3MELA

Crystal structure of thiamin pyrophosphokinase family protein from enterococcus faecalis, northeast structural genomics consortium target efr150
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
213
structure length
213
Chain Sequence
SRVLLVAGGNPSDWPTIEPATYDYFVGIDRGCLHLLEADLPLQLAVGDFDSLSREEYHFVQETTETLIQAPAEKDDTDTQLALQEALQRFPQAEMTIIGATGGRIDHLLANLWLPFEPRFQGVLRQIRLCDRQNSIQYYAPGSYIVPKEPDKEYLAYCCLTPVENLTLRRSKYLLTNQDVPYPTSYASNEFIEEAAAFSFDAGMIAVIQSKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamin pyrophosphokinase family protein
publication title Northeast Structural Genomics Consortium Target EfR150
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 54
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04263 TPK_catalytic Thiamin pyrophosphokinase, catalytic domain
A PF04265 TPK_B1_binding Thiamin pyrophosphokinase, vitamin B1 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Thiamin pyrophosphokinase, catalytic domain 3melA00
2G9ZA 2OMKA 2HH9A 3K94A 3MELA 3S4YA 2F17A 3IHKA 1IG3A 1IG0A 3CQ9A 3LM8A 3L8MA
chains in the Genus database with same CATH superfamily
3X1JA 4CU2A 2G7ZA 2XTZA 3OT1A 4URUR 4OMUA 5DBGA 2IV3A 5CDGA 2DWUA 2RGYA 1NMXA 4LXUA 1QYRA 2HDHA 3LOUA 1RM0A 1I9CA 3ASZA 5KVQA 3U49A 3UM9A 4BDSA 4JROA 2VXYA 3R7AA 4UU1A 3NM4A 3R3XA 1M2FA 2REQA 2YJ6A 2RKBA 2WB4A 3DONA 2ZSKA 3Q0TA 2QG6A 1G8PA 4FOOA 5DNUA 1MNQA 1JG7A 3R7BA 1MOZA 1EVKA 1GO2A 2ZTMA 1JAXA 3DZFA 2A0FA 4O5OA 1YI1A 4OHRA 5EWMA 1QHHA 3ROTA 3UA3A 4HDNB 3MD9A 4CBVA 5HZGA 4GDFA 2HMVA 4JITA 4HQNA 1Q84A 2X8JB 4TMKA 2PRSA 1I9GA 4GBED 4XKJA 3T4EA 4URZR 4RQTA 5C8ZA 3VJLA 4ENTA 3L5KA 2PV0A 4L1KA 2C5FA 4DBVO 1L7OA 2ZRMA 1L7PA 1K5PA 3HH8A 4ZGGA 5LVAA 1J0XO 3H42B 1KTVA 4DA7A 3OE7D 2HNAA 3BCHA 1VQ1A 2FX3A 2W6PA 3WLRA 3EVNA 2JGKA 4GI5A 3VZCA 1XZFA 2A0YA 3FCEA 3L6CA 2TMYA 4HDOB 1DARA 1IE3A 3LC7O 4MWCA 5FF9A 5TVGA 3HUUA 2ZJYA 4ZT6A 2GEUA 3BXGA 2YMPA 2FUG1 4PSVA 2ORWA 3DEHA 1WZIA 4RPGA 4EKNB 3GJ8A 5KQLA 2WHYA 3DEKA 3IBGA 4UCQA 3WMWA 4QM7A 1TZKA 5CXUA 3ZZ1A 1YRBA 4C2UA 2VRCD 1WP4A 4X1YB 2Z5GA 1M2OA 1VG0B 2XWPA 1L4GA 2C2BA 4JP8A 5AI4A 5HUHA 5F52A 2VXBA 4FP9A 1QGED 3JU3A 5CH5A 3PPVA 1WMDA 4EHLA 2QN1A 5CLQA 4BLUA 3T61A 1C8KA 4YJFA 3K6SB 2V5VA 2W2KA 4KNVA 2DPMA 4KXUA 2C03A 4WKNA 3ESQA 2V7XA 3ROXA 3SJBA 1RCTE 4YI3A 1E4EA 1P0QA 4KQJA 4NBUA 3HWSA 3R6LA 5GQSA 1T26A 5HF9A 3NHZA 4E03A 2AVNA 2XZDA 2ZJ0A 4EM6A 1UAGA 1ZNXA 1PWYE 4FMDB 5HQJA 4A2CA 3QVGB 5FLEX 4B8YA 4JODA 3PNYA 1QGUA 3PI6A 4P4NA 4E7PA 5A0VA 2W90A 1AS0A 1QIDA 4QUGA 4QEDA 3HXQA 2OWDA 1XCLA 2CV0A 4XWGA 1TVKB 3QYAA 1N6LA 4I4LA 4U3JA 4AYWA 2NO4A 4DLKA 3EFHA 1S01A 3MOSA 2BEJA 3W9BA 1LSOA 1M8GA 5HR5A 2V7TA 1I24A 4OH1A 3BXXA 3CKYA 2JAWA 2WZCA 3QWHA 4EG5A 3KAJA 2RJOA 2C2YA 1TTPB 1TVMA 1AUVA 4CLEA 2FJPA 3AJAA 5E1MA 1ZUIA 3IBYA 4L5JA 4G63A 3DM9B 4KLNA 2GFIA 2Y76A 3W7AA 2PG3A 3NB0A 2V59A 4HTFA 4MV1A 4P4GA 5ICFA 3FNHA 4YXWA 4BNTA 1ZK2A 3K1YA 3IAS6 3REOA 3M4ZA 4GX2A 4AURA 4F0JA 5CLJA 1LK7A 4JYPA 1YJBA 5FNVB 3FFBA 1EDEA 4KP7A 3WYBA 2C83A 1L7XA 4DV7B 2FZLA 1TZBA 3NCHA 2XTMA 4BB5A 2ZE6A 1FP6A 3M5CA 3Q98A 4TL9A 3RHFA 3WBFA 1SCNE 4HWRA 4JI1B 4MW0A 3TPFA 5F7JA 2AF3C 5EY5B 1GRNA 3CLKA 3E9DA 1Z4NA 2Z6VA 4NNJA 4U3JB 3RWOA 4L16A 5ALSA 4F92B 1BYUA 2FW1A 4TTVA 4X41A 4W5WA 2D7DA 1M66A 2A0UA 1J0CA 2SKDA 1A2KC 1LPMA 1G6HA 3Q2OA 4HO1X 1WIWA 4FSHA 1XWIA 4C1NA 2JAXA 4IVRA 3PXGA 1RP1A 3ADDA 3I1FA 2OO7A 2MR6A 1YJQA 3A1EA 1V4BA 3G9XA 4ZARA 1RYNA 4LXTA 1PHRA 1HDZA 4NZNA 3GFVA 3MLBA 2ZIVB 4Q21A 4OXQA 1XN1A 4KUEA 2UZIR 1E5VA 5HQ3B 2IS1A 3FSGA 1J49A 4M0MA 5K0NA 3X1XA 4UXIA 4BGIA 5CFNA 5IU6A 3AL0C 1CE8A 3HZRA 1L7BA 2FSVA 3PC7A 3AFIA 4YAWA 3HM2A 1ZP6A 3ABZA 2NM0A 3RS3A 4C2BA 4DSOA 3CUUA 3USZA 3IP9A 3HA3A 4IO1A 3UY4A 1ZN2A 2C77A 5JWOA 4BXOA 2H65A 1T25A 1DIRA 3EULA 3MAJA 3O74A 5T5QA 3K0BA 4MMYB 4DLPA 2QK4A 4Z2AA 3VNRA 5CA1B 3CNLA 4RU1A 3RRMA 3P96A 5L3QA 1K6MA 1PYOA 1D4ZA 4JLWA 3IBTA 2NU6B 2P35A 1ZOOA 3F78A 4OYLA 2PYIA 1G9TA 2WYOA 1Z0DA 4KQCA 4ZCPA 4G89A 4NPCA 5BMVF 1M3SA 2PO7A 4I4TB 1L5VA 1O95D 2H31A 4NONA 3K9BA 1Q7GA 4PRYA 2WB2A 4OY3A 3F7OA 1KKLA 5LZ5A 3TJMA 1Q92A 3TBHA 1EG2A 3CRNA 3ML1A 4ZGBA 4E7OA 3CFYA 3SQMA 4LJ9A 3LZDA 2WYVA 5BNFA 1YZQA 3HP7A 2HWUA 3FM9A 4IXWA 4X6LA 5U4QA 3DDWA 1RBZA 2PQMA 2QTRA 1FQOA 2VPPA 2XWJI 2IP4A 2OLJA 2I8LA 2WKPA 3HJGA 4GWKA 4PYKA 3PXDA 1GGEA 4XM0A 1I3LA 1HDEA 2IEBA 3NP7A 2WWIA 2ZIGA 1B15A 1Z7GA 4NSNA 4DRZA 4PN7A 1E1KA 4GC5A 4U2CA 4YGXB 1OTHA 3DCIA 2N75A 2A6PA 3ENQA 3N8NA 1VL2A 3LHDA 3QBEA 1CUCA 2NXWA 4HD8A 2VP2A 3R40A 3TNYA 4ZCTA 5FWNA 2RH8A 2XEDA 3LXUX 4UMDA 2I65A 3B12A 1UOOA 4MVWA 3FWYA 5CJ2A 3FRIA 1VIMA 2VWGA 1OWNA 3F6BX 1XLTA 3FRJA 2K2WA 1K6JA 4KI0A 1YDEA 3P8ZA 5A5FA 4BASA 4D2IA 3L6RA 2IXFA 4L8YA 5EHNA 5JCZA 5KX5A 1H3EA 5KEIA 3EEYA 3TN7A 3TQOA 2VI5A 3C3YA 3LXXA 4BWFB 3ZCUA 2P30A 3CN7A 4TV9A 1MIOA 3DHEA 4C0XA 1NQTA 5CNJA 1UBCA 2R11A 1GT91 1PVOA 4DRYA 1M1NA 4RJLA 3F5SA 1K8ZB 4P4TA 5BSWA 1JE1A 3NH9A 2OYSA 2B3DA 2XD9A 5ITZB 3PEWA 3JR3A 3RQSA 5LZ2A 1T4GA 1XMVA 2JJ8A 3VHLB 4AO8A 3DC2A 1Y1SA 3L0ZA 3NG1A 2BI7A 1XNQB 2PFKA 1SD5A 3E9RA 3TLMA 3ZWBA 3DDCA 5FBQB 4AKEA 4IMJB 1EA7A 4HMPA 