3MFAA

Computationally designed endo-1,4-beta-xylanase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
194
structure length
194
Chain Sequence
b'GSDTTITQNQTGYDNGYFYSFWTDAPGTVSMTLHSGGSYSTSWRNTGLFVAGKGWSTGGRRTVTYNASFNPSGNARLTLYGWTRGPLVSYHIVESWGTYRPTGTYKGTVTTDGGTYDIYETWRYNAPSIEGTRTYQQFWSVRQQKRTSGTITIGNHFDAWARAGMNLGSHDYQIMATEGYQSSGSSTVSISEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Computational design of an endo-1,4-{beta}-xylanase ligand binding site.
pubmed doi rcsb
source organism Thermopolyspora flexuosa
molecule tags Hydrolase
total genus 56
structure length 194
sequence length 194
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3mfaA00
1QH7A 1REDA 2C1FA 3VZMA 3WP3A 3AKQA 3WQ0A 3WQ7A 1OLQA 4HK8A 2NQYA 3HD8B 1XNCA 1HIXA 2F6BA 4S2GA 1REFA 1NLRA 1OA2A 3O7OA 3VGIA 2BWAA 3VHOA 4H7MA 3VHNA 2BWCA 3LB9A 1H4GA 3EXUA 3RI8A 3LGRA 1C5HA 1QH6A 3AMHA 1F5JA 1UU5A 3VZLA 1IGOA 2VULA 4S2HA 2DCYA 1BVVA 3WXPA 2B45X 1BCXA 1XYPA 1KS5A 1BK1A 3MF9A 3WY6A 3M4FA 1H8VA 1YNAA 1UU4A 1UKRA 1H1AA 1XYOA 4XQDA 2BW8A 1XYNA 1H4HA 1UU6A 2JENA 1XNBA 2B42B 4XQWA 2QZ3A 1ENXA 4IXLA 3MF6A 3AMQA 2DCJA 3WT3A 1W2UA 2JICA 3MFCA 5K9YA 3B7MA 1XXNA 1XNDA 3VZOA 2VUJA 3VZNA 5K7PA 1XNKA 2VG9A 1PVXA 2BVVA 2D97A 1OA4A 1TE1B 2VGDA 1AXKA 3ZSEA 5HXVA 4HKOA 1C5IA 3AMMA 2DFCA 4HKLA 3VLBB 2B46X 3WP5A 3VL8A 4XPVA 3AKPA 4XQ4A 4NPRA 3WQ1A 3VL9A 2DFBA 3AKSA 3MFAA 2D98A 2DCZA 3AKTA 4HKWA 3WP4A 2QZ2A 1HV1A 3VHPA 3AMPA 1KS4A 1REEA 3RI9A 1OLRA 3VZKA 1T6GC 2DCKA 2JEMA 5EJ3A 3WR0A 3B5LB 4S2FA 1H0BA 3WX5A 4S2DA 2Z79A 1HV0A 1M4WA 3WP6A 2NLRA 4HK9A 3VZJA 3AKRA 3AMNA 1OA3A
chains in the Genus database with same CATH superfamily
1N1SA 5BV6A 1X8MA 1X7NA 4KU7A 1G9BA 5F37A 2DUQA 4OULA 2ZGLA 1XPWA 1IOAA 1ZRRA 2E7AA 4GJYA 4SLIA 4CUAA 4DXSA 4GMP1 1LEDA 4A7ZA 1YQ2A 3GALA 2CGNA 2QJVA 2E9QA 1XRUA 4QPYA 3UGFA 4UFIA 5I8TA 2DUOA 4MHRA 2PHWA 2YG0A 1G9FA 1JU3A 3APBA 3H50A 2ZHMA 3S0MA 1DGRN 3MLLA 2MEV2 5LCWL 4A3XA 4N53A 4LBQB 2WR9A 3OBTA 4JAAA 2PN5A 3RVHA 4Y24A 3UGGA 2GH2A 1K5JA 2DYCA 2JDMA 1XC6A 5FUIA 2VW0A 1W0PA 2V5YA 4FXGB 1CIWA 3K75B 1GQHA 5A3MA 4HMZA 4LJHA 3JQXA 5JXJA 4JV4A 2ADEA 4RFT0 3AMHA 2VUDA 1AJOA 1YXWA 2CGPA 1LESA 1VP6A 3WLUA 3WXPA 1RB8G 2J22A 3IB3A 2DURA 1GWMA 1UX7A 2Q30A 2ZA9A 3DV8A 4IE0A 4PBOA 4URTA 3SISA 4IERA 2SLIA 4NIGA 3FUOA 1G7YA 4NIDA 1RMU3 3H0OA 2ZGPA 2YMZA 4JGYA 3TNQA 3HNYM 2WJSA 2GNMA 3OOXA 1UIKA 5C8CA 3TNPB 4D8MA 4OQ9A 1VIWB 1XNBA 3ZXKA 3VBUB 5HV0A 1TMF3 2G1MA 3LD8A 2V72A 4Q0VA 4CYDA 2JXAA 3DUIA 3CLPA 1L7LA 4K1YA 4QU2A 2QQMA 3DXUA 5T55A 3B01A 2VVDA 3VBOC 1COV2 5LZ6A 5FZGA 5IVJA 1S4CA 5DUUA 1RUH3 1WMXA 4BYYA 1QJY2 2AEZA 5FXZA 5FZ8A 2A6XA 2BZDA 3FMGA 3LFMA 2CTVA 2VQ0A 1STMA 3FHQA 4CZSA 5JXIA 4C1XA 2P2KA 3JXSA 1AR61 3AKPA 5FYZA 2ZX4A 3PJYA 3POYA 1S0IA 1QQP1 4JGYB 4YGBA 5C70A 3NNLA 2CDOA 2WSVA 4HLTA 5D1IA 5EWSA 5C8CB 3I2DA 1O8SA 4LBLA 1S2BA 1NCRC 3IDAA 