3MEJA

Crystal structure of putative transcriptional regulator ywtf from bacillus subtilis, northeast structural genomics consortium target sr736
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
273
structure length
251
Chain Sequence
HVSLARGEQSVKRIKEFDPGKDSFSVLLLGIDQARSDANVLVTFNRKEKTAKMLSIPRDAYVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVTVKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTRKSDLLRGQRQMEVLSAIIDKSKSLDTMGQNLKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVYYFKLNQQKLQEVKKELQNDLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target SR736
rcsb
source organism Bacillus subtilis
molecule tags Transcriptional regulator
molecule keywords transcriptional regulator ywtF
total genus 73
structure length 251
sequence length 273
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03816 LytR_cpsA_psr Cell envelope-related transcriptional attenuator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.150 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3mejA02
1.10.260.190 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3mejA01
2XXPA 3PE5A 3TFLA 4DE8A 3QFIA 3TEPA 3OKZA 4DE9A 3NROA 2XXQA 3NXHA 3OWQA 3TELA 4OBMA 3MEJA
chains in the Genus database with same CATH superfamily
5DSXA 4GHJA 2H8RA 3GZDA 3OWQA 3UFDA 3FYMA 2LYKA 1ADRA 3QQ6A 2B5AA 3NROA 1E3OC 4MCXA 3GN5B 2ICTA 2KEJA 2EBYA 3GN5A 3TRBA 1NEQA 2O38A 2R1JL 2IU7A 1ZZ9A 2EWTA 2HINA 2MEZA 3LFPA 3JXDL 2R63A 1ZS4A 1B0NA 3SR4A 1ZZ6A 3OQMA 1LMB3 2FFHA 1RZRA 5JUWA 1X57A 1DULA 3PXPA 3NDBB 3FYAA 4Q2JA 5DTQA 2GZUA 3OP9A 1ZZCA 2PXFA 2PXQA 2FJRA 3PE5A 4DE8A 4X4DA 3QOWA 2HSGA 2HCSA 4YBAA 4WVLA 1WIZA 4FN3A 2JCGA 1QP0A 1UXCA 2BNMA 1ZZ8A 4PU4C 2CROA 2PPXA 3UWPA 1ZUGA 2AXVA 2PUCA 3BS3A 4ER5A 1LLIA 3TFLA 1OSLA 3A9YA 3A9ZA 4ER3A 4Z5HA 3CLCA 2AUWA 3OQNA 3G0TA 2PUGA 4IVZA 2XXAA 2LYSA 1EFAA 5DRTA 1JFSA 3GBFA 3QWGA 2J7UA 3D1NI 2IUOA 3JXCL 1HQ1A 1O4XA 2IVQA 4Z5CA 1VPWA 4Y42A 1JH9A 2D5VA 4X4EA 1GT0C 2HCNA 4X4IA 2WUSR 3NXHA 4ER0A 2O49A 2LNMA 4I6RA 3BDNA 2MQKA 3GZDC 2M4HA 3OMTA 1BDHA 1LCCA 1IC8A 1ZAYA 