3MFAA

Computationally designed endo-1,4-beta-xylanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
GSDTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGLFVAGKGWSTGGRRTVTYNASFNPSGNARLTLYGWTRGPLVSYHIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTYQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Computational design of an endo-1,4-{beta}-xylanase ligand binding site.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
molecule tags Hydrolase
total genus 56
structure length 194
sequence length 194
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mfaA00
2B42B 1HV0A 3WQ7A 1H1AA 1HV1A 3M4FA 3ZSEA 1UU5A 3RI8A 4H7MA 2Z79A 3MF6A 1TE1B 3AKRA 3VZMA 3MF9A 1XNBA 5EJ3A 1BK1A 3VZOA 3AKPA 1NLRA 1W2UA 3LB9A 3MFAA 3VHOA 1ENXA 2BW8A 2DFCA 4IXLA 2VGDA 3WXPA 1XYNA 2DCYA 3MFCA 3WQ0A 3HD8B 4XPVA 1OA2A 2D97A 2NLRA 4S2DA 1XYPA 3WP3A 1OA3A 2QZ2A 2VULA 3RI9A 1REFA 4S2HA 1OA4A 1C5HA 2DFBA 1F5JA 1XNDA 3LGRA 3AMHA 3B5LB 3WQ1A 4HKWA 3B7MA 1BVVA 3AMMA 3AKTA 4S2GA 1BCXA 4HKOA 3VL9A 1XNKA 2F6BA 3AMQA 2DCKA 1OLRA 1H4GA 1OLQA 3WP6A 3AMPA 3WY6A 3O7OA 3VHNA 1UU4A 1XXNA 5K7PA 1UU6A 2NQYA 1M4WA 3VGIA 1REEA 1H0BA 4HK8A 4S2FA 1YNAA 4XQ4A 1QH6A 1PVXA 2JICA 3AMNA 3VZLA 3VZKA 4XQDA 2DCZA 2VG9A 3WP5A 2BVVA 1HIXA 2QZ3A 4HKLA 1XNCA 3WT3A 1REDA 3VLBB 1QH7A 4XQWA 2BWAA 1T6GC 3WR0A 1AXKA 2B45X 3AKQA 1KS5A 3WP4A 3VL8A 5K9YA 2JENA 2D98A 2BWCA 2JEMA 1IGOA 1XYOA 2B46X 2DCJA 2C1FA 3AKSA 3VZJA 3VHPA 1C5IA 2VUJA 1H8VA 4HK9A 4NPRA 3VZNA 1UKRA 3EXUA 5HXVA 3WX5A 1H4HA 1KS4A
chains in the Genus database with same CATH superfamily
1RUJ3 1MZ6A 2HWF3 2NM1A 3O0WA 3O1RA 2X29A 5A6YA 2ZXQA 1QXRA 4E9KA 2UWAA 5FY5A 3PDQA 3HEIA 4NHXA 1IOAA 3K3OA 4W6YA 3VZMA 5CISA 1GWKA 1S0IA 5I0SA 2ZZJA 2XJVA 1LJ7A 5L36A 1VP6A 1H9PA 1OFNA 5CU1A 3CDZB 3PMEA 1NLRA 1PNFA 1ZBE1 2VUDA 4FP3A 4HPKA 4BPZA 2K2SA 2P4EA 2R071 3MYXA 3DEMA 3J8F1 1AX2A 1W2OA 4C0BA 4JX0A 2BW8A 2BERA 2QFEA 2VNOA 5BNNC 5ABJA 3VDDB 2Y34A 1W6OA 3O12A 4IEUA 4QQPA 3FLPA 4DXTA 3IDCB 5A6XA 1JYXA 1AL23 3GCXA 2WNEA 1Z78A 2PAEA 2JDHA 2VO5A 4JTNA 4XE9A 2HWD2 1S0GA 4XMAA 5GLVA 3WDWA 5FJKA 4AG4A 2JE7A 3INAA 3BN6A 5DUXA 5FMOL 5FY8A 3GGLA 4HG6B 3VD5A 1V9U2 3WEZA 4CEWB 2Y6JA 3LCPA 2VOWA 1O3RA 1ODNA 2VMIA 3OUJA 1PO13 1V6MA 4XJAA 4FPHA 2Q4SA 1R1A3 1HXS2 1RUH3 5K4LA 2OUJA 4XHBA 3UETA 4AR2A 4MGQA 3B01A 1G86A 3HR9A 4LIVA 3U4XA 3AP9A 3ACIA 2WFF3 1DGLA 1NT0A 1TQ5A 1EYBA 1UW8A 1FOD3 3MW4A 1US2A 1RUD3 3I4IA 3POWA 5KHIA 3U0ZA 3IMNA 3PUHA 4K6BA 3WHUA 4QX0A 3WG4A 3C2UA 3GZEA 3RG0A 3ZN5A 1F4HA 1DQ1A 1URXA 4JZRA 4GMP3 2X8KA 1OVSA 1Q43A 4KBZA 1LGCA 4K7JA 1PIV2 1OHFA 4N7UA 3R0RA 4NIHA 3ST7A 4URAA 4MX3A 2WZR2 2ZGQA 3BB6A 3FHQA 5L9VA 1LECA 1QIQA 5C3OA 2ZEYA 4JGYA 4AGVA 4NAOA 1WGPA 4YVWC 4D6QA 4X6RB 3R4DB 1BKZA 1UXZA 1AR63 4P9JA 1Q8VA 2DF7A 2DURA 4HK8A 3VBSB 2DU1A 4NRQA 4XURA 1D4M3 1U0AA 1QH6A 3ZN6B 3M70A 2VZ1A 4R4XA 1K45A 3K46A 4C1WA 4RGKA 2W3JA 4O61A 5FYMA 2DCZA 3RNSA 1JN2P 2HWE2 4HKLA 3W5NA 4YM2A 3LE0A 1GR3A 1APNA 4RR3B 1X36A 2WNUC 1E5RA 1BJQA 2VNRA 2XLAA 1RUC1 1WCQA 1YFXA 1QQP1 1PO23 2ZGKA 5FYTA 3U14A 2FDFA 1UZWA 3DYMA 1GYKA 3OGSA 4Y26A 4YVWB 2JB8A 4F8AA 4ISQA 3KHBA 2LW8A 3FZ3A 5GZEA 4QXBA 1NG0A 1SFPA 2EALA 2JJ6A 3E5QA 3IM0A 4Q0QA 4L8QA 1WZXA 3EQEA 4GH4B 4PI0A 4XBNA 5FUIA 5FBJA 3DN7A 1JOBA 1LOCA 2B46X 3P3PA 2DCJA 3NNJA 2P3JA 4EWAA 2WT0A 5SV5A 4NIAA 3T30A 3A0KA 4E2QA 4CCMA 3NV3A 2RS31 4NHMA 4LTAA 3KB5A 1GNHA 2BOIA 3DL3A 1GP6A 5EJ1B 2R0HA 3UGHA 3POBA 4YZ2A 1NE4A 4UW3A 3FUQA 3CJIA 2RM23 3I97A 2PHUA 5C4WA 1LGNA 5IVVA 1WW7A 2A5ZA 5F5AA 3AKPA 5GKAC 3VDDA 3DGTA 3ZYJB 3GJAA 4Q4V3 4XC9A 1M06G 3O1PA 4UI9L 4CP2A 4C0HA 1IG3A 2G9GA 4HLTA 4A42A 3T2OA 1RUJ1 3ACGA 3IDAA 4CCCA 3J9SA 2W1WA 1I1EA 3N7LA 3I59A 3JD71 1TG7A 4IEPA 3D0SA 4MGSA 3URFA 1SDWA 4FOYA 1XB9A 1NCRC 4NIIA 2VZTA 4YFZA 3I2FA 1LOGA 1AUYA 1EV13 5FZ3A 1ULOA 4CU7A 1G9CA 3RWKX 1GKBA 3IPVA 2H6CA 4KH9A 2E9QA 2BNNA 3AL6A 2Z69A 2BTVC 4XBQA 5F5CA 1ZZBA 5BNNA 1J1LA 1Z0HA 2D6LX 5C5TA 3KLSA 1ND3B 1GMMA 4AEDC 1AL21 1RUI3 4FPKA 1H1IA 2AEYA 2DVFA 4Q26A 3WUDA 4ASLA 2D43A 1JH5A 1CAWA 2ID4A 4HVQA 4RSUA 4DOUA 2RR13 1FT9A 4PIZA 3TB0A 1DF0A 3IDBB 4GWJA 2Y6FA 3O1SA 3K4ZA 3B7MA 1OPMA 3K4DA 1SMVA 3OSDA 1PO11 1D2QA 1QMJA 2GC1A 3RSJA 1W8OA 2E6VA 4CP9B 3N4MA 2ZAHA 1R1A1 5T55A 1FPN3 1RUH1 4E4HA 3THCA 3CBNA 1JU3A 1XU2A 4IUGA 2FZ1A 2WFF1 3CIHA 3N9OA 1LOAA 1CPNA 4MGTA 2CGNA 3M3EA 4B4QA 1RUD1 3BTAA 3N9PA 4XAAA 3OD0A 4AEDB 1ULEA 2PLV3 4D6SA 5DZGA 2TNFA 2GNBA 2ZGUA 1DYPA 3I3BA 2Q1MA 2HBTA 5JSRA 2HWB3 4QKBA 3BCWA 4CDUC 4GMP1 1L7RA 2G9FA 1JXNA 1PVXA 3GZUC 5ISLA 1VLNA 3LIGA 4COWA 4LO4B 2JD4A 5C3SA 1AXZA 4JVAA 2D6PA 4BM8A 1I5PA 1ODMA 1NZCA 2BP6A 1W9TA 4JHTA 4WVMA 5IK5A 1FI2A 2Y0IA 5FBZA 5F32A 4YVWA 5IK7A 1UKGA 1AR61 1QH7A 4ZZ5A 1B35C 2QQWA 2QQIA 2VQAA 3U4SA 4HETA 5BXXA 2WABA 1PHMA 1AXKA 3H0OA 1N47A 4Z92B 2WIIB 1B09A 3VL8A 2JENA 3I3EA 1HW5A 5EZWA 3GZAA 3T3YA 4JCKA 2BBVA 2IFRA 1O3QA 3WNLA 2CNAA 4N90A 5GZFA 1RUNA 2WNUA 1C8M1 5DPNA 4OULA 1PMJX 2IUWA 3HIFA 2JXAA 4Q4W3 2B8MA 1W03A 2ZX2A 1PO21 3FHAA 4JHZA 5FZKA 4COUA 4YW5A 1IKQA 1S1AA 2AEZA 4P9XA 1W6NB 4LBQB 