5A6YA 5FWEA 5E8AA 5IHRA 2A6WA 4JGZB 2R043 1RHI2 2IUWA 3PHMA 4AW7A 1JZ2A 4LORA 5A7PA 5F39A 1OH4A 3B5LB 3HEIA 1L7RA 4S2FA 5L9RA 3VD5A 4Y1ZA 4BQXA 2XJRA 1HV0A 1W9SA 2BFUS 4YG6A 3LOIA 5A3LA 3PTRB 4FO9A 1CN1A 1PM7A 3SKVA 5IFPA 4XMIA 5FZ6A 1RUF2 2R16A 1PO22 1R093 2C1FA 5B2GB 3VZMA 2VQTA 1PMHX 3LPGA 2D6NA 4HK8A 5FMCA 5FY4A 4BXSV 4D7YA 3VKMA 1FOD2 1R1A2 3TN93 2ID4A 4AI3A 4NWVA 1UNBA 1WA6X 5T54A 1U12A 4AAXA 4MGKE 1NLRA 1RUE2 5FJHA 3MIGA 4IEZA 2H6BA 4INDA 5F5IA 4ZU7A 3OGRA 1H8TC 3WUDA 2JG9A 2NP0A 4YLZA 4CDXC 4LE4A 3ACIA 4LO5B 3RJRA 4DRRA 1RUI1 1GZWA 4R4ZA 4F7ZA 4SBVA 5FJKA 3B69A 3C3VA 3NKGA 2WO3A 3LCPA 4QD2A 1MQTC 4O9GA 5JOWA 3RMXA 4RR3B 4IV3C 2ZMLA 5FY1A 1UQXA 1AYN2 1NA1C 2B9UA 5LATA 4EN9B 1VBA1 2DF7A 2XR4A 3J7NA 1XJAA 3ZPYA 1COV3 2B45X 5EZWA 3LEKA 4QXCA 5CA6A 1QJY3 2J1UA 1QJFA 5A3PA 2ZEXA 1NLQA 1QDCA 3HQUA 1XBFA 1UW8A 2P34A 3HMYA 4IEPA 5LY2A 3AXDA 4MADA 1OC1A 1ULPA 4G9SB 4D7TA 3UKTA 4OI4A 1VBE2 5FREA 2P3KA 3TEXA 2IXJA 1S0BA 2JG9B 1VAMA 4FPHA 5FPLA 2W94A 4U36A 1OQDA 4QT6A 3VBSA 3DF0A 2I07B 1WW5A 4Q4V1 4P9XA 3OPWA 2R49A 3NV2A 1IG0A 1W2NA 2Y34A 5DUVA 3FHIB 1ASJ1 2VQAA 2ZPXA 4QQ2A 3PU8A 3HBZA 5JWPA 5FXXA 4CSWA 2DVDA 1OF3A 2G19A 2KXLA 3DPRC 5A70A 5ACA2 3CJXA 1NUKA 3S7IA 4KG0A 1GWLA 2TNFA 4MLOA 2VQUA 4WZFA 2XKPA 5AC93 3K3NA 2PLV1 4DIQA 1ZZ6A 1ZREA 3ZIXA 1QHDA 2I45A 3VL8A 3EYPA 4O65A 3BIEA 3FX3A 1O4TA 4YVSC 4DY5A 4Q4X2 3A23A 3T2TA 2GH8A 2PQSA 4BB3A 5JMOA 2WQZC 2P4EA 3GBWA 2V4AA 4PIXA 3MFAA 4BMBA 4HKWA 3ZSKA 4UBHA 1JN2P 1PGW1 5T5PA 1MEC2 5IT6A 4HANA 3JB8A 4YPJA 2JEMA 3I2JA 2CNAA 2VUAA 1KXGA 3J8F1 2ILMA 3T4VA 3RJ2X 3C7OA 4KGGA 2YC2A 1JYNA 4RSUA 1FXZA 3I8TA 1AZDA 1DP0A 2Q0AA 4OZOA 4XXAA 5FTTC 1GQPA 3LE0A 2PAKA 3O0XA 4NHLA 1QJU2 4LUMA 4JZRA 3VKFC 5FYSA 3H8UA 4CU6A 1ZZ9A 5E1RA 1UMHA 1PO13 2VD7A 1W8UA 5FZ7A 1OI6A 1YQCA 2G9GA 3OGSA 3D6EA 3BALA 4AI1A 4OZXA 1DQ6A 2R062 2ZGOA 2VBBA 1YCIA 3JB4C 2QQIA 3NAPA 2I74A 1GP6A 1Z7S1 2LM3A 3ZR6A 5KHKA 2YBPA 5FFOC 3THDA 1RUNA 1RC6A 4NROA 2OIIA 3BOPA 4GAZA 5BNPA 4NAMA 1DZTA 2VOWA 4UBGA 1D4M1 4EE2A 1UF2C 2GC0A 2WZPP 4L97A 5KXEA 1V9U1 1GQGA 1HDKA 1JYCA 2VZ3A 2A70A 3IDCB 4Y1VA 3ITQA 1W6MA 2RS13 2VE1A 1KFUL 2W5FA 2YC4A 3QOPA 4Q27A 1DGWX 4CDWC 4YFZA 2RJLA 4BCUA 1BJQA 3N9PA 1ACCA 4JQRA 4LPLA 3GBFA 3VDDC 4BQWA 2QE3A 4AF9A 2HWF2 2WNVC 1CAXA 1F4HA 3QH7A 3OY8A 1KS5A 3MF9A 1A6CA 4XHBA 5FO7B 1QNWA 5LK5A 3WUCA 4ZY9A 4XJZA 2A3WA 3JUUA 3NAPB 5JIUA 1POV3 2ERFA 4R9AA 1RVF1 1S2EA 4UFLA 3AC0A 1MZFA 3K48A 1H2LA 4NPLA 2EIGA 1W04A 4LKSA 5CFDA 3VBOA 3OEBA 5EHDA 3WINE 5BNPB 1E5SA 2RS51 2YXSA 3ZSJA 5DAVA 2VZSA 2XWBB 1QMJA 1LHOA 1QNYA 2W39A 1J59A 1WLDA 2W1UA 3CEWA 4QM9A 1TZOA 2DWRA 1W2UA 5CISA 1ZZ7A 4MGYE 4FPKA 1W6MB 1SBDA 1XNDA 2NMOA 3VZOA 1VBD3 4FPFA 5C3OA 2HKXA 2WAAA 5L9BA 3WNOA 3N36A 1XNKA 1NY71 1NCRA 1V6NA 1F2NA 3RZJA 4AGRA 4F83A 4BLJA 3VLBB 4AQ6A 5DZEA 4CRQA 2JX9A 3IIAA 4GJZA 3RMYA 4FPGA 4AGGA 4M3CE 1FI2A 4K40A 