3MFAA

Computationally designed endo-1,4-beta-xylanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
GSDTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGLFVAGKGWSTGGRRTVTYNASFNPSGNARLTLYGWTRGPLVSYHIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTYQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Computational design of an endo-1,4-{beta}-xylanase ligand binding site.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
molecule tags Hydrolase
total genus 56
structure length 194
sequence length 194
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mfaA00
1M4WA 1XNBA 3VL8A 2NQYA 4H7MA 3AMPA 1BVVA 3WXPA 2JENA 1OA2A 2VUJA 3EXUA 3WQ7A 2BWCA 3MF6A 3AKPA 3B7MA 3VL9A 5K9YA 2DCZA 4HKLA 3LB9A 1HV1A 1H4GA 2BWAA 1OLQA 1XNKA 3O7OA 2Z79A 1UU5A 4HKWA 4HK8A 3VHNA 1UKRA 1QH7A 3WT3A 1OLRA 3WP6A 1REEA 3VZKA 4XQWA 3VZMA 1HV0A 1F5JA 2JEMA 3AMHA 1W2UA 3WQ0A 3AMMA 1BCXA 1UU4A 3WQ1A 2B42B 3VZOA 4XPVA 3RI9A 2QZ3A 4HK9A 1UU6A 3LGRA 3AKTA 1XYNA 2VG9A 3MFAA 1TE1B 1XYOA 4S2DA 4XQDA 3MFCA 3WY6A 2JICA 3AKSA 2DFBA 1REDA 2F6BA 1REFA 3VGIA 5HXVA 2BVVA 1IGOA 1KS4A 3M4FA 4IXLA 1XYPA 2B45X 2D97A 3AMNA 4NPRA 4S2GA 1BK1A 4XQ4A 3RI8A 3MF9A 2VULA 1NLRA 3VZLA 4S2FA 1OA3A 2QZ2A 3VHOA 3VHPA 1KS5A 1QH6A 1HIXA 4S2HA 1T6GC 1XNCA 1XXNA 3WP3A 2NLRA 1H1AA 3HD8B 1PVXA 1H8VA 2VGDA 2DCYA 3VLBB 3WR0A 3WP4A 1H0BA 1AXKA 3AKRA 1ENXA 2DCKA 1C5HA 1C5IA 3AKQA 3WX5A 3ZSEA 2DFCA 1YNAA 3VZNA 1XNDA 2C1FA 5K7PA 4HKOA 2B46X 3AMQA 3B5LB 2DCJA 1H4HA 3WP5A 1OA4A 3VZJA 5EJ3A 2BW8A 2D98A
chains in the Genus database with same CATH superfamily
1ZBA1 4XFAA 1SCSA 3MW4A 3G7DA 3O1VA 3AMPA 5CFDB 3LEIA 1H9PA 2O14A 3S30A 1POV0 3AFKA 4QX7A 1QJY1 1MS0A 1X8EA 4HVOA 4UAPA 1H1IA 2V4VA 2WO2A 5M0TA 3NJZA 4IEXA 1FXZA 1BJQA 3E6DA 4E8CA 5HCHA 1QJX2 1UY0A 5FQ0A 2P1BA 1S1AA 3SLIA 3H3UA 4FFHA 1KEXA 1AR92 5IK4A 1UO9A 1BVP1 5JDBA 2D6LX 2GMEA 1R1A3 2EAKA 4Q4W2 4YVWC 3WCSA 4B4RA 1O4YA 5IK5A 1Y9GA 4AWDA 2ID4A 1VAKA 5FBJA 5T50A 4BM8A 4MGZE 1VB4A 1SHWB 5B2GB 4DNYA 2YY1A 2GN7A 4Q4Y1 3USSA 1AL21 5IFTA 4Y20B 2VECA 3BB6A 1S0FA 4YG3A 4QB2A 4UFKA 1LTEA 3WSOA 4XTPA 1KXGA 4IV1B 5FYZA 5FZ4A 2DVDA 4AFBA 4CCMA 2JEMA 5EJZB 3WOGA 4AVAA 2AC1A 1RXGA 2Y8KA 2MEV2 2W0XA 3B93A 3CKHA 2ORZA 2PXJA 4P9LA 3WNPA 1K3IA 3I2FA 1LOEA 4CVUA 4NHYA 4I0WB 2VMIA 5HCFA 4XMAA 1O6UA 1COV2 4Q1RA 1OFSA 1XU2A 2QZ3A 5EWSA 4IE0A 1OXCA 3BODA 3ZYHA 1E57A 2JD9A 5C9AB 1RYYA 5KXCA 1Y7BA 1UXXX 4JAAA 5L9RA 5I0SA 2NN8A 1ZZ9A 4YPJA 5A3NA 1REDA 5FR3A 1LULA 1OLME 2H0BA 2WNOA 2VUCA 3H1WA 3GJAA 1JOBA 2ZACA 4H14A 5A3MA 5JXHA 2WKKA 4NOTA 4NHLA 4AEDB 5E6HA 1NUKA 2RJ2A 1CD3G 1MQTB 4GALA 1R1A1 1GUIA 2JKBA 1RUD2 5FRAA 1EYBA 2Z42A 2W9XA 1BZWA 1RUC2 1O8SA 1ZBE3 5FYIA 1AYM3 4PBPA 4JTOA 1O4ZA 4COYA 5FYUA 2XQRA 3L2HA 4WVZA 2EIEA 1SBFA 1RGSA 3SCFA 4D8MA 2VE1A 1H1AA 4FPGA 1DQ6A 4NHXA 2C9AA 4UF0B 4XJAA 3PIJA 5JR2A 4RR3C 1JZ5A 1DGWA 4TWTA 2WZR2 3HR9A 1ACCA 5F32A 2HJIA 1W8NA 4LBOA 2VCMA 2J22A 4MOAA 2EXIA 4YG0A 1C5IA 3ELNA 5H9PA 3NMBA 3M3QA 4DUXA 4AI8A 4MGTA 5IWFA 5T5OA 3AMQA 4QM9A 2WA4A 1BEV2 1EAH2 2VZ1A 4YRDA 2FCUA 4OI1A 3TOJA 4N7UA 4A7YA 3ABZA 3VBUB 3J26N 1SG3A 4TZDA 4YM1A 4BJ0A 3ECQA 5GM0A 4CEWB 5JAXA 4ASMB 3JXSA 3GXUA 2CGNA 5LASA 3RMXA 2B5HA 2J7MA 3DECA 5CKMA 5FZ1A 4MGIE 3BTZA 4XC9A 1VBB1 4COWA 1W0OA 2ZEZA 1GOFA 5JZGC 3NVCA 4Z07A 5FPBA 5L7OB 3VBOA 2RS11 3NRUA 1A34A 3LIHA 1ZBE1 1F35A 2ZGUA 4XF4A 1AR93 2VH9A 2HLEA 5KC6A 2E26A 2PHWA 4Q4W3 1HB1A 2YBSA 1LEMA 2E7QA 2GDFA 3LB9A 1DHKB 1NA1C 1QXRA 2VZOA 1DYKA 3JZVA 4I02A 4YM0A 1H6YA 5EV7A 3LEKA 4NHKA 5BYNA 3OG2A 5FZOB 3VBSA 4HK8A 3OEBA 1NKGA 4AEMA 3VDBA 4ONUA 3ZVXA 2A1XA 2VMDA 1CAWA 2AH2A 1UZZA 1YJLA 2HWC2 2HWE2 1UKGA 3IAPA 4GWNA 4M01A 2WFF2 3AL6A 4GAZA 4PDWC 5G05L 2ZHNA 3K77A 2BTVC 3D0SA 4KWKA 2MEV3 3VDCA 4CUBA 1W8UA 1ZRRA 2ARBA 4XF3A 4EYUA 1RUF2 3WQ0A 1NY72 2D7FA 3ZSMA 2OKXA 3OPTA 2YV8A 1W9YA 4M3CA 1J83A 1COV3 2QUOA 2CHHA 2JECA 4N90A 2QCSB 2EXHA 1IQAA 5FQ0B 1SACA 1GKBA 2QQKA 3LGRA 2VG9A 3DUIA 2ZGPA 5F8PA 3K4DA 4FOWA 2JDZA 3BPSA 3ZYGA 4CPBD 1VBA2 4LA3A 3MW2A 2PHXA 2BVVA 3ZPYA 3M3EA 1AR91 4DRRA 4RQPC 2WNVC 1W0NA 2WSUA 4Y5SA 4CEYB 4Q0UA 3LF7A 2XVGA 3VHOA 2BEOA 1IS4A 1RUC3 3AZZA 3LA3A 1K5MA 1DQ1A 4TTGA 1V6KA 3O12A 4PI2A 4QHOA 4CDXA 3KVBA 5LA1A 1JZ8A 4RGAA 4X8PA 1B35B 2KA3A 4DXZA 4CCLA 1C4RA 3H1MA 4TXWA 1OSGA 2JG9C 3NKTA 3O5SA 5FLJA 2WZR3 1MZEA 1G6NA 4E4SA 5FUNA 2PLV2 4NROA 1V70A 4XIOA 4YZ2A 2DCTA 2YGLA 3E1F1 5FZAA 4BXFA 4XJ8A 5AFBA 3T2QA 2BBAA 4OUSA 3LQCA 3N36A 5GLUA 4AOCA 1LHNA 1WBFA 2OW4A 4MGYE 5EXOA 3VBHA 3ZKYA 4HVQA 1LHUA 1EAH3 4Y22B 3KSCA 4CP2A 2FDJA 5JMOA 1JZ6A 3ALQA 3GZAA 3AK0A 5GZDA 4UFIA 4YWAA 2BYVE 4BOWA 3Q8FA 2GNDA 2GC3A 1X50A 1GFF2 1R081 1RUH2 5FZ9A 1J3RA 3DXTA 4BQ3A 1RTVA 1JZ3A 3N9NA 5C5TA 1YC61 4IGQA 5C4WC 4IEPA 5ACA2 2PAEA 4XDQA 3OOXA 1XSQA 4N43A 1O3RA 2XOMA 3KS7A 1ENRA 4NWWA 1U5IA 3TEWA 3OSDA 5DN2A 2W68A 3THTA 1RUC1 4MLOA 1PK6B 2WJSA 1JZ2A 1O3SA 5EIYB 3UGFA 1JZ4A 5FZIA 5IJRA 4MADA 1ZRFA 1VRH3 2RS31 1OKOA 1F4HA 1W9WA 2P34A 4JRLA 5C8WA 2QTWB 2V09A 2D6OX 3C7GA 4L2NA 5FO9B 5K9YA 3LOBA 1ULPA 1NCQC 1W6QA 5FOBB 3OBRA 4FOYA 1OLQA 