1BBT2 1OOPB 4IV3B 4A7ZA 2FDKA 2RS12 1UIKA 1O5UA 1QY4A 4FPCA 2WUHA 2Y6KA 3RGBA 2PAMA 5C9AB 4QB2A 3TWIA 1BK1A 5B4XA 4CUBA 5JOYA 4XFAA 1CIYA 1Y9QA 2J1UA 2NN8A 4UW4A 1RJ8A 1ENXA 4GALA 4BQXA 2P37A 4IXLA 4JDOA 5E16A 4GWIA 3JQXA 2FCUA 1GV9A 3USSA 1OQEA 1RUE2 1X7NA 2RM21 3I2HA 3B00A 4A44A 1A34A 2W2IA 3KT7A 4V2VA 2ZX4A 1AX0A 2RDNA 4Q4V1 2GALA 4QPGC 5T3NA 5A3MA 2D3PA 4BHPA 3WDVA 3SH5A 4L2NA 1HN1A 5T54A 1AYM3 1UNBA 4BH9A 1GBGA 4FFIA 5JWPA 1BK0A 4P08A 2EXKA 1NXMA 4D7YA 2ETEA 4N43C 3BPSA 2DTYA 2QJVA 5ANQA 4AF9A 2BBAA 4CP9A 1NCRA 1LCLA 5G04L 5FY9A 2W52A 2BYVE 5LBFA 4JGZB 4JQRA 4F83A 5G05L 5LA9A 5H9SA 1RUG2 5JZGC 5FP4A 5BNOB 4QWNA 2ARCA 2JX9A 5FK8A 4H2AA 3EYPA 1SCSA 4XZUG 1RUI1 4AEDA 1VMHA 3QLQA 4KL1A 1O7FA 3LSDA 1SLTA 2I2SA 4AGRA 3CNAA 1STMA 4Y3OA 1OVPA 1RITA 2RR11 4YW7A 4B1LA 3NVCA 5T5JA 1T2XA 4M0NA 4R8HA 5ACA2 5JOZA 1PK6C 4JRLA 1REEA 5DDJ1 3Q8AA 3WHTA 1L3JA 2EXJA 2A1XA 2OUHA 4KG0A 3VKLA 1CJPA 2QQJA 1FPN1 5FWJA 3ZPOA 3E6CC 1VBC3 1Y9GA 2Q0AA 2J1AA 1UY1A 2AYHA 5BNPC 1ZM1A 3VB9A 2VC9A 3VBRB 1HDKA 3BODA 2D6KA 2XUMA 3SKJE 1C1FA 2CHHA 4EN0A 1LHUA 1SBEA 1OF3A 2ZEXA 4FPJA 4XJUA 2HWB1 3WDYA 1F9KA 1HRV2 1UX6A 4CDUA 1UX7A 4XUPA 1YHFA 5JR2A 5LRRA 1VB4A 4Y5TA 3WR0A 1RVF2 4Q5OA 4JC1A 5F3EA 1UXXX 2PN5A 5IK4A 1FV3A 4ZS2A 3UKVA 2XJPA 3KVBA 4LLFA 2WSVA 4DFSA 5IFPA 2VPVA 3W58A 4KG8A 1G9FA 5GLTA 1DBNA 1YUDA 3MLLA 1EY2A 4CUCA 1AZDA 1CAXA 2XMLA 4HXCA 2LM3A 3PTYA 4M01A 1WLDA 1AYN2 1B35A 1T6BX 4FXKB 4BXFA 1OH4A 2BPA2 5LEKA 4IE0A 4L99A 3VBOB 4IDZA 1IPJA 2JG9B 3WG1A 4CXXA 2Y8KA 5IK8A 1H8VA 3IIIA 2QQOA 3H7JA 4XF1A 2VOVA 1AR73 5IVYA 4C90A 1VAMA 4H7MA 2VZRA 3BPZA 3O0VA 2W1QA 3ZX7A 3VDBA 1W0OA 1UZYA 2V73A 1KJLA 2ERFA 3E5UA 1JU4A 4M00A 4ZONA 2PA7A 5FRAA 5AC91 1WMDA 1MQTC 3D82A 4GD4A 4GJZA 1H6YA 4FAHA 4O9EA 1AJOA 5FZGA 3BYWA 1OUXA 4XDQA 1OPOA 1XYNA 1ZZ9A 2XUEA 3PHMA 4A7YA 5IAVA 3USUB 5IHRA 5A3LA 1UY4A 2P1BA 5KXCA 2NZ9A 1NA1B 2D97A 1OXCA 1YFYA 4IESA 4Q0PA 2VVDA 2QVSB 3X29B 5CNAA 3A22A 1NXD1 2PELA 4PF1A 3ILRA 4XTPA 3R6SA 2RDQA 4K9SA 4QDQA 1JHJA 1JHNA 1NKGA 2WWSA 4PT6A 3FE5A 3RYRA 1WUVA 1LTEA 3H8RA 4IEWA 2MPFA 2WNOA 1FAYA 1ZZ7A 2EF6A 3KT1A 3AMHA 1RHI2 5BNOA 2F4LA 1OUSA 3B5LB 4CDXB 5F7UA 1J58A 3QOPA 5IVFA 2D40A 3V0BB 1YEWA 3OGVA 3GHMA 4QPGA 1HX6A 1NE6A 4MVTA 1ASJ2 3AM2A 3MEPA 1OT5A 1AYM1 4RFT0 4UFIA 4R52A 3GALA 4D7TA 3H3LA 3ZXFA 1GOGA 3FX3A 1JYIA 2E7QA 1O4TA 4N43A 2F6BA 3DXUA 2YGLA 4XIKA 4XMIA 5FAXA 1BMV2 4CDWC 5FTTC 4Y1VA 3VKMA 3WP6A 2G1MA 3HBZA 5JIUA 1IQAA 2FHRA 4EWDA 2D6MA 4BQYA 2YHJA 1QOTA 1V6IA 4BE3A 2JIJA 1XU1A 2QUOA 4KWUA 3OY8B 5JZGA 3WF1A 2L9LA 3WD5A 2RMU2 3C7OA 1YRZA 4W50A 5CFDB 3S5QA 4GB32 5GZGA 2VZPA 3ZFFC 3ZOIA 3T2TA 1V6JA 2YFZA 2QZ3A 3WT3A 3WNKA 3ETQA 1QHDA 1PK6A 1W8UA 3LD8A 2C9KA 3LEIA 2BDRA 3MPBA 2BOJA 2BV4A 1LR5A 1DZRA 2BWAA 2VMGA 3HNYM 1ST8A 3PURA 1W9WA 3S30A 3M1HA 1VBC1 1DG6A 1H8TC 2ZKLA 2PHWA 4I3GA 4Z1VA 4TWTA 2XL9A 4YNIA 5BNPA 4LKDA 3I54A 5A32B 5IT6A 3RPQA 1AR83 4BQ3A 2UY8A 5T50A 5FZLA 1NYWA 3N9MA 2GU9A 3H42B 4UW6A 3ZFFB 2V4AA 3LFMA 2XR4A 3BOPA 1YJLA 3NW4A 1JUIA 2CAUA 5FXZA 4M3CB 1W9SA 4CCDA 4MGKE 3W9AA 3TN93 2ZHMA 2XHKA 1NQDA 1RJ7A 1X8MA 4UT5A 4YM3A 1OLMA 1UYZA 5LWBA 4U2AA 1JYWA 1HB4A 2PHRA 2BZDA 4WM7C 1QJU2 1DU3D 2CU5A 2HWE3 4OI0A 2ZACA 3MO4A 3ZMNA 5E1RA 5AFEA 5EJ3A 4K40A 1G7YA 4MXWB 2VZQA 3J4UH 1NX9A 3IAQA 3ZXEA 2ZAAA 1VALA 3SLIA 1MEC2 4UFLA 4JKLA 5A80A 5KR7A 2FCVA 1O4ZA 1G8WA 2IWGB 2YGMA 3NSTA 3B3QE 4KBBA 2VOKA 3PL0A 1L7QA 4MGYE 4UWDA 1AR71 4CCKA 3KQ4B 1LAJA 4P9WA 1Q3EA 3ZSLA 4RD7A 5D8AB 3BGAA 4QDSA 4LBQD 2LS6A 1DQ2A 5C8WA 4EE2A 1S0JA 4PQ9A 5BNQA 4CPBD 1MQTA 1LOEA 4YARA 3VBFC 5LA1A 1QJX2 3AZXA 1PGL1 3ZIWA 3SQOA 1DFQA 2P5BA 2VZVA 1UY0A 1A8DA 1WMXA 4LPLA 5JAXA 4BOWA 2VMCA 1XNDA 2NP0A 3UK9A 3NV1A 4KWJA 2ZA9A 1UOBA 4XCBA 1SPPB 2VBBA 2Z42A 5CBLA 3CHXA 3WW4A 1DQ4A 2P6HA 3O14A 4FXGB 2RDSA 4ARYA 5FZ0A 4XUQA 3AP7A 3T08A 3AC0A 3AYEA 3I2DA 4N8MA 4CDQB 4DEVA 5HBAA 5DXDA 5CVRA 1PGW2 1SBFA 3H3UA 1SEFA 4JKKA 3W21A 3NV2A 1ZZ8A 3CQOA 3GM8A 4Y33A 3DPRC 5CKNA 1BLZA 1YJKA 2FBEA 2YUEA 2ZGNA 3WCSA 3TEYA 4E4DX 4Q4X3 3POJA 1NCQB 2H6BA 4H7LA 1VAKA 1SG3A 1C28A 4QX8A 4EZ4A 2JG8B 1BYHA 4YWAA 4S2FA 1GQGA 4XUOA 3QBQA 4XQ4A 3UNPA 4QKDA 2AZ5A 2J1VA 5C8CC 4WZCA 4YW4A 3RJRA 1VPHA 1YFUA 1BEV1 4QPIB 3U07A 4CDWA 1S2BA 1H2LA 4H14A 5FYZA 2VR4A 1D2SA 1WA6X 4MHRA 1DQ0A 1RL3A 1WD3A 3JQWA 5FJHA 3D8CA 1FX5A 3N7JA 3DV8A 2VL4A 1ZA4A 5A32A 1G9AA 2C24A 1PVC2 2CWMA 3DCQA 4L0PA 3ETPA 1DQ6A 1T6GC 1UMZA 1ULPA 2XJRA 3ZPYA 3VHRA 1OQDA 2VMFA 1F35A 1IS3A 4NPLA 3E1F1 3ZFFA 3VD4A 3WP4A 5K9YA 3RZZA 1W2NA 2PHDA 4LOSA 2DVGA 5EQUA 1KRIA 2FDGA 3GHNA 4Z07A 1U5ZA 2A70A 4Y20B 1C5IA 2ORZA 2TEPA 2VW2A 3V65A 4XJ8A 1NQJA 1H8TA 4GKXA 5HCAA 2WO7A 2X53S 5DAXA 4IE5A 3UL2A 2QQPA 2X5IC 4LKEA 1QJEA 2FDJA 2EXHA 1AR81 2WO1A 2C9AA 2A3WA 3CKHA 3RI8A 4AFMA 5A33A 3M2MA 1LKNA 1HKDA 4XCAA 2AC1A 2D93A 2UURA 4IEYA 4LHNA 3ZR5A 3LPFA 5DZFA 4QHOA 3A4UA 1JMUB 2W5FA 2I45A 2YB7A 4MG2A 3HPNA 2GC3A 3TN91 1N1SA 2P3IA 3LZZA 3OBAA 4AQSA 4BZ4A 2YU1A 4QXKA 1X33A 3A21A 4LKFA 4AQ2A 1POV0 2VGDA 3OOXA 4XJ9A 4WM7A 4XF3A 4H3WA 4WM8C 4LOTA 5DUWA 3SCHA 5LRSA 3H8XA 2W87A 