2AUYA 2RHPA 4Y22B 5FZLA 2Y6LA 2GDFA 2XBO3 5AFEA 3GJBA 5CFDB 4B7EA 4IETA 4LA2A 2WYSA 4LBJA 1Q8PA 4YW6A 2FMYA 2D98A 4H2AA 4Q4W3 4FBFA 2GN7A 1TQ5A 2DVGA 2RG4A 1K45A 4JQTA 4NRQA 1OOPA 3I3DA 5H9PA 3MIDA 5FZFA 5JI9A 2JDYA 2TUNA 3RI9A 3DCQA 5IAXA 2DCKA 1OLME 2VOVA 2E6VA 3I3MA 2YROA 5DABA 2XHKA 3KD4A 4QPIC 5GZGA 2K0GA 1GZTA 1W2OA 3RDIA 1W6OA 1HRV2 1V6KA 3MYXA 3MLJA 1Y4WA 1NCRB 2QQKA 5FZ0A 3AMNA 3WNNA 3R4UA 1NXD1 4GMP3 2RDQA 3GJAA 5IVBA 1VB4A 3MI8A 5GZCA 1MS1A 4CEWC 4RN5A 4Z2AA 3ZYGA 2JWPA 3AX4A 4LHSA 4CDXA 1QOOA 3WQ7A 4Z8BA 3G6JB 4CCEA 2P37A 1HXS2 4C1WA 1RUOA 2P3YA 3PLQA 4GWMA 4C0HA 2GC2A 3Q8CA 5GALA 5BY5A 1K42A 2LALA 3ACHA 1MQTA 2VNVA 1AYM2 2JE9A 2WUHA 3LQCA 3VBHC 1OOPB 1LTEA 1WCKA 3MW3A 2KA3A 3CL1A 4IV3A 1N3OA 1NA1A 3W21A 2DVAA 2GNDA 3B3QE 1CAUB 4MXWA 2EALA 3BYWA 3THCA 4CP0A 3VHNA 1TNFA 1WBLA 4C91A 3DYMA 1ZVFA 1IKPA 4E8CA 3LB9A 5F6KA 1Z78A 5G05L 4OLLA 1JMUB 1LULA 4CXXA 3LGRA 1C5HA 3KT7A 1CX4A 3RGBA 4DXTA 4RA0A 4Y5Z0 3E5QA 3WDVA 1F5JA 2OQ7A 4PLOA 4ZONA 1ENRA 4XDQA 5GLZA 3O1SA 1EYBA 3OUIA 2VCBA 4WVMB 4CDXB 2RR12 4AYUA 1UAIA 2PTMA 3LEGA 1URXA 4JX0A 4UFMA 1X33A 4NR1A 4FOYA 3PTYA 3GBGA 3JCIA 4E2GA 4PF1A 1EAH2 2WS92 2WFF3 1CWPA 1MQTB 3VD3A 4LLFA 4A44A 1ND3B 3FL7A 5AVAA 1EV12 4MX3A 3ACLA 1NA1B 1WMFA 3CQOA 1PIV2 3DPRA 3ETQA 2UY9A 2R0HA 1O3SA 4MXWB 4OHYA 5IVYA 3GHNA 4QXKA 2ZX3A 2Q8DA 5FY9A 3WQBA 3AMQA 1SFNA 2WL1A 1DLCA 4P5HA 5F7UA 4GIQA 4HG6B 4XZPA 1POQA 1XNAA 2IFRA 1SG3A 4JHTA 4M4PA 4UW6A 4P9LA 5LBBA 4RGKA 2IXHA 5JZGA 2W1WA 2EXIA 4YVSA 3KLSA 4YZ5A 3BIWE 5CZKA 5AVPA 3CF6E 1FATA 2E33A 4NPMA 1AR63 1R1ZA 5A7QA 1X50A 2NM1A 4LUKA 1QQP3 3WSOA 4XMAA 2WT2A 1JYVA 2KD7A 4DXZA 4NUBA 5DUWA 1H6XA 2IXLA 3WP5A 3N7LA 1RGSA 4BIFA 4COYA 5IVVA 2ZHKA 4LIVA 1CESA 4C8DA 4XQ4A 3ILFA 3NL1A 5LW9A 1F5FA 2ZGQA 3HNMA 5C6CA 2R7EB 3ZN6A 2MHFA 3FBMA 4UF0B 3RWKX 4I0WB 4BQ1A 4DS0A 2R0FA 4BQ5A 1P8JA 3O0WA 5AFBA 5FO8B 1IS6A 4DEQA 2FCVA 2PHRA 1LGCA 1RIRA 3N7JA 3MBWA 5CIRA 4Z2WA 1I1EA 1VJ2A 2PLV2 4AGVA 4BQ2A 5FIXA 1KS4A 4J6GA 4M4RA 4XFBA 2XLGA 5J3UA 2R072 4UOJA 5F3IA 2DDUA 4P5YA 1W90A 3V56A 5LBEA 3S30A 5A1FA 5JZGB 3SEPA 1RUG1 2HWE2 5A1AA 3Q9OA 2Z79A 5DAXA 4CP9A 1RUJ1 5C3PA 1DCSA 4MSVA 4UFJA 3N4MA 3OD4A 3ZYJB 5FMOS 1LOCA 3I97A 2YHJA 1QJEA 2AC1A 5J96B 2VVEA 4OYUA 2ZX1A 1QF3A 3C2UA 3FLTA 5FZCA 3UKVA 3ZO0B 4D3WA 2XVLA 5JIAA 5JOYA 3FFQA 3NWKA 5JSPA 3DKWA 3GM8A 5KXBA 1FMD1 3VDCA 2HWC2 4FFIA 2VZVA 1ZZBA 4FOWA 4PI2A 1HN0A 3J8F2 2GNBA 1Q3EA 1HIXA 2B9VA 3POJA 4FAGA 1JYWA 5JPNB 3RRDA 4BQ4A 4XFIA 4XF1A 4MUVA 1HJGA 1J83A 5FPVA 2P5BA 1KDKA 1RUI3 3J9SA 4CDWA 1DQ1A 4FFGA 3ENRA 1NYWA 1VB2A 1IPSA 3VDBA 1YLLA 5KC6A 4Z82A 3VDDA 4QX3A 4FSJA 1PGL2 4EWAA 3MIEA 5I93A 2XOMA 4H7MA 4QU1A 4UFKA 4DPNA 2WNVA 4EQVA 5J36A 1VBA3 1RUC2 3PURA 4Q0UA 3ZIWA 2RM22 5BNQA 5ANNA 5FOBB 4AI8A 1H4GA 3P3PA 1R64A 4X6RB 2F17A 4DZGA 3O1UA 1UMIA 1G9AA 3TBDA 1S55A 1MZ6A 1IGOA 1V70A 3K4ZA 4IE4A 5F3GA 5L9VA 