4JBNA 2RONA 4AY2A 4NMMA 1NMYA 2H4FA 4O4IF 3OEWA 1Q0HA 3NYIA 1KAMA 4C4AA 5C7IO 4LY9A 3RT9A 3EW7A 2BTEA 3IA7A 3DFMA 3LA6A 4QGBA 1D0IA 4P3OA 1BD4A 4II3A 4NBVA 4MYDA 5KHLB 2IW1A 5KX5B 1MXFA 2ZVDA 3S27A 4XYEA 1AKNA 1LBTA 4D4IA 5T8KA 3LC1O 1V8ZA 4N65A 2HHHB 5D84A 2C9YA 1N2GA 3FLAA 3W5CA 1VMKA 2WE8A 4IGFA 2CSXA 4C4OA 4AJ4A 5B3JC 1FX0A 2XCOA 4QJIA 1LU9A 4CKCA 2ACKA 3I6IA 3I73A 3CX3A 2JGDA 5LYYA 1SR8A 1GGFA 1NONA 2GZMA 3AQ4A 3VPDA 4GE0A 3WNVA 2CFIA 2NVUA 3N2GA 4F4IA 5KKNB 1M74A 2VBIA 1FDUA 3SKYA 4EVSA 2BJHA 7ABPA 1R0WA 1DCMA 3DEYX 3R0ZA 4FGSA 5LYJA 3FWPA 2IP2A 4R84A 4JNKA 4W4TA 2P2NA 4JI7B 1KI8A 4YDQA 5IT5A 3K94A 3EHDA 5IDVA 3LBIA 2Z4RA 2M32A 3OIYA 1NPDA 2IEYA 4KFSA 3ZHUA 2PUFA 5KOJA 2DJ5A 2C0QA 4R1SA 3OOWA 2MSNA 4M9XA 3K9CA 4NE9A 1X0VA 2QYOA 3UAGA 4C3VA 1XJQA 4FE7A 4ZGWA 3EX7C 2YJTD 4R3NA 3WJAA 4G9EA 1HMYA 2JFPA 3G6KA 4JR1A 5AVXA 1XPUA 3KELA 1CX9B 3ORHA 1EB8A 1SKBA 2MMGA 2R8RA 4OXIA 1FY2A 3V2GA 1XTBA 5D5QA 3VU0A 3HVJA 1DZ3A 1E63A 1HETA 1RYDA 1YBFA 2OEPA 3HYRA 3HZOA 3MTJA 5JECA 4RTOA 1SOWA 4KB5A 4P31A 4EFLA 2AH5A 3QX9A 2NVUB 4GKAA 5T4BA 1A8SA 1GAWA 4NHEA 4C07A 4QPPA 5HF6A 2Q3MA 3FLEA 1T1JA 3JVIA 4QG7A 4NCXA 7YASA 3M4YA 1AKTA 1B14A 2G0TA 3A31A 3GJQA 2NSYA 4EJFA 2WQ6A 3F5QA 1V35A 2QAGB 4M0CA 4V38A 5F4ZA 1MZPA 3D2LA 3S2UA 1YZLA 1C0IA 2FKAA 2R87A 3LDFA 4H4CA 3SXJA 3IV7A 4ZCLA 1M7HA 3PQ8A 5DHSA 3NV9A 2CXTA 4R5HA 2VDNB 5KU7A 4PFKA 1N3IA 1W93A 1HA3A 4IDGA 2RHJA 4Q34A 2D62A 4YMLA 3EH2A 5M04A 4CQLA 1KA9H 5EP1A 1XXHE 1YRHA 3ACBA 2Y99A 1OH7A 3F67A 2OVBA 1JLLA 3PR1A 1EGHA 3GJRA 3ESBA 4KIJA 1XMSA 4GNRA 4QUIA 2R85A 4TMVA 5ENDA 4R69A 2GI4A 2LP4Y 1YZKA 4HGQA 4PXAA 3PTLA 2H2HA 1HFJA 3UG7A 3CPEA 2X1HA 4PYOA 4U8GA 2FTKE 1T5HX 2C2WA 2FEKA 5A0TA 1U04A 4QTXA 2R84A 4MKHA 1U7TA 1N33B 5LMUB 2XLCA 1S4QA 1XXHA 2W6OA 5F3DA 3VYTB 4J07A 1XVUA 2IIPA 1RKVA 4J76A 4M9RA 2WD8A 3ZKAA 3QWIA 3C0KA 2BH9A 3ENWA 3O84A 4RA9B 4XUDA 4OQXA 5CJJA 4PG8A 4D25A 3Q3IA 2HGZA 1ABEA 3FN4A 4NENB 3WGQA 4Q1EA 3CV3A 4KVAA 1SH7A 4ATNA 1EYZA 1K98A 5EZYB 2UYYA 3B9PA 3C1TA 5DKFA 2HU7A 2C7OA 1I3NA 1SZDA 2CDNA 3DE5X 4IOLA 4PLCA 4CQLB 2XIQA 2YN2A 5JBIA 2ADMA 1MTOA 3UANA 2PZFA 1CIPA 2H1SA 2UUAB 1XHLA 5BRJA 3ZLVA 3HXLA 3RJTA 2G63A 4JELA 1GUDA 4TKUB 1WXWA 1XVIA 5AI5A 5I7AA 2Q5CA 2NXEA 2NSDA 2AB0A 2I4RA 4QXQA 3T7DA 5JFOA 4MRRA 1DAKA 3RBAA 3JZFA 5TY0A 2QUJA 3BL8A 1X3LA 1QB7A 3P0RA 5DNDA 1OAAA 3TFWA 5C7OO 3A3PA 4IUYA 1L7EA 5ISMA 2CZQA 2GZRA 3QEJA 4MCIA 1AN9A 3K9FC 2Q49A 3H1AA 5CDFA 1ADJA 2R8ZA 1SHKA 4MGZR 2XRYA 3UG6A 3RJMA 2ZRGA 3EUEA 5KDDA 1KO4A 1H85A 2HYIC 1UBEA 3QJ5A 4PSKA 2IPNA 5TDHA 3PHHA 4OBEA 1ACMA 2NUPB 4LBVA 1KO1A 3WG9A 1MR3F 3MJFA 4H6PA 1BD3A 4OOFA 2PPVA 3PNLA 1E0AA 2XT0A 1Y7TA 5TQ0B 1YVUA 1E3WA 4S05A 5K8IA 2WSBA 3ZIUA 1ZICA 1QCYA 2K7FA 1T5OA 4U8HA 3CKLA 4FD2A 4B6RA 5KZMB 1VG8A 2X58A 1ORHA 3LCCA 1QFZA 3SLKA 3PQ3A 1MIHA 3N75A 4AJEA 4AMZA 3ZDBA 2ET6A 2WIFA 2VHVA 2JKVA 4MB0A 3ZH9B 5EWLB 3HCRA 3HPQA 2Q6OA 3OE4A 1GPMA 2J4DA 4FX2A 1A88A 4N01A 4PGAA 5AQEA 4A3SA 1Y1PA 2XOKA 2JPDA 4L07A 4DJFC 5IF3A 1HPLA 1UPCA 1FRZA 3NBUA 1U9YA 3AL2A 3L18A 1A8PA 3AETB 1P2GA 4CM4A 5LP6F 1CUGA 1JEEA 3EEBA 5DHQA 4PG4A 4HEQA 2FSIA 1TYZA 1PR2A 3IT0A 3NR2A 5BORA 1ZM7A 2BMAA 3BIWA 1B26A 2FA9A 3GT7A 4HI0E 5J3JA 1WKVA 3B78A 3FOEC 3ED5A 2QMOA 2NO0A 4YECA 4YV0A 5BNWA 2C88A 3DUFB 4I0WB 4NQZA 2P6NA 4E5VA 4RFLA 5A5VA 2QN2A 3A14A 3ZJVA 2AYYA 3BIXA 3CF0A 2QZSA 4H7DA 2R1TA 2L2QA 3O8BA 2PR2A 3DFKA 1AO0A 3SYKA 1W85A 4FN4A 3G2JA 4N76A 4J2TA 2W71A 1IAVA 4RW0A 2W2MA 3WDLA 4A6EA 4KXNA 4HSEA 3MCWA 5JO0A 2VP6A 1YA8A 2PEYA 1U2GA 4DARA 2C1XA 2W0MA 2WSIA 1UWLA 4LVUA 4D0LB 5KYNA 4JXXA 1GOTA 4P3YA 4A4DA 4GWGA 3PZRA 4FFNA 1FLDA 1SU7A 4JA2A 1FDIA 2YJ4A 3EF0A 2MCFA 4A6PA 3CJRA 3K2EA 1GQFA 1I4WA 4B6GA 1ZH6A 2CVPA 5E6UB 4ZU6X 1G42A 4U7JA 4QQNA 2H6EA 5TQ2B 4B4OA 1P7PA 5F9HA 2IEDA 4ABYA 1F6BA 3AUJB 3SYMA 5H02A 1QGYA 4GUAA 3I6MA 3EE6A 1EZ4A 4BJ1A 3CCBA 1W36D 3H8WA 1JECA 1I1HA 2G1AA 1KE1A 3OBIA 3K2IA 3E3AA 3SHOA 5INTA 4L3VA 4WADA 4EI8A 2Y1XA 2WNSA 1N6KA 1FDOA 1BQ3A 3FJ1A 2D1YA 4NU8X 5BMVB 3RU3A 2C4MA 1PD0A 1W7AA 4MYHA 2XTNA 4XX1A 4K0RA 2SNIE 5DK4A 5CAEA 2B37A 2EFCB 5LD2C 4Y18A 1U8FO 2FFQA 1PL7A 1I3MA 1T2DA 5KQRA 2PX8A 2RAVA 3HFRA 2AJDA 4LKRA 4M0FA 4W8OA 4FSXA 4HYTA 1GUYA 3GAZA 1F4LA 5ICSA 3V1TC 4DIBA 2CV1A 4INZA 1QANA 2CVHA 3MWFA 4FFBA 5HFNA 5KNBH 3Q7SA 3CLTD 4HGOA 1D4AA 4OL0A 3CX8A 4NXMB 3GFOA 4G24A 5JO9A 3TDNA 5BWOA 1AGRA 3BS4A 3WA7A 4DR1B 1RWBA 2GN4A 5H9WA 2Q1TA 3AOEC 3PSHA 3STWA 2QP3A 4YRTA 2AR7A 3AI2A 1NUPA 4UEWA 1B6RA 3EQZA 4CEIB 1CUXA 2ZIWB 1N2OA 5D7BA 1C3OB 4G81A 2I5PO 1FYDA 1G7CA 2OFPA 3Q5GA 3U4MA 3G7UA 4BQOA 2VHYA 4OF4A 4PLGA 4DMHA 3EEQA 5IMSA 1OX4A 3G8BA 2DPGA 3KPYA 3PJFA 3PRJA 3DOUA 4FLMA 2A1TS 5DI3B 3VTAA 4FFDA 2Q6LA 3V8NA 5ALMA 4CM1A 1P91A 1UXKA 4AU1A 5BQFA 2VHQA 4LHYA 1RAGA 3MS2A 4OSPA 2P9BA 4DHEA 4PPGA 1AA6A 1NP7A 1ZH4A 4N7JA 5ESDA 5GM2A 2R8PA 3HTXA 2PUCA 2B4TO 1N92A 1XDBA 1L3IA 5CVDA 2CBXA 3ZZUA 4Z1MA 4ASUD 3E7PA 1KXZA 7GPBA 2J3KA 1P1BA 3H6KA 5EP2A 1XNHA 1RVV1 3IALA 4HH1A 1VHTA 1SZJG 1L8OA 4POAA 1SC6A 2GLUA 1H65A 4US0R 5D87A 3VKUA 1DIGA 3ZPXA 4BQQA 4ZCMA 3R0JA 4G1CA 1CZLA 5F73A 3OU6A 4O4IB 2KI5A 