LQJA 3MAAA 3IO1A 5ETTA 1FKOA 1HQEB 2D1CA 1LWEB 3NRBA 2ZJQQ 1K73T 3POTA 1XMQJ 1R0AA 4USKA 3PW7A 3T9NA 3MR6A 1NCLA 3QFWA 2OPQA 4MJKA 4Z2XA 2MZTA 1J5OB 1R8HA 4GVLA 4BC7A 2ADBA 4ECVA 1RCXB 1Z2LA 5FLXU 2KJWA 3NLCA 1YWXA 2GCFA 3TEGA 4TY8B 4BS2A 4ZHRA 3AFGA 3MOZA 1WKKA 1S77D 1FJGJ 1PC4A 3L7OA 1FWPA 2JC0A 3KLHA 2O5DA 3ENWA 4JOUA 2Y9HA 3TAPA 1IBLJ 4KIAA 1X9SA 3KLGB 1WJ9A 1R0CB 2ZJPQ 2GJIA 3LP1B 4DR1J 3MUTP 2JEGA 4OJGA 1SQEA 3MM5A 1KQGB 2CYYA 1TQLA 4RUAA 2HZAA 1D8ZA 3TX0A 1JLFB 2ZOGA 4HHJA 1YKWA 4DL3A 3CDBA 2YY3A 3I0SB 3D0GE 3AQPA 4QWCA 3N6MA 1H72C 2VFRA 5J1NA 1QVFR 1WF1A 5LXYA 2WVDA 2P5VA 3HFKA 1SL1A 1HBMB 5C25A 1F9EB 4WYLA 3KJVA 3ZTOA 4IOCQ 4CCHA 1WG5A 1M1HA 1CVJA 4DPTA 1FWLA 4NLTA 4O4GA 2ILYA 4RW9B 4HI2A 4PXBA 3ITHA 3VZIA 3M8QB 1VIXA 1DARA 1TKTA 3VR1A 5LXRA 1F5CA 4LSLA 1A7GE 1K1SA 3AOAA 1UP1A 2ACMA 3BV8A 2BW7A 3V6KA 4CNZA 1JLCB 1VQ5S 2HWTA 4DL4A 2OGUA 2MLYA 1SL2A 4DHVA 1IR1A 5DM6Q 4GRSA 1IKYB 3UDLA 1KHVA 3H2LA 3Q89A 4OHVA 2F3JA 2J9DA 3VV2B 3U1NA 2ZVSA 2IC3A 4TLQA 2NPIA 1ZM4A 4GC7A 4JI8J 2QX0A 1U8WA 2EBEA 3T1HJ 1MNEA 5DG7A 3IMQJ 5T14A 1TUVA 3E51A 1PJ6A 1HBNA 1NDLA 2PEHA 1LW0A 1H3DA 1SC6A 4ED3A 2DXFA 1S1VA 3Q8PB 2HNYA 1W2IA 1YDLA 2EEYA 3I31A 2FHMA 1WSVA 1OO0B 5E2QA 1FEEA 1XTZA 4FDFA 3NOCA 2PFFB 1SXLA 2M2BA 1Q8KA 2UXBF 5L8RC 4JI0F 3UVJA 3C3LA 4WWSA 1RWVB 2FQQB 1TKZA 4HACA 2IRXA 3MTKA 2L48A 3VF0B 3RR7A 4HVZA 3PY8A 1DBDA 5GVQA 4DR7F 1F2GA 1F2HA 2HQFA 4EBEA 4M94A 2LCWA 4C8KA 3SFUA 4N8OA 2YNFB 1TL3B 1TL5A 4LR9A 2ZE2B 3PYDA 1U26A 4NLQA 2J6TA 5HP1B 4FS2A 1P6TA 1J5EF 1R8PA 3JSRA 1T05B 2UXCJ 4G1QA 2FGOA 3E8OA 3HMJG 2BDPA 4WFNQ 4ED4A 2FVPA 4ZLLA 1DRZA 4Q2MA 2CNOB 2HIQA 3ZZPA 2NR0A 3GIRA 3MZIA 3RYLA 2R8GA 3ILJA 4K4WA 4KAIA 2DYAA 2D7SA 2YKMA 3LTOA 2ZDOA 5CZVA 1T7PA 4FYYB 2CPJA 3J7ZT 4EZ9A 3GJQB 4K4TA 3KK1A 2Z56B 4X4RA 2MGZB 1FNXH 3BR8A 3W65A 3ZZYA 1PYOB 3KTQA 3OBIA 5IXUA 4EZ6A 1IKXB 2XG8A 2IIHA 2DVIA 5FLXY 1YZ7A 5J2PA 4QW8A 1WF2A 3B82A 5KFAA 4X4TA 1SIZA 3OLAA 2ROGA 1KOHA 4J37A 5D4NA 1JQGA 3I56S 2KFYA 1CS4B 3THTA 1H7XA 2UUTA 1VRTA 3MD3A 3Q8RB 1VBYA 1HNZJ 1FKAF 4K0KF 4MFBA 3HHNB 2FC9A 3D7SB 5D3GA 2CZ9A 1RZMA 2FYXA 3QO9A 3CJ0A 3MECA 3UD5A 3Q8SB 4O0IA 1RHUB 1RTDB 1JLGB 4NLRA 1S4FA 4I1TA 3DOMB 2KZMA 4CH0S 2IJRA 2HQIA 3W8PA 3MM9A 2F9JA 4DR6J 3T6JA 2K1RB 2JRSA 4X65F 1K8AT 2M8DB 1SH3A 1BD6A 2ZNZA 2D9PA 5GAHU 5DQGA 3R2DJ 4NMXA 2LDIA 2VBYA 3K7RA 1PG5B 1NUEA 3O5TB 1NK5A 3M6VA 2WBMA 2VPXB 2LVWA 3CJSA 