4IDZA 5F5CA 1D2QA 5FY8A 3I59B 4ISQA 4ES9A 3O0VA 3MPPG 5FY7A 1Q5OA 3WOGA 3KHCA 3WY6A 1WCDJ 4AEMA 4ZKTB 1OHFA 1YFWA 4DNYA 3JZVA 4Q4V3 1NZIA 2W2IA 4F3JA 5KBFA 5FZEA 2H0BA 1ASJ3 1X82A 4Y1UA 1C57A 3H7YA 4K8FA 5T3NA 4A7KA 4IV1C 4TXWA 5KHIA 1VRBA 2XH6A 1TG7A 3JD73 5BXXA 2WIIB 4Q29A 4CXWA 2BOJA 3ETPA 4LK7A 2WNVB 4XZUG 1JH5A 1VRH1 1C3HA 1XOYA 4DFSA 3SCFA 3AVSA 3PIGA 3BUCA 2VCCA 1CPNA 3KS7A 1W8NA 3K4DA 4HN0A 4CCOA 3GZUC 1XQNA 3AYCA 3Q8BA 4XJAA 5DZGA 1RVF2 1ULEA 4PHZA 4XVHA 2TBVA 4IEWA 1FAYA 2J1RA 4Q26A 2CAVA 5EFUA 4QX5A 2ZGKA 3M3CA 4D69A 1YI9A 2VGDA 3MPBA 3WF4A 2PXJA 4GB31 1JZ4A 2BGPA 1C5IA 3BPZA 3GZEA 3J26N 4N43A 3AMMA 2DFCA 1I6XA 3LSEA 3D82A 4NOTA 4K7JA 3UNPA 4HFSA 1KDMA 3PIJA 2J1AA 3MIFA 1LU2A 2LW8A 4IEYA 1MS9A 3PL0A 4XUQA 4BE3A 4UW5A 4QPIA 1W39A 4BK4A 3SQOA 2C24A 3SLIA 3BTZA 3J8F3 3TYJA 5FBJA 1NY72 4YW2A 3A7QA 1LECA 2VMCA 3AXEA 3WW1A 3URFA 1WWYA 3EB7A 3ZFGC 1OSGA 5JSRA 4LKFA 3MDPA 4XBNA 1OLRA 2QBXA 2WNUA 3ZFEB 4CEWA 3WZ1A 1PZ8A 1ENSA 3WX5A 2ZZJA 3TEWA 1JZ7A 1DDLA 1RMU2 3OF1A 3R6SA 4XFHA 2C9KA 1N3PA 5A6QA 1HX6A 1QH7A 2D5HA 4N43B 1QXRA 3VBHA 3GZTB 1LGNA 1TMF2 3AKQA 2ZHLA 1W0OA 1TEIA 2VM9A 2Y33A 3LWCA 1Z7S3 4MH0E 4RHV1 2OS2A 2ZMNA 4ASKA 1N3QA 2HEWF 3H9AA 1UL9A 3A0KA 4S2GA 1D4M3 2PA7A 4E8DA 4LMFA 2WC2A 1UZYA 3ZMNA 3AL6A 5A3TA 1V9U3 1YWKA 3KMHA 1RUH2 1H2MA 1LOFC 1RITA 1W3XA 2Q5TA 1ZRFA 3IDEA 2WNUB 4CEWB 3NNJA 3R05A 2XUEA 5E88A 1UOJA 1MPXA 2FMDA 3N7MA 4LA3A 2O1QA 3WG3A 2P3JA 2DVFA 3FC0A 4N7IA 5F6LB 1DG6A 2XVGA 2PHXA 3EXUA 4XJ8A 4XF0A 3WDXA 1UZ0A 4XAAA 4L11A 1IQDC 5FCCA 4AL9A 2Q1ZB 3EO6A 3VBHB 1SCRA 1OQ1A 2JG8C 2QDRA 2WSUA 5DDJ1 4ZS3A 1WD4A 2VULA 2VOTA 1AHSA 1W9WA 1RVF3 1ZBE1 4Y20A 1LB2A 4WV8A 4X8NA 5A3OA 3SITA 2R042 3IKWA 1O4YA 1VPHA 3U4XA 2YY1A 4C0BA 5FYCA 2RS53 3FLPA 4G3YC 1W0NA 4LHKA 3VDAA 1ST8A 4XFGA 4Q4Y1 1DFQA 3WHUA 1IQAA 1UYPA 1WMDA 2RS33 3K3OA 4PLMA 4XIOA 2YB7A 4QB2A 1T2XA 1R092 3VBFB 2LRPA 5LA0A 4NHXA 2PHDA 2JICA 3E5UA 1XXNA 4UT5A 2HBUA 4GH4C 2VTXJ 1MZEA 2VTXA 5H9QA 3DYOA 2UWBA 3TN92 5K7PA 1AL21 5GLTA 2ARAA 3KV5A 4QMAA 4MGSA 5JI7A 5FO9B 4MOAA 3D0JA 4LK6A 1FNYA 3SMHA 1HB4A 5FK7A 4W6XA 1OPMA 5DAQA 4M3CA 2ZXQA 2W46A 3OUHA 2QQUA 3LA7A 3TAYA 4AR2A 4FTBA 1W8FA 1W6NA 4N53B 1QXJA 1UOBA 2W9XA 4PQ9A 5EYYA 1IS5A 2WFF1 3CU7A 4I3GA 3KCYA 3AKSA 4LT5A 1S0JA 5JVVA 3AM2A 3Q8AA 4D6SA 1ZA4A 3H8XA 3ZYHA 3N35A 4OCTA 1OLMA 1WKYA 3D4KA 3RZGA 1POV0 5FQ0A 5F2WA 2Y0IA 2D6KA 4GA9A 5A7OA 5FZ3A 4AEDC 1R081 3I7DA 4WM7C 1Q8QA 5C3SA 3BN6A 1APNA 2XMLA 3MV11 2PMWB 4A4AA 2OYZA 1F4AA 3HT1A 3OGVA 4IGPA 4YW5A 2VTFA 4EZ4A 3V0BA 5FYTA 2ZHNA 1BBT1 2OPWA 1JHNA 5JR2A 5F8PA 5H9SA 2BGOA 3ELNA 3ST7A 1WLCA 3K51A 4I30A 1AR71 1QIQA 3E6BA 2Y6FA 4HVRA 1W6NB 1JW6A 1GKBA 2XQRA 2YC0A 3EHKA 4HVOA 4A3ZA 5CG8A 5BNOC 3IMNA 4FPYA 1G9DA 4E27A 3ASIA 1Y9MA 4P08A 2FQPA 4JCKA 1J58A 2ZGNA 4XJUA 5FY0A 4DUXA 2FDGA 3E1F1 1KGYA 3H3UA 3O7OA 2EF6A 2D6MA 1HB1A 5AC92 3M3OA 4AHZA 