3N9LA 4XDPA 4A41A 4YW2A 1WMFA 2WAOA 4BU2A 4Q1RA 4DB5A 1SACA 1HN0A 1DYOA 2CDOA 3VDCA 4J25A 4E4SA 4S2HA 1MPXA 3C8XA 4CEWC 5LEJA 5FZ8A 5C3QA 1Q8PA 2VY0A 4HFSA 1JYVA 3I2KA 3ITQA 5JPMB 1W3XA 1VBD2 5A3PA 4KU8A 3WF0A 1RUF3 2W47A 4COYA 2TUNA 3PNAA 4NHKA 4UW5A 4BLJA 3L2HA 5EXOA 4IGQA 1E5HA 1SCRA 4QM9A 2ZTNA 4FQ4A 2EIGA 1POV3 4WM8B 2E33A 2QBXA 1YQ6A 4FPYA 3VBFA 5DABA 2UYBA 2PHLA 1YQ2A 4O7XA 5GZDA 5KXDA 4UFJA 4CVUA 2XJTA 4P14A 3IT8A 2VU9A 1LB2A 3OBTA 4AZZA 2CYFA 1RUE3 2ET1A 1AVBA 1W2TA 1ENQA 3ZMOA 4P5YA 5DAQA 2VZOA 1VMFA 5BV6A 4KI5M 5CA6A 3JU9A 2QKDA 3CMGA 3JUUA 2OYZA 4GULA 5DAPA 3VGIA 5CAZA 5CG8A 5DZEA 4JTOA 4FTSA 1MZ5A 4MZUA 1JYNA 1QEXA 1WMEA 5T52A 3VBSC 1KGYA 3LEKA 3DPRA 4W4ZA 1LGBA 1D0GA 1E5IA 3VV1A 1JOJA 2HEVF 5CZKA 3ES1A 5EPAA 3BTXA 1COV2 1UZ0A 4Q4X1 3S57A 5F9TA 4MGIE 4QB1A 5FLJA 4CCEA 2A7AA 3MGUA 5FZMA 1OI6A 4JDMA 4K1YA 1RXGA 5AFBA 4FTEA 4M0HA 4HSJA 1QF3A 1RUG3 5IJRA 4OHZA 3ZXKA 2C26A 4RR3C 5FR3A 3KT4A 3EJKA 5KHHA 3AP6A 4P9GA 2WA3A 1ULDA 2GN3A 4XACA 3AKQA 4LA3A 1XNTA 5LY2A 2WN2A 2CDPA 4Z8BA 4AHYA 5C8CA 2WL1A 1KD7A 2KR2A 4Q0VA 1GZTA 1UYYA 3DYOA 1U5YA 4LBJA 5BPXA 4EN7B 2JEMA 1CONA 3UKNA 4A7KA 2G19A 1XYOA 5ACA3 1QJY2 1GNYA 2A6WA 3AVSA 4GH4C 4A6OA 5J7MA 4LBMA 1W8FA 4K8FA 3EO6A 4RS5B 1A8MA 2H0VA 2CL2A 3P5BA 1DHKB 2VUJA 1G9BA 2LRPA 4YG3A 3Q8EA 4YSFA 4ZHNA 3CLPA 3POYA 3EXUA 3U75A 2VCBA 2VQTA 1EUUA 5L7OB 2YY1A 4BIOA 4ES8A 3J26N 1GSLA 4HOOA 5M0TA 1ZRFA 1QXJA 5HCFA 5DMYA 3MDPA 1RB8G 3FMGA 1ZRDA 3PIJA 2DV9A 4LA2A 4M4RA 3VZOA 2D6NA 2ES3A 1R093 1DLLA 1IPKA 4NIGA 3WNPA 3D5OA 3AJZA 4MADA 3CU7A 3AK0A 4YYOA 3LDBA 3VHOA 5CADA 4OYUA 2VOXA 1R1ZA 1RVF3 2JIGA 2WAAA 2WLPA 1LHOA 4UAPA 1VBB2 4AI1A 1WW6A 2X5IA 4HMZA 4ISRA 4HN1A 3SC7X 5K8SA 3WQ0A 5LA0A 2QQNA 2OA2A 5JIAA 3EB7A 1YYNA 1GFF2 2VM9A 2ZBJA 3IWZA 4JDNA 4PBOA 2YDEA 2ZJCA 5E8AA 2HWC2 3G6JB 4RGGA 1IG0A 1AYN3 3OBRA 3ZKUA 3HQRA 2QQKA 2QQUA 1Q8SA 1WA4A 1REFA 1X82A 3KVAA 1RGSA 1N1VA 1GZWB 3ALQA 3N35A 2W68A 4GA9A 3SMHA 4WM8A 1RXFA 5FXWA 1F5JA 2A6VA 2CV6A 1ZBE2 4K1ZA 1ND3C 4OQ8A 1YWKA 2X09A 2FZ2A 5L19A 2R062 3J8F2 4TSVA 3AFKA 4CP1A 4OHVA 4LULA 3WNNA 1W28A 1JODA 3BUCA 2DBIA 3SHRA 4I01A 1S0CA 3FC0A 2HWF1 1S2KA 5TSWA 2IC1A 4LBNA 1ZBA2 2JDYA 4CEWA 2BNOA 2N7GA 2WLQA 4QD2A 1FATA 4OUMA 1XNKA 4A3XA 4BQ4A 2Q8OA 1RUF1 4V2WA 2DCTA 3LAGA 4IEQA 4KU7A 1POV1 4LLOA 3WY6A 1JYCA 3KM5A 2PHTA 3OG2A 1UU4A 4YVSB 1N1TA 4QPWA 3WF4A 5F37A 4XABA 5DN2A 5FXXA 3AZWA 4LR4A 5FYUA 1YNAA 4Y1UA 4QXCA 2DBNA 2Y60A 4XF9A 3RS6A 4PQQA 2JICA 1RUE1 1A3KA 2WFPA 2RDRA 3OEAA 1HB3A 5FKCA 3AYAA 4LQRA 1RHI3 2JE9A 5EP9A 4RHV2 3RWNA 2P3KA 2VCAA 1LOBA 3M3CA 1XQNA 2ARXA 4XUNA 5FO7B 2VJXA 4WVWA 3A0NA 4G9SB 4NHYA 4NMIA 1FOD1 3VBSA 1RMU3 2XBO3 5A7WB 4DY3A 2XH6A 3T0DA 2Z2SB 1AF9A 4NR1A 3ZN6A 4UYBA 1H6XA 1GWLA 1QJZA 1TMF2 3LWCA 5GLUA 1OH3A 2BWCA 4LHSA 4EJRA 5FY1A 4FFGA 3KSCA 1QOSA 4CU8A 1XE7A 1YO8A 2D5FA 1LHVA 1RUG1 2C1FA 4YGEA 4J1WA 4RR3A 2QQVA 5F3GA 4XDOA 2RMU3 2VTXJ 1TME2 3VZNA 4CCJA 4FTBA 4MO3M 2I74A 4GB33 1J84A 3WSOA 3H9AA 1OOPC 1ZA7A 4CA9A 4IV3C 3MV11 3MF6A 1RUC2 4LMFA 3K48A 4Q29A 1LHNA 2XVGA 4ET7A 4NIDA 3AP4A 4NJ4A 5ACA1 1SLLA 1D4M1 3OGGA 4GH4A 2ZKNA 3VKNA 4P9IA 5A3WA 3D6EA 2J42A 4LUMA 5C9AC 3ZYBA 5JLVA 1LENA 4OI4A 2GP3A 4AXOA 2Q5TA 4XF0A 1JW6A 4AWDA 1W9YA 4YW3A 2OS2A 1DLCA 3IDEA 2AUYA 1CD3G 1V70A 2UWCA 2W1UA 3AYDA 1GUIA 4J1XA 2XJQA 5IVCA 5CKMA 1KEXA 2RHPA 1UY3A 1R091 2RS32 1UYXA 3HNMA 3WNOA 1U12A 4IE6A 3WINE 4LXLA 3A23A 4RYDA 3GBFA 2LROA 4PLNA 5L73A 4AEJA 1TVGA 4TYSA 3CJXA 3L9JT 5A7SA 1QJU3 5F2SA 5EYYA 4BMBA 1HQNA 2KXLA 3T4HB 4Y24A 1PM4A 3LGRA 2UWBA 1QNWA 3LEGA 4XFGA 4Y4RA 1CESA 3BTYA 4CZSA 4BYYA 5FZOB 3ZYPA 5BNNB 2MHFA 1RUJ2 4DINB 3OBZA 1C57A 5JPNB 1NAEA 4COZA 3OEBA 1BVVA 1W0NA 4JGZC 3MIEA 2ORXA 3JD72 1XBFA 4S2GA 1VR3A 1BCXA 3VBUB 5BNOC 2WA4A 3F2ZA 2XL7A 4I2OA 1HJFA 1ND3A 2WNVB 1EUTA 2XKPA 2RJKA 1OLRA 4QHBA 4AFBA 1OLQA 2GDFA 1GP5A 4Y1ZA 1NY72 1MS0A 1M4WA 2IXJA 2R042 2Y6LA 1LOFC 2XDVA 2FDHA 3PIGA 1DQ5A 5C7GA 4NWVA 2BRTA 1CZVA 1V6LA 4R4ZA 4E2GA 1EV11 3AZYA 3FBMA 3W20A 3VZKA 4UFKA 3WP5A 2KA3A 3Q9OA 3POIA 3VBRC 1OURA 4D3WA 4DO0A 2ADDA 4MV2A 4AFCA 5A7WA 5HV4A 2Z5WA 5LK5A 5LK7B 1RUH2 4FI9A 1SFYA 2ZZQA 2XQXA 2E7AA 5LW9A 1ONAA 2ZGLA 1IPSA 2XWJB 2D6OX 4BQ5A 4ZXEA 4NWWA 1YQ8A 1ZRIA 2JWPA 3FN9A 3ELNA 3G7DA 3WCRA 5C3RA 2ADEA 3VUOA 4YM0A 5D2AA 4IV1B 1UY2A 1RHI1 4FQZA 4DXRA 4Q8KA 1OKQA 5K0UB 4JRAA 1S4CA 3RZMA 1POQA 1K5MB 1W90A 3K4AA 2FMYA 5JOXA 1GLHA 1VRH2 3ACFA 2P6CA 3AKSA 1F5FA 2D7FA 1FXZA 2ZHLA 5H9PA 2W94A 4DEQA 1MVEA 4JQTA 4X8NA 1QOOA 1RMU1 2XBO1 1YFWA 3ASIA 3RYKA 4IEZA 3VBOC 5IVJA 2JG9C 2WINB 1UD1A 2PLV1 5HCBA 1HQLA 3D0JA 4O65A 1H1AA 2JKXA 2WC2A 1AR62 2SLIA 4DXSA 4PLOA 3APBA 4XILA 3C7GA 5FY4A 2YV8A 3M8LA 1QWRA 3DECA 3IIAA 4A4AA 2B9UA 1ND2B 1SLCA 3B9CA 4E27A 3H3ZA 5FZBA 2ZMNA 1PVC3 4YZ1A 3VBHB 2K46A 2BNMA 1WKYA 3K3NA 3M7AA 1P8JA 3ILFA 4GB31 5FMCA 1EP0A 3TRSB 4Q0SA 1W6NA 4LBQA 3WDUA 5F3IA 1C8M2 1OOPA 4LBKA 5FZCA 4IV3A 1C8NA 1ULFA 2AR6A 1CX4A 1W6PB 2DDUA 5D21A 3UV9A 3TOJA 4XPVA 4CPBA 1ZYBA 4RA0A 1NA1C 5C9AA 3WOGA 1AR93 5FMOS 1PNGA 3ZFEB 2D5HA 2TBVA 4P9YA 4TZDA 2ZX3A 4Y4YA 1O3TA 