1RB8G 2JG8C 1CJDA 1N47A 5GZGA 1MZ5A 3E97A 2WZR1 1JS9A 2RG4A 1ZREA 4XZPA 3WDUA 3HQUA 3PU8A 1UZVA 1GWMA 2HWC3 2BOJA 2MHFA 2RM21 4FPHA 4WM8C 4KQ7A 5ABJB 2WFF3 1ASJ3 4LO8A 5FY1A 2XUMA 1ND3A 4A7ZA 1FMD3 4YVSA 2UWBA 2XBO3 3EB7A 3VBSC 3AMHA 3N7KA 2JE9A 4EROA 1NT0A 5ISLA 1RMU1 2V72A 1Q8QA 3BOWA 3ZPOA 1BCXA 2YMZA 4RS5B 3H3ZA 3OJBA 3IMMA 4KU7A 4UW5A 4YG6A 5I8YA 3CJIA 3VBOB 1K42A 2CDPA 1OF4A 1NLQA 4M0HA 5IUQA 3ZYRA 1UU6A 4XXAA 3ZFFC 1W6PB 5A6YA 3MIFA 4XJZA 4S2DA 1W8FA 5C3OA 5AFEA 1AJKA 2WUHA 2JICA 4PJYA 5CYYA 1VBA3 3IIAA 1I6XA 2C4XA 2ZX3A 5LY1A 4RHV2 3P5BA 2B9UA 2ZPXA 1W9FA 1LOFA 4QDRA 2Y64A 3VD4A 4GH4C 1XE8A 1VRH1 1ZZCA 1KS4A 3ENRA 3LFMA 3PDQA 5KHGA 1CAWB 1WCSA 4O65A 1N1TA 4XDPA 4XHXA 3ZFEA 2UY9A 5L19A 1ZRDA 1RITA 1ENQA 4XUOA 4KMQA 1RC6A 5BNQA 1W90A 1HIXA 4OLLA 1QIQA 4ZKTB 2LUWA 2E6VA 4EWDA 4GMP3 5CISA 2IVJA 2LM3A 3H0OA 3LOIA 1ASJ1 1WCDJ 2X5IA 1MEC1 2J1VA 4YM2A 1YO8A 4DFSA 1FMD1 1HLCA 1SLLA 2VGDA 2PLV3 4PT6A 4CDXC 1LGCA 2Z4FA 2DCYA 2XBO1 5FP7A 1VBE2 2CV6A 3ZXGA 3H3LA 1NY71 2ZZJA 3IAQA 3U75A 4BISA 4IE5A 2P6HA 5A32A 1PGL1 2DCKA 3GHMA 4YZ1A 4TN7A 5C8CA 1XB9A 3T09A 1EY2A 1V9U2 3KHBA 3MUY1 2WZPP 1H4HA 3WZ1A 3WP5A 1X9TA 1PGW2 4TSVA 4AW7A 3HVDA 3DKWA 2XDVA 1RUH3 1UD1A 3LD8A 3Q9OA 2GMPA 3IDAA 4OVEA 1VBA1 2K2SA 1QKQA 4CDWA 4OHXA 2UURA 1ULEA 2XJSA 2FZ2A 3RRDA 5A7SA 4HPKA 2X09A 4GKYA 2VOWA 1NCRB 2O8OA 4JKMA 4EN6B 5ACA3 3KV9A 3OGSA 2DTYA 3D5OA 3ES1A 1S0GA 1YYNA 4LK6A 1SLBA 5KWRA 3N35A 2ADDA 3KMHA 4B4PA 2NM1A 1H6XA 1RUNA 3G6JB 1HRI2 1PVC2 1N3PA 3MHZA 5F2WA 3U37A 2ZAAA 4QPIB 5HCBA 2OIIA 4ISRA 3SKJE 5HXMA 4MSVA 4RL7A 4GMP1 1JOPA 5K0UC 3IPVB 4XFBA 3MIBA 4MXVA 4KH9A 4WM7A 4EZ4A 2VTXJ 2DVAA 5I0RA 3OBZA 2W1UA 2Z2SB 2HWF2 2ZABA 4HN0A 4LQRA 1T2XA 4XURA 2UYAA 5FJKA 3UESA 1HRV1 1H8TB 1HQLA 3IN9A 2MNGA 4LLOA 4QKBA 5BNNC 4OHYA 1QNWA 3KCCA 1JOJA 1YQ2A 5AC91 3RQ0A 3V56A 2BERA 3BGAA 3BU7A 4FPCA 2C24A 2A3XA 1W3XA 3I7DA 2Q30A 3LAGA 4Q0PA 1U5ZA 4Q2FA 4NIAA 1O4TA 1PIV2 4DUVA 4NIDA 4GZ9A 3FBYA 3ZSJA 2E53A 3AP7A 4A2UA 1CZTA 3RI9A 2B9VA 4UBHA 2JDHA 3PVEA 3K51A 4M3CE 1W8WA 4LLFA 5ACA1 2B4KA 1CPNA 5D8AC 4DZGA 1UIJA 4MH0E 4AQ6A 2AYHA 1DU3D 2WSVA 4JRAA 4RHV3 1W6QB 1OKQA 4LNVA 2VJXA 5D2AA 4CDQA 4QGMA 3ZYIB 5FXZA 5FMCA 3WNOA 5IK8A 4JQRA 2Y6KA 4RSUA 2P3JA 2WS92 3DYOA 3VD5A 3V64A 2F4LA 4IXLA 4Q4V1 2Y38A 3AYEA 4QD2A 3SC7X 1JBCA 3ILFA 2LALA 3LFIA 4W8JA 2ZEXA 4YVSB 4FSJA 4AVTA 4L11A 4I01A 1P8JA 2QJVA 5EQUA 3UETA 2WQ8A 4LBMA 2C26A 1N3QA 3WW3A 3ZSKA 1LU1A 4DS0A 1BQPA 4NE9A 1H8VA 3W58A 1NXD1 5FYYA 1VBE3 3I59A 4ZU4A 3NAPA 3PVOA 2X8KA 2W52A 2NP0A 4XHBA 3CZUA 4JQTA 4AFMA 1C5HA 1RUJ1 1QJY2 1SZBA 4CXYA 1UIKA 1D4M3 4CDUA 1JN2P 2Y6LA 2C1FA 5C5UA 1V9U3 3WF1A 3CF6E 5FKBA 3N7JA 2DVBA 3ACGA 4Y1XA 1C8NA 5FY8A 5CFDA 5BNOC 4LBNA 1AR81 4HSJA 1WA4A 2FDHA 4PIYA 1Q43A 4RHV1 5C8CC 5HPOA 3HAGA 2BP6A 4JGYB 3AZYA 5LK5A 4E4ZA 3L2YA 4NWVA 2R30A 1OURA 3S7IA 4FPYA 1QDCA 3GALA 1AL0G 4K8FA 4JKLA 2VXRA 3EXUA 4FTSA 5C71A 1HRI3 1PVC3 3O1TA 2YXSA 5FK8A 2X5IB 4BZ4A 4N53A 4L92A 1X8MA 1GOGA 4Q4Y2 2VMCA 2YZ4A 4TLFA 3AKPA 5DAQA 3FUQA 4V2WA 3B7MA 5JXIA 2ES3A 5HV0A 4ZXKA 4BHPA 5F5AA 2CNAA 2BV4A 2DCZA 1SDWA 2VL4A 3AJYA 4CA9A 2OPWA 3O0XA 2VVEA 3POJA 5JXGA 3I54A 2BWAA 1W6NB 4Y20A 1UU5A 1NE4A 3JD73 1VBE1 4NRMA 2CDOA 1RXFA 4A41A 3KT1A 3ZOIA 2IXCA 2Q1ZB 4E9KA 4IV1A 3CNAA 4ZS3A 1UNBA 1XSRA 2JXAA 2W3JA 1BKZA 1OQDA 4BLJA 5D1IA 3WT3A 3E6BA 4IEZA 3WP6A 4HMZA 5DQ0A 4CDWB 1UOFA 3NQHA 2ZHKA 1D4M1 1D2QA 2A5ZA 2W1WA 2CWSA 1UX7A 5ANNA 2HEWF 5FMOL 2ZGTA 2EIDA 1PGW1 3PJQA 2PELA 4Y1YA 2A70A 3TWIA 3WW1A 3N7MA 2BNMA 4W6YA 5EHDA 5C9AA 2VMFA 5E1RA 2ORXA 4OHZA 4JGZB 3N9QA 4MGSA 4DXRA 5J3UA 3KV4A 3N4MA 3DKQA 2XPJA 2N7GA 2VVFA 2ZGKA 2ETEA 3MFCA 1H1MA 2AACA 2XKPA 3T0AA 3GM8A 3AKSA 1HRI1 1PVC1 4QPGB 4AEDA 2OVUA 2FDIA 1MQTA 4JX0A 4AG4A 5DAVA 4CP0A 3C2UA 5HXVA 4AYUA 1ND2B 2WS93 1CN1A 4DY5A 2W94A 4FOQA 2FD8A 1X9PA 4MV2A 5FXVA 2DWRA 2YUEA 2VZRA 1ULFA 1YWKA 4H3WA 1LGBA 1KFXL 1C57A 2IXHA 3Q8CA 3H9AA 3MV11 1CX1A 3I2HA 1A8DA 1S0JA 3FLTA 3FBMA 2VUDA 4UF0A 3GYDA 4I3GA 3JD71 2AEYA 3QD6A 5JPMB 1UY1A 2WR9A 4B7EA 2VW0A 5F3CA 3FHIB 4NJ4A 4OUMA 1D2SA 3W5MA 3DPRB 4HFSA 4FVVA 4HZFA 1POV1 1PVXA 2BDRA 4JDNA 3EHKA 3DYMA 4JZRA 4CCKA 5BUVA 2BBVA 2RE9A 3HEIA 1V6JA 4BQWA 3HN1A 5CEHA 2WA3A 1LAJA 1V6OA 4IV3C 1Q8OA 4KNCA 1GP5A 4EN9B 2DTWA 1KJRA 5KR7A 1L3JA 4FFFA 4WBBA 3ZSEA 1MPXA 1VBB2 3HQXA 4JV4A 1XNDA 5DG2A 3VBUA 2BOIA 4XILA 5LA9A 4NR1A 2HYKA 1TMF2 4CEWA 4OI0A 1CESA 2OQ6A 2OZ6A 3IKWA 4ATFA 2RS12 1KDMA 4IERA 5FUIA 1JMUB 3VDDC 2PAKA 2O8QA 1FPN2 1H2KA 2WQ4A 4MXWB 1UF2C 4AQ2A 5A6ZA 3IMNA 4AI3A 3OGGA 3MPPG 4FPJA 3T2PA 1PO23 3KD4A 2XJRA 2WS91 3MV01 4FPKA 3MLJA 5FZKA 4BK4A 1OT5A 5DUWA 1OA2A 3AYAA 3E5UA 4LORA 2BRTA 5LA2A 5CFCB 2CAVA 2X53S 3UKTA 1Q8VA 3OEAA 1QJZA 4WVWA 5FYSA 3BPZA 3POYA 2A7AA 3FFZA 2W08A 3BYWA 2QFEA 3OY8B 1WW6A 2D43A 3RZJA 4TYSA 4YGDA 1IG0A 2GC0A 3AM2A 3RJRA 3WNMA 4AQSA 3O1SA 2YC0A 1EP0A 3DL3A 3U10A 1RL3A 5FZOA 3O1UA 2J1EA 3SMHA 5LATA 1XQNA 2PFWA 5F1RA 5FCCA 2WO7A 1SFYA 3CDZB 3O7OA 1OPOA 1ENSA 4PI0A 3ZN4A 5JVVA 1G9BA 2KM2A 4LIUA 3ZX7A 4PIZA 5T55A 3VHNA 1DF0A 3UNPA 1CAVB 3M3OA 1GYKA 