2MNGA 5FQ0B 3FE5A 2XJTA 2QQNA 2IXCA 4TN7A 1VAVA 1AJKA 2VUCA 1RJ8A 2LUWA 3I2KA 3PVOA 5DXDA 3SH5A 4KBZA 2J1SA 2JIGA 1I5PA 4FPEA 1W03A 4UYBA 4AQSA 2YFZA 3RI8A 3VUOA 3M3QA 3WW2A 2EA7A 3V0BB 2Y0OA 3H1WA 4IV1A 3ABZA 4AVCA 5LRSA 1LKNA 3N9QA 4ATEA 2DV9A 1NG0A 4OHZA 1BCXA 1B09A 1W6PA 1W6QA 3HIFA 3R4DB 4Z07A 3NV4A 4O9EA 1UPIA 1YNAA 1ZA7A 2ZAHA 4OMDA 4EYUA 4XIKA 4GMP0 1XYOA 4C90A 5IK4A 4EWDA 2BW8A 5LRRA 5A7SA 1WZXA 3AFGA 2FHRA 3KZ4C 1PK6C 3POEA 1RTVA 3GXUA 1EUTA 4Y4YA 1EP0A 1AL0G 4IXLA 5DUXA 2J7MA 1J1LA 3H3LA 3WNXA 4QHOA 2JJ6A 2Y60A 1YO8A 1GBGA 1AR91 1Y9GA 1QWRA 4K6BA 4PJYA 1PO12 3SH4A 2PFWA 4YARA 3P5BA 1GNYA 1HLCA 2VECA 1C8M1 3QLQA 4HVQA 4MHUA 3JBG1 3CJIC 3KM5A 1Q8OA 2WQ8A 3LOBA 2B39A 5A32A 4CUGA 4IV1B 4YWAA 1JUIA 1TE1B 2D6OX 4QXHA 1U5ZA 1FPN1 1N1YA 3DKQA 4LO4B 5FWJA 1DZQA 1W6PB 3KV9A 1BEV1 1SLLA 1IZ3A 5IWFA 2HBTA 2HWD1 3UGHA 3ZFGA 2X5IC 3AVRA 4H55A 4E2QA 2WLPA 2VY0A 2D5FA 1QJX1 2WT1A 1PZ9A 2BFUL 1EUUA 4LO7A 2B5HA 3LIGA 3VL9A 2RS12 3IAQA 5TSWA 1BMV2 3HQXA 3IAPA 4N8MA 5CFCC 3JU9A 1GZWB 3AKTA 3VD7A 1RUG3 2YUEA 4E2SA 4LHNA 1EPWA 3JD71 1RUJ3 1LHNA 2PAMA 2HEYF 3OYWA 4FVVA 1DYKA 2X05A 4B1LA 1AR81 4QDRA 1UIJA 4CCDA 3ZYRA 2RDRA 4I2OA 2FZ2A 1V00A 1SMVA 3TEYA 4S2DA 5FZ9A 1XE0A 1FYUA 2XKOA 5FRAA 4Z1VA 4EN7B 4AAPA 1FMD3 1SFYA 2KR2A 1QDOA 1UZVA 2QFEA 2NPIA 5E6HA 3UETA 4B8EA 1TME1 2UY8A 2HYKA 2OZ6A 3OGJA 1VMFA 1LOFA 2VL4A 3WQ0A 2JKBA 4XILA 2Z5WA 5EPAA 3VBSB 3OJBA 4LR4A 5C3RA 1UOGA 1V6MA 4XFFA 4M0NA 2JDHA 4XDPA 1DQ2A 4QDSA 3ZOIA 2Z2SB 2XUMA 1NT0A 1GUIA 1REFA 2CY6A 1VBD2 2EIEA 1FV2A 5FYYA 1WCUA 2WN3A 4Q0QA 4U2AA 3OYWB 2A75A 2EAAA 2JG8A 2RV9A 3ZVXA 1IPKA 2RMU1 4R9DA 1OH3A 1RL3A 4BOWA 1A8DA 5FPUA 2VVFA 3RZLA 5CB7A 1LR5A 2BWAA 3WDTA 3ZX7A 2Y64A 2HLEA 4RS5C 4D7SA 1JXNA 1OBNA 2E63A 5C4WC 3RZHA 3P6BA 3KV4A 2ZBJA 2XBO2 3U37A 4NIIA 1JYTA 4KG8A 1OMIA 3SHRA 4JRLA 4Q4W2 3T1LA 1ZBA1 4H7LA 1N1TA 4JDNA 4EZHA 1YEWA 3TB0A 5GM0A 4LE3A 3W59A 5FZIA 3QCWA 1K5MC 2DTWA 2J1VA 3H1MA 2RJKA 4B4PA 2AREA 2JDPA 1JZ3A 4OI1A 3NNFA 4GH4A 5BYNA 4OI2A 1O3RA 3PUQA 1VRH3 1W9YA 1WGPA 4YVWC 3AP7A 1CONA 1BVP1 2XJUA 5LBCA 1MR5A 4FXKB 4FCAA 5DDJ2 5K0UB 3OTFA 3VB9A 4LOSA 3WDUA 5DMYA 1E5RA 4O61A 1J3RA 2XJPA 5EP9A 5ISLA 2IFWA 1GOGA 3V0AA 4PDWC 1RUD1 2IWGB 1PHMA 4MVTA 1XB9A 5J09A 4AVVA 3BVCA 4GB33 2UYAA 2BEOA 2VUJA 3T1MA 3P3NA 5IUQA 1SBEA 4W8JA 2BVVA 4RQPC 1UXZA 2FCUA 4QKDA 4QX2A 4LBOA 1OPOA 3CBNA 1A3KA 3MUY1 3N9LA 3ACFA 5IYYA 4HKLA 3POIA 3IPVA 1U5IA 4QM8A 4QHZA 2FD8A 4CEYC 3ZDSA 5KHHA 3AK0A 2OUJA 4X8PA 4AEDA 3F2ZA 2DFBA 2L9LA 1GANA 1VALA 1AL22 1XE7A 5FKBA 4OQ8A 3T30A 3Q8FA 2RS31 4KWJA 4LBMA 4LTAA 3LPFA 2RDNA 3VHPA 2XGXA 5HCAA 4KI5M 3V0AB 3ALQA 3UL2A 2G9ZA 4CU9A 3LEMA 5EYXA 1X9PA 1H0BA 1J3PA 4BQ3A 4KH9A 1W8TA 3PUHA 3MEPA 3PVEA 1CAXB 1JODA 2PHTA 3BU7A 5BNOA 2EAKA 4RHV3 2WFF2 3OY8B 1XNTA 2V4VA 3THTA 5IVFA 3T0AA 2VZQA 2EVXA 4P9YA 2XHNA 5FYHA 2WA3A 2ATFA 5EQUA 1W99A 1S0DA 1ZM1A 