4W5TA 4QTUB 3OX3A 4OLHA 4KQ9A 1YCFA 1SHTX 1ZCBA 1VYTA 2GBIA 1BJKA 2O05A 3IQWA 4IMPA 3SE0A 1YQUA 2VT6A 1H1DA 3TLXA 3K20A 5IBCA 1SKAA 3VR3D 5B1EA 3MCZA 1JWBB 2G88A 1XOIA 4J3NA 3SXUB 5IVKA 2G5TA 5CEFA 3O93A 1RQPA 5I5EA 1U7UA 3CW2A 4JV5B 2YWFA 4GI2A 3VZQA 2XD4A 4KDRA 4R8VA 3BCUA 2E4XA 3QPUA 1M0SA 4AN0A 4WIAA 4DA9A 5KNDD 3WYEA 2BUCA 3L43A 4EB6B 1AGXA 4EY8A 2PE5A 3V6LA 1D9XA 3L05A 3L7OA 4D9EA 3ILHA 4OQPA 1GARA 4C30A 5H83A 4K03A 4N6NA 3W04A 4FOTA 1NM5A 2BCJQ 2I7CA 3Q41A 4S2UA 2ONCA 3RANA 3DZCA 3KPWA 2FR0A 3QKSB 3U48A 2V6FA 5AJZA 4ZVPA 1OXUA 4G1BA 2I1LA 4GKVA 3V8RA 1PG2A 3AM1A 2XCRB 3AVOA 3NETA 2BY4A 4IHJF 1Q0QA 1NDQA 1HE2A 2HA7A 4BNDA 5T41A 4B79A 4Q48A 1EDBA 2IX9A 3I28A 3UO8B 1V71A 1U3CA 2JW5A 3T9BA 4ACBA 1MFZA 4UAUA 4MV6A 3V34A 2G80A 1H6AA 2Z95A 5ILOA 1Q1ZA 2V1XA 3UMRA 4WX2B 1S2LA 4HR7A 1OAKA 4KWHA 5NULA 4EQZA 4P7BA 2GF2A 3F6PA 1OH8A 3O8OB 1R8QA 1KMCA 4N0MA 1U0EA 2Q1SA 1NW9B 4ZMBA 3BA6A 1HFEL 3DOHA 4R1MA 4R1OA 4DIKA 2AC4A 1VPVA 5HJ2A 1NATA 3DMTC 2GVZC 2G9VA 1IWBB 4QARA 4D9IA 2WTXA 4RMJA 2POCA 1JFVA 3UTCA 1D09A 3ZZ0A 2EZTA 4BUJA 3WQRA 5KTPA 3RSSA 2WHRA 2Q2NA 1V8OA 4LV6A 3KQQA 4S1WA 4EY4A 1JEQB 2WAXA 4G1FA 1WL8A 1XTTA 1QTNA 3B1WA 1SBTA 3F9CA 2GNOA 3K09A 1NZFA 3NTVA 4KO8A 4PS1A 1PQ4A 4BNDB 3T1HB 3FF1A 1NBME 1W5BA 2PMDA 4N5HX 3UH1A 3OQ6A 5AW1A 2C8VA 2KMLA 4RZQA 4CR7A 3GLFB 4IUDS 5ERYA 1QH1A 2ZE8A 1YS9A 1Q7TA 2MOKA 4M1SA 5FXMA 5L40A 2HFJA 3BB4A 4V2UA 4XWTA 1OXBB 3DCYA 1JB1A 1FYEA 3OZSA 1ZA2A 1GQSA 2FRDC 5DHFA 1T3ZA 5J5VA 3JQ9C 3RI3A 4Y7CA 2VQEB 1NBMA 4ID3A 1M9NA 2XT9A 1GZ5A 2HJRA 5T7BA 5FLXA 2C0PA 1VMDA 2C9OA 5IULC 2FVYA 4KVFA 3NPMA 2BGGA 1VHWA 1YL5A 2WVHA 4FM9A 2PUDA 2PU7A 2F8TA 3UH0A 2CN1A 5TJ9A 2C4NA 1T1RA 3SS7X 3X1KA 2CYBA 1CRZA 3CF4A 4JWKA 3ELUA 5P8WA 2CXSA 1UR5A 1YL7A 1QC5B 3KFLA 3D5EA 4GD3Q 2O7QA 3IOMA 2P2DA 5FBWB 4CM3A 4UPEA 3KPUA 1DLJA 2XVMA 3EF3A 3ICOA 1M8PA 2Q3EA 3DMDA 1RR6A 4FS3A 3ELYA 4FW8A 1SQGA 2VDWA 2F64A 2XYQA 1UOPA 1AKQA 3N6RA 4P54A 4BNKA 1UFQA 5JU6A 1Q1QA 3QF4A 3PB3A 4IG9A 1B76A 1T9GR 1BHJA 1ZG3A 2J7PA 1KQOA 2QTTA 3FTCA 1I32A 2FQYA 5DN9A 1DAIA 2A0XA 2A0KA 4LVCA 5EXXA 5C35A 3GOQA 1ODLA 1ZJJA 2YXLA 4QICA 4CDMA 4OXXA 3PNMA 2H2IA 2J8ZA 3BGOS 1FPMA 4ARIA 4MV3A 4IYRA 3KXLA 2OILA 5I4CA 2XBLA 1SHLA 2CMHA 3HYTA 3CO0S 3G3EA 2XQGA 4I4NA 3N70A 3GWZA 1KFKB 1ZGBA 2C94A 1JA9A 1J0BA 1BXRA 4OGKA 2ZJ1A 4I6GA 1RHJA 4BWGA 4DABA 5LP6A 1IZ7A 1B8UA 1NAHA 4JLJA 7AT1A 1ISGA 5MN5A 3HDTA 4CKXA 3VC1A 2JI6A 4G56A 1Z26A 2EGGA 2AZDA 1KI7A 3AUTA 4ROSA 4CR6A 4LHSA 3JARA 3RIHA 3IKJA 1VSUA 1DHRA 2WFLA 4Y98A 3NORA 5KWEA 3MJCA 1JAHA 3C8UA 4AJLA 1ZFNA 5C31A 1WKBA 4L95C 1AOXA 2PKXA 3PNBA 1J70A 2OQVA 2V0GA 1PS9A 1SU4A 3L8CA 2XB9A 3OFKA 3B1JA 5BN3A 4DNFA 3O38A 1OLXB 3NRCA 1SVWA 4D74A 2KBFA 2RD2A 2WKWA 1NXXA 4MSUA 3S99A 4HFRA 1KPIA 4TRNA 2YC4C 3GPLA 3CVYA 3VOTA 1RU3A 3OEEA 2Q7OE 3S68A 1ZGAA 1Z75A 3ROQA 2QQEA 4BO0A 3RYCB 5IF9A 2Y2UA 2AK2A 4UUNA 4BFTA 1F06A 5JDIA 1P31A 3KM0A 5LP6B 3W3AA 2PSSA 4YC7A 2VAPA 5AM5A 2VBGA 2CHGA 3QVOA 1E92A 3O94A 3U7HB 4URXR 1LQTA 4DGSA 4ZVVA 1TU3A 3WOVA 1WKCA 2COUA 2PL3A 3V9PA 2XLBA 3Q15C 5GZ3A 4C0LA 3KT3A 2E9SA 1H23A 1KMHB 4A0GA 3DVQX 4EG8A 3U4AA 5HPYB 1C9NA 2R6HA 2BGLA 4RDCA 3ESXA 5TE9A 1VI2A 4KGXA 4IHQA 4YN3A 3AKCA 3UNXA 5A4KA 3AF3A 4B3FX 4U7DA 2FP4B 1OU4A 1GDTA 3CTMA 3KHUA 3L7BA 4NL4H 3CRRA 2O5EA 2ACVA 2B4KA 3Q3VA 3WHLA 4ARUA 3SF0A 2CXQA 1THMA 2QLNA 1SUCA 4GRIA 1FXWF 2OUIA 3M49A 1BRTA 2G9ZA 2H00A 1ZUNA 2JGMA 5HUJA 3U7EB 1UIRA 2X9VA 4G23A 1IHDA 1EGQA 1DO2A 1W1UA 1XYVA 5FWAA 2OAEA 1W2WB 1VHDA 1A7JA 1MRZA 3KZOA 2IJGX 2W58A 1EXVA 3PDJA 3LPCA 3G02A 4ZO6A 1U63A 4M0DA 1QU2A 5KHAA 1L4FA 3HGTA 2BGKA 1SXJE 5HILA 4P83A 3O8QA 3USES 3DDZX 1HYHA 3RV3A 2BTQA 2CMGA 1KY3A 3B9BA 4M8NE 2YBDA 1T8YA 4GEGA 1KYTA 3TXYA 1F5NA 5DTEA 3UMYA 1ZESA 2BH2A 1JFFA 3T1QA 1YL6A 5KSYA 2EFHB 3L49A 3NHBA 1U9CA 4D3YA 2YMLA 2ZS8A 4XAQA 4ENQA 4B48A 3OSUA 5IZCA 5LQKA 3OCJA 3HI4A 3BE5A 4BO7A 4B32A 3VH3A 3E9NA 4CYMA 3IKTA 2JEYA 4QOFA 3RASA 2QZ9A 1SO8A 5AHRA 4X1KB 1YZ3A 4FFOA 2FWIA 3CH5A 3S40A 1AKVA 2JG3A 3NBXX 1BKSB 1H1LB 2C1EA 4XUCA 4MW1A 3KKNA 3UWKA 4IZIA 1TQ8A 1U3VA 4P5PA 3W6UA 5I48A 2NU9A 1DNPA 2IE0A 1VFNA 1FU8A 2SKCA 4RIIA 1CS0A 2ZRCA 4ZI3A 3FOZA 2G5GX 1NDHA 1KDRA 1V4VA 4C5BA 5DCLA 4AO7A 1B8VA 4V1CI 2CCGA 2C2XA 2XCLA 1PRYA 1OCEA 4UHFA 1E5QA 2PZMA 4OLJA 5KYXA 3OM1A 2E6UX 1G4HA 5EIWA 1NBAA 1EHCA 1RBMA 1P0PA 2C31A 2ENWA 4GGMX 3FPJA 4OQMA 3SZOA 4D9HA 3C3KA 1K6IA 1G5PA 3K0CC 1D6JA 4OX9B 3HU5A 4C03A 5JYDA 4EDFA 2DHEA 1SXJB 2AUTA 4AW9A 3EY9A 4Z9YA 4R7ZA 1IG3A 3HSYA 3BAZA 4WE3A 3EEOA 4S1NA 1WQ3A 4KKXB 1WP9A 4ZVQA 5JASA 1V1MA 4RHEA 5B7PA 2ZRNA 3D6HA 2CLLB 2PGIA 1XA3A 3JQCA 1DU4A 3OY7A 1V11A 1DV2A 3EF1A 4JLPA 1E2BA 1UK8A 3OAAA 3QEMB 4IH9A 2QTWB 5CFMA 1M1ZA 2WZQA 4PZDA 3PC2A 4DIOA 1FSFA 3BMQB 1LGYA 1Y33E 5ICEA 3HM9A 3OKPA 2QLFA 2QWXA 4YRRA 3RG2A 2BEUB 3T7AA 3FTQA 2QRJA 3ZIDA 1PNVA 1CUZA 4EY7A 1Q50A 2ZT6A 2O2CA 3FVRA 4HQ0A 3RYIA 1P0FA 2J3LA 3DOJA 4V0NA 2P27A 4DLAA 3WLMA 1AQLA 3U16A 5HVNA 1E9BA 2R8OA 3QPVA 4WN9A 3TD9A 2ATVA 3PV0A 4JP2A 5G2OA 4BVKA 4BZWA 4IMRA 3OJFA 3TAHA 4CF3A 4YRNA 2P3SA 4LJ5A 2X19A 1P7VA 4UBOA 3E6AA 2W8BB 4YMSA 