2ZGQA 1JHNA 2IXIA 2FCVA 3O1RA 3ZXJA 1NG0A 5FKCA 2VBPA 5A3LA 4B1MA 1JUHA 4FQ4A 1M06G 3V0BB 3TEZA 4CCJA 3A4UA 1WCQA 2KR2A 4D7SA 3ZFGB 4FBFA 1C3HA 4IE6A 4IV1C 3ZN5A 2BZDA 3AMMA 4YW3A 2W1QA 2XVLA 5LCWL 3SXWA 3WQ1A 4LR4A 5FWJA 1UYZA 1ZRCA 4N53B 3RWKX 4Q0QA 2CYFA 4XF9A 2Q8CA 1W05A 4HOOA 3D0JA 1PO21 4LBLA 5CIRA 4EE2A 3IDBB 3P3PA 3Q8BA 5CB7A 3WCRA 2D6MA 4INDA 2D40A 2DVGA 1X82A 2E63A 3FX3A 4ATEA 4DB5A 1QWRA 4CEYA 2JDNA 2NPIA 3INAA 4RGGA 2AGSA 3ME2A 1J3PA 5BXXA 2DF7A 5GLZA 4CU6A 3I2OA 1Y9QA 4JKKA 5LRRA 2W5FA 1GNYA 3HN3A 4S2GA 4AAPA 4QQLA 4AHZA 4CTEA 4QX3A 5GZEA 5C3RA 1OA3A 1B35A 4QX8A 4IL7A 5T5PA 2H6CA 4RGKA 4ASLA 4E27A 3A7QA 5JUVA 4KGQA 1H2LA 1HXS1 3RZHA 4P9IA 2VM9A 1U12A 3ZDVA 2WZ8A 2NLRA 4XVHA 3CO2A 1LHWA 2BGPA 3HD8B 3W9AA 5BNPC 2SBAA 4UW4A 4LEJA 1KRIA 3VN4A 3RS6A 3KCXA 1FNZA 5C6CA 4ZXEA 1R082 3VLBB 1KITA 1O5LA 4CSWA 1DG6A 3RMYA 1I3HA 1UX6A 1K45A 2DYCA 4Y22A 1YQ8A 4AK3A 1VBB3 4AI1A 1RJ7A 4X8NA 3WX5A 2R7EB 3VZNA 4BQ2A 5FO7B 1TMF3 4YVWB 2XUEA 1C8M2 5I91A 1MZ6A 2RS13 2GC1A 1URXA 3NV4A 1I5PA 4JDMA 4BQXA 2RS32 2D3PA 1FPN3 3W5NA 1A78A 4FI9A 3VBUC 2EAAA 4L97A 1BVVA 4G4FA 2G9FA 1W3VA 1WMXA 3QLQA 1YXWA 1PK6A 2DURA 2ZGSA 1CVNA 3AJZA 5C3QA 3E6CC 4FPLA 4XBLA 3U07A 3S5AA 5A7OA 2WL1A 1HJFA 4EN7B 2DUQA 3R4UA 2JE7A 1JYTA 2RM22 3ZYPA 5FZGA 3K3NA 2IZWA 4UWDA 1OF3A 2RMU1 2UWAA 5LA0A 4XUQA 1XOYA 2JIGA 3GZUC 4OQ8A 2GZWA 1AX0A 1OVSA 2W87A 3OGVA 4OULA 4R9AA 4BA6A 5FDBA 5ABJA 5L36A 1RMU2 3K3OA 1W6OB 1ULCA 2TEPA 3B9IA 3NNGA 5FMOS 2RVAA 2WINB 4BWOA 4DXSA 5IYYA 4HKWA 4A42A 3LA2A 2W39A 2GNBA 2UY8A 5KXEA 4Q0SA 1GU3A 4BDVB 4EV0A 3R0RA 4Y33A 3T1LA 4COZA 1W8TA 1GANA 2PHTA 2CWMA 2CGPA 1OUXA 2VBDA 1QGLA 4K6BA 2RS52 1V00A 3B3QE 3NW4A 1TMF1 4YZ4A 3A23A 5IVEA 3ES4A 1OD5A 4RS5A 5SV5A 5J7MA 2PHFA 4FFGA 4XUPA 1TNRA 3RWNA 3LWCA 3ACFA 2ZJCA 1PM7A 1W6PA 1W99A 3N9LA 2OT7A 1VRH2 2Q5TA 2A6ZA 1FPN1 2GNTA 1VIWB 3PL0A 4BK5A 5DZEA 5JSRA 1SLIA 4RR3B 3DGTA 3TB0A 4YARA 3UGHA 4FP3A 2P3KA 2DUOA 2XMLA 3B69A 3U4XA 4NIHA 1IHMA 5GLTA 1DBNA 2VVDA 3AP6A 3MW3A 4J1XA 2PHDA 1JUIA 1S0CA 3Q8EA 3NNJA 2VCCA 3FJSA 3POIA 1US3A 2LS6A 1ASJ2 3IWZA 1MEC2 4GWJA 2RDRA 3AYDA 5I0UA 3AFGA 4ES8A 3M4FA 1FMD2 2VZSA 3VKFC 2XBO2 4HVRA 3TBDA 4LK7A 1Y3TA 3SH4A 2WFPA 3WDVA 5HCAA 1PGL2 4NVPA 4PLMA 4S2HA 2WWUA 4O9GA 4DMIA 3WINE 2XQXA 1YQCA 3MIEA 4QHBA 5FPLA 1D4VB 4RA0A 1J3QA 1OFNA 1XNCA 3HT1A 3OB8A 5FZ7A 4LUMA 1HX6A 3RFRA 3KLSA 2WDBA 3CLPA 2YU1A 4LO7A 1YFUA 4LA2A 4XOGA 5FZ8A 4CE8A 4CUCA 4QX2A 5JZGB 3GZEA 1R083 4ET7A 1UY4A 2XJUA 2IC1A 2JB4A 3ACIA 3M1HA 4XFGA 1J59A 4LKSA 4HONA 2B7YA 5L73A 1O59A 2Y6HA 4A45A 4AHYA 1WCUA 1C8M3 5A7QA 1H9WA 4NAMA 4IW3A 1VJ2A 5JOYA 3OYWB 1NCRA 1G86A 4CCNA 2RS33 2W91A 2XKOA 5TSWA 3OUHA 1SMVA 4H7MA 1A6CA 1GQPA 1GZWB 1PMHX 5JSOA 3WNNA 2B39A 2E31A 1BBT3 2QQOA 3B94A 3DXUA 4PDWB 1RUI3 2L9LA 3BIWE 1QOOA 2VNVA 4E4DX 4Z92B 2HYXA 4QPIA 4WVMB 3T4VA 3TEYA 1G8WA 4PIXA 2R6QA 5FYBA 2FDKA 1HRV2 2RM23 1KDKA 2H0VA 3PJYA 5FZMA 3IPVA 1SFPA 3LA7A 2HWB2 1F31A 5F39A 3LDBA 5AC92 2WLQA 3ZXDA 1LODA 5FAXA 3VL9A 2JDUA 3QH6A 2DUPA 1ONAA 5LW9A 1H8TA 1HB2A 1RMU3 3WEZA 4X6RB 4PLOA 5BY5A 1LECA 1O8PA 4SBVA 4AL9A 1W9SA 3V0AB 3HNYM 3I2IA 3T08A 4BXSV 2PHRA 5FZCA 4D7TA 4ISQA 3I4IA 1CZVA 5SV8A 5CA6A 5JR7B 4RQPB 2GP3A 4LBQD 2WNVB 3FHAA 4LHLA 2A3YA 3OD4A 2RS53 5FPAA 1QJU2 5GJ6A 3AB0A 3AZVA 4BMBA 3FZ3A 1C8M1 3HQRA 3A0KA 5DZGA 5H9QA 2Y6GA 1AJOA 3M7AA 4E2GA 3FC0A 3PUAA 1GQGA 4M4RA 5CVRA 1UW8A 3T2TA 4E2SA 3NNMA 5CBLA 3KWVA 2ARCA 4P00B 4Z2AA 2GN3A 3ZYJB 3HT2A 2XXZA 1NZCA 4O9EA 2ZGMA 5L9BA 1X36A 4HETA 1IPJA 2W1SA 2VW1A 5FMDA 3RPQA 4Q4V2 4CXWA 1BBT1 3MGUA 2JG9B 2HEVF 1RUI1 2KD7A 3MLKA 3THCA 4LO4B 3VBOC 1JYVA 2BQPA 2WC2A 4TLGA 5C7GA 3S0MA 1ULDA 2Y33A 3MYXA 5LB6A 5JI7A 4KGGA 3WQBA 2P3YA 1ZYBA 3M2MA 1GLHA 1QF3A 1WMEA 4QU1A 5F3IA 2JDMA 2YYOA 1NLSA 1MEC3 3BTXA 5IVBA 3RZKA 3HPNA 4JHTA 2OQ7A 4QDSA 3IIIA 3ZLIA 1BK1A 5A7WB 3JBG3 3E5XA 3VKNA 3A21A 2BVBA 4AHXA 2RHPA 4UFMA 3LSEA 4D6RA 4UFLA 3GJBA 4LBJA 4BCUA 4HL0A 4P14A 5G04L 5T5LA 1RUJ2 4PQ9A 1KGYA 4LUKA 5C4WB 1WBLA 4NPMA 3C7EA 4LMFA 3ZN6B 2EVXA 1WD4A 2GMMA 4W4ZA 3I8TA 1BHGA 1DLLA 2D5HA 2PQQA 2RS51 2BPA2 1AR82 1PX4A 1LHVA 5JOXA 4NN0A 3RNSA 2P4EA 3PMSA 2V4AA 4WV8A 5A6XA 3J7LA 3KGZA 4Q8KA 4K8RB 3AYCA 3S5QA 1VB2A 4Z8BA 4HXCA 1VMFA 2OS2A 3OPWA 4DOUA 2W95A 4Y1UA 1NCQB 3OPZA 4Q26A 5FV3A 2JG8B 3IDEA 4JGYA 5FPXA 3ETQA 1I9RA 5FUPA 1NXMA 4Y4RA 4CU8A 2QNKA 4Q4X2 2XL7A 4WM8B 2ATFA 4GD4A 1ZVFA 4LO5B 5FJHA 3RYRA 1VBD1 1Z78A 2DV9A 2ZAHA 4I0BA 5FIXA 4META 3WXPA 1WUVA 3KHCA 3BIEA 1K5MC 1DCSA 2XJQA 5FO8B 5FZDA 4LBKA 3I49A 1NYWA 1OBNA 1HRV3 1UOJA 3KF5A 3JBG1 4C8DA 5FP4A 1U0AA 1FV3A 2J1RA 1TG7A 2QBXA 1QQP1 2HWB3 5AC93 4V2VA 5CKQA 1VALA 1WKYA 5GALA 4K7JA 4NIIA 4P02B 1W6NA 2A71A 1JYNA 1D4M2 4ZONA 4ZU7A 1DP0A 5FY7A 3ZFFB 4AVBA 5I8TA 2FQPA 4XAEA 3ZIXA 1UY2A 1YFWA 5E8AA 5IAVA 2ZZQA 2O0OA 4U2AA 2Y26A 4AXOA 4MVTA 1XBFA 1MVQA 2FBEA 1SPPA 1UKRA 4XZUG 3QCWA 3VBHC 4GH4B 3HOBA 3VBFB 1CIYA 2JDPA 4UFJA 5JPNB 5FZHA 2PA7A 1QJU3 1JH5A 1MS8A 4E8DA 2K9ZA 1ALYA 2D3SA 4ZU5A 1ODMA 2A6YA 3URFA 1IZ3A 2V5DA 5DAWA 1N1YA 2HBTA 5GLVA 1W2UA 4JGZA 2LW8A 2G4IA 3AX4A 