3NBPA 1QAXA 4ZJOA 1S9EA 4ZPDA 3NG8A 1X5SA 3QLHB 3DLGA 2CJ9A 2MKKA 5K20B 3KNGA 1VQ4S 4F0HA 2G0CA 2BV3A 4C3MA 2DNZA 3LA0A 3V81A 3HVWA 3MM7A 1U6BA 2YKPA 3LPYA 4DPWA 4B3RJ 2BANA 3Q8UA 1UZDA 5KG0A 3P8BB 3V6HA 1HWJA 3D28A 3A8JA 3CT9A 4TQSA 4M5LA 1LXJA 4NXNF 1R0BG 5GAEI 4JI7F 6FD1A 1XR6A 3P5BP 4P9SA 1G4CA 5A6WA 1H38A 1RYRA 1RHKB 3OHAA 3PM9A 2KG1A 3BQ0A 2J9DE 1Y10A 2CQDA 1XR5A 4LMZA 1TL7B 2J6UA 2UZAA 2YWGA 3Q8VA 4YHHJ 4RW6B 4ELUA 3I4HX 2AKWB 4LUBA 3DYAA 2YBVA 3DXSX 4DLGA 3IM9A 3PVXA 1GMVA 1RT2A 2P2CB 3V4IB 1WKJA 2H5JB 3SIPB 4X64J 4EYHB 2GVDB 2XSJA 1Q5VA 1IBKF 4DQSA 3DGPB 2DT9A 1EJ7L 2M70A 1N33F 2YH1A 3UPFA 1NZ8A 5HVGA 1RI7A 1SJRA 3CE8A 5KFLA 4W92B 1UJ6A 3NAIA 2B7BB 1TZ0A 3PRDA 1AFIA 1X4EA 4X4VA 2ZOFA 2XEXA 2VA2A 3GWCA 3B78A 1B0PA 3SEOA 1X31C 4RL1A 2RH3A 4AXJA 1EZZB 3UCZP 1HWUA 2KU7A 2DNOA 2C2EA 4YUDA 4NXMF 1U02A 2F1FA 4NOHA 3GSDA 3N0VA 3PNIA 4OZJA 4LIWA 2KDOA 4JYAJ 3GR0A 2ZHAA 1S9GA 4YEAA 4RUCA 1YLXA 4XO0A 1CJKB 4HI1A 3QJPA 5HSPA 3I55S 3QT6A 3GIKA 4B3SF 2HK3A 4ZPBA 5CYMB 2C2RA 5KFEA 4MK7A 3I6PA 5KOWA 4DEZA 3Q2TC 3ULHA 5DZ7A 2HBYB 3PR4A 2ZUAA 3OL8A 3FC9A 2DO0A 1PILA 3GJSB 4RNNA 3N4WA 3L4BC 4LSNA 5HVHA 2HGNA 2OMOA 1S99A 2RUSA 4RUBA 3UW1A 4J9QA 1AUSL 2GAHC 3FCHA 3VGVA 2BX6A 3G6YA 1F0XA 4DX8H 4PQUA 4NLGA 1ZBTA 4Y28C 2DPJA 3CDEA 1N6QA 4IFYB 4ALZA 4DI6A 1SUQA 4KHPJ 2CPXA 2DY1A 2W9BB 3AY0A 4KPCA 4JV5J 1F3VA 4OLOA 1IJFB 4KE5A 4WFXA 1WC1A 3LP2B 4OYBA 2BR0A 3D6FB 4FF2A 1V5VA 2G1DA 4NLVA 1R8AA 1VFJA 3QMQA 2FVQA 1Q7YT 3QYYA 2IBKA 3GE9A 4DX6A 5F8MA 4I6WA 5C24B 4M63A 5G0RA 1NBEB 1VK3A 4O44B 1VISA 1B7FA 2YNIB 1F5AA 1OYDA 4EYIB 4NA2A 2RQCA 5D6GA 2DJWA 2B9XA 3BZQA 2IPOB 2NSCA 3DRRB 4LVNP 1HI0P 2IDLA 1IJEB 2ZVIA 2KM8C 2YX7A 2F8HA 3UD4P 1FX2A 1D3WA 3RB4A 2LEBA 1RT7A 3TI0A 4RKUC 1YRXA 3VQSA 4WIQA 2BRLA 1IXKA 2FHKA 2CQIA 4QIFA 2H65B 2FY1A 5ETRA 1A6LA 4ZPCA 2UU9F 3R97A 4UOFA 4PG4A 1X4CA 1S6PA 1SC1B 2VBWA 4CT9A 3EPGA 1ZA2B 3NNAA 2E29A 5DZ6A 4ENOA 2IVYA 5HROB 1T95A 4P7VA 2XM3A 3GG0A 1JLQB 2MZRA 3HX9A 3OTOJ 3VVTA 5A8WB 2CPYA 2I6WA 4CI0B 1W26A 3SYZA 2EI5A 4L75A 1HNWJ 1TKXB 5RUBA 1OY9A 2FIUA 1AROP 3DRXA 3MCOA 2MSTA 2VQFF 3AD9C 1UFWA 2E5LJ 4FXDA 4LF4F 4OZ2A 5B0GA 2YPZA 4F4YA 1RCOB 3DHWC 2YH0A 2A18A 3I9V9 4EK2A 1AUDA 4D3GA 2R2SA 2DHAA 2ZZNA 2DIUA 4ILMA 1QTNB 1EP4A 1RTIB 1TELA 2R8JA 1VGYA 2IJFA 4FYWB 2AEMA 4RJVA 5K8PA 5F9NA 3M2UA 5DGBA 1PBUA 3SCIE 4ED5A 1F9FA 3JSMA 4P52A 4AYBD 5KFCA 2E9RX 3RB6A 4DV2F 3G2XA 