3DXTA 4R9AA 3NRUA 3P1IA 2P17A 4Q4W1 3UJOA 2O1QA 4YGCA 3OPTA 1LODA 5A7QA 2LUWA 2DU0A 5DUUA 1BHGA 5A3UA 2JD9A 3LSEA 4CDXC 4LITA 3N7MA 2PTMA 1WCDJ 4QU2A 5HXMA 4B3NA 1GZCA 4BK5A 2R7EB 4N9IA 4QPYA 5FREA 4CCNA 3R05A 1QJU1 3B93A 4K8RB 5AVAA 4META 3B94A 5FPLA 1HB2A 4CCLA 2DCKA 1H30A 3BU7A 3MLKA 5FZAA 1H4GA 4OMDA 2RJLA 3T1LA 2RE9A 3NO8A 1H1MA 3PUQA 5I0DA 3J7LA 1Z7S2 1WBLA 3IN9A 2ZEZA 4OHYA 2OT7A 2CGOA 2VD7A 3Q8CA 4JGZA 3RMYA 4EV0A 2VW1A 2DYCA 3FUOA 4ZU7A 1X9PA 1YXWA 2ZGTA 4AEMA 4HVRA 3POEA 1RUOA 4BQ2A 5A1LA 4M3CE 2GAUA 1WBFA 4XFCA 2GH2A 5CFDC 2YMZA 3ACHA 1XNAA 5A70A 4D7SA 2CSGA 3OPZA 3WV6A 1ENSA 1WCSA 2ENRA 2IZWA 3IB3A 1CJDA 1LOFA 2XQRA 3RQ0A 3ZXJA 4IV1A 3UT0A 2VOTA 3PJQA 3NJVA 1YI7A 2GZWA 1QDCA 3ZXGA 2HWD3 3ZSJA 3FBYA 2XGXA 1Y4WA 2RR12 1H9WA 2WQZC 3J7NA 1V9U3 5FPZA 2FDIA 2ILMA 5L9RA 3WDTA 2QCSB 5DDJ2 2E31A 5IVBA 3VBRA 3EMRA 3GZTB 2AH2A 2Y38A 3THTA 1LU2A 3M3IA 1DCSA 2KD7A 2VXJA 2VUCA 3BKZA 1HXS3 3ZYRA 4RGAA 2H0BA 3LA2A 4FPLA 5FO8B 1JZ7A 2YYOA 4IETA 2VTXA 4DZGA 1W05A 3BALA 1X9TA 5FZ1A 1UKRA 4ZXKA 1WLTA 1AHSA 2Z4FA 5BYNA 1HV0A 3U11A 3MHZA 3WQ7A 1YI9A 2R32A 1COV3 1PMIA 2PXJA 3MW2A 2QE3A 2HWB2 2VH9A 4GXLA 1XE0A 4XYXA 3D4KA 5FZ9A 3KF3A 3UGGA 1HLCA 1RYYA 3PU8A 2VTFA 4FP2A 4UFMA 1X50A 2BEOA 3NAPC 4EN9B 4FPEA 1DZTA 1PIV3 1UPSA 3EBRA 2XXZA 1Y3TA 4LE3A 4OUEA 4IGOA 5FYHA 4MLOA 2WZR3 3VDAA 3VBOA 5KHGA 2JG9A 1V00A 5F6LB 2D3RA 1YC61 5F5QA 3O1OA 3MFCA 5CIRA 5A1AA 2E32A 3ZYFA 3WZ1A 2GN7A 3MBWA 4W6WA 2W39A 4FT8A 1OA2A 4U36A 3O1UA 4QAWA 3MICA 4Y22B 5A7PA 4G4FA 5D8AC 1W6MB 5FXVA 1PVC1 2HH9A 4EYUA 4OVEA 5B4NA 1UIJA 2W1SA 2QDNA 4Q4Y2 3RI9A 4TLFA 5GM0A 3SCGA 4NAMA 4UF0B 3NAPB 1W2AX 1WLWA 5FZIA 1CAUB 2C0ZA 4QU1A 3KMHA 3QD6A 5LA2A 1OFSA 1W6QB 2JB4A 2XG3A 3I7DA 4FBFA 5AC92 4OZXA 3USUA 5EIYB 4TTGA 1GOFA 4LBLA 1NA1A 1AR91 1D7PM 1N3QA 4NVPA 3FFQA 2PHXA 3VN4A 1EAH2 4QX3A 2WZEA 4X6QB 3AX4A 3AKTA 1Y43B 3DYPA 1VBB3 3HMYA 3PLQA 2B7YA 4I0WB 3UKTA 4CDQC 4CUGA 2B39A 4IERA 5FLHA 4KGQA 3RZJA 1Q56A 4BLIA 3T2PA 5J96B 1W3VA 1LU1A 1PGSA 3AMQA 4OHWA 3T09A 4AOCA 3PVNA 4FOQA 4ASMB 1S0FA 2BGPA 1PX3A 4IW3A 2OZJA 5AVPA 4CDXA 2MEV2 4AFDA 1E5SA 3C7HA 1L7LA 3TAYA 2K9ZA 1NCQC 2X05A 3V0BA 4M3CF 3E97A 1R082 2XVKA 3ECQA 2GP5A 2JG8C 4N53B 4NO4A 5EYXA 2EIBA 2W46A 4ASKA 5J98B 4OCTA 1F8VA 1ZBE3 1KDKA 2ZGOA 3JCIA 2R16A 2OX0A 4XQDA 2R063 2ZABA 1UQXA 3T4VA 5F5IA 1SDDB 4KWKA 4QPIC 5JDBA 3TNPB 3IMMA 4LT5A 5FWEA 1JZ3A 3LDRA 4GQ7A 4QHZA 3Q8BA 2HLEA 1ZBA3 3WW3A 4C8DA 4FOVA 3H8UA 3OY8A 2VXRA 4YM1A 5C5UA 3ZYHA 2B45X 1DYKA 2ZEWA 2EAAA 5E89A 4XFIA 5I0RA 3B9IA 3CL1A 5CFDA 2D98A 2FMDA 4FPGA 1RC6A 1K3IA 1ZRRA 4AI3A 5GLZA 4R9CA 4ZY9A 3CO2A 2YC2A 1QU0A 4LO8A 5LZ6A 1ALYA 2V4VA 2YC4A 5FP7A 5ABJC 3RYPA 2CGPA 4DQAA 2WS92 2HWD1 5LBCA 1I6XA 4A6SA 1C4RA 1W6OB 2ARAA 1S0DA 1V9U1 1WCUA 1VB2A 3WX5A 2AENA 2VAUA 3JB8A 1UYPA 4GZ9A 4RHV3 3WVJA 1TE1B 3NNGA 2E7TA 4ATEA 4F3JA 3V0AB 2GMPA 1HXS1 1XC6A 5FZ6A 1GQPA 1YQ5A 2GNDA 1SLIA 1W2UA 4FSJA 3HN3A 3S0MA 2V72A 4DS0A 3K77A 1MS9A 4M3CA 4NRMA 1EPWA 1MR5A 2PQSA 4Y22A 3WXPA 4BDVB 4K3UA 3WDXA 1TMF3 5FPAA 4YFWA 1VBE2 1IKPA 3H7YA 3NV4A 5FP3A 2RG4A 4QX5A 3UGFA 4DIQA 4K20A 4RL7A 4GJYA 4UXAA 4XAEA 3KGLA 3LDKA 3NAPA 1OMIA 3JBG2 1PIV1 5T5OA 5HV0A 4MXWA 2WZR1 1TME3 1YCIA 3AXEA 4JKMA 4GWNA 4HANA 5DAWA 4TXWA 2WR9A 4QXHA 4A3ZA 1JI6A 4LK6A 4YZ5A 5FZHA 1RUC3 1I3HA 2HEYF 1TEIA 3HNBM 1AX1A 3AZZA 4AVSA 3BI3A 3L2YA 5D8AA 5C3PA 1KQRA 1VIWB 3TNQA 3GBGA 4XW3A 4MSVA 1AR72 1NUKA 2ZHKA 2HWE1 2JDNA 3AMMA 3MIGA 4P9LA 3WW2A 4AI9A 1KITA 4DMIA 1O59A 1W8TA 5BY5A 3ABZA 1TNRA 2A75A 5FYBA 3U78A 4AVBA 1JOPA 4AW7A 1PGL2 2PHFA 4A45A 3AYCA 3AMPA 1DGWA 2RS33 1SPPA 3O7OA 1BBT3 1IS6A 2C6SA 1UU6A 2NPIA 2EA7A 2RS13 3K75B 4Q8LA 2OXBA 1CR7A 2VNGA 4I30A 5KWRA 1VBB1 5FPXA 1MS1A 3BVCA 2YC0A 4CDQA 2B4KA 2Q1ZB 4B29A 5FPVA 1VRBA 5HI0A 4KMQA 3OB8A 4XJZA 4DNYA 1LULA 3M3OA 5KC6A 2ZHNA 2HEWF 1FMD2 2WZ8A 1HIXA 1YIFA 3N9NA 4PHZA 2P2KA 4MYEA 5EHDA 5JXIA 1MS4A 2Q8DA 1VE0A 1LEDA 4D0QA 1NCQA 3DKQA 5JMCA 3JD73 3WUCA 2JG8A 3KD4A 3C7EA 1KDMA 4XETA 4I02A 3S6PA 3C3VA 5KC5A 2R061 3QH6A 1CWPA 5C6CA 3CJIB 3PJYA 4EWEA 3POGA 5C4WB 3ZYIB 4QPIA 2MNGA 3MV01 3O0XA 3OD4A 1IGOA 1ZNPA 2R043 5HPOA 3SISA 3OF1A 1SZBA 3SH4A 1ZBA1 3VHPA 1F31A 5IVEA 3OYWB 3RZGA 2XOMA 3ZLIA 1DZQA 1BEV2 3BIWE 4RS5C 4GMP0 1Y7BA 2IFWA 1A78A 2BFUS 3P3NA 5FUPA 3V0AA 5IFTA 4J6GA 4DRRA 2DTWA 2YROA 1GWMA 1D4VB 2BGCA 3ACLA 3IKWA 3IAPA 4BCUA 1HV1A 3I59B 4BK4A 4AAPA 4XUTA 5H9QA 1VAVA 1VBA2 4UBGA 3ZDVA 4FAGA 5L7OC 3TEZA 1D0HA 4AAXA 2J1SA 2ARBA 5LY1A 3FHIB 3NNLA 1IS5A 1O6UA 3IPVB 5FDBA 4N7IA 3KCXA 1Q5OA 1SBDA 4FFFA 4IGPA 4YPJA 3NKGA 1H2NA 4Y20A 2ZX0A 2JECA 3MFAA 3KV9A 4QGNA 4LNVA 3BOWA 3SITA 1SLAA 3ZSMA 2HYXA 4W65A 1PZ8A 2A73B 4OHXA 4HZFA 4PF5A 1CAWB 3HJRA 2A3XA 5JSOA 4RHV1 2OQ6A 4Q0UA 5GLWA 4OFGA 3KQRA 1OBNA 1VRH3 1PM7A 5FP8A 1DDLA 3T0BA 1BZWA 1NLQA 4QMAA 4FVVA 2EIDA 4QGLA 1AR82 1OD3A 2Q30A 2VZUA 3FJSA 1DIWA 4ES9A 5F1RA 4V1PA 1GU3A 1TMF1 5CFCC 4AVCA 4AYUA 1C5HA 3PTRB 1HRV3 2RS52 2C4XA 4Y1XA 1QNYA 4O9GA 2W92A 5I0TA 3TN92 2WJSA 5FYYA 5EWSA 1PZ7A 2XJSA 2E51A 3N36A 3W59A 2WRAA 4CUAA 1GOHA 4ZU4A 2Q1FA 4HKWA 1TME1 