1LKZA 1ENPA 1W2GA 2L0XA 2XYVA 5EC8A 2P8SA 3OI7A 4Z4QA 1NLUA 4MYSA 5EP3A 1OB5A 1IHYA 1XMJA 4U02A 3KOUA 2O0HA 1KAHA 4H59A 4MI9A 4IHJA 3GRUA 1TO6A 4H3KB 4J3FA 1CF2O 4FLFA 4FOSA 4BNHA 3H04A 2JLWA 2OG2A 3NGLA 1E1CA 3E3LA 2TMGA 3LWNA 1LFDB 1EWKA 4LZLA 2E4ZA 4D9BA 4BGDA 3DYBA 2BM1A 1T0UA 1Y34E 1Z8NA 3PC6A 2GYWA 3LUPA 1OI2A 4D4KA 3CA8A 1Q0TA 2J3IA 1WPXA 1QHFA 2VO1A 4OM8A 1EFPA 3KQOA 4JB3A 3QLVC 2XMCA 4U2DA 5JCXA 4QHTA 4IP0A 4ZRMA 1TA4A 2YXPX 1S6YA 3FIUA 3Q9SA 3SFTA 2AQIA 2C00A 1RHMA 1JHYA 2Q3FA 4DADA 1XVTA 3PD7A 4ZP1A 2Q9UA 3VFDA 3ZWCA 2GK6A 1CD5A 1PYGA 1VSTA 4R7GA 1RWPA 1JYFA 2AE1A 1F12A 2ECOA 3FPBA 3W5AA 4ZZ2A 1NE7A 4RMIA 3FUWA 3GZTB 4HUQB 4Q7EA 1TAQA 3IEMA 3MCVA 5P21A 4BNGA 1TU4A 2QG9A 4ECEA 2BZ1A 5E9JA 2CBZA 5JSZB 1E1CB 2MSWA 2WQZA 3DM5A 4NEGA 1JJ7A 3KB8A 1I0LA 1V41E 2C7RA 3PC8A 1VSVA 2O0JA 1WABA 4NZ9A 1EAYA 5KB3A 3OX2A 4IDFA 4WK2B 1W47A 1UZUA 3VNBA 1IY2A 1B16A 4JB2A 4JZYA 3NOQA 1A72A 4FKZA 4FUQA 4KZKA 3V1UA 4N3CA 2Y93A 4WFQA 5LDDC 2BUBA 3GA5A 1OFHA 5ESRA 3CZPA 4HAYA 4QYWA 5DFAA 1KVSA 5G1OA 4DQLA 4JI0B 1YRWA 5H3HA 2QZ4A 3CPHA 5IHXA 1XF1A 2PBLA 4NOLA 2FY8A 1QM5A 2MDTA 2FMUA 2ZYHA 3VPBA 2C42A 2FLWA 2PCLA 3L1IA 4RD6A 1RRGA 5ALWA 1JSZA 1JSCA 3VAAA 4QTYA 3HNOA 1IMOA 2WJ4A 2PLWA 3THWB 3RQIA 4F9FA 1QP7A 5JNLA 1NXQA 4R68A 4ECAA 3ZDRA 4F6RA 1XDWA 1BS1A 4HYYA 1F8FA 1BDIA 5D3QA 2WFMA 5TMPA 3FMFA 2BFBB 1UXGA 2WT8A 2ZVQX 4O8ZA 4G0OA 4A8JB 3MB5A 5MDHA 3R0VA 3AB8A 1UKYA 2QN9A 2ZIFA 3ZCSA 2V7QA 3OZIA 1HR0B 3HUEA 2ZB8A 4Q1DA 5HK9A 1MJNA 1S4MA 3N2ZB 5DMHA 3M33A 1SCUB 2QNIA 1F2UA 1R0BA 3KPJA 4ZQEA 3RSGA 3SNHA 3N2NA 4A1FA 2IS2A 3EDCA 1GGJA 3Q8MA 1P7YA 1ZBDA 2R65A 5BO5A 1J5PA 2W11A 4PGMA 3VJRA 1Z4IA 3DVRX 5F1YA 1U8EA 2X5OA 1SULA 3B89A 2QTFA 3GRCA 1Z17A 3QVMA 4FFMA 1Z4JA 2EX0A 2YVQA 4M3NA 2AC7A 4ZOEA 3TTYA 1TGYA 3SQOA 5FUMA 5IVPA 1XLWA 1ZISA 1Z38A 3F5MA 1Q17A 2OOKA 3BG5A 2WWYA 2QVZX 4EHAA 1NZDA 4EGAA 2BI4A 5A3VA 4YMIA 1KVRA 5CK4A 5A05A 3VC3A 5JPDA 2F3SA 1H9AA 4F85A 2ODQA 1J8VA 1JMKC 1U1GA 2ZQ5A 1W52X 3COSA 2JRLA 4OUDB 4AG3A 3PR3A 3RTDA 2OB1A 2RGEA 5EQFA 5JANA 3M83A 5BQOA 3D7NA 2I4OA 3GJ6A 5J4KA 2O5CA 2G3YA 3ELBA 4LHXA 2DLCX 4QTZA 2DBZA 1MJHA 3RTGA 4F8JA 2Q8QA 5IN5A 3ROZA 1ZC4A 5IT4A 1DX6A 1DRUA 1XRRA 1QP4A 2R1VA 5JQWA 3PEFA 3ETLA 1KDYA 4DXAA 4AS2A 3EVCA 1TM4E 2JVKA 1T2CA 3KSDO 1JYEA 2I34A 4OBWA 4YCLA 1F0YA 3GEGA 4MVJI 1N5IA 1A27A 4RKYA 3DE0X 3GB9A 4NYJR 2AMJA 3ID6C 4EPRA 2Q46A 3A70A 4DWVA 5FH9A 5JCOC 4AXXA 3JWPA 3RSHA 4DS3A 1OBFO 2O07A 1BGWA 4RMNA 5ABPA 4WY2A 5FFFA 1UKBA 4GR5A 2C9DA 1QYIA 2EDCA 2P0EA 5LNK1 1LK5A 2Y92A 5JVDF 1GG2A 3MIZA 1GLNA 4UEJA 1JQAA 3HKDA 4UHDA 1N2XA 3PXXA 4DVJA 2DBQA 1W1WA 3N6XA 3FX2A 3B6KA 1UM9B 3QITA 2HQOA 4LRTB 1X80B 2I6XA 3RSOA 4D82A 4PYJA 1KSHA 1LD3A 3H75A 3ZGNA 2UVDA 3PKIA 3WRWA 1K8QA 3ZIAA 1K7FB 2XNHA 5T3UA 4F4JA 3WGHA 4CIAA 4J4TA 1E9VA 1G20A 2R4QA 4OJYA 4D4GA 3GJYA 4GPEA 4KLCA 4E94A 5JXWA 1XMPA 5CR9A 3WL4A 2ZR7A 5F5XA 2V6IA 1F8YA 1XHFA 4FFLA 4GSYA 4DA6A 2CE7A 3KOWA 3Q6MA 4IPTA 3C3XA 1UJBA 2Z2IA 2C3PA 1EVLA 3UGKA 2PHZA 4REOA 3TNFA 3ZCVA 5AVSA 4NBKA 3SFVA 1VPLA 3P4XA 2JHPA 3BRWA 1RRFA 1S8NA 2DQSA 1O96A 5J9FA 3R3UA 4OAQA 1M6VB 3R9KA 4A9AA 1MH9A 2DM6A 3VNQA 4NH4A 3HKDB 3TRDA 1MEOA 3MS7A 4MHTA 3EEFA 2PH3A 1KRHA 2VEOA 1K92A 4CGZA 3BJIC 1CF4A 2RSLA 3S29A 4KSBA 3K15A 3VZBA 4R9NA 5FPPA 3IB3A 3GCWA 3H0CA 3MJTA 4PEVA 3WL8A 2AL7A 3QLEA 3GZNB 5I7OA 5JAIA 1RBYA 2J45A 3NAMA 1ULUA 5ALZA 2RIPA 3FOCA 4KMMA 3AUFA 1JNYA 3U7JA 2JL1A 2VXCA 5AKGA 1P81A 3CY6A 1OX5A 1KRWA 2XGOA 4F7DA 1QWSA 1NYTA 2X7XA 2EWVA 4QWWA 4BLQA 4R98A 2ZPTX 3KSBC 1WTCA 4ZC8A 5I7WA 2XIJA 1XZGA 4Y2HA 5J23A 2I6FA 5AWFC 4Q7LA 2CJWB 5A62A 2HQBA 2FPRA 3GVXA 1ID1A 5B1IA 4A5OA 4EGQA 5G0SA 2J0QA 3DVLA 4LF9B 2BHSA 1YMVA 4QECA 2IGTA 5C8VA 3BSSA 4MX8A 5HDBB 2IZ1A 3JZAA 4HQ6A 4EFNA 5ICCA 4IIJA 1ZOLA 1UKCA 1R4MB 5F1OA 3FFAA 1V5WA 1R6XA 3R0IA 4LQLA 3I9V1 4QAQA 4Q93A 3K6KA 4OHVA 3HKBB 4J75A 4MEJA 3FNBA 4A23A 3WGMA 4FYPA 3DBRA 4WBSA 1KZ9A 2PNJA 3KQUA 3GCZA 5TF0A 3SKVA 2XVYA 3HU3A 4BGUA 4KWEA 5B58T 3GDGA 5CCEA 2JJ2D 1XKXA 3LQ2A 2IA5A 1DMSA 4K9NA 1IZZA 3LG2A 4RVSA 4I6JA 2BCEA 4Y2XA 1BA3A 3GRZA 3WV5A 3P4UA 4DE5A 1JIIA 1FSSA 1X1RA 1KKUA 2QQ0A 2OD7A 2BR4A 2XB8A 2X41A 3E4DA 4LOLA 1GUBA 3OE1A 4LJKA 1DFIA 1YBMA 2YOFA 5FLYA 3TL2A 2QVBA 3AYXB 1N7JA 1XEXA 2HN9A 4DG9A 2QBYA 2BP7A 5FADA 3INRA 5EFOA 3M9LA 4HNRA 2J0SA 3WGNA 1MNAA 1RQLA 2B78A 3EY4A 5IC5A 2OQRA 4PW0A 3LGSA 1DKRA 2GDZA 5AKEA 1E20A 1D2AA 2TMDA 1FFGA 4M8IA 5MF6A 3T7KA 1S3FA 3O4FA 1XBTA 2PM8A 3VMFA 2JBAB 2R47A 4E07A 2VDPB 1SCBA 4DMGA 3DHNA 2VF2A 4DQKA 2ZAMA 4DUZB 1V3TA 1QYWA 2VUHB 4O33A 4WZ6A 1U94A 2FE4A 3WQQA 2AIRA 2HNBA 4UVIA 3WR5A 2WUFA 1M2EA 4OK5A 3EVAA 5JNUA 2BFAA 4TVOA 5FI5A 3E4CA 1HE8B 1PUJA 1UMCB 1P3DA 3CC8A 3ZGXA 1XPRA 2Z2KA 4WL0A 3IDSA 4YONB 4KYTA 1Q3TA 2W37A 4KDEA 4MQ4A 2NPFA 3GGCA 4GYKA 3CLRC 3RS9A 4J4BA 2IS6A 4XJVA 2GUGA 4PIVA 3RVSA 4AP5A 3PX7A 2O48X 1KJIA 3VBEA 1LEHA 3T1VA 2I1VB 4RGQA 2FRXA 4PINA 2OK8A 2VZEA 2NWQA 2GS9A 3PGLA 4XEHA 3AJRA 1QFXA 1KMMA 1PV1A 3BOSA 3AHCA 2JI9A 3UC5A 2FEWB 1XRMA 3ASUA 4QOJA 2IXEA 4A0RA 5EGSA 4K6GA 3HRHA 4I3FA 1AMNA 3SX0A 4UJ3A 1Q2UA 1IN6A 3IAM1 3OCYA 4COOA 