3GQCA 2UV8G 2UUWA 2CZVC 2G2ZA 2GMLA 4OX8A 1Y5NB 2PGCA 2C2OB 1RAOA 2NQPA 2J0WA 2RU9A 4LBIA 1JLAA 3K8WA 5KG1A 1NEEA 1FT8A 2MZ1A 3EUNA 2DR8A 2Y3YA 1FA0A 3EPIA 2FDNA 2OPRB 2C28A 4DL2A 2HFUA 1HNVB 4U8VA 2CPFA 1JXEA 4CLUA 2APOA 2PMWA 3M30B 4GKJF 1LWEA 1REVB 3K89A 3HZGA 4UTGA 5KT3A 3WIUA 3OL9A 4F04B 3BBCA 4YB5A 1Z4UA 1RT5B 3U1LA 2QA4S 2GVZA 2XO6A 2XLKA 4LRBA 3OLBA 4ZVUB 3QZ8A 4OI4A 2HIYA 2VJVA 4LF9F 2HFOA 1PBAA 2ZH2A 1NJXA 5L39A 3MMJA 1Y5LB 2BXJA 4ZCMA 4C6AA 1U2RA 4TY8A 1GTEA 3QIDA 2ZBPA 3UI3A 3PX4A 3SI8A 5B0FA 5IC6B 5LMUJ 3Q8YA 4B08A 1RWKB 4DR2J 5F8JA 2GX8A 4K2XA 2JX2A 4V1Ak 3LP1A 1UW4A 2RILA 4L76A 3T5LA 3GYXB 1T9XA 4CO2A 8ATCB 2DIVA 3PR5B 4J91A 4P6QA 4DV0F 2VG6B 4JI1J 1JLFA 4DV6F 5FJ4A 3CCLS 3I0SA 3LQVA 1IM4A 2PA8D 4ZPAA 1WI6A 2DEJA 5F41A 5DG9A 1GMUA 3RRKA 4A8XA 3MPWA 4C11B 3MM6B 1LW2B 4TXSA 1I94F 2Q3PA 4CO4A 1SV5A 1B99A 4QR0A 2HS3A 4DV7F 2RE1A 3PKYA 4CYUA 3H4BA 1NKBA 4RW9A 4M5NA 3I0RB 3M8QA 4ZLJA 2MLZA 3D54A 3BM7A 1HBUB 2DK2A 5F8IA 1CG2A 2CPZA 4U7UK 4HDHA 4DG1A 2BMBA 5A8RB 1YIJS 3MFIA 3PEHA 1N34F 1K44A 1JLCA 1HBOB 2YNHB 1LFPA 4ZVGA 1KP6A 2V4QA 1NB2A 3DLLQ 3NOGA 4U9RA 1IKYA 3U27A 2QA4G 4YQWA 2DGSA 4WFZA 2D74B 1RT6B 2LXFA 3QFHA 2XLIA 1Q8IA 1A9NB 3D2WA 2DB1A 4C8ZA 1X9WA 5B08A 3IR6B 5AE2A 4UF4A 4NEYA 2A1BA 5JVGQ 3A3OB 2BJ7A 2BE9B 1JNZB 2NXEA 2CVEA 1FRLA 1LEOA 1R8CA 4DU7A 2GS8A 5LT5A 4DV3F 1JJ4A 3JS9A 2PMZD 3C6UB 2BBEA 1RTZA 3TUPA 2HNDB 2BQRA 3TEHB 3KKFA 2OHDA 2A0FB 3A3PB 3PYEA 1MMLA 4F4ZA 5ETLA 5K5MA 2ZH5A 4IUFA 2OFGX 4QYZJ 1TMMA 3TUJC 3R7NB 1GMWA 3OFHA 1YG0A 4P73A 2F40A 1PC5A 1Q5YA 2E44A 2EKNA 2GHPA 3TYTA 1NO8A 5ETKA 1NHUA 3W8GA 2YNFA 4CZCA 2UVVA 5LL6d 1G2EA 1S6QB 2G1HA 2R7RA 1HKAA 2ZE2A 1Y0HA 3AAWB 4JI3J 1Q8LA 1NDPA 3TRGA 1IBMF 1KNZA 4B3OA 1D1UA 3H5YA 3D67A 1T05A 1X4HA 1RAEB 4J9NA 4X84A 4HYKA 3QRPA 1MSWD 1KHWA 1LWXA 4ECRA 1KQKA 4WYWA 1AZSA 1VBKA 2BZ2A 4DXLA 3ZNJ1 3DCAA 3ETMA 2F4VF 3OR2B 2VUGA 5J2NB 3MMAB 1GT8A 1IKVB 4A8FA 2KFNA 4NLYA 2MGZA 2I2YA 2FJXA 1N8RT 4F4WA 1Q16B 5KT7A 3IR7B 2XZDB 3CD0A 2DXDA 3OW2R 1T3OA 2QIFA 3G6XA 2HFNA 2HQDA 4P74A 1CS4A 3CJQA 5A0YB 2YNGB 1HHQA 2CG8A 2JFKA 3HZEA 1FDDA 4RWWA 2OMLA 4IOBA 2EXUA 3CMQA 4DWIA 3BSOA 3B4MA 3UQSA 3DM2B 2XY5A 2JL9A 1X60A 3OXLA 4CDIA 5CD4A 2MKCA 2B8PA 2C3PA 1XMQF 1GX5A 5LMNJ 1UL3A 1V3SA 2F65A 4L72B 2ZWPA 3DOMA 4WJBA 3DLJA 1RB0A 3W2VA 2K1RA 4F67A 1AYEA 1U1RA 1B0TA 2HHPA 4QPTA 4ZN3A 2ZD1B 2YX4A 3LALA 2KXHA 3AA8A 4OJHA 2FPHX 