1QXJA 3J9SA 3IB3A 1AUYA 1UWWA 2QQUA 3S6PA 4CP9B 5KHJA 2WAOA 4GULA 3S57A 4N43C 4Q4V3 5E89A 4YFWA 1S0EA 4YW4A 2MPFA 4QPGA 4M0NA 1IG3A 1LR5A 2GP5A 2W2IA 4J25A 2OXBA 3LE0A 1IQDC 5F3GA 1ND2A 4OMCA 5FY5A 3HBKA 3JD72 1CX4A 4W65A 2VOTA 5B4XA 3THPA 3ZXFA 4I09A 3MICA 1VBC1 3GCWA 1ZNPA 1RJ8A 4HSLA 4QDQA 3I3MA 3SKVA 1JYIA 2HWB1 3IZOA 1IS3A 4XABA 4K1ZA 5A3UA 1C1FA 3PTRB 3BCWA 1I5ZA 1IGOA 4Y5TA 1QMJA 4NPLA 3WF3A 2J42A 2TBVA 5FXWA 5ERLA 2PQSA 3TYJA 4Z2WA 3RI8A 4XMIA 3WF0A 5FREA 3MLLA 4M4PA 5EJ1B 2ZHMA 1UMIA 4LOSA 3H8OA 3POBA 2ZMLA 3MEPA 3DPRA 1SQ4A 1J1LA 1RUJ3 2E9QA 2PAMA 3OGJA 4R4ZA 1BMV2 1RVF2 4N7IA 2VXJA 1ND3C 4DRVA 4HN1A 4RN5A 5J09A 1CJPA 4YVSC 3WV6A 4FPFA 3N7LA 5FZ6A 4EWAA 4P9YA 2WO3A 3SEPA 2JDKA 5IK7A 1W8ZA 1QJU1 2P3IA 3I2GA 1AR83 4FT8A 1FATA 4A3ZA 3OUIA 1OC1A 2DDUA 4XF0A 5KC5A 4IESA 4YW5A 3CU7A 2CTVA 4MGKE 4XCBA 3CJIC 4D3WA 1AXKA 1YCIA 4FAHA 1H30A 4AI0A 1ENXA 1QY4A 4Y3OA 4Y26A 3W59A 3D6EA 3ZXEA 5K0UB 4DO0A 2VC9A 5FWEA 3H42B 4IGOA 4COUA 3CJXA 3LPFA 1AR63 3I2KA 3SQOA 2R071 1WLDA 2EIBA 3DYPA 1GSLA 4MXWA 1OH3A 1YQ6A 1LOFC 4YM3A 1OA4A 2YPDA 3BTYA 5JOWA 3PUSA 4Q4X3 5EYYA 4R4XA 2NMOA 1Y43B 1V6NA 5CFCA 1R64A 3SH3A 4PQQA 3ZFEC 3GZTB 5LWBA 1HB4A 1Q8SA 1XC6A 2D6PA 3Q8AA 2R16A 3TN91 3HNBM 3OY8A 4ZY9A 4KBZA 1OQ1A 4QB6A 5A3TA 3AVRA 4HANA 4LKFA 4NO4A 1UZWA 4WZCA 2X5IC 5DUUA 4PBOA 3GBWA 1HKDA 2OPKA 4C91A 5GZCA 3FWEA 4GWIA 1VAVA 2P5BA 4GMP0 1QOTA 3UKVA 1HV1A 2ENRA 5D8AB 1DZTA 1CAVA 1JW6A 3VKLA 2BU9A 3J8F3 1OLMA 5CG8A 2C9KA 4KL1A 4QPWA 2QKDA 4CPBA 3NJYA 2WNUA 1VMHA 3T4HB 4GXLA 1GNZA 2VU9A 5ANQA 2VUAA 3V0BA 4D69A 4QU2A 2XLGA 3ZFGA 1MS9A 4LE3A 1PO22 1WW4A 2WAAA 1ZZ8A 4DXTA 2OYZA 4EJRA 1GWLA 2JIJA 2B8MA 1LKNA 1QU0A 4AI9A 4CDWC 3O1OA 1AR61 1SLAA 1DQ0A 4LTAA 1PO12 4GB32 2ET1A 1LENA 4QGNA 1EUUA 4W6WA 1DZQA 2GH8A 3JUUA 4Q4X1 1UU4A 3W20A 3F2ZA 3CBNA 1VMJA 1TNFA 2G9ZA 3GDBA 3OF1A 4LO6B 1FOD3 1U5YA 2QQNA 1NZIA 3L9JT 4K1YA 4R8HA 5DUVA 5KXDA 1G9AA 2WZEA 3CL1A 4UFHA 4D6SA 3POSA 1FI2A 1HXS2 3POEA 4BLIA 1PM4A 1AF9A 1U5XA 4IEVA 4Q29A 5KHIA 3U4SA 2R0FA 2JE8A 3VKMA 3W21A 5IVVA 3OTFA 3CQOA 1POV3 2A3WA 2NYYA 1S2BA 2GSYA 3P1IA 4AEKA 4EQVA 4F7ZA 4WM7C 2G19A 1SPPB 1NQDA 1PGSA 1VLNA 2GH2A 2B45X 1WLTA 1GZCA 3MBWA 4OI2A 3AXEA 2XLAA 4BH9A 3ILNA 5BNOB 4FP2A 4XBNA 1QDOA 3WG1A 2G9GA 2Z69A 4Y5Z0 1RVF3 3J8F1 1SLCA 1LOGA 1CONA 2WLPA 4YGEA 4AAXA 5C3SA 3VUOA 4FPEA 2YU2A 1GBGA 1OHFA 1CGPA 1GICA 3GBFA 1E5IA 2PHLA 4G3YC 2E33A 1AR72 4H55A 4LT5A 1NE6A 1ST8A 1W8OA 1YI7A 2YC4A 4PCRA 2R1BA 3AZWA 4XAAA 4YVWA 2FDGA 2VCBA 4NUBA 2A75A 1XE0A 1DGLA 4KWLA 2O1QA 4P9WA 4AGRA 3TRSB 3T1MA 5C3PA 3I3DA 5A3PA 5J1XA 4OCTA 4JC1A 1FOD1 4CDQC 2WYFA 2R49A 1V6MA 1W6MB 1RUG2 1GP6A 1YLLA 2LTNA 1YEWA 2RDNA 2Y6JA 1CAUB 2D5FA 1UAIA 3LDKA 4QWNA 4AR2A 3T0DA 3LZZA 2RMU2 4JCKA 4B7KA 3PHMA 1S4CA 1AX1A 2YBPA 3HMYA 3K46A 3WHUA 4P5YA 1ZZ7A 4MX3A 2JDAA 1DFQA 2JENA 3LEGA 4V1PA 4Q0VA 1YQ5A 5AVPA 4FOVA 2BNNA 2VOXA 3PIGA 2ET7A 2HEYF 4YNIA 1TEIA 1BMV1 2IXKA 4OHVA 4QB1A 1RVF1 3MF6A 4OMDA 5J98B 2JD4A 1WGPA 5LY2A 1W6OA 4NRQA 4UI9L 1FT9A 1F4AA 4ASKA 2QQIA 3NAPC 4C1WA 4B4QA 3KV5A 1DQ4A 1S2KA 1W03A 1UQXA 5J48A 5LEKA 5JSPA 3I3QA 2WWSA 2Z5WA 4CDUC 4R9BA 1H2NA 3D82A 3QACA 5IW0A 1LU2A 2Q8EA 3UV9A 5JLVA 4BE3A 1CPMA 5K4LA 1YFYA 5KHHA 3BUCA 5CFDC 2YG0A 3VZKA 3JCIA 4J1WA 2VZTA 4XF1A 5GLWA 3C7HA 4CRQA 1IKQA 3I97A 1OD3A 1PO13 4GB33 2Q8DA 2P2KA 5FFOC 4RR3A 2PMWB 3POFA 1PZ7A 4QKNA 1I1EA 4OFGA 1RUOA 1LESA 5BV6A 1OOPB 2BUKA 4YW1A 4N53C 3RG0A 4XQDA 1Q3EA 1HXS3 2WYSA 4JDOA 2TUNA 1GNHA 1L7RA 4RYDA 4XFCA 4IV3B 1D7PM 3O0VA 4O7XA 4QMAA 1KD7A 2VCAA 5F2SA 3U1XA 4IGPA 4YYOA 1WZXA 2WNUB 2WT0A 3NL1A 4F8AA 3J7MA 2Y0OA 2X05A 3VD9A 3QH7A 1MZFA 2D97A 2UYBA 4I30A 1XPWA 4NPRA 3VBRB 2DBNA 3BKZA 3MF9A 1XNTA 5KXBA 1DLCA 1VRBA 5JWPA 3VDDB 4UXAA 1V0AA 1Z7S2 1YIPA 3PNAA 1EPZA 4FXGB 2KXLA 1T6GC 5JZGA 4IETA 2XHKA 4QT6A 2ZBJA 4FFIA 4FTEA 1N3OA 4ZPIA 5IT6A 1WLCA 2VQAA 3LSDA 1AR73 2HWD1 2ZS6B 1G9DA 1POQA 1W2OA 3RGBA 4LJHA 2JKXA 2AENA 5C9AC 4PF5A 1QJEA 3WF2A 1D0GA 4DQAA 1PO11 3DCQA 1RUE1 1NA1A 4GB31 4OZOA 4AHWA 4AF9A 3DEMA 2D6KA 1Q5OA 3T3YA 1S0DA 2AZ5A 2Y60A 3OYWA 4IEYA 3V65A 5FPUA 3KV6A 3USUB 3MIGA 1TME2 4QXKA 4LHKA 4A7KA 3PTYA 4LULA 1F15A 3JQXA 4AEDC 5FP9A 1RUG3 1GZWA 1EV12 1MQTC 1CQ9A 3GCXA 4XUTA 2RMU3 4P9XA 4PDWA 5FZ0A 2BW8A 2A6XA 2IXLA 1E5RA 4WVMA 3TAYA 3SCGA 2QE3A 3NNLA 3UJQA 1UN1A 1JXNA 1AX2A 1R091 2ERFA 1WW7A 2VMHA 2XLFA 2WRAA 2XJVA 2E32A 2VMGA 4MGQA 4A44A 1W2TA 1YI9A 2VUJA 3RSJA 3ZYBA 5IAXA 4LBQB 4Q8LA 5EYXA 1YUDA 2W46A 3KF3A 4JVAA 4ZZ5A 2F4PA 4N9IA 4WZFA 5LBCA 5FOJB 3GF6A 1X33A 1MS5A 1HQWA 1JYCA 3B01A 4M00A 4XEZA 2VR4A 3RDIA 4D6QA 1PNGA 1BYHA 3ATGA 4KWJA 1CAXB 3V0AA 5F5IA 4NIGA 4QPYA 4OHWA 1Q8PA 5L9VA 5FPVA 1AR71 4XYXA 1E5SA 5EZWA 4RQPA 2WNVA 5IVFA 2EALA 3WF4A 4R9CA 4YW7A 4I3PA 4UYBA 1LGNA 4R9DA 3C8XA 4UW6A 4CCDA 4CEWC 5JMCA 4F83A 1BBT2 4A4AA 4D7YA 1W28A 1HB3A 1RUI2 5F9TA 4XQWA 4QX0A 1XJAA 3U11A 3BOPA 1HV0A 3I2DA 1MS1A 5F6KA 3PU3A 2HKXA 1RUG1 3M70A 3R6SA 2XH6A 2JG9A 4XXPA 5L7OC 1X7NA 3POWA 1CWPA 1APNA 1SFNA 4YZ5A 3UKNA 1EUTA 4K21A 2ZGLA 5BNPB 1W2NA 3JQWA 2Y6FA 4HK9A 4BQ1A 1BK0A 5EPAA 