1XX6A 2WUVA 4DUYB 3IXMA 4EB0A 3D31A 2HO4A 4PO9A 2QVLA 1QRRA 4KR7A 1E64A 1FQJA 1SVUA 1TA9A 3GA0A 4CL2A 3OJXA 4HLDA 4B44A 5JYEA 2EZUA 1LQUA 1UFVA 3E48A 1BJTA 1XF9A 1ZJ5A 2CNKA 3IT1A 3WRXA 1YR1A 2RKWA 1NW8A 3EG5A 3AF6A 2PUWA 2QM0A 2ZU6A 3DZIA 4YBRA 2MR5A 4Z0PA 4DYHA 1E9EA 1SUFA 2P1RA 2ZANA 4AJJA 1R0SA 4XGNA 2Y68A 1HQCA 2AFIE 4ETNA 4JU8A 4AKSA 3D3EA 5DHPA 4L6AA 3KKKA 2PZBA 1EHYA 2Q6TA 3EPJA 3TEFA 1NNSA 1Z7EA 2OGTA 2XKBA 1RD4A 1DQSA 3EW9A 3HY4A 3QXSA 4P4LA 3VU3A 3BWDD 4QU0A 3B5IA 5IBPA 3IVAA 4TXJA 3WXBA 4MDFA 5EJIA 2MU1A 1UJ6A 2POQX 4R1TA 3VX3A 4OI2A 1WXFA 1Q74A 4B31A 4DDWA 5BNTA 2AFIA 2JC3A 4DR7B 1GZ6A 1WXGA 5FOSA 3HDYA 1BAPA 4TN5A 2O8EB 3Q5DA 4RADA 1ZMXA 4F3CA 4C06A 1C9YA 1CQWA 2A67A 1GILA 1UBKS 1XB2A 4ES6A 3DAHA 5CB4F 2JIRA 1W4ZA 1C4KA 4OHPA 1CJCA 2WG0A 3EAFA 4FYKA 4DPMA 3RIMA 2L19A 4UASA 8ADHA 3OG9A 2EG9A 2NZXA 4L3WA 2I54A 3AVQA 3GCXA 4LBYA 2B99A 4KKVA 1G18A 3SBOA 3KZ1E 5LBTA 2GXQA 1I13A 2HLDD 4DXDA 1FFXA 2JASA 1G8AA 4X90A 5F1KA 5EYPB 1QIEA 3RS8A 5E7QA 3KDAA 4P5EA 1Y3BE 2AN9A 3OZDA 1OKKA 5LQJA 9MHTA 1MV5A 1SQSA 2CNWD 2BLNA 2ZYAA 3RFCA 3UMGA 3R9XA 1VJTA 3D2CA 3QU7A 4HVAA 2EV9A 4HAXA 4ZO9A 3VOAA 4TVSA 1YOVA 3PXUA 4PPNA 4DCSA 4C7XA 2R4UA 3AW8A 2YOHA 3LNCA 1WQ4A 3SJZA 3CLUD 2AZ4A 2BEVA 2VYVD 5JNWA 2ZG6A 1PFYA 2DUMA 3QHAA 2IUUA 2VG8A 3TQSA 2AEFA 3A2NA 3OZRA 4K2AA 4RPIA 1PJ3A 4LWQA 2LW7A 2NU7B 3OX1A 3T1TA 1YJ8A 3LQRA 3BBPA 3ZW9A 2E55A 2FFAA 5JCJA 3DL7A 4J0GA 3ZY5A 1GAJA 3FB1A 3ITNA 2I8AA 4HK4A 4KYVA 3E8MA 4OU5A 5F7ZA 3I9OA 3R4CA 3ZWMA 1XR3A 4X6XA 5KPJA 5JLJA 3RF7A 1Z34A 4G37A 2PS1A 3UYLA 4CMKA 3HCEA 3PUYA 4IX1A 9LDTA 4HYQA 5IJAA 3CZCA 4MARA 3TD6A 3DAFA 5FR1A 3SWWA 1WULS 1B0AA 4PAWA 4LCJA 4ALIA 3PFFA 1N2SA 5JBQA 2CFCA 2QY6A 2ZWVA 4M83A 1VG1A 3EXHB 1EUCB 1AO3A 4G4SP 4G5RA 5EJMA 1YOVB 3ECSA 1ILEA 4RTJA 1ZCFA 4KR6A 1DXHA 4XB1A 1G2QA 2DCMA 1QRAA 2ZUBA 3WLPA 1DDGA 3LPMA 5BQ5A 1K86A 1OX6A 3CUTA 2CKDA 4XE5A 2Q5QA 3VSEA 1NSYA 2RHCA 2BBSA 3R24A 3HSSA 2H52A 4YAUA 1VYUA 4HPJB 3P2OA 5F33A 5K0ZA 4IFTA 4MR8A 1AXEA 4V03A 2CJXA 3W0LB 4C08A 1E98A 3EARA 2OZVA 4CDRA 5JVDA 2WWRA 2HWKA 4IH4A 1Y7PA 1JKXA 3UJBA 1XZEA 1AB5A 1HUQA 2Q1XA 3ONFA 1QZTA 2FRVA 2G1KA 5FPKA 2RGNA 4MWGA 1VE7A 1CKEA 4CMAA 4Z7JA 2QUAA 4IJ6A 4AYTA 2VZ9A 4HWGA 4IXMA 1NMSA 1GJRA 3M6XA 1F2DA 2W2TA 3HO6A 3ICQB 2AX3A 3USCS 3CXUA 3MELA 3OFND 3U56A 1UKEA 2XH8A 5K0BA 5LQMA 4DG8A 2ZSDA 1OH5A 3DV9A 1GTMA 1TF2A 3HR8A 4M7OA 1Z12A 2XBMA 1GCIA 1W88A 2CWDA 3FGZA 2WWFA 4MQ6A 3PKZA 3E0QA 4QWMA 4V02A 4E5NA 1PZNA 1YA4A 5DP2A 2ZR9A 4DBLE 1WUIS 3BZBA 4IDAA 1LF0A 4C6SA 3CUSA 2XYPA 1QLWA 1CR2A 3K0FA 2H2GA 5JVDB 2F3PA 2P68A 1EK1A 3FKQA 4B17A 1J99A 2MT9A 2HCBA 3LMKA 1X7WA 1MX1A 4QNRA 1LSJA 4HHEA 3H1PA 3U9SA 5BR4A 1SBYA 1UMBA 2CB9A 4B6SA 2OBYA 5EIAA 4FZ3A 5LLDA 2UKDA 3P27A 4TTSA 3B5JA 1G55A 4LWZA 4FW9A 4KIWA 1IH8A 2ZJZA 3PF9A 1KERA 2A14A 2MYUA 4UFNA 3S6JA 5LMNB 1F60A 1O9GA 2HO5A 4PQYA 4IXTA 3ISTA 4EKGA 5REQA 1W88B 1L4KA 2DPXA 1O03A 1VIAA 1ICEA 5EA2A 3HJRA 1N34B 1WA5A 3WC4A 621PA 5EXEA 2GKSA 5CURA 2WU8A 4LOHA 4UFOA 4WZZA 5J43A 1XNRB 3LZ6A 2RC5A 1MKYA 2KLHA 4HX5A 3OE7A 1BHSA 3MINB 1XXLA 1U0SY 2R5WA 4ZEWA 2ARKA 1MMFB 2F1IA 3ADKA 1PZGA 3DPUA 4PG7A 3G7NA 5TMBA 5IAOA 3HCCA 3UQYS 3PQ4A 4QNMA 4W9NA 1X1AA 3JD4A 2CNNA 2WYWA 4JYCA 3KZNA 1A9QA 2QLTA 4K8OA 4XARA 2JIZD 3DP7A 3C3CA 1RYBA 3KT8A 3HI6A 3ND6A 1PJBA 3QKIA 5AFSA 5FX2A 3ICPA 2P3OA 2Q7DA 2FSVC 3QEOA 5C1OA 1WZ2A 5JTTA 3ZCXA 1J06A 1K7EB 3ZZNA 3I1JA 1U0TA 2Z8YM 2P91A 4ARAA 4KJZA 5CDSA 2ZRIA 1V39A 4PZLA 4A0QA 4H3HB 1FDTA 1LFAA 2FFRA 4EGCB 3TEJA 2PKQP 4BKPA 2YWEA 2OHIA 2CDRA 4B80A 4WNAA 1R8SA 2GWRA 5LQNA 4U2KA 1GGNA 3VR6H 1ZGJA 3QMPA 5MFZA 4EBBA 3TG2A 5HOEA 3MOIA 3SX2A 3M7IA 3NHJA 3HRKA 5TS3A 4Q16A 3ELWA 1DX4A 2UZ3A 2WAOA 3DCJA 2REBA 2YH2A 5EKXA 1T10A 4EUNA 3WKBA 4TSRA 2DQ4A 1PHPA 2JGAA 1U3DA 1EKXA 3KJIA 1FP4B 1AKWA 1TKCA 3EHEA 3RYTC 1JTVA 1VKOA 1NUTA 3F71A 6GPBA 2JJQA 4N7MA 3RVOA 4B7ZA 2J07A 4LY3A 3WSTA 1MQSA 5HOQA 1N6IA 4JL8A 4MAAA 1WDTA 5E0OA 3B3JA 5L6MB 3ZHSA 1GCOA 2W42A 4OEHA 1VPDA 1OFTA 3T7CA 4XJSA 1P5HA 2GPBA 1L7DA 1YZTA 5LBIA 3LXMA 4PNPA 4YRDA 2OPBA 3VJKA 3W1EA 4I1VA 4BL5A 4EENA 4WNAB 4Y2UA 3DB2A 2JCSA 3BD6A 4IIEA 1L5GB 4UPVA 5C9ZA 4ZODA 2VP5A 5DBOA 4W5JA 5B5SA 1JU4A 1SBHA 2H63A 1PSZA 3BDVA 2WI8A 1UXJA 4WXHA 4YRJA 5BQXA 2AOTA 3HZHA 3Q4GA 3OT5A 5EI5A 3IR5A 4NE7A 3LUGA 2F55A 1WXQA 1ZQ1A 4HLQB 1Z83A 1XLTC 3NC0C 3NUZA 4UCFA 1DP4A 1D1TA 1RLIA 2XJ9A 3VR0A 5DNEA 2CNLA 1QAMA 3S5UA 3ZQ6A 1T8RA 1NLMA 2IIQA 3L8HA 2CCKA 3WB1A 1MW9X 1I6MA 1QRUA 1COZA 4GQIA 4RE5A 5AKLA 3X44A 1IN4A 1DB3A 4PE5B 1CC1S 4RNCA 1S02A 4G9GA 5CT4A 5TARA 3TSYA 3CTPA 5L3SB 5LL6P 1L8XA 3MGGA 4TVKA 2VTEA 4YYEA 3PFCA 3GD5A 4P5DA 4N3AA 1FUYB 1T9GS 3KB2A 4ZOCA 1GKIA 5JY6A 4GBGA 2YFKA 5AIBA 4BLTA 2XGJA 5MN4A 2GEBA 4F6LA 4Y8VA 1E7MA 2ZI5A 3IHTA 2E1RA 1ZIPA 1MRSA 1Z16A 5F9MA 1ZEMA 1TZCA 3V8VA 1K9VF 4I50B 2OP1A 3GQBA 1Y5LA 3HVKA 3BGDA 1E1QD 1KI4A 2KBEA 2XUKA 2ZSIA 3ODPA 2B5OA 3NLLA 4Q4HA 3V2UA 2Z3WA 3VR5D 5J4HA 3OLWA 3STTA 3UJ8A 1Y7IA 5BV8A 2C2HA 1IVYA 4RETA 1ZRSA 1NBIA 2BEWA 2OT3B 1D5WA 1JMYA 1UQRA 3FPEA 3KSRA 1KJZA 1RT9A 5DM60 1PF7E 4NC9A 5IFKA 4QVIA 5T8KC 4MWTA 3UPTA 