3JB9k 2CVIA 3JXOA 3ONQA 3MEDA 3HDSA 2KH9A 2P9CA 3HT0A 1C0TB 1T11A 1FJGF 3LGMA 2B7CB 1DTQA 2CJBA 1IBLF 1EKSA 4NLPA 2J8SA 2W2OP 3CVKA 4F2SA 1VQSA 2N4CA 1YBTA 3D68A 4F0KA 3NKYA 2W8LA 3QLHA 3S01A 1VQNS 2VB6A 4I69A 2DH9A 4UOHA 1UAWA 5E33A 4PXEA 1NSAA 2H54B 2FZKB 4C0HA 2CADA 1QM9A 4P2FA 2WSCC 2ZH6A 1FCAA 3IA0A 4DCOB 1TMJA 4CRJA 4DUYJ 4M5JA 1YJ9S 4MKYA 2OPSB 3PJXA 4FF3A 2JEJA 1P9QC 3H40A 5DQHA 4ZA1A 2RS2A 3P3DA 2WRMA 4ZLNA 1TUWA 3K2YA 4Q2LA 2GGPB 1GX6A 1TP7A 2AP6A 5B0DA 2DITA 2B4PA 2XQCA 4LBHA 3PFEA 1T0TV 1TAQA 3H20A 2JWNA 1JJ2R 5E0OA 3ZO7A 2B4UA 4OV6A 1TL7A 3SCJE 5HQ8A 2RSQA 4I64A 1RWXB 4DDFA 2V94A 5GMEA 1RA6A 4RW6A 5ETPA 1LWFB 2KKHA 2QLBB 4ZK7M 2GIFA 2GAGC 3FBCA 2V8VA 2VFVA 2VHGA 4K0KJ 1LXNA 3FJ2A 4UZBA 3ZTRA 4J9LA 3CD6S 3SSSA 1T3NA 2CJKA 4QPXA 3MGJA 1CLFA 3AD7C 4JI8F 3BSNA 1HMVA 3POTB 3W9IA 4M8LA 3T1HF 2H5EA 2I38A 3DGPA 4RW7A 4KT0C 2OPQB 4CT8A 4IG0A 3I4PA 1IUJA 2BQUA 3M8WA 3HPOA 2EKYA 2ZFHA 4L6V3 1X0PA 2RIJA 4NYZA 2W2QP 1HL6A 4RW8A 3M32A 1VOMA 2Z4PA 1YJVA 5M2UA 3R5BA 3L95X 4NRUA 4IH5A 3M6UA 2EFQA 1S9FA 3MM5B 4URSA 2ROPA 4QBUA 3P96A 3PW2A 4TNOA 2VJUA 3PYGA 1U24A 4K59A 7FDRA 1KR4A 3P6YC 4RW4A 4ZS6A 1UFLA 3NCRA 1CQMA 3HVTB 5GMDA 4LVOP 5KFOA 2O67A 3HF5A 1YSJA 2JHEA 3AJ1A 1QAIA 4WCEQ 2VZ9A 4N5SA 2UXCF 1V3RA 3QRQA 3F0NA 5C25B 5CYMA 2HKEA 1WC3A 1ACMB 2CJXB 3EMTA 2EFGA 3H2VE 3TP2A 2HBZB 4NZ6A 3ZTSA 2FHJA 3ITHB 1D9FA 2HHQA 2VPZB 3KG4A 2JOQA 3RU0A 2VKRA 3C6TA 1NJZA 1TKTB 1RAFB 3D6MB 2ZOMA 3NGUA 1U2FA 5KG6A 3TJ8A 2DR9A 3VVUA 3TANA 3D0IE 1HFEL 3CJ3A 3IWXA 1SJQA 4PG8A 3B4DA 5DDQC 4ATNA 2DNGA 2DR6A 2ZZMA 4C98A 1WC0A 1NSPA 3G82A 4XK8C 3AH6A 3QWUA 3LPEA 1VRUA 2W9BA 5H9EJ 2VFTA 3PRBA 4ECWA 3LP2A 1MLAA 1HNZF 2LP4A 4QIEA 1MMDA 2MY8A 1NHKL 2EC2A 1D9AA 3TX8A 4QJVA 4CNYA 5C24A 1FDNA 1BC6A 5EHHA 4O44A 2CIMA 1N33J 1LW0B 4PUOB 2YNIA 2CZ4A 2O01C 2OELA 2X1GA 2AYEA 2CNNB 5J1EB 2HNYB 2MMYA 5DETA 4DR6F 2OTJS 4USWA 1RGVA 2CPDA 4DL5A 1XIQA 1NK8A 1V3ZA 3UWTA 3IXQA 3DRRA 3L7PA 2VG7B 3UVJB 2KI2A 3UR0A 2IYIA 2DH8A 2XS2A 2VBXA 1K0TA 3G8TA 4HACB 4GVBA 4ZCLA 4P75A 3G87A 3P45B 1NPPA 3KUEA 3AODA 4U7UD 2PD1A 4OI2A 4UOCA 3TQ1A 4QOTA 2V5HG 4NLSA 2IA6A 2N3OA 4KKOB 2QN6B 3OXGA 3PX6A 3VAKA 1WC4A 2F7VA 3KLVA 4J9MA 3CC7S 4ZITA 1VBXA 4G1QB 5D0RA 5E3CA 2W1BA 3FSIA 2EG2A 2NXNA 4B3RF 1RK8A 3N6NA 4DBQA 3JAMU 1APSA 5K8OA 5HROA 1RKIA 2CQ2A 3NEKA 2FHOB 2HRYA 4ZDNA 1UFKA 5THWA 4DZDA 2RJZA 1NK0A 3JTOA 3SSRA 1AW0A 2YKMB 1ULRA 2CUYA 