1UTXA 3R1FA 4EZIA 3OQOA 1R69A 4EQZA 1PNRA 1QQAA 2AW6A 2L1PA 5DT2A 5GAHi 4YG1A 4I6UA 2AWIA 2PXUA 3ZPXA 1RZRD 3GZCA 1PRVA 1JWLA 1AU7A 5DTRA 4DE9A 4X4BA 3DM5A 3EUSA 1QP7A 2PUAA 2PXVA 4PU3C 2LYRA 2PXKA 3A9XA 2VEOA 3O9XA 3CECA 4OBMA 1X2LA 1ZPQA 2XJ3A 1DW9A 1HF0A 3TEPA 1DWKA 3ME5A 2PUEA 2OR1L 2BNOA 1Y9QA 2KPJA 2O4AA 5K98B 2LLWA 3TELA 1QB2A 2LYPA 1POUA 4X4HA 2AXZA 3KZ3A 3ZHMA 3H5TA 1QQBA 1RIOA 2PUBA 3MEJA 3M9LA 2LYQA 4EKIA 1L1MA 1LCDA 3F51A 3QF3A 2XIUA 2IVGA 2EF8A 2OFYA 2PXTA 4Z59A 1JFTA 2KEIA 4OB4A 3S8QA 1QP4A 4X4FA 1CQTA 3QFIA 1ZVVA 1ZZ7A 1CJGA 2LCVA 3KXAA 4NDWA 1LQCA 2XCJA 4F8DA 3VK0A 4YG7B 1QZXA 1BDIA 1SQ8A 2JVLA 2YBDA 3OKZA 3F52A 1Y7YA 2KZ8A 2HFZA 2BJCA 3SCFA 1PRUA 3ZKCA 3SCHA 2A6CA 3MLFA 1MFQC 1WH6A 4ER6A 3LISA 2PXDA 3KL4A 1QPZA 4Z5DA 5A7LA 4O8BA 2ICPA 4J1WA 3RZZA 2KEKA 1S7EA 1WH8A 4PU7A 4JCYA 3BD1A 4MCTA 1RZSA 3JXBC 2XXPA 4JCXA 2GRLA 2PIJA 1NW3A 3DNVB 2WIUB 3F6WA 1UXDA 2PXBA 2XI8A 2PXLA 3QYXA 4I6TA 3IVPA 4IWRA 4YG4A 4J1XA 3FMYA 3G7DA 2V3CC 3NZLA 3HZIB 2PE5A 3KJXA 2PXEA 2LYJA 2JQEA 2GRMA 3U3WA 2PUDA 2MXDA 3R09A 1WETA 3QOXA 4IA8A 4YARA 2IVBA 1PRAA 2AXUA 2XSDC 2PXPA 5DRYA 2LYLA 5GAGi 2PUFA 4JQDA 2IV1A 2ODRD 3GUUA 2XXQA 2LLVA 1YSEA 4FBIA 4Z58A 3SX0A 2CSFA 4EKGA 2BNNA 1PERL 3B7HA 3ZHIA 3SCGA 3CROL 5DTMA 1RPEL 4ER7A 4EK9A 2J7WA 1OCTC 1R63A 3LQXA 4X4CA 3VWSA 1XWRA 4HRAA 2L8NA 2L49A 1ZZBA 1NERA 4PU8A 4GQMA 3G5GA 4X4GA 1U2ZA 3L1PA 4I8TA
chains in the Genus database with same CATH topology
1NW3A 5DT2A 3A9XA 2VEOA 2HCNA 2YBDA 3OKZA 4Q2JA 5DSXA 4ER7A 3GZDA 3NXHA 3OWQA 5DTQA 4EK9A 2J7WA 4ER0A 5DRTA 2LNMA 5DRYA 2HFZA 4OBMA 3UWPA 3GZDC 2M4HA 2J7UA 3NROA 3ZPXA 3VWSA 3GZCA 2ODRD 3GUUA 5DTRA 3MEJA 4HRAA 4DE9A 3M9LA 3PE5A 3SR4A 4ER5A 4DE8A 3QFIA 3TEPA 4EKIA 2XXQA 2LLVA 3ME5A 4EZIA 3QOWA 3SX0A 4EKGA 4ER6A 2MXDA 2XXPA 3R09A 3TFLA 2HCSA 3A9YA 3G0TA 3A9ZA 3QOXA 5JUWA 4ER3A 4EQZA 5DTMA 4WVLA 1U2ZA 2LLWA 3TELA 2L1PA 3NZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXP A;  3PE5 A;  3TFL A;  4DE8 A;  3QFI A;  3TEP A;  3OKZ A;  4DE9 A;  3NRO A;  2XXQ A;  3NXH A;  3OWQ A;  3TEL A;  4OBM A;  3MEJ A; 