3AKTA 1XYNA 3KZ4C 5FLHA 4ITCA 4G9SB 4C90A 2Q4SA 4IDZA 4JHZA 1QJFA 4QQHA 1TVGA 4N8MA 2ARXA 4FXKB 2DU0A 4DIQA 4CZSA 5A7WA 3RJ2X 1PZ9A 4UT5A 3I3EA 4DEVA 2VBBA 5I0DA 5EFUA 1UPIA 3OBAA 4CXXA 5HBAA 4QXBA 2Y0IA 2WT1A 1UOBA 1VPHA 2K46A 2VULA 1NLRA 5C4WA 2QZ2A 3K2OA 5CNAA 5FXXA 3ZN6A 1O3TA 3WG2A 1Z7S3 4RD7A 4YZ3A 4XJWA 1F8VA 3PUQA 2QDRA 1UCXA 3WD5A 3PVBB 4XCAA 4AEJA 3WP3A 4P9GA 1FNYA 3RZGA 4BPZA 1XRUA 4AQTA 4FTBA 2ZGRA 1CR7A 2ZGOA 1WCKA 4LPLA 2RR12 4HBNA 3R4SA 2R062 3LIGA 4RFRB 2W92A 2ZMKA 3VKOA 4ZZ8A 1H0BA 4AGVA 4XACA 1NCQA 1QJX3 2A73B 1VBD2 4MO3M 4EN8B 2JG8A 4L0PA 4CYDA 2VMEA 2BFUL 5AVAA 1TME3 1AYM1 1H2MA 4QX1A 2X29A 4BYYA 5JIUA 4WM8A 1SLTA 1EV13 3JBG2 3B5LB 4CEYC 1K5JA 2ZA9A 1Q56A 3EMRA 1QQP2 1OPMA 4K20A 3BU0A 5LZ6A 5I8SA 5FMBA 1XNBA 3VL8A 3OBTA 4QKFA 4XW3A 3PLQA 2QQMA 5A33B 1F2NA 2J1AA 2ZCWA 4XUNA 3OGRA 1B35C 4PF1A 2QQPA 1UOGA 4QHZA 2BGCA 1PMIA 1JHJA 1UYPA 2ZXQA 2RJKA 5T54A 4AVCA 5FLIA 3H7YA 4Z82A 1W04A 2BWCA 3NNFA 3ZFFA 3B02A 3P3NA 3NV2A 4XFFA 1Z7S1 2WQZC 3AP9A 3B9CA 3IT8A 4MZUA 1GOHA 1UZ0A 1NA1B 1S55A 2CY6A 2XONA 3ZR6A 2GC2A 2CGOA 3MIDA 5DABA 1MVEA 2OUJA 3F95A 3VBFA 4GH4A 2P17A 4UBGA 3C7OA 2EA7A 4DINB 1A8MA 4FAGA 2XWJB 2YDEA 1TQ5A 1IOAA 4AVVA 2XGXA 3KVAA 4BIOA 1WMDA 1LCLA 3IM0A 3A22A 4BMEA 1JU4A 3I3BA 1QJX1 1G9CA 4MYEA 4MG2A 5FP3A 4OYUA 3ZMOA 3BN6A 1TME1 1RIRA 3U78A 3BI3A 5F6LB 4CP9A 3DF0A 1TZOA 4Q4W1 1EV11 1N1SA 1RUD3 1VBC2 4B3NA 2QQLA 5FP8A 3WNLA 3MIHA 1UPSA 1PK6C 1LOCA 4Q27A 4ZS2A 3WW4A 3ILRA 5CAZA 2YBKA 2IFWA 5DPNA 2YFUA 2FMDA 4QQ2A 5DG1A 5A70A 1TE1B 1XYOA 4CU9A 5K8SA 4LKEA 1DGWX 3AZXA 2R1DA 4QX5A 4LHNA 1STMA 1XE7A 3ROUA 4K40A 2F6BA 1GZTA 1VAMA 1ZM1A 1Y4WA 2MEV1 5APAA 5JI9A 4FO9A 1OVPA 4D94A 1ULOA 1AZDA 2A6WA 3O0WA 5ABJC 4F3JA 3FN9A 5H9RA 1QNYA 2FCTA 3UL2A 1COV1 1OMIA 1XYPA 3AMNA 3HWJA 5FYHA 4FCAA 5FYMA 2QVSB 4A6OA 3TNPB 1BEV3 3VZLA 4QKDA 3ZYFA 2EXKA 3OD0A 4Q5OA 1GQHA 1PX3A 4L8QA 1QH6A 4HLTA 5DDJ2 2Q1MA 4GJZA 2VY0A 3WW2A 2E7AA 1XXNA 2ZHLA 4RS5C 3VDAA 3POGA 1JTZX 1XU1A 4MHRA 3ACHA 1UMHA 3GBGA 2R072 4OZXA 1YJKA 4EZHA 5A1AA 2RR13 3MUZ1 2ZKLA 2R063 2SLIA 4WVVA 5LBEA 4AVSA 3WDYA 2LROA 5DAXA 5K0UA 3ZSLA 1AHSA 2GNMA 2VQUA 3D8CA 4SLIA 1RUD1 1VBD3 5A80A 5JCTA 3C3VA 1BXHA 1QOSA 1UYXA 1O91A 2AREA 2WT2A 1YHFA 4AZZA 5DMYA 4BQYA 2ZTNA 1ZRIA 4RFT0 2GAUA 1PHMA 3TN92 1YNAA 5A7PA 2VNOA 2DU1A 3HBZA 3VD3A 5BNNA 2ILMA 2IFRA 3H7JA 3KT4A 5H9SA 3M3IA 1AXYA 1QQP3 3VD7A 4XETA 4CUAA 5A6QA 3JU9A 2A6VA 1O5UA 2PN5A 3UGGA 3WDWA 3VZMA 2IUWA 1EPWA 2D93A 2NQYA 3R4DB 4GQ7A 3PUIA 5IVJA 1SEFA 2NMNA 2RDSA 3BTAA 2HWE3 2OUHA 1NX9A 5FBZA 5FZFA 4XIKA 5FY9A 3TEXA 3UJOA 4C1XA 2WN2A 4CCOA 3MZHA 5JOZA 3H1YA 2I74A 2UWCA 1BEV1 1EAH1 3WUCA 1RUF3 1ULGA 3ZM8A 3EO6A 3ST7A 3AP5A 3AVSA 4YSFA 1S0IA 2C6SA 5A1FA 1WW5A 3ITQA 3NKGA 5D8AA 1LB2A 1O7FA 3AL5A 1SCRA 5FYVA 3LKJA 1BLZA 2VZQA 2Y34A 2R32A 2RDQA 5A3OA 1H4GA 1AR62 5C33A 3J4UH 2RR11 5IVYA 2R061 1L7QA 4AI2A 4DEQA 3KB5A 2VPVA 4YLZA 2XL9A 1D0HA 3H50A 2Q1FA 2CAUA 3C7FA 3GGLA 1LHOA 1REEA 2OZJA 2XHNA 1NCRC 5DZFA 3VBFC 3VBSB 3M8LA 2BGOA 4M3CF 5EP9A 3WHTA 1VBC3 2ADEA 3NV1A 1DIWA 2C5DA 4P5HA 4A3XA 2ZX0A 3AXDA 4K9SA 4CP1A 1UY3A 5FTTC 4P08A 1AXZA 4QPIC 4YGBA 4YW2A 4ARXA 1CZSA 3D4KA 4QQPA 2BJSA 1J84A 3LDRA 4Q1PA 2HWC1 4NAOA 2HWE1 4XE9A 2WFF1 3MFAA 5JIAA 1XNAA 3MPBA 4M3CB 3WY6A 3J8F2 4QAWA 5FYCA 3FMGA 3NO8A 4KU8A 1E5HA 4YGCA 3EQEA 1LJ7A 4QM8A 2DFBA 1KJLA 3P6BA 3KCYA 4PHZA 2VD7A 1YFXA 2VQ0A 2OX0A 1RHI2 5I0TA 1OI6A 1RUF1 2WABA 3QBQA 3CIHA 5FY4A 2VNGA 1H8TC 1WA6X 3ZXKA 1FX5A 5BNOA 1JYWA 2WN3A 4IE7A 1F5FA 1KFUL 1UZYA 3MI8A 3DV8A 3QOPA 4CU7A 2FDFA 1DQ2A 3THDA 4Y1VA 1DDLA 1RINA 1PNFA 3VHPA 3LCPA 1L7LA 3GNEA 3LEMA 4XJUA 3T0BA 3O1PA 4J6GA 4QXCA 2I07B 5DDJ3 5KHKA 1QEXA 5FK7A 4AE2A 2BFUS 2R042 2YB7A 3RVHA 3K75B 2BNOA 2LRPA 2YFZA 1FOD2 2R073 2JWPA 1K5MB 3SNMA 5FPZA 4W50A 4CDXB 3BALA 3T2OA 3SHRA 2C0ZA 4URAA 4E4HA 1S2EA 5FY0A 3WNKA 4XFIA 3HJRA 4I2OA 3AKRA 2OA2A 1S0BA 4H2AA 1J58A 1W6MA 5E16A 3TN93 3RZMA 2CL2A 2ZGNA 1AVBA 2VO5A 1CAUA 2ARAA 1GV9A 5K7PA 2D44A 4H7LA 3WG4A 2XG3A 3NV3A 4O61A 5J36A 2DCJA 5GZFA 2VNRA 1Z0HA 1LRHA 1Y9MA 1AYN2 4E2QA 1LOAA 2VZVA 2XWBB 1HN0A 3UYJA 4HG6B 2EXJA 4OI4A 3VZJA 3WG3A 3VBHB 3WNXA 1M4WA 2ZX2A 3ZO0B 2PLV1 2CU5A 1JYXA 2WO1A 4AGGA 4DUWA 5A1LA 2XB6C 3ZDSA 3JB4C 1SBDA 2VOKA 3EJKA 2VZ3A 4OQ9A 3ORJA 4Z1VA 3KQ4B 2ZMNA 1QHDA 1V6LA 1K12A 4URTA 3WQ7A 2ZX1A 4XDOA 4GWMA 2UU8A 3ZIWA 1VP6A 3ON7A 1GZ9A 4IQPA 4N43B 2J1UA 3NJXA 1YRZA 3FE5A 1ZA7A 5DDJ1 4DY3A 5D21A 4EN0A 3S7EA 1RUH1 5GKAC 4P9JA 5FZEA 3JB8A 1DYOA 2YHJA 4NRPA 4Y1ZA 4HKLA 3FFQA 2JB8A 4LXLA 1XNKA 4GJYA 2GU9A 3ZXLA 2IVIB 3DN7A 3EBRA 2YGMA 4W6XA 5BNNB 3KM5A 4BIFA 1KQRA 5IHRA 2YC2A 2ZX4A 2I2SA 3WLUA 4JGYC 3N9MA 5F5CA 1OUSA 3B00A 5J96B 2VTFA 3VHRA 2AUYA 3VB9A 1NQJA 4LHSA 3VV1A 1F5JA 3U0ZA 5F37A 2V5YA 1ZA4A 1OH4A 2J1SA 1NAEA 1OOPA 1ND3B 1DZRA 2VQTA 1UMZA 5LEJA 4L99A 4D0QA 2B42B 4B8EA 4BQ5A 5L7OA 4AFDA 1W9TA 1WD3A 3ZXAC 4UW3A 3H8UA 1T6BX 3IBMA 4IV3A 1GR3A 4LITA 3AP4A 3ASIA 2JX9A 3RZLA 3O14A 3CJIB 4C0BA 3OCPA 1RHI3 3SH5A 1YIFA 3VBRA 1ZBA2 2WBKA 2XVKA 3VGIA 2X10A 2HWD2 1MS4A 4Y24A 3RZZA 2D6NA 3HNMA 4KBBA 