5L46A 5D4LA 1TKXA 2E7XA 1W7WA 4F36A 3GFZA 1FFSB 5E3QA 1FE0A 3QT8A 3CSKA 3W9JA 3MTJA 4V19X 1HARA 3CDUA 3CJ4A 5D4OA 2HSEB 2H1YA 4DF4A 3VGSA 1QUPA 3J80Y 5AXMA 3HD2A 5KG2A 1TL1A 2XI3A 1RTJB 4YHHF 5LJ5Y 4BBYA 1VRTB 3DDKA 2VQEJ 4M5KA 3F44A 1KFSA 4X4QA 4ED1A 1YJ7A 4PQAA 4MFBB 1T9VA 1RWWB 5D3GB 3MPVA 2Z30B 1KONA 2PC6A 1QVGR 3SZ2A 2AJFE 2GJFA 4DQRA 4X64F 3E01A 3EXCX 2H4YB 2QA2A 4QIWD 1NK9A 2VODA 5C42A 1DURA 5CCMA 2ZDPA 4YB7A 2R7OA 5L1JA 4ZCIA 2OPRA 4OZ3A 1FRMA 3J7A1 3BF4A 3TAMB 5J2MA 2BJDA 3L3CA 5CYQA 2J9EA 5A76A 3WX8A 1HNIB 3GJTB 3M30A 4NASA 4Y2KA 2HGLA 2Z2MA 3NBPB 1MWZA 1YJUA 2PI4A 4N8NA 5H9FK 5CABA 4IR1A 2RQKA 1QAYA 2DCUB 4PG6A 1WG1A 4KGMA 4CQ1A 3G6ES 4J9VA 1O8BA 2WTFA 3CB4A 2Y0BB 2B51A 4OZ0A 1FVSA 1U49A 1S12A 4RX6A 3M1VB 1IR0A 1JXLA 2Q66A 4JYAF 4IH7A 1ITPA 2FD2A 2G0IA 3PFOA 1HWKA 3C14A 2GIRA 1RBLA 2GC8A 2BANB 2GHVC 2Z58B 2VIHA 1CJVA 2E1RA 2BUNA 3HSGA 3HO1A 2B56A 1T94A 1V5IB 2CWKA 8AT1B 3GFXA 2ACYA 3EGNA 1EIYB 3QIPB 2LYVA 4WZMA 2CQBA 3VAHA 3E3XA 3M8PA 3PZPA 3G4SS 4HTJA 4NCGB 2C3YA 5HVFA 2JDJA 2N7YA 4C11A 3MM6A 1LW2A 4AE5A 2DHHA 4DSKA 2ASYA 5DJBA 2DH7A 2G0JA 3KK2B 4UQGA 4A8KA 3VAIA 4ETXA 1M5OC 3DYAB 4KHPF 4Q43A 4USMA 2W25A 4JV5F 1IQTA 4LRAA 4ES3A 2V34A 3BO4A 3RB3A 1RT2B 1I51B 1N52B 2X1FA 5HQMA 2V2KA 2LQ8A 2N82B 1HBOA 4MAKA 3FSYA 2DKOB 3TJAA 4JUZA 4KGZB 2P9EA 4Z7CA 4K4XA 2VOOA 3TJ9A 1XMOJ 3ZTPA 1UTAA 3LO3A 2GA7A 2XCAA 3T5JA 1MMNA 3JAMY 2OIHA 4K7QA 2HFZA 1FFWB 5KAKA 4LFAJ 3DI6A 4U6PA 3PHEA 1R8BA 2Y1LB 2QMXA 2ASJA 3OFFA 1S1XA 3CDAA 1RT4B 1UVJA 3R5AA 3NWRA 4M1KA 5T41A 5L9XA 2HZCA 1PGZA 4MMOA 4ECSA 2DHGA 3LP0A 2HNDA 1I3OB 1NXIA 1WDTA 2K06A 5KFPA 3SQOP 4KHRA 1S9GB 1K47A 4RO0A 2VICA 2NYHA 1T9YA 2FZCB 2WZ1A 4WU2A 2VDIA 4DL0C 3EZ5A 3LANA 3KHHA 2FVRA 4K4ZA 3CO0P 2DGTA 2M5YA 1S1UA 3CCZA 1Q0NA 4O3SA 3BQ1A 2E9TA 2HFVA 2V8HA 3OTOF 1AA1B 4PABA 5HLFA 1S48A 5EUHA 2NUUG 3SQGA 4DN9A 1WC5A 1H73A 4LSNB 4PWDA 1HNWF 4YDDB 4XDDA 2OD4A 3KLIA 3A8IA 3KLEB 1YK9A 3M2VB 3OT9A 3R3TA 4DQIA 4XTTA 1C2PA 1I94J 2PSZA 2E5LF 2CQCA 4PQUB 4OZ5A 4O23A 1N6QB 3EGWB 3JQJA 2RU3A 1T03B 2C3OA 5IC4B 1SUQB 2KRBA 3CCJS 1FE4A 1VQPS 2RMLA 2IVMA 5ETNA 3OR2A 4RPFA 4AD6A 3K5PA 2R7UA 1IKVA 4DUZJ 1KWMA 3TQEA 4IG3B 1DHMA 2B6AB 2WVBA 3OUYB 2W2PP 5L1KA 1C1BB 3OVSA 4X4SA 1U47A 2Z57B 1I6JA 1PYSB 2RS8A 5G0RB 4K4UA 1AXQA 2KHDA 3NGRA 3ZNUA 2ZH7A 1WG4A 4FYVB 1EETA 4PYAA 2YNGA 1E6YA 4JV1A 4RLEA 1VMBA 2VONA 3BGFA 2E7VA 4C3LA 4RNMA 5KG7A 1FESA 