3KCXA 5FLJA 3VBOB 1UYZA 2BGCA 2DU1A 3PUSA 4ZU5A 5L36A 3GNEA 3B00A 5HCFA 1XE8A 1XNCA 2AGSA 2XVKA 3GHMA 1HRI1 5A3NA 3AZXA 2WZR1 4KGQA 1VBB1 4Q8LA 3OG2A 4PT6A 4ORFA 1PX4A 1F15A 1ZZCA 3CZUA 1AR62 1CJPA 3HOBA 4F8AA 2B4KA 1QQP2 2O0OA 4H14A 1I5ZA 3RZKA 3GZAA 4JRAA 4YZ1A 2ZGSA 5DDJ3 2VMHA 2YYOA 2AR6A 4FPOB 1E5HA 4AFCA 2VMEA 5KHJA 1OFSA 1QU0A 3NV1A 1MVEA 3GDBA 5A6ZA 3T09A 1QOTA 1ZBE3 4LO6B 1H8TA 1VBC3 3U10A 3BCWA 1NQJA 3ZMOA 1LOBA 1GOHA 2JE7A 4AVBA 1PK6A 3NV3A 1J3QA 3B9CA 4Q4Y3 3FHAA 1WW6A 4XABA 2JD9A 4XACA 3OGGA 3W5NA 2D3SA 4XBQA 5A1LA 1D7PM 2R1BA 2VC9A 3MO4A 4IE6A 1ODMA 5A33A 2NN8A 2IVJA 4XW3A 3AP5A 2QNKA 3BGAA 5CNAA 2CL2A 4FI9A 1ND2C 3X29B 3CJIA 4JDOA 2WRAA 4XQWA 5LA2A 1MVQA 3ECQA 2D6PA 1S1AA 5GZEA 3AL5A 1ENXA 1W6OB 4Q1PA 3SKJE 3IZOA 4AVTA 4BH9A 1AL23 4G4FA 4DINB 3C7HA 3F95A 1JOJA 5K9YA 2X5IA 2D43A 2JB4A 1H8TB 1BKZA 4MGQA 4FAHA 5GJ6A 5LY1A 2OT7A 3VZNA 3R0RA 2PHUA 2R6QA 2ARCA 1SLTA 3BOWA 1JOPA 1PK6B 5C5TA 4OUEA 5CFCA 5FMDA 2ZJCA 3H1YA 3NVCA 1RUI2 2OKXA 3ZYFA 1EY2A 1JYIA 4CCMA 1YHFA 4QGMA 3SCGA 4TWTA 4XXPA 2MEV1 1NE4A 1JU4A 2GALA 1NXMA 4ITCA 3G7DA 4IV3B 4QQLA 5JDBA 2AENA 5IK8A 4LO8A 5A33B 3WQ1A 3KHBA 1VBA2 4GWJA 3VBRC 4L99A 1L3JA 4BLIA 2VMGA 3CJIB 4NIHA 4B4QA 4IL7A 1HKDA 3WDWA 2H0VA 3E5XA 2QZ2A 3IIIA 1R083 1SPPA 5LK7B 4Q2FA 3AP9A 4GQ7A 1D2SA 4J25A 4E4DX 3O1TA 2XWJB 1T6GC 2X5IB 4M3CF 4J1XA 4NE9A 4QWNA 5BNNC 1BBT3 1VR3A 1VLNA 2WO1A 3POBA 4R9BA 2VJXA 1C1LA 3NMBA 4Q4V2 2JB8A 3VHRA 1FX5A 1GP5A 2OZJA 3KB5A 1AR73 1LGBA 1MS0A 2GAUA 3HN3A 4GWIA 5LA9A 4AFDA 1ASJ2 4BISA 5CFCB 3QD6A 3IM0A 1S2KA 1AX1A 3KV6A 3ON7A 1HJFA 1OXCA 2VNRA 3JD72 5LASA 3RWNA 2ZTNA 1NLSA 3DPRB 3K2OA 2VAUA 2VO5A 2A71A 3ILRA 4WM8C 3VBUC 5C5UA 4ZXEA 2F6BA 2ET7A 4IESA 2V5DA 2DBNA 1XSQA 4QKBA 4RS5A 5C4WA 2WWSA 1KJRA 4GULA 2CGOA 4Y1XA 2GMPA 3S7EA 4CDQC 3PUAA 1YFUA 4JKMA 4YVSB 3IBMA 4I0AA 1O6UA 1Y3TA 2Y6GA 1V6LA 5FZAA 3K46A 5A7WA 3VN4A 1BQPA 4MXVA 2BWCA 4XF4A 4R4XA 4YYOA 1K5MA 3T0DA 3OD0A 1PGW2 5L73A 2GNTA 2PELA 3RPQA 1DIWA 3RNSA 4P02B 4NRMA 1US3A 3N7KA 5IW0A 4WVWA 3M1HA 5ANQA 3ZN6B 4YVWA 2E7QA 5C3QA 1X8EA 2BJSA 3CMGA 1XU1A 5FR3A 1XYPA 3WF1A 2UYBA 4AOCA 1T6BX 4QX8A 1BK1A 2RJ2A 2FDFA 4IEXA 3ATGA 4P14A 4AZZA 4JGZC 1RHI1 4PDWA 2VPVA 3RZMA 3OPZA 5JXHA 4EROA 5IATA 5SV5A 1K3IA 1AR93 2Y38A 2Y6HA 4JKLA 2LROA 5CYYA 2BOIA 2YV8A 2OPKA 2D44A 1H30A 1LOEA 1YQ8A 3I4IA 3J7HA 3ZYBA 3CNAA 4RQPA 4CP9B 5A3UA 2O8OA 4QHBA 4NJ4A 1C8M3 1S0EA 2QQVA 4Q0PA 5FV3A 3JBG3 5HXMA 4JKKA 1G9CA 2BTVC 3HPNA 1KEXA 1RUF1 2Z42A 4K3UA 1PO21 4XUNA 1Z7S2 1GSLA 4Y4RA 1K5MB 4KWUA 5FXWA 1OVSA 2YU1A 1FPN3 4A6OA 4MGTA 3MICA 3ZPOA 1MS8A 1QJZA 1BEV3 2YFUA 1LOGA 1ENQA 1O5UA 2XL9A 2HWD3 3FN9A 2Q8OA 1CZVA 2QCSB 4CEYA 1D4M2 1D0HA 2E53A 1FOD1 1R1A1 1PVXA 1QJX3 2J1EA 4YVWB 1OA4A 3I2OA 1K12A 1V9U2 1RUE1 2VZRA 3ZKYA 4DXRA 5IVCA 4KWKA 2C26A 4CDWB 2FZ1A 1IHMA 5EJ1B 1I9RA 4PDWB 5FPAA 3RYRA 3WW4A 1CX1A 5FYBA 3C8XA 4XUPA 1ULGA 