3K5IA 2NACA 3K9GA 4HRXA 1FDVA 2VCEA 3JQGB 2LCQA 1JJFA 3ZQJA 2PGAA 4E2YA 1JDZA 1TJNA 2XDQA 4AMUA 1C9DB 4EB3A 2CLDX 2XCQA 3KYCB 2EKDA 1CUVA 3FPAA 3FUXA 4PCUA 4UQOA 3LK6A 4XM2A 2BFFB 3ILXA 2ZSJA 4OP1A 4ZJPA 3QFRA 3UW1A 4Q3BA 3EWSA 3LFHA 4K6FA 4F96A 1H2YA 3GLSA 4MHOA 5CMLA 3RUEA 3WSVA 1O95A 5BRAA 4JX9A 1MW8X 3WY9A 5KYUB 1FJXA 3IAEA 1QIJA 2VKQA 3GAFA 2O7RA 5CA0F 2VWHA 1GL9B 3KZMA 1HE1C 1RI1A 1CDOA 1W0JA 3KC2A 3R5JA 2X40A 4F5EA 5A04A 4AUNA 1RI2A 3TNLA 4P4SA 4X60A 3A1FA 1L2TA 2JFHA 5T4HA 3FTDA 4YRKA 2A59A 1JLRA 1JLMA 2NVBA 4E15A 2W4IA 5M7EA 1HMPA 2TRSB 1XCBA 5C37A 2G1PA 2FEPA 4IJQA 4K3UA 5KTMA 2GJKA 1OYVA 2OXRA 1EXWA 3W05A 4DCMA 5CB4B 3GGPA 5KQSA 2FUG6 3SC2B 1JFTA 3GGDA 5HM8A 2Y9MB 4Z1OA 3WWZA 1Z0IA 3HR4A 4H2DA 4JVOA 4UM7A 4YPFA 3TSZA 2YWGA 2EW1A 3WJ7A 1L1QA 2VTBB 3H11B 2H54A 1MA3A 1P4AA 4MQ5A 2FEXA 1V16A 4C88A 3UMVA 2L69A 3JQAA 4YB8A 1RKBA 3LUDA 4EOGA 4NV1A 3D0OA 1EE9A 4TWBA 3N2EA 1ODCA 4YALA 5J2TF 1MAWA 4R8MA 4XCQA 2G9QA 4XWWA 4AZWA 2RGWA 4MKXA 4JBIA 4UTRA 2FPMA 1H94A 3F6CA 5H4GA 2X1LA 3CBGA 1N4DA 4J8PA 5JSYA 2EZ4A 1AMUA 2QSUA 4J1TA 3WZ2A 3H0EA 1G8SA 2Q2WA 2FWBA 1MT0A 3BX1A 3WYNA 5LMCA 5HSGA 4HSGA 3JQFA 5D5HA 5HP4A 1E89A 4B3TB 3CWZA 2Z2JA 1JILA 2FOLA 5A6VA 1D07A 1MAHA 3SEQA 1Q7EA 1X2BA 5FEUA 5JZSA 3O47A 3BHNA 4RGBA 1US8A 4RM2A 4B9EA 1PLLA 2DLNA 3LSYA 1FF9A 1N57A 1QX3A 2XZPA 2R8BA 2NTYC 1CLUA 1VMEA 4WW0A 4XFDA 5D3KA 4WOBA 1ETHA 4ER3A 4QYIA 4W8HA 1QRSA 3FBTA 4GMHA 3IVXA 2OFWA 1X9GA 3OOHA 2DQYA 4RK4A 5ILGA 3GAAA 3A1TA 5DGCA 3PC4A 4BWVA 1CSEE 1Y3CE 3PX3A 1P39A 4MLCA 4NCBA 5GJWC 4HXYA 2VYNA 2VF4X 2CFRA 3TFQA 1U0RA 3ABOB 1JDTA 1WCWA 1RC0A 4PFSA 4C20A 2QYHA 2PRYA 2I6TA 1DAGA 4R41A 1TW3A 4ERNA 4BV9A 4BB0A 4LTMA 2CCJA 4XASA 1JHOA 4XPIB 4GEKA 2JLZA 3M5WA 3V7WA 3QPCA 1NX6A 2PZEA 2VPXA 3QX7A 3F46A 5BSVA 3MEQA 1MGOA 3OA0A 1C30A 1L8LA 1SVNA 2AKAB 2YYYA 3CZRA 3JALB 2OG1A 1FOEB 3K0HA 1U0FA 2A86A 1US8B 4M9CA 2IUSA 2O8BB 1FUUA 1FFSA 2HJ9A 3A4NA 5FQNA 4UOEA 4YR7A 1S0UA 1HKUA 2NAFA 1HLPA 1TJPB 3KJEA 4J91A 4TTIA 1CETA 2O3UA 1C0LA 1X7XB 1B4DA 1TU0A 4E3WA 4B73A 2C59A 1KH2A 2IPLA 5IAKA 3VSDA 5K8VA 3ND5A 3QKRB 1Y0BA 2H57A 3FIJA 4LC1A 2AFRA 4WACA 1P1JA 3I2YX 1DOZA 3NHAA 3WB0A 1BTOA 3WKDA 5FAKA 5JDCC 3QX3A 4NMLA 1G5HA 1SUDA 1LPAB 1GL6A 3GVPA 4C21A 8LDHA 3HXMA 4ER0A 1RKUA 5K8TA 1DJPA 3OPYB 3WKEA 3I3OA 1QX4A 3K5HA 4S0XA 1ZXBA 3B8EA 2ZREA 4KPFC 4JGGA 1MLDA 1DOAA 3R7DA 4P80A 1C30B 2HRRA 4Z4IA 2OPHA 5FEMA 2QTZA 3PD1A 1QKKA 2VH5R 3RF6A 2PVPA 4GKBA 4EO7A 3G79A 4DY4A 3AT1A 4ZHQF 4PFJA 1OU0A 3DE1X 4LZJA 2B4RO 3RK4A 1Q7BA 2JLYA 3JPYA 4X20B 2FX2A 4DA0A 3OQNA 2NZWA 2ZUCA 3ZNPA 1LRKA 2VDQB 5AJXA 2ZAYA 4G5XA 4QOEA 6REQA 3Q5EA 1P75A 2XMZA 4X6YA 5DXJA 2ZIEA 1MEJA 2PANA 2YHIB 3IR6A 4CG2A 2DKFA 3KJGA 3QGMA 3W90A 5JYCA 2ZT5A 3CZQA 4XIGS 1W49A 3B3FA 3TZCA 4ENVA 1KEPA 2WJWA 2CDCA 1C81A 1RE1A 4L5CA 4HKTA 4RH0A 1M2JA 5JJIA 4ZVMA 2NNLD 4MR9B 1TGVA 4P9NA 4V3BA 1UQTA 1C4OA 3NHFA 4ZAXA 2JLCA 1GLVA 2HA3A 2ZRHA 4LDQA 4QLAA 3OFJA 3SHFA 5I4IA 3QLJA 1DUVG 3RRZA 1FJGB 3ICVA 1HFWA 1RKQA 3I3SR 3IAS1 1OTYA 3JQPA 3N1UA 4AMBA 3DE4X 1UOEA 3ICWA 2W4QA 1E5XA 1N9GA 2XUIA 3AR3A 1OJLA 3C8MA 3KAQA 3RUCA 2GA8A 2NG1A 4DOMA 5AUPB 1RXSA 1NRXA 1AX9A 2IBMA 2Q62A 4JUDX 3PNPA 2QRMA 5IN4A 1EVQA 1YHYA 2HCFA 5TF4A 1YR3A 3KUUA 5IM5A 1RJGA 3V8EA 1Z73A 2O50A 2LCIA 1U2GC 2PUHA 2ZE7A 3HCOA 3TO5A 3TDKA 5ER9A 1S7CA 3W8FA 1KFJB 2WYIA 3AU8A 3H2KA 3ZD8A 1O0CA 4ZCRA 3PXAA 1GKUB 1IPHA 3FPHA 4X71A 3TZQA 1GITA 1JI3A 4PLYA 2HJSA 1BOFA 3VDMA 1ZITA 4I19A 4QXAA 5HBRA 1QLHA 4RNDB 8ABPA 5LB4A 3ANTA 2RHBA 5ALGA 4DIEA 1K66A 1YCDA 3FSJX 3DA8A 4LOJA 2GCPA 2X1MA 1GPBA 4EG6A 1VLJA 4G8JA 1NXTA 2XMQA 3CLVA 3HABA 5F3RA 4U00A 2PSEA 4L15A 2ISCA 1ADGA 4UMVA 4YJ2F 2W6QA 1NNLA 4EF6A 1ZW1A 1H4QA 2M6KA 2VZLA 2HBZA 3AFNA 4GLJA 4A0HA 1UT6A 4NJEB 1BVHA 2I91A 4EO9A 3V9AA 1A8HA 2OGZA 3KDSE 3E22B 5FPYA 2R2AA 4A92A 4N39A 3P32A 4IUBS 1PWZA 1GFIA 4KE6A 4OJKA 4RLSA 1U5BA 1D2HA 2QM7A 4RY9A 5E6SA 1Y8AA 2QSYA 1YB4A 1RWQA 3V4VB 4E5UA 1N5DA 1Z5GA 1ZRMA 1NMQA 3GN1A 4JLOA 5E9AA 5THXA 3L6DA 4G36A 1YS7A 5KSPA 4QDZA 1ZD9A 2H48A 4GM4A 3ZS8A 2JGLA 3GVCA 3V1LA 4OUKX 2Q6IA 3BZWA 1V96A 2XTAA 4KE9A 1T0JB 4ITVA 2IGBA 4E5PA 2R7AA 3K1TA 4X8OA 2XVAA 2ODBA 2PMCA 3ED1A 4PZEA 4ZIRA 4KBGA 2OWEA 1B74A 4C7OA 1T3LA 4KIGA 4UMFA 1NPYA 3E35A 5AM4A 5IKPA 3A06A 2I76A 3GGOA 3BULA 1Z2OX 2J7KA 3IXLA 4N1AA 5LOVF 1NXOA 3D54D 3AESB 3GFFA 5CEEA 4FDMA 2QDXA 4FNAA 4RSHA 4L0CA 4ENSA 1B0UA 1RRPA 1KARA 1QYVA 1HQKA 2AYXA 4RCYA 5I45A 3ZGVA 2WTMA 2Z2YA 4LKOA 5E6SB 1BMTA 2QT1A 3ZKWB 5I9NA 2A0WA 5JNRA 1JXMA 2J3EA 5GZ1A 3M3DA 1ZMOA 3DKVA 1VLLA 3OHPA 4TKZA 5JISA 1V3QE 3MRSA 2WZDA 4LX8A 2AFHA 3W9YA 2KS6A 4EABA 1LDMA 1P5RA 2Q07A 4GUDA 5EUCA 2QP4A 3F5DA 3JX9A 3RW9A 3HKCB 3NVMB 1MX9A 5EHQA 4RY0A 1V3VA 2II6A 3GT0A 1E2KA 1JKIA 2WVJA 3AHJA 4HT3B 3EJWA 2VJMB 1S2OA 6PFKA 5LIPA 3QZUA 3CH6A 2Q21A 3BJEA 4HH3C 2C92A 4I3GA 1I14A 3G0BA 3CX4A 4M86A 4RZIA 4WT7A 3P26A 5HG0A 4CMEA 2FSGA 2F9MA 3PGXA 3DR3A 1UADA 3MWJA 4JXKA 4U2GA 4UTVA 3CVVA 4MS1B 1E1LA 2QY9A 3JWEA 4LGYA 3HZZA 4ZEMA 3VR4D 2HPHA 2I3AA 1REQB 1W6RA 1GNTA 2WP0A 3GEDA 4MYCA 3RRJA 3VYRB 1CUUA 3LHSA 1FB5A 4JDUA 3TINA 