#chains in the Genus database with same CATH topology
 5DSX A;  4GHJ A;  2H8R A;  3GZD A;  3OWQ A;  3UFD A;  3FYM A;  2LYK A;  1ADR A;  3QQ6 A;  2B5A A;  3NRO A;  1E3O C;  4MCX A;  3GN5 B;  2ICT A;  2KEJ A;  2EBY A;  3GN5 A;  3TRB A;  1NEQ A;  2O38 A;  2R1J L;  2IU7 A;  1ZZ9 A;  2EWT A;  2HIN A;  2MEZ A;  3LFP A;  3JXD L;  2R63 A;  1ZS4 A;  1B0N A;  3SR4 A;  1ZZ6 A;  3OQM A;  1LMB 3;  2FFH A;  1RZR A;  5JUW A;  1X57 A;  1DUL A;  3PXP A;  3NDB B;  3FYA A;  4Q2J A;  5DTQ A;  2GZU A;  3OP9 A;  1ZZC A;  2PXF A;  2PXQ A;  2FJR A;  3PE5 A;  4DE8 A;  4X4D A;  3QOW A;  2HSG A;  2HCS A;  4YBA A;  4WVL A;  1WIZ A;  4FN3 A;  2JCG A;  1QP0 A;  1UXC A;  2BNM A;  1ZZ8 A;  4PU4 C;  2CRO A;  2PPX A;  3UWP A;  1ZUG A;  2AXV A;  2PUC A;  3BS3 A;  4ER5 A;  1LLI A;  3TFL A;  1OSL A;  3A9Y A;  3A9Z A;  4ER3 A;  4Z5H A;  3CLC A;  2AUW A;  3OQN A;  3G0T A;  2PUG A;  4IVZ A;  2XXA A;  2LYS A;  1EFA A;  5DRT A;  1JFS A;  3GBF A;  3QWG A;  2J7U A;  3D1N I;  2IUO A;  3JXC L;  1HQ1 A;  1O4X A;  2IVQ A;  4Z5C A;  1VPW A;  4Y42 A;  1JH9 A;  2D5V A;  4X4E A;  1GT0 C;  2HCN A;  4X4I A;  2WUS R;  3NXH A;  4ER0 A;  2O49 A;  2LNM A;  4I6R A;  3BDN A;  2MQK A;  3GZD C;  2M4H A;  3OMT A;  1BDH A;  1LCC A;  1IC8 A;  1ZAY A;  1UTX A;  3R1F A;  4EZI A;  3OQO A;  1R69 A;  4EQZ A;  1PNR A;  1QQA A;  2AW6 A;  2L1P A;  5DT2 A;  5GAH i;  4YG1 A;  4I6U A;  2AWI A;  2PXU A;  3ZPX A;  1RZR D;  3GZC A;  1PRV A;  1JWL A;  1AU7 A;  5DTR A;  4DE9 A;  4X4B A;  3DM5 A;  3EUS A;  1QP7 A;  2PUA A;  2PXV A;  4PU3 C;  2LYR A;  2PXK A;  3A9X A;  2VEO A;  3O9X A;  3CEC A;  4OBM A;  1X2L A;  1ZPQ A;  2XJ3 A;  1DW9 A;  1HF0 A;  3TEP A;  1DWK A;  3ME5 A;  2PUE A;  2OR1 L;  2BNO A;  1Y9Q A;  2KPJ A;  2O4A A;  5K98 B;  2LLW A;  3TEL A;  1QB2 A;  2LYP A;  1POU A;  4X4H A;  2AXZ A;  3KZ3 A;  3ZHM A;  3H5T A;  1QQB A;  1RIO A;  2PUB A;  3MEJ A;  3M9L A;  2LYQ A;  4EKI A;  1L1M A;  1LCD A;  3F51 A;  3QF3 A;  2XIU A;  2IVG A;  2EF8 A;  2OFY A;  2PXT A;  4Z59 A;  1JFT A;  2KEI A;  4OB4 A;  3S8Q A;  1QP4 A;  4X4F A;  