3ZYPA 1MZ5A 4IW3A 3VDDB 5FMOL 5FP9A 4XUOA 2H6CA 4JDMA 4NRPA 4OFGA 1AR83 1LHVA 5CADA 1S0CA 1E5IA 1U5YA 1HQNA 1SLIA 2VXJA 4RQPB 1F31A 3OBZA 4COUA 3O12A 4EN6B 4ZZ5A 1EPZA 1NCQC 3H42B 4RR3C 1AYN1 1REEA 1ZYBA 1HW5A 2A6VA 2TEPA 2W1QA 1D4VB 2XJVA 4BWOA 1LCLA 3NJZA 3BI3A 1KD7A 1TME3 4OHWA 4CVUA 3KVBA 2CDPA 2RS52 2ZEWA 4HPKA 4XETA 4QB6A 4YW3A 3LSDA 4CCLA 1CZSA 1PVC1 4OUMA 5D8AC 2RS32 2W68A 1VBE1 1ODNA 3POFA 1ULDA 3QBQA 4JHZA 4LQRA 5I0TA 2ZMKA 3SEEA 3H8RA 4AHXA 3N9OA 4ASLA 4YM0A 3H3ZA 4UW3A 3IT8A 1BHGA 3LZZA 4XE9A 2RMU3 4PIYA 1W9FA 4FQ4A 5LWBA 2Q1MA 4KNCA 2O14A 2C5DA 4HSLA 4TLGA 1FV3A 4K8RB 4Y26A 5ACA1 1KITA 1ULCA 5FY5A 2WABA 2UWAA 4DRVA 1YFYA 2P17A 5GKAC 5JPMB 1H2KA 3CHXA 5EV7A 5C7GA 1OKQA 1YC61 1H6YA 1MS3A 1ZBA3 2DU0A 4PCRA 2CV6A 4DMIA 1WBFA 4XYXA 5M0TA 2X29A 2WWUA 4K21A 4YGDA 2QQWA 4Q4X1 3VZLA 1UWWA 3NKTA 5JUVA 1JOBA 2VMDA 1ND2A 2DCYA 1MS5A 4QPIB 3LFIA 3S57A 2C0ZA 2VOKA 4JVAA 1ZRCA 1MEC1 2ZS6B 2WYFA 1S0GA 1UU4A 2W92A 3I2GA 2BVBA 1CIYA 3KVAA 3WW3A 4AI2A 3ZXGA 1IG3A 1NQDA 2ZEYA 5E16A 1RUD3 2MPFA 4NIAA 2NYYA 4BHPA 1GICA 1W8OA 2JDUA 4QPGC 2VZOA 2QTWB 3ZLIA 1UYXA 5T52A 3HT2A 3D5OA 3SH3A 2P6HA 4E9KA 1QJU1 1QY4A 3V65A 2P3IA 5DG2A 3PVBB 1W8HA 4AG4A 2CSGA 1Y9QA 5JOZA 5I0DA 4IE7A 3QH6A 3D8CA 1AXZA 1VAKA 4LBQA 3AZYA 2Q1FA 3HJRA 5E89A 3ZXAC 3O1VA 1VBC1 2ZACA 3EMRA 2LTNA 4ONUA 3VBRA 3W20A 4Q8KA 2VG9A 1ND2B 4YZ3A 2R061 2ZCWA 2CU5A 3MIBA 4OVEA 4D94A 5KC5A 4QQHA 2E7TA 4YW7A 1IS4A 3I49A 5FZMA 2XQXA 5DZFA 4CDUC 3O1PA 1SACA 1WLWA 2P1BA 3TRSB 3RQ0A 3HVDA 2CWMA 4DB5A 2D7FA 4LULA 4TYSA 5FZ4A 5BNNA 2QDNA 2GMMA 3KGZA 1G6NA 4W50A 4L92A 1RXGA 3OB8A 3U75A 1UZWA 3SCHA 5CAZA 5KWRA 3J4UH 2QUOA 3NSTA 1AF9A 2BBAA 4L9BA 4BA6A 5T50A 4NMIA 5B4XA 1CPMA 3H7JA 2G4IA 1O7FA 4BQYA 3IDBB 3BPSA 4LBKA 3EJKA 3D0SA 3VBUA 1AVBA 2HWF1 4WM8A 2ENRA 4Y20B 3ES4A 3ZSMA 4BXFA 3VBRB 4AFBA 4M00A 2YPDA 3FJSA 4FT8A 4XDOA 5C9AC 3VZJA 4V2VA 4AFMA 2ADDA 1OA3A 2ARBA 1U0AA 3NAPC 4GKXA 1US2A 4OUSA 5IK7A 3W9AA 4XURA 4H3WA 2BNOA 5KXDA 2VXRA 1HRI3 2XONA 3MV01 4CDQA 2WZR3 2R1DA 3M7AA 3T2OA 5BNPC 4NO4A 1VBB3 5DG1A 2BBVA 5BUVA 1LNSA 2Z69A 3LIHA 3HD8B 2WN2A 4W4ZA 5BNNB 5FP8A 3ZXFA 4I0BA 1OKOA 1YIFA 4Q0SA 2E32A 2A73B 2D3RA 3WF3A 1E57A 2I2SA 5EXOA 4AVSA 1ZRIA 4E4SA 1NKGA 3MGUA 1ALYA 2EIDA 1UOFA 3T3YA 3RS6A 4CUBA 1DZRA 2WNOA 3ORJA 2DTYA 4WM8B 3SXWA 1DYOA 3BB6A 4XTPA 4RYDA 1HN1A 4P00B 3QACA 4JGZA 4PBPA 1RXFA 4JTOA 1CZTA 2W47A 2C9AA 4M3CB 4N90A 2RE9A 4NHMA 1UX6A 4FOVA 5CKQA 1GZCA 1XU2A 4CDQB 5CFDC 4FPCA 4HXCA 1RUG2 2Y6KA 4J1WA 5FMBA 3JQWA 4LKEA 1V6OA 5F5AA 4RGAA 5A3WA 1RUJ2 1CGPA 4XBLA 3WF0A 4ISRA 1LRHA 3CKHA 2Q8CA 2WWJA 3WEZA 2ZX0A 2VBPA 4W6WA 5SV8A 4R52A 2ZGUA 3HAGA 5J1XA 3FWEA 1O59A 1SBFA 4IEUA 1UO9A 1YYNA 1O5LA 2XB6C 1UU6A 5FP7A 1AXYA 1FMD2 4EWEA 2QZ3A 2WNEA 2YPJA 1HRV1 5FOJB 3MF6A 1PM4A 1H9WA 1MACA 1DQ4A 3M3IA 5A7NA 2W0XA 5C33A 2ZAAA 1YI7A 1UXXX 2OW4A 3MFCA 5A80A 1LHWA 3B7MA 1AUYA 