2I07B 1WW4A 3P6BA 4IEOA 2J1TA 4AHXA 3H50A 5F3CA 1TNFA 5CKQA 5C70A 3AFGA 5DAVA 1C8M3 1N3PA 4NN0A 3JB4C 2YBSA 2W08A 5A3OA 3E6DA 1HRI2 3NJZA 2YBPA 4WVMB 3FLRA 4Y5SA 4DXZA 5IAXA 3ME2A 2EICA 3BTZA 3LPGA 5CFCB 2A6XA 3RZLA 2OQ7A 1W8ZA 1XE8A 2VMEA 1JS9A 5GALA 2A3YA 3I2GA 4YVSC 5LASA 1JZ2A 1H0BA 3GBWA 1JZ8A 2R072 4DUVA 4IL7A 2O14A 4NOTA 3VKOA 4AI8A 4Y1YA 4AE2A 2ZMKA 4BB3A 3DUIA 5A6QA 3CF6E 3KGZA 3RMXA 2R49A 3N7KA 3VD7A 1W04A 3LQCA 1F2NA 3I2JA 4XZPA 4OLLA 4D6RA 1UO9A 2WYSA 1BBT1 2WNUB 2XONA 2WWJA 3WF2A 2RS11 1ZX5A 1K5JA 3I3MA 2WBKA 4CSWA 3ES4A 4B4RA 1OF4A 4XQWA 3KV5A 5I93A 4C1XA 5IATA 2D3SA 3R4SA 3TYJA 3A7QA 5LBEA 5FKBA 1KS5A 2Y6GA 4E8DA 2ZX1A 2ZPXA 1KFUL 2ZMLA 5BUVA 4FOWA 5I8SA 4RFRB 3OYWA 1HJGA 4FPOB 3O1MA 3MUY1 1NZIA 3E6BA 3HOBA 2DUPA 1Z7S3 2YPDA 3ATGA 3NKTA 5F6KA 4AL9A 5FPUA 1YQCA 4D94A 2V09A 3VZJA 4XJWA 2OKXA 3PVBB 2CY6A 2JDMA 3S7EA 3U37A 1CZSA 2B5HA 4Q4X2 2RJ2A 4IEVA 4X8PA 5T5LA 5FCCA 1S0EA 1SLBA 2J1EA 5J09A 4YZ4A 3WW1A 1KS4A 3DF0A 4YGBA 3UYJA 3LOIA 5E88A 5E6HA 5L9BA 3ZSEA 4B1MA 5J36A 1ASJ3 4HBNA 4L92A 5JUVA 4ITCA 1NY71 3MF9A 2R041 2AACA 2ATFA 3QCWA 3RFRA 2JDPA 1HQWA 3LF7A 1LNSA 4XF4A 2IXIA 2XB6C 2QNKA 4RS5A 5LCWL 5FPBA 1LEMA 2CAVA 2WT1A 4JV4A 1MS3A 2GMMA 3B69A 4I0AA 1JTZX 4FPFA 2DCYA 3OUIA 3SEEA 1N1YA 5ANNA 1W8NA 4AVAA 1MZEA 4NPMA 3HBKA 5DDJ3 5A6ZA 4LO7A 4P5HA 1E57A 5L7OA 1JBCA 2XWBB 4YG0A 1NCRB 3LIHA 3U10A 4MOAA 4C91A 4F7ZA 3SNMA 1OC1A 1ACCA 2QDRA 4HT1T 2VBPA 4B7EA 1ULCA 2F4PA 4NROA 5J48A 4I0BA 4QKNA 1BVP1 1WD4A 2VULA 5H9RA 2XLGA 3AL5A 2BVBA 1QQP2 4XXPA 1OA4A 1Q8OA 4XBLA 5KBFA 2A6ZA 1W8HA 2DUOA 2K0GA 2DWRA 3WNMA 4WVVA 3LA7A 1UF2C 1VRH1 2E53A 2GC2A 3F95A 4ZU5A 4DRVA 2ZS6B 2V5DA 3WF3A 4AVVA 2LTNA 4EROA 2QQLA 2W95A 2J1RA 2JDUA 3HQUA 5CFCA 3MZHA 1ENRA 2XLFA 1GZWA 4KQ7A 2YFUA 2WZPP 1HRV1 1J3PA 4AVTA 2PAKA 3VBUC 5LBBA 5JOWA 1RVF1 2WNVC 4A2UA 2IXLA 1PZ9A 4QX2A 1CZTA 4CU6A 3VHNA 1XXNA 1Q8QA 4LIUA 4CDUB 4Q4Y3 3MI8A 3TBDA 4L97A 4QB6A 2HYKA 2YZ4A 3CZUA 5LATA 5JCTA 2ZGRA 5JI7A 3ENRA 4NHLA 5FYCA 4HSLA 3AMNA 2DVDA 5FLIA 1AYN1 3SXWA 4AFAA 3VD9A 2VMHA 2VUAA 3VZLA 5AC93 1AL0G 1V6OA 2HWF2 3AP5A 1MEC3 4RN5A 4AI2A 1MS8A 3POFA 1CAXB 5A7OA 3ZKYA 4H55A 1VMJA 1V6NA 4Z2AA 4E2SA 1B35B 1REDA 1EAH3 3NNMA 4NUBA 3H1YA 1NLSA 2PYTA 2OPWA 4YVSA 1QGLA 1RUF2 2R6QA 3I3QA 2GNTA 3GYDA 2PMWB 2GC0A 5DQ0A 3AJYA 1PX4A 2ZOEB 3OTFA 4SBVA 3J7HA 3I2OA 2QTWB 5CYYA 1O8PA 1GQHA 4RQPC 2R1BA 4N9HA 2KM2A 1QJX3 4ARXA 4B4PA 1AL22 4IV1C 4B7KA 1W8WA 3ZIXA 5K0UC 2MEV3 1ULGA 4W6XA 4CXWA 3MIDA 1CAVB 1K5MC 5IUQA 3C7FA 3UESA 2Q8EA 1R083 2Y26A 3S7IA 1ZREA 3TEXA 3ZXDA 3IBMA 1U5IA 1PO12 5I0UA 5HXVA 4XFBA 1R1A2 3E5XA 2ZGSA 3M4FA 5FMBA 4AHZA 2Z79A 4OQ9A 1Z7S1 2WFF2 1O3SA 2OW4A 2OPKA 1FOD2 5SV8A 4RQPB 4COVA 1RUD2 2AREA 2W0XA 3JZVA 3WNXA 1ND2C 4IEXA 4EN8B 1IZ3A 3WQBA 2BJSA 3VBHC 4R9BA 1JYTA 5EJZB 3OGRA 2IVJA 1N3OA 1ASJ1 1GP4A 1KJRA 3HD8B 4P02B 1UL9A 2JKBA 4LUKA 2FD8A 1AXYA 4QQHA 4EQVA 2VCCA 4S2DA 1J59A 1UPIA 4QPGB 4D8MA 2JDZA 4PLMA 1JUHA 2R0FA 2WS93 1BMV1 1OLME 1W99A 4INDA 1BQPA 3R4UA 1UOGA 4BQ1A 5KHKA 4MHUA 1I9RA 3ZFEC 2IVIB 3GXUA 2HJIA 3VKFC 4D69A 3K2OA 3FLTA 4N43B 1D4M2 3CZJA 2UY9A 3H1MA 2JE8A 4PJYA 4YZ3A 1CVNA 3SCFA 5JXGA 1UMHA 1V6KA 4DUWA 5FYIA 1W9FA 2RMU1 2R1DA 5GZCA 3SEPA 3KF5A 3WQ1A 2WT2A 1QKQA 4PCRA 3OPWA 3ZDSA 5CEHA 2CWSA 5JZGB 3WG2A 3EHKA 4XXAA 1V0AA 2YU2A 3HT1A 1PO22 3HQXA 1XJAA 3ZN4A 1RTVA 3UJQA 1R092 4SLIA 1VBE3 2UYAA 3NJXA 3T2QA 5FQ0B 2FQPA 4EN6B 1CX1A 1W0PA 2OZ6A 4WZFA 3PMSA 1R64A 4I09A 1MS5A 2P3YA 3JBG3 1PK6B 2P34A 3DKWA 2NQYA 3GF6A 3KCCA 4XEZA 5T5PA 1LRHA 4MH0E 4QQOA 5FZOA 1I5ZA 3RJ2X 4K21A 3S5AA 3IZOA 3Q8FA 3GDBA 4XFFA 4LBOA 1W39A 2BUKA 1NOVA 5BNPB 2VQ0A 3O1TA 2G9ZA 4AQTA 4LORA 4L11A 1DGRN 3KS7A 3RRDA 3SH3A 2O0OA 3VBUA 2DUQA 5FOJB 1G9DA 3H8OA 2HKXA 2BFUL 2WNVA 1XNCA 5KXBA 2WO3A 4HONA 1JZ5A 2RM22 3K51A 2VVEA 1S0BA 2YPJA 4Q4Y1 1IS4A 2LALA 1UCXA 3NWKA 1O91A 3FL7A 5FK7A 4Y5Z0 1WW5A 4Q4V2 3GNEA 5I8TA 1H2KA 3TEWA 3QH7A 4YGDA 3ZFGC 3NQHA 4FCAA 1CAVA 4YW1A 1XRUA 2Y33A 4ZPIA 4QM8A 1MEC1 3OGJA 4UOJA 5CB7A 2R30A 2VQUA 3AXDA 2EAKA 4ZKTB 2PFWA 1EAH1 1S55A 1VBD3 2V5YA 1EV12 1WCKA 4XTMA 5JSPA 2VE1A 4AHWA 1CPMA 4MXVA 2IXHA 4RQPA 1CN1A 1QJX1 2B42B 2XVLA 1FMD3 1RUI2 4QQ2A 1LESA 5EFUA 1BXHA 1KXGA 3AKRA 4QQLA 1PMHX 2MEV1 1FYUA 5K0UA 3ZFGB 1OD5A 3ZXLA 3O1VA 2YG0A 1K5MA 1MQTB 2OVUA 1HB1A 4OMCA 4XIOA 4XVHA 1CQ9A 5FUNA 1R081 2IXKA 4ATFA 2GNMA 4PDWC 5FZEA 1YIPA 5FP9A 1MACA 3ZR6A 1G6NA 5JXJA 1XPWA 3RZKA 1FPN2 1O5LA 2GSYA 1U5XA 1UZVA 1TZOA 2E26A 5FY7A 3MIHA 1PGW1 3GCWA 1C3HA 1GICA 1RMU2 2NLRA 2XBO2 4CCOA 1C1LA 2VZSA 3D3AA 4LO5B 1UOFA 5FY0A 1XYPA 5B2GB 2PLV2 2WWUA 1ND2A 4XOGA 2RV9A 1YLLA 1BEV3 1F15A 4CE8A 3VBHA 5FZ7A 3KWVA 3ZYGA 4E4ZA 3OJBA 5KHJA 4GIQA 3PUAA 3POSA 3MUZ1 3I2IA 2DFBA 4PDWB 1VBA3 4YRDA 4CEYC 4CRQA 1XSQA 1KFXL 2QQMA 3NMBA 4W8JA 1W6PA 3H1WA 2Y64A 4OZOA 1O4YA 2WYFA 4PI2A 4UFHA 5F2WA 3WLUA 1F4AA 4AQ6A 4CYDA 5A1FA 2WS91 4AI0A 3THPA 4MUVA 2SBAA 4DY5A 4G3YC 4Q1PA 5FQ0A 3PUSA 2C5DA 4XHXA 1EPZA 3ZFEA 5J1XA 4OI2A 4ONUA 3U1XA 2WKKA 2AGSA 3PVEA 2ET7A 5F39A 3RVHA 2OIIA 2EXIA 1QJY3 5IWFA 1X8EA 4CDWB 5DG1A 5FIXA 3AB0A 