3D59A 3J80A 3HXKA 2JJ1D 4LRXA 3U4HA 3UUEA 1K4YA 1R0CA 4LJLA 4RTLA 4BQIA 2Z1MA 3IIJA 1KFCB 4LRYA 9ABPA 2PCJA 4W9RA 5JZOA 5LUAA 5TT0A 2Y67A 1IY9A 3DGFC 1DCTA 2G17A 2NO6A 1GUAA 3FETA 3SPXA 1BRMA 4Q4AA 1NM5C 1WS6A 4NFLA 3SLGA 3UWDA 2DLDA 4IIBA 1DQRA 3LVFO 3KQMA 4YRFA 4BATA 4DCGA 1A82A 1V7PC 2B1IA 2G9RA 3DBHA 2YHUA 4PAQA 4RA6B 3L7KA 1VHLA 5AKXA 1R10A 2G28A 1ICIA 1CUBA 2VSYA 1II8B 3BIJA 4XQGA 2QROA 1J8DA 2R7LA 2XUDA 3AUAA 5CCXA 2QJOA 2FMXA 1PJZA 3I01M 1L5KA 4EHDA 5IABA 3TLGB 3T3NA 2C9BA 3G1UA 4KW7A 4CF4A 3MJVA 4L0QA 1T5LA 2EX4A 5IJXA 1SU8A 1PEDA 4F91B 1OI3A 3DDOA 4MJXA 4RHUA 4DDHA 2AYZA 3DG9A 4HN9A 3B53X 4IWNA 1GR1A 3QVLA 4M38A 1J1UA 1NIPA 2ZPAA 3BJRA 4Y2SA 1ST2A 3F4KA 1R9NA 3AP2A 4UU0A 2C04A 3THXA 3OURA 4IV8A 4JQZA 3ER6A 4DRXA 3DHVA 3NDPA 3R3WA 3MTDA 4RQUA 3LDHA 1C7EA 3D43A 3QW2A 3PJDA 1HRKA 1O6ZA 2YV3A 5AOBA 4R81A 4JLVA 1RS0A 3OU2A 4NDNE 1GTRA 4X84A 2V8BA 4FONA 1JEJA 4ZI2A 2PGNA 3R8FA 1UP7A 3HP4A 1NGSA 3DBHB 1QV7A 4F5DA 3L1JA 4HH0A 5J2TB 1NX9A 4KH0A 1E6EA 4BBAA 4RSRA 2BD0A 2ZAOA 3SIWA 3K09C 1PJSA 3H5RA 2WF6A 4B76A 1Y3FE 2HTFA 4ASUA 1W4CA 1XZKA 1QK5A 3M34A 2COKA 2AWNA 1NVVR 3P9IA 3LLUA 4GQBA 1CYDA 2B98A 1Y4ZA 4H1HA 2HF9A 4Z5XA 4D8YA 4EUKA 4AQ7A 1ZIDA 1SK8A 4H7EA 2PKWA 3RVQA 5JEEA 2EEZA 1XVLA 1EWVA 5ITVA 1Z5OA 1ML3A 4CPDA 4MKFA 1W87A 2IF0A 4NMWA 3H19A 5I7RA 1KP2A 3QV1A 2P62A 4RZXA 1BVRA 1LBEA 2AZMA 2ZRPA 5E1BA 2NXCA 3V33A 5KU1A 4JKIA 1GFSA 4IDHA 2IOHA 3ZNOA 1E2DA 3O8NA 3H84A 1P8JA 1OWMA 3IV6A 1PK7A 4HAWA 2WHPA 3LKBA 3URKA 2IHBA 3GQVA 3ZGLA 2QTCA 4EY3A 3KUKA 4CWAA 4XUGB 5GZ6A 2E85A 4I08A 2AE2A 3L41A 4MCJA 4NV3A 4R0NA 2C61A 2D59A 2OC9A 2XKJE 3DWEX 2QR2A 1M2HA 1NVEA 2BMJA 2PBZA 3LQFA 3M82A 2Y1OA 4HB3A 3WDMA 5IDXA 2BDUA 1P0IA 1O08A 3D4OA 1CQIB 3DBLB 3I58A 2JAOA 3OJCA 3QKTA 4LX0A 4R83A 1GCGA 2ZUDA 1LPPA 3HWWA 2BKVA 4NYIQ 4BBJA 3DMYA 3MWGA 3PUVA 4NNOA 4RC9A 5G0VA 4HX9A 1WVIA 1ESCA 1R16A 3FI9A 3RHTA 3SZGA 3WK8A 3ZV5A 5D6OA 1QBGA 3EGOA 1C1DB 5CVEA 1T4DA 1Q0SA 2CW5A 3FCAA 1RRVA 3ASVA 3GBSA 3N3AC 1P9LA 3NPAA 4IWYA 1CUWA 3MTEA 3UMFA 4ZHQA 2ZYWX 3RJ5A 1XTSA 4ALJA 4Q4JB 4AK9A 5KYWA 4C7BA 3ZQ4A 4ZWNA 3IE1A 4R2IA 4RZ3A 1W73A 1YB7A 4ZT2A 2O23A 3EQ7A 3HL0A 4URYR 1TADA 3STXA 1XRSB 3ZY4A 1R3UA 3MJEA 4IICA 4PSAA 3DTYA 2GF0A 2QL9A 4M8LA 3D5TA 3JPWA 4QOHA 4LFCB 4WK0B 2X14A 1PZHA 2ZT7A 5LP6C 4DQDA 1Z7YA 1KZ4A 3BGSA 3OMWA 3DOEA 1KSFX 5HRUA 4JIGA 1AS3A 4LDPA 1ULTA 4MPPA 4RKRA 3JAMA 4A16A 1HT1E 5FWXB 5MFPA 2WTUA 1JF8A 2LD4A 2VL7A 3A36A 4AZ0A 2H5LA 2RK4A 3F1LA 2GZAA 3E58A 3HLKA 4JC0A 3WICA 4R71A 3DOIA 1WCIA 5B2ZA 2VHWA 2JFNA 3V80A 1ISFA 2DT5A 1O57A 2X5XA 3D3KA 4IXNA 4P3KA 2WU0A 3WBKA 4CKBA 3PUIA 4HAOA 5AKJA 1OIWA 1PFGA 1Q0PA 5IXYA 1ZD3A 3VKWA 2GESA 4RAOA 5E4FA 4BVEA 4ZRNA 3PXEA 2C8KA 2FE1A 5KINB 2VJBA 1WNTA 1RWVA 4P7JA 3ZY2A 4RXUA 3MA0A 4PO8A 3ZR4B 1WDKA 3OZWA 4N47A 1HQDA 1RHRA 1RWXA 3NTUA 2Q4OA 3MWLA 4PQEA 1M73E 4WOPA 3B82A 3TNJA 5GOTA 1V5GA 4Y1GA 3WLFA 1ZUHA 4O1IA 5FBLB 2KLBA 4JOSA 4C87A 4W7HA 5I7UA 1KNXA 4L3OA 1DBQA 3CG0A 1G17A 2R1ZA 3H0KA 1QQBA 1WUTA 3VZSA 1VECA 1K8RA 5BW8A 4LQDA 5TEVA 3JWIA 3C1UA 3K31A 3LUFA 1QMPA 1NJGA 3F1KA 5BR7A 3T12A 3MIIA 3OTGA 2JGRA 4CKWA 2ONYA 4OQDA 1JU9A 1SM4A 5E4YA 4B0OA 3IEPA 1RAHA 1UBLS 4TTAA 1O97D 2G0NA 2AF4C 4WV3A 1KVTA 1PS0A 2D7JA 2P9TA 3PUHA 4MI6A 1IRIA 1ONNA 1MJFA 4X0EA 1M6EX 2FK8A 2JA2A 1YASA 3L7MA 3UWOA 5JPCA 1NJSA 2O2EA 3TZ6A 4GVLA 3PNVA 2AOWA 2JHFA 2QRLA 1UWKA 4MUEA 3TFOA 1D2MA 2R7MA 2UYOA 2ZJ3A 2PFGA 3CNHA 1AV6A 2D0OB 3WISA 3VJMA 3KL2A 4QSHA 3WE7A 1GP2A 1TD9A 4KUGA 4P2GA 4CLHA 4EBFA 8GPBA 1V5EA 4QYMA 3RTCA 1EVYA 4ILKA 1FA9A 2JD0A 2X0JA 4X1IA 5B64A 1NG1A 1PKEA 2DHQA 3U4IA 1Z5NA 5A4MS 3RK1A 4DJ5X 4GVPA 2NYAA 3S2IA 3H86A 1DIAA 1KI1A 1QZUA 1P4GA 3CB4A 3LUCA 3PS9A 5EZ5A 1QG4A 3LL4A 4P84A 2WVGA 3V32A 4EH1A 3VHRA 3FY4A 1JU3A 1M76A 5AJVB 2I2DA 4XXHA 5EJ4A 2FPPA 2O8DB 4LECA 1N0UA 4I66A 1Z18A 4YJ2B 2R0QC 4MPJA 5F21A 1GFZA 3H2BA 5JZBA 1E9CA 1PDOA 1Y7LA 1CVIA 2I6UA 1Q7CA 3GFRA 3GH1A 3OH8A 2VA9A 3TECE 3FD8A 2B2CA 4YJHA 1GG9A 3KK0A 4BKRA 2GCEA 5DNAA 4HV4A 3HYSA 4MAFA 1LJ8A 2WWVD 3O73A 1Q6ZA 4MIOA 2QYTA 2CFSA 4YRCA 1NVTA 4LYJA 3CW9A 3JATA 3K1AB 3P4YA 3JYLA 5IVDA 1CR6A 3L1UA 1B0PA 3I5UA 2SKEA 1T2UA 3SVTA 5HCIA 3ISJA 2AMLA 4TOIA 2VCHA 3WJ1A 3W4KA 1YDHA 4EGJA 5T67A 4Y3UA 2GNAA 3IELA 5SICE 2H16A 1KQNA 1ZQ9A 4C4RA 1LW7A 1QHNA 1X74A 3E2MA 1KMIY 2GH1A 2QMYA 1RHUA 3GPDG 4UAVA 4INJA 3A05A 5HBGA 1PL8A 2QL5A 4NBNA 3R74A 1G1AA 1YQXA 1YC5A 3ZWNA 3QY9A 1YDWA 2G07A 4JNCA 4RZHA 1DOHA 2WG1A 1R4NA 1YB2A 1OILA 2OO5A 3FUCA 2YIMA 1XK6A 3U3OA 2EU8A 4DNPA 1Z5ZA 4BO6A 1T8PA 2OK7A 1JB9A 3FCOA 4RPJA 1X1DA 5CGQB 1APBA 4DJAA 1A5TA 5LOVB 1YB5A 1NI4B 2GLXA 4TGLA 1DSSG 1J2YA 1BSVA 1P9OA 2YWXA 5DHUA 2Q2VA 3TRIA 3EIHA 2YW2A 4QVGA 2VOJA 1MCZA 3GK3A 4PTYA 2HQRA 4FT2A 4R9SA 4P92A 3UJCA 1XRJA 3ABQB 3BXPA 2FPGB 2VNSA 4YI5A 4BP1A 4BYGA 1AQIA 1WSBA 1NY6A 4L27A 6ABPA 5K6TA 1Z13A 3LFTA 1Y9ZA 5KKCA 1CUIA 1GWNA 2C4UA 3V48A 1UBTS 1NVXQ 1HGXA 1H5QA 2EP7A 3WLIA 3OIGA 2CZCA 3KQYA 3SVZA 1R4NB 2FJ0A 5AKKA 2VJPA 4XDZA 3BMOA 2G40A 1E9DA 2PQ2A 4FB4A 5FOUA 5EJEA 1AXRA 1HRDA 3CG4A 1M54A 2I3ZA 3S2SA 4J6FA 1QH8B 4B3XA 1QF9A 1DDIA 1L5SA 5CH8A 