5FYTA 3J7HA 1UL9A 3VDDA 2XJPA 2HH9A 5J37A 2VAUA 4XQ4A 1SBEA 5E88A 4K3UA 1RUE2 3SITA 2GALA 3N9PA 5DUXA 2FMYA 3ZFEB 1IS6A 2R043 3ZKUA 5C70A 2EICA 4PLNA 1J1TA 1FAYA 3N9OA 2IWGB 2WWJA 1MR5A 4JGZC 2WNEA 5A7NA 1HJGA 3U14A 4CUGA 4KG0A 3PMEA 3IDCB 3CMGA 5DXDA 1ODNA 3AC0A 3CHXA 3USUA 4QGLA 2J1TA 3WR0A 3K4ZA 3WP4A 3SCHA 2G1MA 1JI6A 4QPGC 1R092 1VR3A 2YPJA 4XFHA 3TNQA 4GIQA 5F5QA 4CCEA 1AL22 5HI0A 1WMFA 2DBIA 3D3AA 4KG8A 3WDTA 2DFCA 1ND2C 2JDYA 5A32B 4IE4A 4BU2A 1AYN3 5JXJA 4YW6A 5FZ3A 4XTMA 3PVNA 5C8CB 2IXJA 1MS3A 1CIWA 1V6IA 1W06A 2HWF3 2RJLA 1SDDB 5EJ3A 3RYPA 3RYKA 1HDKA 4YFZA 2XR4A 1RHI1 3KT7A 4LBQA 1ZZ6A 1W2AX 3H8XA 2P6CA 3ACLA 3DPRC 5KBFA 4N9HA 4XJ9A 2E7TA 1A3KA 4HPKB 3NSTA 3SEEA 4CCCA 1CAXA 1V9U1 2K0GA 3BVCA 1W0PA 3LPGA 4BQ4A 2PHUA 1DYPA 5B4NA 5IFPA 1PIV3 1LNSA 2I45A 5CADA 2QQJA 3R05A 4ORFA 1C1LA 2R041 1WLWA 2EF6A 2EIGA 3KGLA 5CG9A 5LBBA 2R0HA 3FL7A 1R1A2 1R1ZA 5IATA 3I2JA 2Z79A 1IKPA 3ETPA 4NMIA 4HT1T 1HQNA 3FLPA 1B09A 4ES9A 4LOTA 1G7YA 1US2A 3MO4A 4IEWA 2RV9A 4WM7B 1QH7A 5IVCA 2VOVA 1JZ7A 3WUDA 4NHMA 1OLRA 1UXZA 1GP4A 1GWKA 1F9KA 2W47A 2FZ1A 3T30A 2VZPA 2XJTA 3K48A 3K4AA 1GMMA 2ZEYA 4UOJA 4A6SA 5CFCC 3E5QA 1AYN1 3PUHA 5BNPA 2YROA 3PURA 1W8HA 4IUGA 5T3NA 3WVJA 1UYYA 2HWF1 1IS5A 1MACA 3VZOA 3CEWA 2CSGA 2DVFA 2VTXA 3GHNA 4KWUA 5CU1A 2PYTA 1HW5A 1DQ5A 4XPVA 1JODA 1DGRN 1QXPA 3H8RA 1PZ8A 3J7NA 3OUJA 2V73A 4B29A 2QDNA 1OOPC 1ZX5A 2ZKNA 3A0NA 5LBFA 1ZBA3 5FZBA 3SISA 1O3QA 4QXHA 1ZZBA 2P37A 1PMJX 2HWD3 1REFA 2FHRA 1N1VA 1VE0A 5CZKA 5A3WA 1PIV1 2Q0AA 1QJY3 5LK7B 2E51A 3FLRA 4IEQA 2QQVA 2Q8OA 1WWYA 5T5JA 4CDQB 4COVA 5LRSA 2VZUA 3NWKA 4XBQA 3APBA 2WNUC 3M3CA 1LEDA 2WIIB 1RUE3 3UK9A 1FV2A 3X29B 5T52A 3WDXA 5BPXA 4S2FA 3HIFA 4GKXA 3VBRC 2ZOEB 3ZMNA 3KQRA 5CKNA 3ZFGC 1KS5A 3MDPA 4FQZA 4LKDA 4MHUA 1ZBE2 4EWEA 1C28A 1AYM2 4I0AA 1G9FA 2AEZA 4GA9A 4BB3A 2HBUA 2NZ9A 2ZEWA 2TNFA 4ZHNA 1W39A 4QQOA 4MUVA 3NJVA 4IEUA 4KI5M 4Y4YA 1NOVA 5HV4A 4L9BA 2PTMA 2VW2A 5DAPA 2AR6A 4OUEA 1JU3A 1HN1A 1R093 1IPKA 4Q4Y3 2QQWA 4IEOA 4LIVA 3O1MA 3N3HA 1AL23 4C0HA 2F17A 1LOBA 5I93A 3EYPA 3AKQA 4AFAA 4JTNA 3I59B 4X6QB 5F3EA 3FHQA 3FUOA 1IPSA 2JJ6A 3NAPB 4LE4A 4U36A 3ZR5A 1DGRA 4FPOB 4HKOA 2B46X 2D3RA 4R52A 5F7UA 4B1LA 1OQEA 4DPNA 5FZLA 5A33A 4AFCA 4CDUB 2H6BA 3UT0A 4ARYA 1FYUA 3CZJA 2D98A
chains in the Genus database with same CATH topology
1ZBA1 4XFAA 1SCSA 3MW4A 3G7DA 3AMPA 5CFDB 1H9PA 3S30A 1POV0 3AFKA 1QJY1 1MS0A 1X8EA 4HVOA 1H1IA 3NJZA 4IEXA 1FXZA 1BJQA 3E6DA 1QJX2 5FQ0A 1S1AA 3SLIA 3H3UA 1AR92 5IK4A 1BVP1 5JDBA 2D6LX 2GMEA 1R1A3 2EAKA 4Q4W2 4YVWC 3WCSA 4B4RA 1O4YA 5IK5A 4AWDA 1VAKA 5T50A 4BM8A 4MGZE 1VB4A 5B2GB 4DNYA 2YY1A 2GN7A 4Q4Y1 3USSA 1AL21 4Y20B 2VECA 3BB6A 1S0FA 4YG3A 1LTEA 4XTPA 1KXGA 4IV1B 4AFBA 2DVDA 2JEMA 3WOGA 4AVAA 2MEV2 2W0XA 3B93A 4P9LA 1LOEA 4I0WB 2VMIA 5HCFA 4XMAA 1COV2 4Q1RA 1OFSA 1XU2A 2QZ3A 5EWSA 3BODA 1E57A 5C9AB 5KXCA 1Y7BA 4JAAA 5I0SA 2NN8A 1ZZ9A 1REDA 1LULA 2H0BA 3H1WA 5A3MA 2ZACA 4H14A 2WKKA 4NOTA 4NHLA 4AEDB 1CD3G 1MQTB 4GALA 1R1A1 2JKBA 1RUD2 5FRAA 1EYBA 2Z42A 1BZWA 1RUC2 1ZBE3 1AYM3 4PBPA 4JTOA 1O4ZA 4COYA 3L2HA 4WVZA 1SBFA 1RGSA 3SCFA 1H1AA 4FPGA 1DQ6A 4XJAA 2C9AA 4RR3C 1DGWA 4TWTA 2WZR2 3HR9A 2HJIA 4LBOA 4YG0A 2EXIA 1C5IA 3ELNA 5H9PA 3M3QA 4AI8A 5T5OA 3AMQA 4QM9A 2WA4A 1BEV2 1EAH2 4YRDA 4OI1A 3TOJA 4A7YA 4N7UA 3VBUB 3J26N 4TZDA 4YM1A 3ECQA 5GM0A 4CEWB 5JAXA 4ASMB 2CGNA 3RMXA 2B5HA 4MGIE 1VBB1 4COWA 1W0OA 5JZGC 3NVCA 4Z07A 5L7OB 3VBOA 2RS11 1ZBE1 2ZGUA 4XF4A 1AR93 2VH9A 5KC6A 2PHWA 4Q4W3 1LEMA 2E7QA 2GDFA 3LB9A 1DHKB 1NA1C 1QXRA 1DYKA 3JZVA 4I02A 4YM0A 5EV7A 4NHKA 5BYNA 3VBSA 4HK8A 4AEMA 4ONUA 3ZVXA 1CAWA 2AH2A 1UZZA 1YJLA 2HWC2 2HWE2 1UKGA 4GWNA 4M01A 2WFF2 4PDWC 2ZHNA 2BTVC 3D0SA 4KWKA 2MEV3 1ZRRA 2ARBA 4XF3A 1RUF2 3WQ0A 1NY72 2D7FA 3ZSMA 2YV8A 4M3CA 1COV3 2QUOA 2JECA 4N90A 2QCSB 2EXHA 1IQAA 5FQ0B 1SACA 1GKBA 3LGRA 2VG9A 3DUIA 2ZGPA 4FOWA 2JDZA 3ZYGA 1VBA2 4LA3A 3MW2A 2PHXA 2BVVA 3ZPYA 3M3EA 1AR91 4DRRA 4RQPC 2WNVC 2WSUA 4CEYB 4Q0UA 2XVGA 3VHOA 2BEOA 1IS4A 1RUC3 3AZZA 3LA3A 1K5MA 1DQ1A 1V6KA 3O12A 4CDXA 4RGAA 4X8PA 1B35B 2KA3A 4DXZA 1C4RA 3H1MA 1OSGA 2JG9C 3NKTA 3O5SA 5FLJA 2WZR3 1MZEA 1G6NA 4E4SA 2PLV2 1V70A 4XIOA 4YZ2A 2DCTA 2YGLA 5AFBA 4XJ8A 4OUSA 5GLUA 3N36A 1LHNA 1WBFA 2OW4A 4MGYE 5EXOA 3VBHA 4HVQA 1LHUA 1EAH3 4Y22B 3KSCA 4CP2A 3ALQA 3GZAA 3AK0A 5GZDA 2BYVE 4BOWA 2GNDA 2GC3A 1X50A 1GFF2 1R081 1RUH2 1J3RA 1RTVA 5C4WC 4IEPA 5ACA2 2PAEA 4XDQA 4N43A 1O3RA 3KS7A 1ENRA 4NWWA 1U5IA 2W68A 3THTA 1RUC1 4MLOA 1PK6B 2WJSA 1ZRFA 1VRH3 2RS31 2P34A 4JRLA 5C8WA 5FO9B 2V09A 2D6OX 4L2NA 5K9YA 3LOBA 1W6QA 1NCQC 5FOBB 1RB8G 3OBRA 4FOYA 1OLQA 2JG8C 1CJDA 1N47A 5GZGA 1MZ5A 3E97A 2WZR1 1ZREA 4XZPA 3WDUA 2HWC3 5ABJB 2RM21 2MHFA 4FPHA 4WM8C 4KQ7A 2WFF3 1ASJ3 4LO8A 2XUMA 1ND3A 4A7ZA 1FMD3 4YVSA 2UWBA 2XBO3 3VBSC 3AMHA 3N7KA 2JE9A 4EROA 1RMU1 1Q8QA 3BOWA 1BCXA 2YMZA 4RS5B 3H3ZA 3OJBA 4KU7A 4UW5A 4YG6A 5I8YA 3CJIA 3VBOB 5IUQA 4M0HA 3ZYRA 1UU6A 4XXAA 3ZFFC 1W6PB 3MIFA 4XJZA 4S2DA 5AFEA 1AJKA 2JICA 4PJYA 1VBA3 3IIAA 1I6XA 2ZX3A 4RHV2 2B9UA 2ZPXA 1LOFA 4GH4C 1XE8A 1VRH1 