3V56A 4OUSA 4QX1A 4HN0A 2HBUA 1FNYA 1J3QA 2Q8CA 4UBHA 4BMEA 1O8SA 4HVOA 1DP0A 1XOYA 1W06A 2W91A 4KGGA 4BWOA 3V64A 4CEYB 2O8OA 2VW0A 5FZFA 2BGOA 4Q4W2 4P00B 2WDBA 1QXPA 2BU9A 5FZDA 1VBE1 1J83A 2JDAA 5FZ4A 4N53C 2WQ4A 2BQPA 2RS53 4LK7A 1S2EA 4NE9A 5EV7A 5A7NA 1JZ4A 3I8TA 2VG9A 2BVVA 2YXSA 3KCYA 4PIYA 1ZZCA 3JBG1 4ZZ8A 3I49A 2O8QA 4IE4A 4PIXA 2XHNA 5F8PA 3KHCA 4L9BA 5I91A 1WWYA 1GANA 3LFIA 5JR7B 5A3NA 5FOBB 2D44A 4M4PA 1H8TB 2EVXA 4Z2WA 1Y9MA 2HWC3 3KV6A 1VJ2A 2Y0OA 4Q27A 4BXSV 5KXEA 3W5MA 1HRI3 2NMNA 3MLJA 2JDKA 4PBPA 4HL0A 2XJUA 4XFHA 5A33B 1RINA 3JXSA 1H2MA 2IXCA 4YW6A 2WO2A 2EIEA 4ORFA 4ZS3A 5FV3A 4E8CA 4BIFA 5C33A 2UU8A 1MZFA 1J3RA 4FFHA 4IE7A 5D1IA 1CIWA 2R073 3PUIA 3J8F3 4CP0A 4WM7B 3ZFGA 4AGGA 5FYSA 4DPNA 1SQ4A 1MVQA 1DGWX 1AYM2 3O5SA 1H4HA 3KZ4C 3MIBA 3LKJA 3QACA 4KNCA 4LHLA 1SFNA 3ZXAC 1UU5A 4LEJA 2W9XA 2WN3A 5FFOC 1XNBA 4Z82A 4GKYA 1GNZA 1VBD1 5FMDA 3AZVA 3GJBA 3KV4A 3LB9A 1US3A 3T1MA 2VZ3A 1IHMA 3NJYA 3NNFA 2DFCA 2E63A 4EZHA 1UOJA 3PVOA 1A6CA 5JXHA 2VECA 1FMD1 4HPKB 5C71A 1SHWB 3PU3A 4BQWA 2YBKA 4CU9A 4CXYA 4DUXA 2GH8A 5ABJB 3VBFB 1OQ1A 3FWEA 1QDOA 4JAAA 2VBDA 3HN1A 3HVDA 4PDWA 3WG3A 4TLGA 3WP3A 1OA3A 4AEKA 4YG6A 2QZ2A 3N9QA 3ON7A 2B9VA 2G4IA 2FCTA 5A3TA 3RZHA 2VCMA 4URTA 1UAIA 3ZVXA 2A6YA 1GZ9A 1WLCA 2WQ8A 3B02A 2CTVA 1VBC2 4TN7A 4BJ0A 1OSGA 3I3DA 4LE4A 4NRPA 5J37A 4GAZA 3LOBA 3MIFA 1AJKA 5IW0A 3SKVA 3ILNA 5LB6A 4JGYC 3J7MA 3AVRA 1W6MA 1COV1 1CGPA 2XKOA 3ORJA 4GWMA 3FFZA 3OCPA 3DPRB 3VL9A 3MW3A 4HKOA 4BA6A 1J1TA 4UF0A 1LHWA 3ROUA 1CAUA 1VBA1 2VNVA 4CEYA 2VMDA 5APAA 5DG2A 5FYVA 2ZGPA 2ZGMA 3M3QA 1W6QA 3CEWA 4LKSA 2NMOA 3BU0A 4R9DA 1ZZ6A 4AK3A 5K7PA 2DVAA 1JZ6A 1OKOA 1ZRCA 3OUHA 4LO6B 3N3HA 1UN1A 1QQP3 2F17A 1QJY1 4QGMA 3MPPG 4JGYB 1RIRA 5C8CB 3LEMA 1AR92 3ZM8A 1FV2A 3ZSKA 2VVFA 4I3PA 1UWWA 4QKFA 2Y6HA 4BISA 5HCHA 2WSUA 2X10A 5JVVA 5FO9B 4OI1A 3RDIA 3VLBB 1UMIA 2ZCWA 3NL1A 4MGZE 1K12A 5DUVA 4FO9A 3LA3A 2PQQA 1QJFA 5J3UA 4WV8A 1DGRA 4CTEA 5JMOA 5CG9A 4N53A 2RS51 2XPJA 5ERLA 4WVZA 4LJHA 5GJ6A 1IQDC 1FNZA 2GMEA 5I8YA 5IYYA 3BIEA 1K42A 3VD3A 4QX7A 4B8EA 3CJIC 4KWLA 5C4WC 2DVBA 4IQPA 2J22A 2NYYA 3VDDC 2A71A 3HWJA 1ZVFA 1UZZA 2RVAA 3HT2A 4WBBA 5JI9A 1XSRA 3HAGA 4Q2FA 2J7MA 2X5IB 2HWC1 4NPRA 4HK9A 4QT6A 4YLZA 3ZO0B 4QDRA 3THDA 4LHKA 1HRI1 3T0AA
chains in the Genus database with same CATH topology
1RUJ3 1MZ6A 2HWF3 2NM1A 3O0WA 2X29A 4E9KA 1QXRA 2UWAA 1IOAA 4W6YA 3VZMA 5I0SA 1S0IA 2ZZJA 2XJVA 1LJ7A 5L36A 1VP6A 1H9PA 1OFNA 5CU1A 3PMEA 1NLRA 1PNFA 1ZBE1 4BPZA 4FP3A 4HPKA 2K2SA 3MYXA 2R071 3J8F1 1AX2A 4C0BA 2BW8A 2VNOA 2QFEA 5BNNC 5ABJA 3VDDB 3O12A 1W6OA 4IEUA 4QQPA 3FLPA 3IDCB 1AL23 2WNEA 1Z78A 2PAEA 4JTNA 4XE9A 5GLVA 4XMAA 2HWD2 1S0GA 3WDWA 4AG4A 2JE7A 3INAA 5DUXA 5FMOL 1V9U2 4CEWB 3LCPA 2VOWA 1O3RA 2VMIA 1PO13 1V6MA 4XJAA 4FPHA 2Q4SA 1R1A3 1HXS2 1RUH3 2OUJA 4XHBA 3B01A 1G86A 3HR9A 3U4XA 3AP9A 2WFF3 1DGLA 1TQ5A 1EYBA 1UW8A 1FOD3 3MW4A 1RUD3 3I4IA 3POWA 5KHIA 3U0ZA 3IMNA 4K6BA 3WHUA 3WG4A 3C2UA 3RG0A 3ZN5A 1DQ1A 1URXA 4GMP3 2X8KA 1Q43A 1LGCA 4K7JA 1PIV2 1OHFA 4N7UA 3R0RA 3ST7A 4MX3A 2WZR2 2ZGQA 3BB6A 1LECA 4JGYA 4AGVA 1WGPA 4YVWC 4X6RB 3R4DB 1BKZA 1AR63 4P9JA 1Q8VA 2DF7A 2DURA 4HK8A 3VBSB 2DU1A 1D4M3 1U0AA 1QH6A 3ZN6B 3M70A 4R4XA 4C1WA 2DCZA 3RNSA 1JN2P 2HWE2 4HKLA 4YM2A 1GR3A 1APNA 4RR3B 1X36A 2WNUC 2XLAA 1BJQA 2VNRA 1RUC1 1YFXA 1QQP1 1PO23 2ZGKA 1GYKA 4Y26A 4YVWB 4F8AA 4ISQA 3FZ3A 5GZEA 1NG0A 2EALA 2JJ6A 3E5QA 3IM0A 4Q0QA 4L8QA 3EQEA 4GH4B 4XBNA 3DN7A 1LOCA 2B46X 3P3PA 2DCJA 4EWAA 2P3JA 2WT0A 5SV5A 3A0KA 4E2QA 3NV3A 2RS31 4NHMA 4LTAA 3KB5A 1GNHA 3DL3A 2R0HA 4YZ2A 1NE4A 4UW3A 3FUQA 3CJIA 2RM23 2PHUA 5C4WA 1LGNA 1WW7A 2A5ZA 3AKPA 5GKAC 3VDDA 3DGTA 3ZYJB 4Q4V3 1M06G 4CP2A 4C0HA 2G9GA 4HLTA 1RUJ1 3J9SA 1I1EA 3N7LA 3I59A 3JD71 4IEPA 3D0SA 3URFA 1SDWA 4FOYA 1NCRC 4YFZA 1LOGA 1AUYA 1EV13 1G9CA 1GKBA 3IPVA 2H6CA 4KH9A 2E9QA 2BNNA 2Z69A 2BTVC 4XBQA 5BNNA 1ZZBA 1J1LA 1Z0HA 2D6LX 3KLSA 1ND3B 4AEDC 1AL21 1RUI3 4FPKA 1H1IA 4Q26A 2DVFA 4ASLA 3WUDA 2D43A 1JH5A 1CAWA 4HVQA 4RSUA 4DOUA 2RR13 1FT9A 4PIZA 3TB0A 1DF0A 3IDBB 3B7MA 1OPMA 1SMVA 1PO11 1D2QA 1QMJA 2GC1A 3RSJA 3N4MA 2E6VA 2ZAHA 1R1A1 5T55A 1FPN3 1RUH1 1XU2A 2FZ1A 2WFF1 1LOAA 1CPNA 2CGNA 3M3EA 4B4QA 1RUD1 3BTAA 3OD0A 4AEDB 1ULEA 2PLV3 5DZGA 2TNFA 2GNBA 2ZGUA 1DYPA 5JSRA 2Q1MA 2HWB3 3BCWA 4CDUC 4GMP1 2G9FA 1JXNA 1PVXA 3GZUC 1VLNA 4COWA 4LO4B 2JD4A 1AXZA 4JVAA 2D6PA 4BM8A 1NZCA 5IK5A 4WVMA 1FI2A 2Y0IA 5FBZA 4YVWA 5IK7A 1UKGA 1AR61 1QH7A 1B35C 2VQAA 4HETA 5BXXA 1PHMA 1AXKA 3H0OA 1N47A 4Z92B 2WIIB 1B09A 3VL8A 2JENA 1HW5A 5EZWA 3GZAA 2BBVA 4JCKA 2IFRA 1O3QA 2CNAA 4N90A 5GZFA 1RUNA 2WNUA 1C8M1 4OULA 3HIFA 2JXAA 4Q4W3 2B8MA 2ZX2A 1PO21 4COUA 4YW5A 1IKQA 1S1AA 4P9XA 1W6NB 4LBQB 1BBT2 1OOPB 4IV3B 4A7ZA 2RS12 1UIKA 1O5UA 1QY4A 4FPCA 5C9AB 2PAMA 3TWIA 5JOYA 1BK1A 4XFAA 1Y9QA 2NN8A 4UW4A 1RJ8A 1ENXA 4GALA 2P37A 4IXLA 4JDOA 5E16A 3JQXA 1GV9A 3USSA 1OQEA 1RUE2 1X7NA 2RM21 3B00A 3KT7A 2ZX4A 1AX0A 4Q4V1 2GALA 4QPGC 5T3NA 5A3MA 2D3PA 4BHPA 3WDVA 3SH5A 4L2NA 5T54A 4BH9A 1AYM3 1GBGA 5JWPA 2EXKA 1NXMA 4D7YA 2ETEA 4N43C 