3NXZA 2ERRA 2VL1A 5IZHA 2LQ9A 3DM2A 2GMJA 3G9CA 3EVOA 1VQMS 2R2TA 4DR4J 1FD8A 2AV5A 2PIIA 2WONA 4JI6J 3RB0A 4WP8A 5KFIA 2KJVA 1RBOB 4HLBA 2E66A 2MKYA 3GIIA 2R7VA 4PKDB 1NAQA 1SI9A 3HULA 1YBAA 3HFZB 3FGVA 2WB4A 3CJ5A 3MMBA 5LMUF 5F8NA 3UDCA 4ANCA 2HK2A 4DR2F 4M5DA 2H4WB 1N54B 3C46A 2QLFB 4B9UA 1KTVA 2VKZG 3B54A 4PZVA 2BVZA 1WI8A 4KC5A 3BSAA 2G13A 4IO1A 4R0JA 2H9ZA 2MEWA 3A8KA 5KFRA 2A2DA 2HHWA 4EWTA 1U2CA 2AD9A 3OL7A 2B4VA 3VCDA 1JKHA 1VC5A 3TA2A 4C2MA 2Y1JA 2NCKL 2IMWP 1N0UA 1EQ0A 1BQMB 5J1PA 1UA0A 4CLSA 3BH6B 4M95A 5IQQA 2MKSA 2OPSA 2CJAA 4PG7A 4ED0A 1HHTP 5E3RA 1M5PC 3KJNB 2E7WA 2J76E 5LSLA 3FSXA 4P10A 4QU7A 1HWLA 2YWFA 5K14B 2UXDJ 4EO6A 4EGLA 1U1PA 3BO3A 3M2RA 2ZH4A 3RBDA 4M5GA 1JLAB 1IWAA 3R7SB 2DRBA 4YDXA 2IRYA 5I3QA 5LSOA 1LWFA 5K9FA 2DXEA 2KXNB 2BKPA 3PYFA 4I56A 4ED6A 1RYSA 3OSNA 3DLKB 2XHCA 4CLTA 2FJDB 4H4OB 1HQUB 5AE1A 2AYBA 4IRKA 4Z37A 5E5NA 4TU7A 5T7LB 4A47A 2JZ5A 3HHDA 1NNDA 4YP3A 2GVZB 1K0VA 2XTJP 4OI0A 2BA9A 4ANDA 2EPIA 5KTQA 4OI6A 1SKWA 1YJNS 1V6HA 4RBUA 2PEBA 4U67Q 3MAHA 4Q45A 5BYSA 4F7VA 3CJRA 4KH1B 3MR5A 4FF1A 4A4JA 2EC0A 4DJBA 5AXNA 2HHTA 2ZM6J 3MEKA 1PJ7A 5IS2A 4KR0B 1NKEA 2CDQA 2D9OA 1RJJA 2L9WA 1PJ5A 5LOQA 2SXLA 3KOAA 4KGXB 4FPIA 3LWMA 4DV5F 2Q43A 2WAQD 1IN0A 1FD2A 3MMCA 3HVTA 4JI3F 2VD3A 1S72S 4V19J 3C16A 1B3TA 3JYTB 1UMJA 3QATA 5KFTA 3ILIA 3DU6A 4TKTA 1NK4A 1WHVA 3HJFA 4O3OA 3CCVS 1IQZA 1UVLA 1F1BB 1IR2A 3N5FA 1SV5B 2R2RA 2AYGA 4O3NA 3C15A 2PFDA 2WBRA 3EICA 1QLNA 2ZUGA 4CYUB 1U4BA 1JB0C 3NAHA 4QW9A 3H59A 5DLGA 1WHYA 3OXFA 2IDEA 1CJTA 3K17A 3VTIA 4J90A 2ZC4A 2COLA 4DSFA 4DG1B 2DHXA 1TK0A 1UW9A 4WFYA 3D3CJ 3FEZA 4KSEB 1GMWD 2HAIA 3MUMP 4IH6A 3R7BB 3M8ZA 1S1WB 2IM0A 1KKHA 3I87A 3SCKE 4ZJQA 3FEXB 1PO6A 2XMMA 5L1IA 2WOMB 3QGPA 2VC0A 5I3UA 4ZOSA 3PTWA 2K8GA 3HSJA 3BR9A 2AIRB 4AUKA 4MYUA 3G6VA 5F3ZA 4LR7A 3J81j 2R9LA 1KVIA 2N7CA 2U2FA 2IHR1 1OJ4A 1X0FA 3AB2B 4PCQA 4WTYA 4ZP6A 5KFQA 4PUOA 5LMNF 5J1EA 2GV1A 2IAJB 3A12A 3W7BA 3M05A 3OTEA 3RRGA 1QAJA 2VG7A 1C4CA 2V67A 2MHEA 2WCXA 4KHMA 5B7WA 1S49A 4Y2IA 3KK3B 3TA0A 3GYNA 3HHLB 2AJ0A 5BJRA 2YQ1A 4OMFG 3TZYA 4M5MA 5KFKA 3M6WA 1ZTTA 4ZPWR 2Y1RI 1TFYA 2BABA 3SV4A 4KKOA 4CLWA 2V8DA 3V4MA 2HVHA 3K5OA 5F8HA 2CJYB 4DFJA 1RHRB 1N5SA 4B3OB 1ZZNA 2J7WA 4CO0A 5HMXA 3GYGA 4OLPA 4DUYF 3DOLB 4TY9A 1QSLA 2GFFA 5D0EA 4Y3CA 2J8AA 3CJKB 1RWMB 1RU2A 1NZAA 4DPXA 5IQ6A 1U1OA 1AZSB 4C8LA 3BGLA 3IRXB 2IM3A 4MTPA 3PX0A 1LNQA 