1ZZCA 1KS4A 3ENRA 5KHGA 1CAWB 1WCSA 1N1TA 4XHXA 3ZFEA 2UY9A 5L19A 1ZRDA 1RITA 1ENQA 1RC6A 5BNQA 1HIXA 4OLLA 4ZKTB 2LUWA 2E6VA 4EWDA 4GMP3 2LM3A 3H0OA 3LOIA 1ASJ1 1WCDJ 2X5IA 1MEC1 4YM2A 1YO8A 4DFSA 1FMD1 1HLCA 1SLLA 2VGDA 2PLV3 4CDXC 1LGCA 2DCYA 2XBO1 1VBE2 2CV6A 3ZXGA 1NY71 2ZZJA 1PGL1 5A32A 2DCKA 3GHMA 4YZ1A 5C8CA 1EY2A 1V9U2 2WZPP 1H4HA 3WZ1A 3WP5A 1PGW2 4TSVA 4AW7A 3DKWA 1RUH3 1UD1A 4OVEA 3Q9OA 2GMPA 2FZ2A 1VBA1 2K2SA 1QKQA 4CDWA 4OHXA 2UURA 1ULEA 2XJSA 3RRDA 4HPKA 4GKYA 2VOWA 1NCRB 2O8OA 5ACA3 4EN6B 2DTYA 3D5OA 3ES1A 1S0GA 1YYNA 1SLBA 5KWRA 3N35A 3KMHA 4B4PA 2NM1A 1RUNA 3G6JB 1HRI2 1PVC2 1N3PA 2ZAAA 4QPIB 5HCBA 2OIIA 4ISRA 4MSVA 4RL7A 4GMP1 5K0UC 3IPVB 4XFBA 3MIBA 4MXVA 4KH9A 4WM7A 2DVAA 5I0RA 2Z2SB 2ZABA 2HWF2 4HN0A 2UYAA 1H8TB 1HRV1 1HQLA 3IN9A 2MNGA 4LLOA 4OHYA 5BNNC 1QNWA 3KCCA 1JOJA 5AC91 3RQ0A 3V56A 3BU7A 4FPCA 2A3XA 3I7DA 2Q30A 3LAGA 4Q0PA 1U5ZA 4Q2FA 1O4TA 1PIV2 3FBYA 3ZSJA 2E53A 3AP7A 4A2UA 3RI9A 4UBHA 3PVEA 3K51A 4M3CE 5ACA1 4LLFA 1CPNA 5D8AC 4DZGA 1UIJA 4MH0E 4AQ6A 2AYHA 1DU3D 2WSVA 4JRAA 4RHV3 1W6QB 1OKQA 4LNVA 4CDQA 4QGMA 3ZYIB 5IK8A 4JQRA 4RSUA 2P3JA 2WS92 3V64A 4IXLA 4Q4V1 2Y38A 3AYEA 4QD2A 1JBCA 3ILFA 2LALA 4YVSB 4AVTA 4L11A 4I01A 2QJVA 4LBMA 3WW3A 1N3QA 3ZSKA 1LU1A 4DS0A 1BQPA 1H8VA 3W58A 1NXD1 1VBE3 3I59A 4ZU4A 3NAPA 3PVOA 2X8KA 2W52A 2NP0A 4XHBA 4AFMA 1C5HA 1RUJ1 1QJY2 1UIKA 1D4M3 4CDUA 1JN2P 2C1FA 1V9U3 3CF6E 3N7JA 2DVBA 4Y1XA 1C8NA 5CFDA 5BNOC 4LBNA 1AR81 4HSJA 1WA4A 4PIYA 1Q43A 4RHV1 5C8CC 3HAGA 4JGYB 3AZYA 5LK5A 4E4ZA 3L2YA 4NWVA 2R30A 3S7IA 4FPYA 1QDCA 3GALA 1AL0G 4K8FA 2VXRA 3EXUA 4FTSA 1HRI3 1PVC3 2YXSA 2X5IB 4BZ4A 4N53A 4L92A 1X8MA 4Q4Y2 2YZ4A 4TLFA 3AKPA 3FUQA 3B7MA 2ES3A 4ZXKA 4BHPA 2CNAA 2DCZA 1SDWA 3AJYA 3O0XA 2VVEA 3I54A 2BWAA 1W6NB 4Y20A 1UU5A 1NE4A 3JD73 1VBE1 4E9KA 3KT1A 2IXCA 2Q1ZB 4IV1A 3CNAA 2JXAA 1BKZA 1OQDA 4BLJA 5D1IA 3WT3A 3E6BA 4IEZA 3WP6A 4HMZA 4CDWB 2ZHKA 1D4M1 1D2QA 2A5ZA 2CWSA 2HEWF 5FMOL 2ZGTA 4Y1YA 1PGW1 3PJQA 2PELA 3TWIA 2A70A 3WW1A 3N7MA 2BNMA 4W6YA 5C9AA 5E1RA 4OHZA 4JGZB 5J3UA 3N4MA 2XPJA 2N7GA 2VVFA 2ZGKA 2ETEA 3MFCA 1H1MA 2XKPA 3AKSA 1HRI1 1PVC1 4QPGB 4AEDA 2OVUA 1MQTA 4AG4A 4CP0A 3C2UA 5HXVA 4AYUA 1ND2B 2WS93 1CN1A 4DY5A 4FOQA 4MV2A 2DWRA 2YUEA 1ULFA 1YWKA 4H3WA 1LGBA 1KFXL 1C57A 2IXHA 3H9AA 3WDXA 1A8DA 1S0JA 3FLTA 3FBMA 5JPMB 3GYDA 4I3GA 3JD71 3QD6A 4B7EA 2VW0A 3FHIB 4OUMA 1D2SA 3DPRB 4HFSA 4FVVA 4HZFA 1POV1 1PVXA 4JDNA 3EHKA 5BUVA 2BBVA 2RE9A 1V6JA 3HN1A 2WA3A 1V6OA 4IV3C 1Q8OA 4KNCA 4EN9B 2DTWA 1KJRA 1L3JA 4WBBA 3ZSEA 3HQXA 1VBB2 4JV4A 3VBUA 1XNDA 5DG2A 4XILA 4NR1A 2HYKA 1TMF2 4CEWA 4OI0A 1CESA 2OZ6A 3IKWA 4ATFA 2RS12 1KDMA 4IERA 3VDDC 2PAKA 2O8QA 1FPN2 1H2KA 2WQ4A 4MXWB 1UF2C 4AQ2A 3IMNA 4AI3A 3OGGA 3MPPG 4FPJA 1PO23 3KD4A 2XJRA 2WS91 5L7OA 4FPKA 3MLJA 5DUWA 1OA2A 3AYAA 3E5UA 5CFCB 2CAVA 2X53S 3UKTA 1Q8VA 1QJZA 4WVWA 3BPZA 3POYA 2A7AA 3FFZA 2W08A 2QFEA 3OY8B 1WW6A 2D43A 4TYSA 4YGDA 2GC0A 3AM2A 3RJRA 4AQSA 2YC0A 1EP0A 3DL3A 3U10A 1RL3A 3SMHA 1XQNA 2PFWA 5F1RA 5FCCA 1SFYA 3O7OA 1OPOA 1ENSA 3ZN4A 5JVVA 1G9BA 2KM2A 3ZX7A 4PIZA 5T55A 3VHNA 1DF0A 1CAVB 3M3OA 1GYKA 2ZGQA 1JHNA 2IXIA 3ZXJA 1NG0A 1M06G 5A3LA 1JUHA 4FQ4A 3V0BB 3A4UA 4D7SA 3ZFGB 4FBFA 1C3HA 4IV1C 3ZN5A 3AMMA 4YW3A 2XVLA 3SXWA 3WQ1A 4LR4A 1ZRCA 4N53B 4Q0QA 2CYFA 4XF9A 3D0JA 1PO21 4LBLA 5CIRA 3IDBB 3P3PA 5CB7A 3WCRA 2D6MA 4INDA 2D40A 2DVGA 1X82A 2E63A 3FX3A 4ATEA 4DB5A 1QWRA 4CEYA 2NPIA 3INAA 4RGGA 2AGSA 3ME2A 1J3PA 5BXXA 2DF7A 5GLZA 1Y9QA 5LRRA 4S2GA 4QQLA 4AHZA 4CTEA 5GZEA 1OA3A 1B35A 4IL7A 5T5PA 2H6CA 4ASLA 4E27A 4KGQA 1H2LA 1HXS1 4P9IA 1U12A 2NLRA 3CO2A 1LHWA 3HD8B 3W9AA 5BNPC 2SBAA 4UW4A 4LEJA 1KRIA 3VN4A 3RS6A 3KCXA 1FNZA 5C6CA 1R082 3VLBB 1KITA 1O5LA 1DG6A 3RMYA 1I3HA 1UX6A 2DYCA 4Y22A 4AK3A 1VBB3 4AI1A 1RJ7A 4X8NA 3WX5A 3VZNA 5FO7B 1TMF3 4YVWB 1C8M2 5I91A 1MZ6A 2RS13 2GC1A 1URXA 3NV4A 4JDMA 2RS32 2D3PA 1FPN3 1A78A 3VBUC 2EAAA 4L97A 1BVVA 4G4FA 2G9FA 3QLQA 1YXWA 1PK6A 2DURA 2ZGSA 1CVNA 3AJZA 3E6CC 4FPLA 4XBLA 3U07A 2WL1A 4EN7B 2DUQA 3R4UA 2JE7A 2RM22 3ZYPA 2IZWA 2RMU1 2UWAA 3GZUC 2GZWA 1AX0A 4OULA 4R9AA 4BA6A 5FDBA 5ABJA 5L36A 1RMU2 1W6OB 1ULCA 2TEPA 3B9IA 5FMOS 2WINB 4BWOA 4HKWA 3LA2A 2W39A 2GNBA 2UY8A 5KXEA 4Q0SA 4EV0A 3R0RA 3T1LA 4COZA 1GANA 2PHTA 2CWMA 2CGPA 4YFWA 1QGLA 4K6BA 2RS52 1V00A 3B3QE 3NW4A 1TMF1 4YZ4A 3ES4A 1OD5A 4RS5A 5SV5A 5J7MA 2PHFA 1TNRA 3RWNA 3LWCA 2ZJCA 1PM7A 1W6PA 1VRH2 2Q5TA 2A6ZA 1FPN1 2GNTA 1VIWB 5DZEA 5JSRA 1SLIA 4RR3B 3DGTA 3TB0A 4YARA 4FP3A 2P3KA 2DUOA 3B69A 3U4XA 1IHMA 5GLTA 1DBNA 2VVDA 3AP6A 3MW3A 4J1XA 2PHDA 1JUIA 1S0CA 3FJSA 1ASJ2 3IWZA 1MEC2 3AYDA 5I0UA 3AFGA 4ES8A 3M4FA 1FMD2 3VKFC 2XBO2 4HVRA 3TBDA 5HCAA 1Y3TA 3SH4A 2WFPA 3WDVA 1PGL2 4NVPA 4PLMA 4S2HA 4O9GA 4DMIA 3WINE 3MIEA 4QHBA 1D4VB 4RA0A 1J3QA 1OFNA 1XNCA 3HT1A 4LUMA 1HX6A 3KLSA 3CLPA 4LO7A 4XOGA 1YFUA 4LA2A 5JZGB 1R083 2XJUA 2IC1A 3M1HA 4XFGA 1J59A 5L73A 2B7YA 4AHYA 1C8M3 1H9WA 1VJ2A 5JOYA 3OYWB 1NCRA 1G86A 2RS33 2XKOA 5TSWA 1SMVA 4H7MA 1A6CA 1GZWB 5JSOA 2B39A 1BBT3 3B94A 4PDWB 1RUI3 3BIWE 1QOOA 4E4DX 4Z92B 4QPIA 4WVMB 1G8WA 