2DTYA 2QJVA 4AF9A 1NCRA 1LCLA 2W52A 2BYVE 4JGZB 4JQRA 4F83A 5H9SA 1RUG2 5JZGC 5BNOB 2JX9A 1SCSA 4AEDA 1RUI1 3QLQA 4KL1A 1O7FA 3LSDA 1SLTA 2I2SA 4AGRA 3CNAA 1RITA 2RR11 3NVCA 5T5JA 4M0NA 4R8HA 5ACA2 5JOZA 1PK6C 4JRLA 1REEA 5DDJ1 3WHTA 1L3JA 2EXJA 2OUHA 4KG0A 3VKLA 1CJPA 1FPN1 3E6CC 1VBC3 2Q0AA 2AYHA 5BNPC 1ZM1A 3VBRB 1HDKA 3BODA 2D6KA 2XUMA 1C1FA 4EN0A 1LHUA 1SBEA 4FPJA 4XJUA 2HWB1 3WDYA 1F9KA 1HRV2 1UX6A 4CDUA 1YHFA 5LRRA 1VB4A 3WR0A 1RVF2 4JC1A 2PN5A 5IK4A 1FV3A 3UKVA 2XJPA 4LLFA 2WSVA 4DFSA 2VPVA 3W58A 4KG8A 1G9FA 5GLTA 1DBNA 1YUDA 3MLLA 1EY2A 1AZDA 1CAXA 2LM3A 3PTYA 4M01A 1WLDA 1AYN2 1B35A 4FXKB 2BPA2 5LEKA 4L99A 3VBOB 3WG1A 5IK8A 1IPJA 2JG9B 1H8VA 3H7JA 4XF1A 2VOVA 1AR73 4C90A 1VAMA 4H7MA 3BPZA 3O0VA 3ZX7A 1W0OA 2V73A 1UZYA 1KJLA 2ERFA 3E5UA 4M00A 2PA7A 5FRAA 5AC91 1WMDA 1MQTC 3D82A 4FAHA 4O9EA 1AJOA 4XDQA 1OPOA 1XYNA 1ZZ9A 3PHMA 4A7YA 3USUB 5A3LA 5KXCA 2NZ9A 1NA1B 2D97A 1YFYA 4IESA 4Q0PA 2VVDA 2QVSB 3X29B 5CNAA 3R6SA 1NXD1 2PELA 4XTPA 3ILRA 4K9SA 1JHNA 2WWSA 3FE5A 3RYRA 1WUVA 1LTEA 4IEWA 2MPFA 1FAYA 1ZZ7A 2EF6A 3KT1A 3AMHA 1RHI2 5BNOA 3B5LB 4CDXB 1J58A 3QOPA 2D40A 3V0BB 3GHMA 4QPGA 1HX6A 1NE6A 4MVTA 1ASJ2 3AM2A 3MEPA 1AYM1 4RFT0 4R52A 3GALA 4D7TA 3ZXFA 3FX3A 1JYIA 2E7QA 1O4TA 4N43A 2F6BA 4XIKA 2YGLA 4XMIA 5FAXA 1BMV2 4CDWC 5FTTC 4Y1VA 3VKMA 3WP6A 3HBZA 5JIUA 1IQAA 2FHRA 4EWDA 2D6MA 2YHJA 1QOTA 1V6IA 4BE3A 1XU1A 2QUOA 3OY8B 5JZGA 3WD5A 2RMU2 1YRZA 5CFDB 4GB32 5GZGA 3ZFFC 3T2TA 1V6JA 2QZ3A 3WT3A 3ETQA 1QHDA 1PK6A 3MPBA 1LR5A 1DZRA 2BWAA 2VMGA 3S30A 3M1HA 1VBC1 1DG6A 1H8TC 2ZKLA 2PHWA 4I3GA 4Z1VA 4TWTA 2XL9A 4YNIA 5BNPA 3I54A 5A32B 5IT6A 3RPQA 1AR83 2UY8A 5T50A 1NYWA 2GU9A 3ZFFB 4UW6A 3BOPA 1YJLA 3NW4A 1JUIA 2CAUA 4M3CB 4MGKE 3W9AA 3TN93 2ZHMA 2XHKA 1NQDA 1RJ7A 1X8MA 4YM3A 4U2AA 2PHRA 4WM7C 1QJU2 1DU3D 2HWE3 4OI0A 2ZACA 3ZMNA 5E1RA 5AFEA 5EJ3A 4K40A 1G7YA 4MXWB 3J4UH 3ZXEA 2ZAAA 1VALA 3SLIA 1MEC2 1O4ZA 1G8WA 2IWGB 2YGMA 3NSTA 3B3QE 4KBBA 2VOKA 4MGYE 1AR71 4P9WA 1Q3EA 3ZSLA 4RD7A 5D8AB 4LBQD 1DQ2A 5C8WA 1S0JA 4PQ9A 5BNQA 1MQTA 1LOEA 4YARA 3VBFC 1PGL1 1QJX2 3AZXA 3ZIWA 1DFQA 1A8DA 5JAXA 4BOWA 1XNDA 2NP0A 3UK9A 3NV1A 4KWJA 2ZA9A 2Z42A 5CBLA 3WW4A 1DQ4A 3O14A 4FXGB 3AP7A 3AYEA 3I2DA 4CDQB 5HBAA 5DXDA 5CVRA 1PGW2 1SBFA 3H3UA 1SEFA 3NV2A 1ZZ8A 3DPRC 1YJKA 2FBEA 2YUEA 2ZGNA 3WCSA 4E4DX 4Q4X3 1NCQB 2H6BA 4H7LA 1VAKA 1C28A 2JG8B 1BYHA 4S2FA 1GQGA 3QBQA 4XQ4A 2AZ5A 5C8CC 4WZCA 4YW4A 3RJRA 4QPIB 1YFUA 1BEV1 3U07A 4CDWA 1S2BA 1H2LA 4H14A 1D2SA 1DQ0A 1RL3A 1WD3A 3JQWA 3D8CA 1FX5A 3N7JA 3DV8A 1ZA4A 5A32A 1G9AA 1PVC2 2CWMA 1DQ6A 1T6GC 1UMZA 2XJRA 3ZPYA 3VHRA 1OQDA 1IS3A 3ZFFA 3WP4A 5K9YA 3RZZA 2PHDA 1KRIA 2DVGA 3GHNA 4Z07A 1U5ZA 2A70A 4Y20B 1C5IA 2TEPA 2VW2A 3V65A 4XJ8A 1NQJA 1H8TA 4GKXA 5HCAA 2X53S 2QQPA 3UL2A 2X5IC 2EXHA 1AR81 2C9AA 2A3WA 3RI8A 4AFMA 5A33A 3M2MA 1LKNA 1HKDA 2D93A 2UURA 4IEYA 4LHNA 5DZFA 3A4UA 2I45A 4AQSA 2GC3A 3TN91 1N1SA 2P3IA 3LZZA 4BZ4A 4QXKA 1X33A 4AQ2A 1POV0 2VGDA 4XJ9A 4WM7A 4XF3A 4H3WA 4WM8C 5DUWA 3SCHA 5LRSA 4YW2A 1WMFA 4Q1RA 4DB5A 1SACA 4E4SA 5LEJA 4S2HA 4CEWC 1Q8PA 2VY0A 4HFSA 5JPMB 1VBD2 4KU8A 1RUF3 4COYA 2TUNA 3PNAA 4NHKA 4UW5A 4BLJA 3L2HA 5EXOA 4QM9A 1SCRA 2ZTNA 4FQ4A 2EIGA 1POV3 4WM8B 4FPYA 3VBFA 2UYBA 2PHLA 5KXDA 5GZDA 2XJTA 4P14A 3IT8A 2VU9A 1LB2A 3OBTA 2CYFA 1RUE3 2ET1A 1AVBA 1ENQA 3ZMOA 5BV6A 5CA6A 3JU9A 2QKDA 2OYZA 3JUUA 5CG8A 4GULA 3VGIA 5CAZA 5DZEA 4JTOA 4FTSA 1MZ5A 4MZUA 1WMEA 3VBSC 5T52A 3DPRA 1LGBA 1D0GA 3VV1A 1JOJA 2HEVF 3ES1A 1COV2 4Q4X1 5F9TA 4MGIE 5FLJA 2A7AA 3MGUA 1OI6A 4JDMA 4K1YA 5AFBA 4FTEA 4M0HA 4HSJA 1QF3A 1RUG3 4OHZA 3ZXKA 4RR3C 3KT4A 3EJKA 5KHHA 3AP6A 4P9GA 2WA3A 1ULDA 2GN3A 3AKQA 4LA3A 4Z8BA 4AHYA 5C8CA 2WL1A 1KD7A 4Q0VA 1U5YA 4LBJA 5BPXA 4EN7B 2JEMA 1CONA 3UKNA 4A7KA 1XYOA 5ACA3 1QJY2 2A6WA 5J7MA 4GH4C 4LBMA 4K8FA 3EO6A 4RS5B 1A8MA 2H0VA 2CL2A 1DHKB 2VUJA 1G9BA 4YG3A 4YSFA 3CLPA 3POYA 3EXUA 5L7OB 2YY1A 4ES8A 3J26N 1GSLA 1ZRFA 1QXJA 5HCFA 1RB8G 3MDPA 3FMGA 1ZRDA 2DV9A 4LA2A 3VZOA 2D6NA 2ES3A 1R093 1DLLA 1IPKA 3D5OA 3AJZA 3CU7A 3AK0A 4YYOA 3VHOA 5CADA 2VOXA 1R1ZA 1RVF3 2WLPA 1LHOA 1VBB2 4AI1A 1WW6A 2X5IA 4HMZA 4ISRA 4HN1A 5K8SA 3WQ0A 2OA2A 5JIAA 1YYNA 1GFF2 2ZBJA 3IWZA 4JDNA 4PBOA 2YDEA 2ZJCA 5E8AA 2HWC2 3G6JB 4RGGA 1AYN3 3OBRA 1Q8SA 1WA4A 1REFA 1X82A 3N35A 1RGSA 1N1VA 1GZWB 3ALQA 2W68A 4GA9A 3SMHA 4WM8A 1F5JA 2A6VA 2CV6A 1ZBE2 4K1ZA 1ND3C 2FZ2A 1YWKA 5L19A 2R062 3J8F2 4TSVA 3AFKA 4CP1A 4OHVA 4LULA 3SHRA 4I01A 1S0CA 3FC0A 2HWF1 1S2KA 5TSWA 2IC1A 4LBNA 1ZBA2 4CEWA 2BNOA 2N7GA 2WLQA 4QD2A 1FATA 4OUMA 1XNKA 4A3XA 2Q8OA 1RUF1 2DCTA 3LAGA 4IEQA 4KU7A 1POV1 4LLOA 3WY6A 1JYCA 3KM5A 2PHTA 1UU4A 4YVSB 1N1TA 3AZWA 4LR4A 1YNAA 4Y1UA 4XF9A 3RS6A 2JICA 1RUE1 1A3KA 2WFPA 3AYAA 1RHI3 2JE9A 4RHV2 3RWNA 2P3KA 1LOBA 3M3CA 1XQNA 2ARXA 5FO7B 4WVWA 3A0NA 4G9SB 4DY3A 1FOD1 3VBSA 1RMU3 2XBO3 2XH6A 2Z2SB 1AF9A 4NR1A 3ZN6A 1TMF2 1QJZA 3LWCA 5GLUA 2BWCA 4EJRA 3KSCA 1QOSA 1XE7A 1YO8A 2D5FA 1LHVA 1RUG1 2C1FA 4YGEA 4J1WA 4RR3A 2RMU3 1TME2 3VZNA 4FTBA 2I74A 4GB33 3H9AA 1OOPC 4IV3C 3MF6A 1RUC2 3K48A 4Q29A 1LHNA 2XVGA 3AP4A 5ACA1 