4EMBA 2PMKA 3GWGA 5CB0A 2F43A 3C3JA 2WTAA 1COWD 1XJ5A 3CONA 3MMXA 5CX1A 2B0CA 3I9KA 1XLVA 1H8ED 1MO2A 4PGGA 3OZ7A 3BJMA 1JIXA 2GN1A 3DQPA 1G16A 4RS4A 4O2RA 4CCSA 3N0RA 3U81A 1VBFA 4C0AC 2CHUA 2W22A 1ZL2A 4Q82A 3TQHA 2GCIA 2H9AA 4OXRA 1TCUA 2O4UX 4XD7D 5TX7A 5JYBA 1GVHA 4TMXA 5DGDA 4EGSA 1LI7A 2H92A 2D06A 3RSZA 4EJMA 3WMFA 4OJMX 4C0JA 4CQMD 3KLNA 5K8CA 2W93A 3MGAA 2YZ2A 2NT4A 1NUAA 3FDZB 3TZLA 4F11A 1OLUA 4BMOB 2PT7A 4DMLA 3CO5A 3H65A 2ILVA 3DVAB 4NV0A 5GVRA 5JSKA 2ZE5A 1NJFA 2OZLA 3KCNA 5A6SB 4UC0A 3D8UA 3DLPX 2EL9A 1ZD1A 5CLGA 1SUSA 2F43B 4BZQA 2C2OA 1RI3A 2OO3A 2V58A 3HUDA 3KOOA 2FUCA 2PT9A 2CLEB 3IBCA 5M34A 2H51A 4CDGA 4KNWA 3PC8C 5TIIA 3D5QA 4KUHA 2DQKA 3WGTA 2VJQA 2WTEA 4JJ4A 3SSAA 3WO0A 1KEKA 3NWOA 4HAIA 3NHLA 4C7MA 2HT6A 4HPWA 4MW4A 5CA0B 4TT8A 1KAQA 5ALHA 2X0DA 4YWHA 2OZKA 3DAYA 3AERA 3F7TA 1DBVO 3MUFA 4UNSA 1YCGA 5KAPA 5C5DA 4G0XA 3B6ZA 2AJTA 3BFKA 3GLVA 3MK31 2J5XA 1DKLA 3QXXA 3IDAA 3RARA 3WLTA 1GZ4A 4QVKA 1I10A 1VE5A 3M5DA 4XCXA 1OVMA 1LLFA 2P6OA 2A7XA 3DTVB 1Y9JA 1CT9A 1JXAA 1ESNA 5AVKA 4D9FA 5WRFA 1ISRA 1DJNA 1TPZA 2BFCB 2CLFB 1BE8A 3ZXIA 2G4CA 1EQ2A 1P2TA 1JG4A 2XGGA 3T54A 5LNK6 1NASA 2I1QA 3Q0EA 3GHYA 2HWYA 1VOTA 1CZNA 2J87A 3IP3A 3MTGA 4JL5A 4XCVA 3T1NA 1L9XA 3OIFA 4R2MA 2ZFUA 4TMWA 3NP9A 4YCNA 5I01A 1SVLA 2YCBA 2W8ZA 1XKQA 4LDJA 1PGPA 1RAEA 3W5JA 2RB4A 1MAUA 2PH7A 2PWPA 5LXTA 4YPVA 5HFJA 3STUA 3AUSA 4K6HA 5TPZA 2B82A 2EKPA 3A3NA 4CCWA 1MN6A 4HP8A 3E84A 4MVJH 2WLTA 2P11A 3VTKA 3ZE2B 1VCHA 4GRDA 2G0AA 3ECAA 5FV4A 4ZAYA 3FGNA 2PWAA 5EMKA 5BWNA 2FZKA 2WY2D 4TTRA 3T1OA 5G1PA 1SEPA 1QZ3A 4CF7A 1ETUA 1IQPA 4UZEA 1UIMA 2PWZA 3W5SA 1E3SA 2PMWB 2LIVA 4P1ZA 4TKVA 5HXAA 4UUQA 1OSNA 4DT1B 1QWOA 1DTWB 1E7RA 2GPYA 1I0ZA 1R88A 5FHQA 1ZJWA 2QZPA 4DC0A 3RFVA 5AP9A 4I9GA 3T6KA 3R3HA 2XRZA 1PCXA 4H6WA 3IP1A 1VBKA 1PR3A 3F4BA 5DHAA 3VBCA 4FKMA 4KREA 2BOVA 3GYBA 3L6OO 3VU1A 4C6TA 1RNLA 2YW9A 1U8TA 4B6JA 3SKXA 2AXQA 2NT3A 1E2JA 1CU1A 4GNKA 4IQ0A 4JLDA 4OA8A 5JT1A 4G0WA 1N6OA 1E77A 1TCCA 2JRCA 3IX7A 4U7WA 2Q29A 2X4LA 1OXTA 1J6UA 4N6GA 1QVZA 4QULA 2RKOA 3UOWA 1JEYB 1X7ZA 1Q91A 2A8YA 2PKEA 3PG5A 4XGIA 1Y4AE 4KGZA 2RHGB 2NZVG 5KI6A 1V95A 4Q1VA 3KXKA 1KPGA 3JQEA 3QNWA 3QYJA 1R6AA 2NZ2A 2PX5A 3HS3A 3C6BA 1YE5A 3QHQA 5NLLA 1OZGA 2G70A 2IKSA 3EXFB 5ELMA 2Z5LA 1I3CA 2WINI 1MC4A 1QK3A 4H31A 5EESA 5BPHA 2VAXA 5I4BA 5HRCA 1NYRA 1WE2A 2YX1A 3H16A 4OFZA 4QO7A 2JJYA 4R7TA 3AF5A 2EWWA 3IQFA 1IZ0A 2V0CA 4WFKA 4IXDA 4WECA 2Q7XA 4XDGA 1STOA 1H2WA 5IXJA 4YRPA 4MOWA 1CVRA 1VA4A 3LQYA 2Y1EA 2I1WA 3BGWA 1FSGA 1NR1A 3WLSA 4LCEA 4OQLA 4MJ3A 1OASA 3BFPA 2JFVA 1J24A 2DZDA 4HN2A 5JTUA 4D7AA 3L8DA 1XMIA 2KSQA 3GP3A 2XXAB 4X7PA 1W0KD 3NZEA 3LE8A 5IJ9A 3JWHA 5DZSA 1Z5PA 5EJ7A 3C43A 1OH6A 1E79D 5G41A 1TFUA 4L7VA 1E59A 1Z3IX 3EFOB 4A0SA 3NDBB 1K4MA 1OWOA 4D81A 2QW0X 1TQ6A 2HYDA 4KQFA 3FGPA 3GY0A 1TM1E 2W9XA 3AHDA 3IUSA 4NBTA 1QIFA 1TFRA 5A4AA 1VLZA 3N3BC 3IJ5A 4ZAZA 4Z0HO 3SHQA 3TTVA 1J9EA 1DWQA 2R8EA 2OLKA 3STYA 2OV1A 1VE1A 3MWKA 4BVAA 4YYZA 4J7CA 2DWOA 2OHVA 4NEQA 4Q39A 4CQMB 3R2JA 4Q3CA 5BSFA 3G0HA 1R5BA 3KV1A 2BI8A 3V55A 3KJFA 4Q37A 3INYA 1KIFA 4QD3A 2ZXUA 2GXSA 4IW3B 2CEKA 5FBVB 1JVNA 1OI7A 4NVRA 4TKMA 2PGOA 4PR0A 5AVYA 2VHJA 3CRMA 5HJEA 3WL6A 3I6ZA 3JYNA 1WETA 1OHHD 5EJGA 1IXSB 4CTMA 2LDBA 3MCUA 4CLOB 1E3QA 5LQRA 2FH5B 2GTPA 4DNQA 3VYUB 1I36A 4JUAA 2C8JA 4GMXA 4C0KA 2EARA 3TB6A 1QQ5A 2HMAA 4A2PA 3SCZA 1UKZA 1T2VA 1USKA 1Z6ZA 4JENA 4DAEA 1QU3A 1USGA 1RAFA 3W8NA 3QX8A 5FFNA 3GLUA 4KXVA 4HBZA 3GARA 3HYNA 4CI0B 4AXBA 4MUAA 1A71A 3R3SA 4PLFA 4CEHA 3ZHVA 4B87A 4D8VA 2IH5A 4RDHA 5KTYA 4FC7A 3ZXSA 3URMA 4EFMA 1E9RA 2VDKB 1EQUA 2WSMA 1GLGA 2HA0A 1GQ2A 1R18A 4DLSA 1OZFA 1KOLA 1HNXB 3Q3HA 3MSCA 1QHYA 4O2BF 1RIFA 4INPA 2XXBA 1KPHA 4M1QA 4RKEA 4TL6A 5LD2B 4P3NA 1K7CA 3A4MA 3QE0A 5B3AA 2ZIZA 3H2JA 3OY2A 4M7PA 4HB0A 4P82A 3R8CA 5DT2A 1HYBA 1J97A 1FS5A 4MRSA 3NOXA 3JQBA 3A0UA 3DMGA 1I5EA 4FNOA 3GLIE 2BMDA 3V3KA 4BO3A 3V7FA 2BKAA 3IEUA 3M4XA 1U2QA 4L72A 4N8EA 1P19A 5K51A 4LZPA 4LC9A 2OHOA 3DSRA 4US1R 3HXTA 3U2QA 3NJ4A 1A7AA 2OFXA 1INLA 3BRCA 1AGPA 4Y2RA 3SD7A 3EXEA 5BWLA 1BFUA 4O4HF 2YV4A 2D3TA 4RKWA 4EL0A 3RIEA 2ZATA 3ZTWA 5KVSA 3Q40A 3BZUA 3MILA 1WY7A 2O8CB 2I3DA 2V7PA 1H8HD 2NV2B 2XE8A 2YZKA 3EQ6A 5ALUA 3GLIA 4MI3A 4CTOA 3OC0A 3L1HA 2I2CA 4OMCA 5HKKA 1NL3A 4I8XA 2PA0A 1TAHA 4NHOA 1G64A 3QOWA 3ESDA 4K9PA 3GP8A 3U31A 3F2VA 1DXOA 1DLIA 1E5LA 3K96A 2PSFA 3TD2A 3LY8A 1RC8A 3C39A 1HYEA 1J00A 3T7RA 1A7KA 4M9QA 2BYTA 1M75A 3E7DA 3DFFA 1U4NA 3V7YA 1IEWA 5CCBA 3H2YA 3KYDA 4G0ZA 2GTIA 4FI3C 4TTTS 3DZBA 1ZN7A 4FWIB 2FDCA 1L5RA 4Y1RB 1XPJA 5JDCA 1GTG1 3BWCA 3ABIA 3DR5A 4G5SA 4EJ0A 2O3QA 2YDYA 3B13B 3HWX1 1J09A 1Y4SA 4OSOA 1SU6A 4QQKA 4LJ4A 2DMRA 3UPDA 5C32A 3H1GA 1PZXA 1DO8A 1RPTA 3P0JA 3U3KA 1U8YA 2RGRA 5JE8A 3BRQA 2JANA 3L1VA 5ELLA 2QAJA 5LA6F 1GKYA 1W5TA 3NO4A 1BXZA 2AXNA 2FMIA 2ZSUA 4ABTA 1CQJA 1WZEA 4UMEA 4EELA 4D46A 1YUBA 1D8AA 3HC7A 2FDXA 4HQOA 4NFYA 3OLCX 3SZLA 3W3AH 3B52X 3K8YA 1YGYA 4Q3KA 3L6UA 1OXMA 4AN1A 4CQNA 1I5RA 1O6FA 3TX2A 2WJPA 2EOAA 2VSQA 2Y2VA 1NKSA 3EWIA 3BQMB 3F97A 4FZVA 4L4ZA 1YQQA 1BWQA 4EFKA 1Y3AA 3C85A 4H7KA 4B7X