1CQT A;  3QFI A;  1ZVV A;  1ZZ7 A;  1CJG A;  2LCV A;  3KXA A;  4NDW A;  1LQC A;  2XCJ A;  4F8D A;  3VK0 A;  4YG7 B;  1QZX A;  1BDI A;  1SQ8 A;  2JVL A;  2YBD A;  3OKZ A;  3F52 A;  1Y7Y A;  2KZ8 A;  2HFZ A;  2BJC A;  3SCF A;  1PRU A;  3ZKC A;  3SCH A;  2A6C A;  3MLF A;  1MFQ C;  1WH6 A;  4ER6 A;  3LIS A;  2PXD A;  3KL4 A;  1QPZ A;  4Z5D A;  5A7L A;  4O8B A;  2ICP A;  4J1W A;  3RZZ A;  2KEK A;  1S7E A;  1WH8 A;  4PU7 A;  4JCY A;  3BD1 A;  4MCT A;  1RZS A;  3JXB C;  2XXP A;  4JCX A;  2GRL A;  2PIJ A;  1NW3 A;  3DNV B;  2WIU B;  3F6W A;  1UXD A;  2PXB A;  2XI8 A;  2PXL A;  3QYX A;  4I6T A;  3IVP A;  4IWR A;  4YG4 A;  4J1X A;  3FMY A;  3G7D A;  2V3C C;  3NZL A;  3HZI B;  2PE5 A;  3KJX A;  2PXE A;  2LYJ A;  2JQE A;  2GRM A;  3U3W A;  2PUD A;  2MXD A;  3R09 A;  1WET A;  3QOX A;  4IA8 A;  4YAR A;  2IVB A;  1PRA A;  2AXU A;  2XSD C;  2PXP A;  5DRY A;  2LYL A;  5GAG i;  2PUF A;  4JQD A;  2IV1 A;  2ODR D;  3GUU A;  2XXQ A;  2LLV A;  1YSE A;  4FBI A;  4Z58 A;  3SX0 A;  2CSF A;  4EKG A;  2BNN A;  1PER L;  3B7H A;  3ZHI A;  3SCG A;  3CRO L;  5DTM A;  1RPE L;  4ER7 A;  4EK9 A;  2J7W A;  1OCT C;  1R63 A;  3LQX A;  4X4C A;  3VWS A;  1XWR A;  4HRA A;  2L8N A;  2L49 A;  1ZZB A;  1NER A;  4PU8 A;  4GQM A;  3G5G A;  4X4G A;  1U2Z A;  3L1P A;  4I8T A; 
#chains in the Genus database with same CATH homology
 1NW3 A;  5DT2 A;  3A9X A;  2VEO A;  2HCN A;  2YBD A;  3OKZ A;  4Q2J A;  5DSX A;  4ER7 A;  3GZD A;  3NXH A;  3OWQ A;  5DTQ A;  4EK9 A;  2J7W A;  4ER0 A;  5DRT A;  2LNM A;  5DRY A;  2HFZ A;  4OBM A;  3UWP A;  3GZD C;  2M4H A;  2J7U A;  3NRO A;  3ZPX A;  3VWS A;  3GZC A;  2ODR D;  3GUU A;  5DTR A;  3MEJ A;  4HRA A;  4DE9 A;  3M9L A;  3PE5 A;  3SR4 A;  4ER5 A;  4DE8 A;  3QFI A;  3TEP A;  4EKI A;  2XXQ A;  2LLV A;  3ME5 A;  4EZI A;  3QOW A;  3SX0 A;  4EKG A;  4ER6 A;  2MXD A;  2XXP A;  3R09 A;  3TFL A;  2HCS A;  3A9Y A;  3G0T A;  3A9Z A;  3QOX A;  5JUW A;  4ER3 A;  4EQZ A;  5DTM A;  4WVL A;  1U2Z A;  2LLW A;  3TEL A;  2L1P A;  3NZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...