1SLLA 1D4M1 3OGGA 4GH4A 2ZKNA 3VKNA 4P9IA 5C9AC 3D6EA 4LUMA 5JLVA 1LENA 4OI4A 4AXOA 2Q5TA 4XF0A 1JW6A 4AWDA 4YW3A 3IDEA 2AUYA 1CD3G 1V70A 2UWCA 3AYDA 4J1XA 2XJQA 2RHPA 1R091 2RS32 1U12A 3WINE 3GBFA 4PLNA 5L73A 4AEJA 4TYSA 3CJXA 3L9JT 1QJU3 5EYYA 4BMBA 1HQNA 2KXLA 4Y24A 3LGRA 2UWBA 1QNWA 4XFGA 1CESA 4CZSA 4BYYA 3ZYPA 2MHFA 1RUJ2 4DINB 1C57A 5JPNB 4COZA 1BVVA 4JGZC 3MIEA 3JD72 4S2GA 1VR3A 1BCXA 3VBUB 5BNOC 2WA4A 2XL7A 4I2OA 1ND3A 2WNVB 2XKPA 2RJKA 1OLRA 4QHBA 4AFBA 1OLQA 2GDFA 4Y1ZA 1NY72 1MS0A 1M4WA 2IXJA 2R042 1LOFC 1DQ5A 4NWVA 1V6LA 4R4ZA 4E2GA 1EV11 3AZYA 3FBMA 3VZKA 3WP5A 2KA3A 3Q9OA 3VBRC 4D3WA 4MV2A 4AFCA 2Z5WA 5LK5A 5LK7B 1RUH2 1SFYA 2ZZQA 2E7AA 1ONAA 2ZGLA 2XWJB 2D6OX 4NWWA 3G7DA 3WCRA 3ELNA 3VUOA 4YM0A 4IV1B 1RHI1 4FQZA 4Q8KA 1OKQA 5K0UB 4JRAA 1K5MB 2FMYA 5JOXA 1GLHA 1VRH2 3AKSA 1F5FA 2D7FA 1FXZA 2ZHLA 5H9PA 1MVEA 4X8NA 1QOOA 1RMU1 2XBO1 1YFWA 3ASIA 3RYKA 4IEZA 3VBOC 2JG9C 2WINB 1UD1A 2PLV1 5HCBA 1HQLA 3D0JA 1H1AA 2WC2A 1AR62 2SLIA 4PLOA 3APBA 4XILA 2YV8A 3M8LA 1QWRA 3IIAA 2B9UA 1ND2B 1SLCA 3B9CA 4E27A 3H3ZA 2ZMNA 1PVC3 4YZ1A 3VBHB 2BNMA 3M7AA 3ILFA 4GB31 1EP0A 3TRSB 4Q0SA 1W6NA 4LBQA 3WDUA 1C8M2 1OOPA 4LBKA 4IV3A 1C8NA 1ULFA 2AR6A 1CX4A 1W6PB 3UV9A 3TOJA 4XPVA 1ZYBA 4RA0A 1NA1C 5C9AA 3WOGA 1AR93 5FMOS 1PNGA 3ZFEB 2D5HA 2TBVA 4P9YA 4TZDA 2ZX3A 4Y4YA 1O3TA 4R9AA 2P17A 4Q4W1 3UJOA 2O1QA 4YGCA 1LODA 2LUWA 2DU0A 5DUUA 3LSEA 4CDXC 3N7MA 2PTMA 1WCDJ 4QU2A 4B3NA 1GZCA 4N9IA 4QPYA 5FREA 3R05A 1QJU1 3B93A 5AVAA 4META 3B94A 2DCKA 1H30A 3BU7A 3MLKA 1H4GA 3T1LA 2RJLA 2RE9A 3NO8A 1H1MA 1Z7S2 1WBLA 3IN9A 4OHYA 2CGOA 4JGZA 3RMYA 4EV0A 2VW1A 2DYCA 3FUOA 4ZU7A 1YXWA 2ZGTA 4AEMA 4HVRA 1RUOA 4M3CE 2GAUA 1WBFA 4XFCA 2GH2A 5CFDC 2YMZA 4D7SA 3OPZA 3WV6A 1ENSA 1WCSA 2ENRA 2IZWA 3RQ0A 1CJDA 1LOFA 4BIOA 3ZXJA 4IV1A 3PJQA 1YI7A 2GZWA 1QDCA 3ZXGA 2HWD3 3ZSJA 3FBYA 2XGXA 2RR12 1H9WA 2WQZC 1V9U3 5FPZA 2ILMA 3WDTA 2QCSB 5DDJ2 3VBRA 3GZTB 3THTA 2AH2A 2Y38A 1LU2A 3M3IA 1HXS3 3ZYRA 4RGAA 2H0BA 3LA2A 4FPLA 5FO8B 2YYOA 4IETA 4DZGA 3BALA 1UKRA 4ZXKA 1WLTA 1AHSA 5BYNA 1HV0A 3U11A 3WQ7A 1YI9A 2R32A 1COV3 1PMIA 3MW2A 4XYXA 2QE3A 2HWB2 2VH9A 4GXLA 3D4KA 1HLCA 4FP2A 1X50A 2BEOA 3NAPC 4EN9B 4FPEA 1DZTA 1PIV3 1UPSA 3EBRA 1Y3TA 4LE3A 4MLOA 2WZR3 3VBOA 5KHGA 2JG9A 1V00A 5F6LB 2D3RA 5F5QA 3MFCA 5CIRA 3WZ1A 2GN7A 4W6WA 2W39A 4FT8A 1OA2A 4U36A 4Y22B 3MICA 4G4FA 5D8AC 1W6MB 1PVC1 4OVEA 1UIJA 2QDNA 4Q4Y2 3RI9A 4TLFA 5GM0A 3NAPB 1WLWA 1CAUB 2C0ZA 3KMHA 3QD6A 4FBFA 1OFSA 1W6QB 2XG3A 3I7DA 5AC92 4OZXA 3USUA 4LBLA 1NA1A 1AR91 4NVPA 1N3QA 3FFQA 2PHXA 3VN4A 1EAH2 4X6QB 3AX4A 3AKTA 1Y43B 3PLQA 1VBB3 3HMYA 4I0WB 2B7YA 3UKTA 4CDQC 2B39A 4IERA 5FLHA 4KGQA 1Q56A 4BLIA 5J96B 1LU1A 1PGSA 3AMQA 4OHWA 3PVNA 4FOQA 4ASMB 1S0FA 5AVPA 2OZJA 4CDXA 2MEV2 4AFDA 3TAYA 2K9ZA 1NCQC 3V0BA 4M3CF 3E97A 1R082 2XVKA 3ECQA 2JG8C 4N53B 4NO4A 5EYXA 5J98B 1F8VA 1ZBE3 1KDKA 2ZGOA 3JCIA 2R16A 4XQDA 2R063 2ZABA 4KWKA 4QPIC 5JDBA 3TNPB 4LT5A 4GQ7A 1ZBA3 3WW3A 4FOVA 3H8UA 3OY8A 2VXRA 4YM1A 2B45X 1DYKA 5E89A 2EAAA 4XFIA 5I0RA 3B9IA 3CL1A 5CFDA 2D98A 2FMDA 4FPGA 1RC6A 1ZRRA 4AI3A 5GLZA 4R9CA 3CO2A 1QU0A 4LO8A 1ALYA 5ABJC 2CGPA 3RYPA 4DQAA 2WS92 2HWD1 1I6XA 1C4RA 1W6OB 1S0DA 1V9U1 1VB2A 3WX5A 2AENA 3JB8A 4RHV3 3WVJA 1TE1B 2E7TA 4ATEA 4F3JA 3V0AB 2GMPA 1HXS1 2GNDA 1SLIA 1W2UA 4FSJA 3S0MA 4DS0A 1MS9A 4M3CA 1EPWA 1MR5A 4Y22A 3WXPA 4K3UA 3WDXA 1TMF3 4YFWA 1VBE2 1IKPA 3H7YA 3NV4A 4QX5A 4K20A 4RL7A 4UXAA 3KGLA 3NAPA 1OMIA 3JBG2 1PIV1 5T5OA 4MXWA 2WZR1 1TME3 1YCIA 3AXEA 4GWNA 4HANA 4YZ5A 1RUC3 1I3HA 2HEYF 1TEIA 4AVSA 1AX1A 3AZZA 3L2YA 5D8AA 1KQRA 1VIWB 3TNQA 3GBGA 4XW3A 4MSVA 1AR72 2ZHKA 2HWE1 3AMMA 3MIGA 4P9LA 3WW2A 1KITA 4DMIA 5BY5A 1TNRA 2A75A 4AVBA 4AW7A 1PGL2 2PHFA 3AYCA 3AMPA 1DGWA 2RS33 3O7OA 1BBT3 1IS6A 1UU6A 2NPIA 2EA7A 2RS13 4Q8LA 1CR7A 2VNGA 4I30A 5KWRA 1VBB1 5FPXA 1MS1A 2YC0A 4CDQA 2Q1ZB 4B29A 5HI0A 4XJZA 4DNYA 1LULA 3M3OA 5KC6A 2ZHNA 2HEWF 1FMD2 1HIXA 1YIFA 2P2KA 4MYEA 1MS4A 1LEDA 1NCQA 5JMCA 3JD73 3WUCA 2JG8A 3KD4A 4XETA 1KDMA 4I02A 3S6PA 3C3VA 5KC5A 2R061 3QH6A 5C6CA 3CJIB 3PJYA 4EWEA 5C4WB 3ZYIB 4QPIA 2MNGA 3O0XA 3OD4A 1IGOA 1ZNPA 2R043 3SISA 3OF1A 3SH4A 1ZBA1 3VHPA 1F31A 3OYWB 1DZQA 1BEV2 3BIWE 4RS5C 4GMP0 1Y7BA 2IFWA 1A78A 2BFUS 3P3NA 3V0AA 4J6GA 4DRRA 2DTWA 2YROA 1D4VB 2BGCA 3ACLA 3IKWA 4BCUA 1HV1A 3I59B 5H9QA 4FAGA 1VAVA 1VBA2 4UBGA 5L7OC 1D0HA 2ARBA 3FHIB 1IS5A 3IPVB 5FDBA 4N7IA 3KCXA 1Q5OA 1SBDA 3NKGA 1H2NA 4Y20A 2ZX0A 2JECA 3MFAA 4LNVA 4QGNA 5BNNB 3BOWA 3SITA 1SLAA 3ZSMA 4W65A 1PZ8A 2A73B 4OHXA 4HZFA 4PF5A 1CAWB 2A3XA 5JSOA 4RHV1 4Q0UA 5GLWA 4OFGA 3KQRA 1VRH3 1PM7A 1DDLA 1BZWA 4QMAA 4FVVA 4QGLA 1AR82 2Q30A 3FJSA 1DIWA 4ES9A 5F1RA 4V1PA 1TMF1 5CFCC 4AVCA 4AYUA 1C5HA 1HRV3 2RS52 4Y1XA 1QNYA 4O9GA 5I0TA 3TN92 2WJSA 5EWSA 1PZ7A 2XJSA 2E51A 3N36A 3W59A 4ZU4A 4HKWA 1TME1 2I07B 1WW4A 4IEOA 4AHXA 3H50A 1TNFA 3AFGA 1C8M3 1N3PA 4NN0A 3JB4C 2W08A 3E6DA 1HRI2 3NJZA 4WVMB 3FLRA 4DXZA 3ME2A 5CFCB 2A6XA 1XE8A 5GALA 2A3YA 4YVSC 1H0BA 3GBWA 2R072 4IL7A 4NOTA 4AI8A 3VKOA 4Y1YA 4AE2A 2ZMKA 3DUIA 3CF6E 3KGZA 3RMXA 2R49A 3N7KA