3M9OB 1W2BR 4OYZA 1NM2A 2OSRA 4QWDA 3AOBA 1JJCB 2GZOA 3QZ7A 1HHSA 2UUAJ 3HK2A 4NEZA 2CDRB 2GHWA 2YQ3A 1RTJA 3FFIB 2R8KA 2X3GA 7FD1A 1RT3A 4DPOA 2P8IA 3EGZA 3EZOA 4ZVTB 3RUBL 1CBKA 4JI4J 2ALZA 2FY8A 3NWGA 4H4MB 4ZP9A 4TQRA 3J7Z5 1FO1A 4DV1J 4I7FB 3GTYX 1L3VA 4LIRA 4F2RA 1MU2B 2X7IA 2V63A 3W2VB 5JVHQ 5KFVA 2QL7B 2KVQE 5IM0B 4RNOA 3TAQA 1U8SA 3TAMA 3OV7A 4UY8T 5DRKA 4UUXA 3PO5A 1HNIA 1VQOS 3ZZ0A 3MEDB 1WOOA 1WSRA 2XYHB 1VHIA 2G9OA 4C7QA 3QSIA 4QR2A 3BGUA 1DTQB 1VS3A 1N56A 1WEYA 4OI1A 1BWEA 3RZAA 1SQGA 2YKQA 1NMEB 2E5GA 2GJ2A 3LH2S 5C5JA 3M1VA 4A8WA 3CTRA 1QTMA 4HTIA 1HD0A 4YR2A 4I0WA 1Z1ZA 3TVZA 3NGSA 2MQOA 2EWHA 3TZWA 1WUUA 2BE2B 3T1YJ 3LWLA 5J2QB 4NX9A 4NZ0A 1WKLA 1W25A 4O3QA 5AT1B 2DEIA 1OQ6A 4F3MA 1S0VA 3TUZC 3G96A 3MAQA 1XQIA 1OY8A 1S6UA 1U0HB 4N47A 3O3LA 1IWGA 2RT3A 2PN6A 3J7AN 2ZEJA 3QIPA 4B9SA 2PA3A 5I4MA 2W2MP 1TL4A 2H5IB 5HMWA 4Y34A 1ZPVA 3D1HA 2GO9A 2QO3A 4NCGA 4F4AA 1WEZA 3V6DB 1VQYA 3KNAA 1L3SA 3IR5B 4K4VA 3GZ7A 4X4OA 4M5IA 1WTBA 1UZHA 3KK2A 3M6XA 1B64A 1ZETA 4C8NA 1Y3KA 1Q4RA 4W90B 4PRFA 2W8KA 6AT1B 2HHSA 2OH2A 2VFSA 5EX0A 5EWFA 3F41A 1JWWA 4F25A 5JXSA 1HMVB 1CSJA 5KT6A 4GO7X 2WHOA 3DHXA 4IOAQ 5I3PA 4OX6A 1WEXA 4DFPA 1XNRJ 3QNWB 4RW7B 4IG0B 1XK8A 4OX7A 1RAAB 3AXKA 2R8IA 3FVYA 2C2DA 1PIEA 3SV3A 3PXGa 3ENQA 1WDDA 1WNEA 1XN9A 3FDSA 3Q0AA 4B9TA 4YS2A 1RE1B 2UUCJ 1OIAA 1RLCL 2IY5B 4RW8B 3A3NB 3M32B 1Q95G 5CYJA 4FP9A 3DMJB 1ZA1B 3DGVA 4OJ3A 4WP3A 3X3UA 4G1PA 1GEHA 1RT4A 4J9OA 5KFDA 3MM8A 4YY3J 3L7UA 4MK8A 4MKBA 1HI1A 1RA7A 1OY6A 2EK6A 2R4FA 3MCSA 2DNYA 4QZVB 4CO3A 5KG3A 3R5DA 1GXUA 3PW4A 4Y65A 1FVQA 4RW4B 1F3FA 2WSEC 1B70B 5HI7A 3SSQA 2YWHA 2W4CA 3FZ2A 2JNJA 2QL9B 3DOKB 2J5AA 2ZBCA 4XIUA 4XAKA 2QSFA 3GV8B 4DCJB 3Q22A 4EU0A 1FTRA 2B5JA 4DPYA 2DO4A 3JTNA 3N79A 2D3UA 3OQ2A 3D1QA 7AT1B 1NH7A 2IM2A 1KOOA 4N7TA 1NJWA 4I6AA 1X8DA 3OTCA 1SC4B 3C6TB 2GQCA 1BLUA 5HBMA 1UVKA 3GPAA 2FJVA 2DGOA 4NA1A 4I2PB 4NLUA 5FD1A 3KLEA 1VR6A 3M2VA 2OJ3A 3GCWP 3HI9A 1RQ0A 3W62A 2HQGA 2NLWA 2QZ8A 4G1IA 4UQTA 4WK1A 3TNVA 2HLUA 3FBBA 1T03A 3G82B 4ZVEA 1WOSA 1IM6A 1VRUB 4HH1A 2KT3A 2BJ8A 4C97A 1UEKA 4CM0A 5B0AA 2VQEF 2YXLA 1YTYA 3ZZOA 3MR3A 3PCOB 3BYRA 4YB1P 3THVA 4EI2A 3KHLA 4IG3A 3CW2C 2B6AA 3OUYA 2HZVA 2H48B 1C1BA 4DX5A 4KTQA 1FERA 3ZXWA 1RADB 2VG5A 1L3UA 3GG1A 2HHVA 2AJQA 4J9PA 2O66A 3Q86A 1WELA 3UN3A 1WD6A 1U09A 3UDEA 4LREA 4OZ1A 4HEA9 1D9DA 2MQNA 2XS5A 2B9YA 1YQHA 5BXIA 1VBZA 1Q82T 1BMQB 