4PIXA 2R6QA 1HRV2 2RM23 1KDKA 2H0VA 3PJYA 3IPVA 3LA7A 2HWB2 1F31A 5AC92 2WLQA 3ZXDA 1LODA 5FAXA 3VL9A 3QH6A 2DUPA 1ONAA 1H8TA 1RMU3 4X6RB 4PLOA 5BY5A 1LECA 4SBVA 3V0AB 2PHRA 4D7TA 4ISQA 3I4IA 5SV8A 5CA6A 5JR7B 4RQPB 4LBQD 2WNVB 4LHLA 2A3YA 3OD4A 2RS53 1QJU2 5GJ6A 3AB0A 3AZVA 4BMBA 3FZ3A 1C8M1 5DZGA 3A0KA 5H9QA 4E2GA 3M7AA 1AJOA 3FC0A 1GQGA 5CVRA 1UW8A 3T2TA 4E2SA 5CBLA 2GN3A 3ZYJB 3HT2A 1NZCA 4O9EA 2ZGMA 1X36A 4HETA 1IPJA 2VW1A 3RPQA 4Q4V2 1BBT1 3MGUA 2JG9B 2HEVF 1RUI1 3MLKA 4LO4B 3VBOC 2BQPA 2WC2A 3S0MA 1ULDA 3MYXA 5JI7A 4KGGA 1ZYBA 3M2MA 1GLHA 1QF3A 1WMEA 2YYOA 1NLSA 1MEC3 1BK1A 3JBG3 3E5XA 3VKNA 2BVBA 4AHXA 2RHPA 1O3SA 3LSEA 4BCUA 4LBJA 4HL0A 4P14A 5T5LA 1RUJ2 4PQ9A 4LUKA 5C4WB 1WBLA 3ZN6B 2EVXA 1WD4A 2GMMA 3I8TA 1DLLA 2RS51 2D5HA 2PQQA 2BPA2 1AR82 1LHVA 5JOXA 4NN0A 3RNSA 3PMSA 4WV8A 3KGZA 4Q8KA 3AYCA 1VB2A 4Z8BA 4DOUA 4Y1UA 1NCQB 3OPZA 4Q26A 2JG8B 3IDEA 4JGYA 5FPXA 3ETQA 1I9RA 1NXMA 2QNKA 4Q4X2 2XL7A 4WM8B 2ATFA 1ZVFA 4LO5B 3RYRA 1VBD1 1Z78A 2DV9A 2ZAHA 4I0BA 4META 3WXPA 1WUVA 1K5MC 5FO8B 2XJQA 4LBKA 1NYWA 1HRV3 3JBG1 1U0AA 1FV3A 1QQP1 2HWB3 5AC93 1VALA 5GALA 4K7JA 1W6NA 2A71A 1D4M2 4ZU7A 3ZFFB 4AVBA 5I8TA 2FQPA 3ZIXA 1YFWA 5E8AA 2ZZQA 2O0OA 4U2AA 2Y26A 4AXOA 4MVTA 2FBEA 1MVQA 1UKRA 3QCWA 3VBHC 4GH4B 3VBFB 5JPNB 2PA7A 1QJU3 1JH5A 1MS8A 2K9ZA 1ALYA 2D3SA 4ZU5A 2A6YA 3URFA 1IZ3A 1N1YA 5GLVA 1W2UA 4JGZA 2G4IA 3AX4A 1QXJA 3J9SA 5KHJA 1AUYA 3S6PA 4GULA 4N43C 4Q4V3 5E89A 1S0EA 4YW4A 2MPFA 4QPGA 4M0NA 1LR5A 1ND2A 3JD72 1CX4A 4W65A 3THPA 3ZXFA 4I09A 3MICA 1VBC1 1ZNPA 1RJ8A 4HSLA 1JYIA 2HWB1 1IS3A 4K1ZA 1C1FA 3BCWA 1I5ZA 1IGOA 1QMJA 2TBVA 3TYJA 4Z2WA 3RI8A 4XMIA 5FREA 3MLLA 2ZHMA 2ZMLA 3MEPA 3DPRA 1SQ4A 1J1LA 1RUJ3 2E9QA 2PAMA 3OGJA 4R4ZA 1BMV2 1RVF2 4N7IA 1ND3C 4DRVA 4HN1A 5J09A 1CJPA 4YVSC 3WV6A 4FPFA 3N7LA 4EWAA 4P9YA 5IK7A 1QJU1 2P3IA 1AR83 4FT8A 1FATA 4XF0A 5KC5A 4IESA 4YW5A 3CU7A 2CTVA 4MGKE 3CJIC 4D3WA 1AXKA 1YCIA 4FAHA 1H30A 4AI0A 1ENXA 1QY4A 4Y26A 3W59A 3D6EA 3ZXEA 5K0UB 4COUA 3CJXA 1AR63 4AGGA 2R071 1WLDA 4MXWA 1GSLA 1LOFC 4YM3A 1OA4A 5JOWA 4Q4X3 5EYYA 4R4XA 2NMOA 1Y43B 1V6NA 5CFCA 3SH3A 3ZFEC 3GZTB 1Q8SA 2D6PA 2R16A 3TN91 3OY8A 1OQ1A 4HANA 4NO4A 4WZCA 2X5IC 5DUUA 4PBOA 3GBWA 1HKDA 2OPKA 4C91A 5GZCA 3FWEA 1VAVA 4GMP0 3UKVA 1QOTA 1HV1A 2ENRA 5D8AB 1DZTA 1CAVA 1JW6A 3VKLA 3J8F3 5CG8A 4KL1A 2QKDA 2WNUA 4GXLA 1GNZA 2VU9A 2VUAA 3V0BA 4D69A 4QU2A 2XLGA 3ZFGA 1MS9A 4LE3A 1PO22 1WW4A 1ZZ8A 2OYZA 4EJRA 2B8MA 1LKNA 1QU0A 4CDWC 1AR61 1SLAA 1DQ0A 4LTAA 1PO12 4GB32 2ET1A 1LENA 4QGNA 4W6WA 1DZQA 2GH8A 3JUUA 4Q4X1 1UU4A 1TNFA 3OF1A 4LO6B 1FOD3 1U5YA 4R8HA 3L9JT 4K1YA 5DUVA 1G9AA 5KXDA 3CL1A 3POSA 1FI2A 1HXS2 4BLIA 1U5XA 1AF9A 4IEVA 4Q29A 5KHIA 2R0FA 3VKMA 3OTFA 1POV3 2A3WA 2NYYA 1S2BA 2GSYA 4AEKA 4F7ZA 4WM7C 1NQDA 1PGSA 1VLNA 2GH2A 2B45X 1WLTA 1GZCA 4OI2A 3AXEA 2XLAA 4BH9A 3ILNA 5BNOB 4FP2A 4XBNA 1QDOA 3WG1A 2G9GA 2Z69A 4Y5Z0 1RVF3 3J8F1 1SLCA 1LOGA 1CONA 2WLPA 4YGEA 3VUOA 4FPEA 1GBGA 1OHFA 1CGPA 1GICA 3GBFA 2PHLA 4G3YC 1AR72 4H55A 4LT5A 1NE6A 1YI7A 4PCRA 2R1BA 3AZWA 4YVWA 2A75A 1DGLA 4KWLA 2O1QA 4P9WA 4AGRA 3TRSB 3T1MA 4JC1A 1FOD1 4CDQC 2R49A 1V6MA 1W6MB 1RUG2 1YLLA 2LTNA 1CAUB 2D5FA 1UAIA 3LZZA 2RMU2 4JCKA 4B7KA 3PHMA 1AX1A 3WHUA 3HMYA 1ZZ7A 4MX3A 1DFQA 2JENA 4V1PA 4Q0VA 5AVPA 4FOVA 2BNNA 2VOXA 2ET7A 2HEYF 4YNIA 1TEIA 1BMV1 2IXKA 4OHVA 1RVF1 3MF6A 5J98B 2JD4A 1WGPA 1W6OA 1FT9A 3NAPC 4C1WA 4B4QA 1DQ4A 1S2KA 5J48A 5LEKA 5JSPA 2WWSA 2Z5WA 4CDUC 4R9BA 1H2NA 3D82A 3QACA 3UV9A 1LU2A 5JLVA 4BE3A 1CPMA 1YFYA 5KHHA 5CFDC 3VZKA 3JCIA 4J1WA 4XF1A 5GLWA 4CRQA 1IKQA 1PO13 4GB33 2P2KA 5FFOC 4RR3A 1PZ7A 1I1EA 4OFGA 1RUOA 1LESA 5BV6A 1OOPB 2BUKA 4YW1A 4N53C 3RG0A 4XQDA 1Q3EA 1HXS3 4JDOA 2TUNA 1GNHA 4XFCA 4IV3B 3O0VA 4QMAA 1KD7A 4YYOA 2WNUB 2WT0A 3NL1A 4F8AA 2Y0OA 3QH7A 1MZFA 2D97A 2UYBA 4I30A 4NPRA 3VBRB 3MF9A 5KXBA 5JWPA 3VDDB 4UXAA 1Z7S2 1YIPA 3PNAA 1EPZA 4FXGB 2KXLA 1T6GC 5JZGA 4IETA 2XHKA 4QT6A 2ZBJA 4FTEA 1N3OA 5IT6A 1WLCA 2VQAA 3LSDA 1AR73 2HWD1 2ZS6B 1G9DA 5C9AC 2AENA 4PF5A 1D0GA 4DQAA 1PO11 4GB31 1RUE1 1NA1A 4AHWA 4AF9A 2D6KA 1Q5OA 1S0DA 2AZ5A 3V65A 3OYWA 4IEYA 3USUB 3MIGA 1TME2 4QXKA 4LHKA 4A7KA 3PTYA 4LULA 3JQXA 4AEDC 1RUG3 1GZWA 1EV12 1MQTC 1CQ9A 2RMU3 4P9XA 4PDWA 2BW8A 2A6XA 2IXLA 4WVMA 3TAYA 3SCGA 2QE3A 3UJQA 1UN1A 1JXNA 1AX2A 1R091 2ERFA 1WW7A 2VMHA 2XLFA 2XJVA 2VMGA 1YI9A 2VUJA 3RSJA 4LBQB 4Q8LA 5EYXA 1YUDA 4JVAA 5FOJB 2F4PA 4N9IA 4WZFA 3GF6A 1X33A 1MS5A 1HQWA 1JYCA 3B01A 4M00A 4XEZA 3RDIA 1PNGA 1BYHA 3ATGA 4KWJA 1CAXB 3V0AA 4QPYA 4OHWA 1Q8PA 1AR71 4XYXA 5EZWA 4RQPA 2WNVA 2EALA 4R9CA 4I3PA 5JMCA 1LGNA 4R9DA 4UW6A 4CEWC 4F83A 1BBT2 4D7YA 1RUI2 5F9TA 4XQWA 3U11A 3BOPA 1HV0A 3I2DA 1MS1A 5F6KA 2HKXA 1RUG1 3M70A 3R6SA 2XH6A 2JG9A 4XXPA 5L7OC 1X7NA 3POWA 1APNA 1SFNA 4YZ5A 3UKNA 4K21A 2ZGLA 5BNPB 3JQWA 4HK9A 4BQ1A 3AKTA 1XYNA 3KZ4C 5FLHA 4ITCA 4G9SB 4C90A 2Q4SA 4QQHA 2ARXA 4FXKB 2DU0A 4CZSA 3RJ2X 1PZ9A 5EFUA 1UPIA 5HBAA 2Y0IA 2WT1A 2VULA 1NLRA 5C4WA 2QZ2A 5CNAA 3ZN6A 1O3TA 3WG2A 1Z7S3 4RD7A 4YZ3A 4XJWA 1F8VA 2QDRA 1UCXA 3WD5A 3PVBB 4AEJA 3WP3A 4P9GA 1FNYA