3CC4S 1S1TB 2VA3A 1WORA 3AJDA 5AXKA 3LF0A 1GK8A 3LOUA 2X1AA 4ZP8A 2M4MA 2DR7A 4H54A 2ZKUA 4AL7A 4DPUA 4GVBB 4E8UA 1U1MA 2LA6A 4JP8A 4OYXA 1R43A 4K5RA 4OYAA 5ETMA 1Q1KA 2E5IA 4YN3B 4LF1A 1HLWA 4WE1A 2RVJA 4BLGA 2KFZA 2CG4A 2MKIA 3JSYA 1X4GA 3KMSA 3M7VA 1S5ZA 2LXIA 4EO8A 5HAOA 4QCLA 1ELOA 2FJWA 1XEZA 3UDVA 3IBFB 4ED2A 2VU5A 3CCTA 1LWCA 3O1LA 3HHKA 3F56A 2VV5A 2KO1A 4B9NA 2QLXA 2X1BA 2XZTB 2R7SA 1M1KT 3VGTA 1BQNA 4FNIA 1U48A 4IQMA 1HYSB 2BRKA 1N4LA 4X4PA 4Q0BA 4KBIA 2JLEA 1E6VB
chains in the Genus database with same CATH topology
4ED1A 2OFHX 3MM9A 1BQMA 2F9JA 3TO8A 4PQAA 1S6OA 4ZLPA 4MFBB 3T6JA 1N0VC 2K1RB 1Z2ZA 2JRSA 1D0EA 3B8HA 2Q6BA 1TFWA 4X65F 1K8AT 4N76A 1U7LA 2HNZB 2CJQA 2M8DB 5D3GB 1SH3A 2R7XA 3MPVA 1BD6A 2ZNZA 4OX9F 3J7YI 4DR1F 2RD5C 2D9PA 5GAHU 3ZZUA 3MEEA 1FK9B 1KONA 2PC6A 1QVGR 1TL1B 1FKPA 5DQGA 3SZ2A 2AJFE 1BQNB 4C3KA 1FNMA 2LDIA 1MROA 3KG1A 2KT5A 4DQRA 2VBYA 3K7RA 4QWBA 4X64F 3CULA 3E01A 3EXCX 3P5TL 2RB7A 2PDAA 2QA2A 2CRLA 4QIWD 1NK9A 1Q81T 1O0PA 3O5TB 5F0WA 4ED8A 1NK5A 3M6VA 2FTRA 2VODA 2WBMA 4Q0BB 3OR1B 2VPXB 2XMKA 3CC2S 5C42A 1DURA 2PT0A 1JLEB 2LVWA 2PI5A 5KFXA 1NHVA 3NBPA 1NU4A 1QAXA 5CCMA 2ZDPA 4YB7A 2R7OA 5L1JA 4ZCIA 1O5JA 2MZSA 3G8SA 5K14A 1S9EA 2OPRA 4EBDA 4FS1A 1BY9A 4ZPDA 1FRMA 2B3TB 2W9AA 2Q1LA 5KFMA 3J7A1 3NG8A 3BF4A 3TAMB 5J2MA 1X5SA 2BJDA 3L3CA 3MEEB 3QLHB 5CYQA 2J9EA 3ISNC 3N01A 2GW8A 2MQPA 3DLGA 2CJ9A 2MKKA 3FRYA 1R6YA 2NYIA 1HNIB 3KNGA 4WIIA 3E01B 1VQ4S 3I5BA 2DCLA 4RU9A 2G0CA 3M30A 2F8MA 3TR5A 2BV3A 2ILZA 3QGHA 3Q23A 4TLRA 4PWUA 4C3MA 1FRIA 5C42B 2DNZA 4Y2KA 2HGLA 2Z2MA 3NBPB 3TA1A 1MWZA 4RNFA 1YJUA 2PI4A 3V81A 3TARA 3HVWA 4N8NA 4IR1A 3CDWA 2RQKA 3MM7A 4BWMA 1QAYA 3IS9A 4MYTA 2DCUB 5L1LA 1XMOF 4FZVA 1U6BA 2P9GA 2YKPA 1WG1A 3LPYA 4KGMA 4PG6A 4CQ1A 3G6ES 3BO2A 3DLKA 2BANA 1O8BA 2EBGA 5J2MB 2WTFA 5CYQB 3PJWA 5KG0A 2QMWA 3V6HA 1HWJA 3D28A 3CT9A 4ZPVR 3MURP 3CB4A 2HG4A 4LFAF 4H4OA 2B51A 1HQUA 4OZ0A 5HL7Q 1FVSA 4TQSA 3KYLA 2R8HA 1U49A 5CXTA 1IKWB 1X4DA 4RX6A 1LXJA 4NXNF 3M1VB 1VLYA 5IFMA 2R7TA 1M90T 1IR0A 5GAEI 2ATLA 1C1CA 1Q86T 1JXLA 5B09A 2Q66A 4JYAF 2MDAA 2HQ3A 4R5PB 4NZ7A 6FD1A 4IH7A 4LQ9A 3NS5A 5T7LA 4JI7F 2FD2A 4DOZA 5B0CA 4MH8A 2ZNYA 3PFOA 2WK4A 1YJTA 1HWKA 1XR6A 3M4XA 2MKJA 1LKZA 2GIRA 3RW7A 3J7YU 3C8YA 2GC8A 2BANB 2GHVC 3V2UC 2ZHBA 5A6WA 1H38A 1RYRA 2HVZA 1X7VA 4X4NA 2D41A 1ZOTA 5AE3A 2DTJA 3KMQA 3OHAA 2DD8S 4G6VB 5HN0A 3PM9A 2KG1A 5D4PA