3ZXEA 3U78A 4GKYA 1A34A 1OFNA 3S6PA 4HOOA 4RFRB 5EJZB 1Z0HA 1LEMA 1O8PA 2W08A 3I2FA 2GSYA 3BKZA 1MS4A 1RJ7A 1HXS1 2IZWA 2MEV3 2D6LX 1JZ6A 1PGSA 4YG3A 5HCBA 5FP3A 5HXVA 2O8QA 5CU1A 3SC7X 1I3HA 1N1VA 2YGMA 2G9FA 2QQJA 1AYM1 4AQ2A 1LHUA 4E4ZA 2XPJA 1NCQA 1DYPA 1OOPC 1Q43A 2WDBA 1VMJA 2W52A 4RL7A 1UY2A 4RR3A 5GLVA 1JZ8A 1DGLA 1JBCA 4UI9L 3FZ3A 3TEZA 3DL3A 5DN2A 3I2HA 5F2SA 2EXKA 2GC1A 3ES1A 3ZXDA 3NRUA 4MV2A 3WP4A 3FFZA 3LDRA 3DN7A 2NZ9A 1BXHA 1UD1A 1HV1A 5FLHA 3Q8EA 3O1OA 2PAEA 3O1RA 1G8WA 5CBLA 5D8AA 2HEVF 1IKQA 5F3CA 1JZ5A 1W8WA 3KF5A 2WQ4A 4P9GA 2RR11 5IK5A 4FP3A 5IFTA 1M4WA 2R30A 4HK9A 3FLRA 3VD9A 4I02A 1W6QB 4A6SA 5APAA 1O91A 1DQ0A 1SQ4A 1AX0A 1SLBA 3EQEA 4B29A 5KXCA 1EAH1 2WS91 5IJRA 3O1MA 1VRH2 4KQ7A 4YG0A 1Q8VA 4HT1T 4BZ4A 1NCQB 1ND3C 2ZKNA 1EV11 3MLKA 4YW4A 4B7KA 2JDKA 1PIV1 1LENA 1GV9A 1UN1A 3ZFFC 2V73A 3LDBA 4KMQA 2A3YA 2WINB 5FLIA 5GZDA 2X10A 3U14A 1X36A 2ARXA 3UYJA 4N7UA 4D6RA 4GB32 3O14A 4YM3A 1M06G 4BU2A 1WW7A 3L9JT 2A5ZA 3OPTA 2UWCA 3W58A 3ZKUA 4GXLA 2Q4SA 3B93A 2WZ8A 4XAEA 4CCKA 3OEAA 4ARYA 1PVC2 4GWNA 2JDZA 5FUPA 2VZPA 5D8AB 4AI0A 3B02A 4XFCA 2VW1A 3RZZA 3E6DA 1B35C 4D0QA 5A32B 3I3EA 4JTNA 3VHOA 5T5JA 1ULFA 3PJQA 3I2IA 2XLFA 1WMEA 4META 4CCJA 1SCSA 3ZFGB 1O3QA 2CWSA 1ZX5A 4CPBA 2JKXA 1CVNA 3LA3A 4XF9A 2BYVE 2ZGMA 4QQOA 2ZX2A 3ME2A 4IGOA 2DBIA 4IEOA 4LEJA 4V2WA 1RHI3 5FBZA 3WCRA 3C7EA 1BVVA 1KJLA 5FKCA 4QPGA 5FYIA 2BQPA 1Q8SA 3RG0A 4CXYA 3GYDA 3INAA 4CCNA 2VR4A 2Y26A 3HN1A 4WVVA 2BUKA 4D6QA 2R071 2EIBA 4CUCA 3C7GA 5FUNA 5D2AA 1SDWA 2K2SA 2XLAA 1RUF3 1UY4A 2HWE1 3ZSLA 1PO23 5JZGC 5LEJA 3EBRA 4RHV2 5LB6A 3HNBM 1GU3A 4YGEA 1PNGA 2AZ5A 4HETA 5C8WA 1SFPA 2PHFA 1YUDA 4MGZE 1ULOA 1GZ9A 2VZ1A 4XF3A 2W95A 4UFHA 1ZNPA 3AB0A 5HBAA 1FOD3 1R1A3 4LLOA 4CDUA 1DGWA 2D93A 2E31A 1G86A 3HQRA 2WAOA 2VBDA 4CU7A 3W5MA 2ORXA 4QGLA 4DUVA 1RUE3 5LEKA 2HWC1 2JIJA 2IVIB 4YGCA 2VU9A 1NAEA 1W06A 4Y1YA 1JYXA 2YZ4A 4XFAA 3UK9A 2A7AA 2BU9A 1YJKA 2JECA 4RD7A 3POSA 1YJLA 2GU9A 1GNZA 4HSJA 4QPGB 3H8OA 1UZZA 3NO8A 3AZZA 3L2HA 2PQQA 1Q56A 5FZOA 2EICA 2XL7A 3GCXA 2QVSB 4MYEA 4K1ZA 4XCAA 4ZXKA 3S5QA 4COWA 2JG8B 1PGL1 1DGRA 4MG2A 5GZFA 1AYN3 4QPWA 2B7YA 2WO2A 4KBBA 4XCBA 1ZBE2 1RUC1 5L19A 3I3BA 5J98B 1VBC2 2RM21 4WVZA 1OT5A 1J84A 3USSA 3ZXLA 2ZEZA 5C9AA 4BIOA 2WA4A 3T4HB 1ZZ8A 4IEQA 3AJYA 5J37A 1PNFA 3CDZB 3MIHA 3VZKA 1UY0A 1WW4A 2W87A 3L2YA 4CDUB 4Q4Y2 1DBNA 4CP2A 4EJRA 3NW4A 3IN9A 1PVC3 3UJOA 1GOFA 2HYXA 3U4SA 1O3TA 4IUGA 1VBE3 3UT0A 3OBRA 4FQZA 1WCQA 5CKMA 3AKRA 2JDNA 4BDVB 1REDA 3WP3A 5FZDA 4GH4B 5K0UC 4YZ2A 2YBKA 5FZOB 4BJ0A 2QKDA 2HWB1 3K4AA 3CIHA 2OQ6A 4WM7A 4YM1A 1C1FA 4BPZA 3BTYA 4I09A 1CQ9A 1W9TA 1BZWA 2A6YA 2IXKA 2D3PA 5ACA3 1H2NA 3ZN4A 1V0AA 4M01A 4Y33A 5C9AB 1UKGA 2VNOA 4QKFA 3AZWA 5IVEA 2VCAA 2VW2A 4AFAA 2RDSA 2X8KA 3WHTA 4DO0A 1PX3A 4Y22A 1SDDB 2FDHA 2X53S 3OCPA 1CR7A 5JXGA 3V64A 3TOJA 5FXVA 1C28A 1YIPA 4Q4X3 4FTEA 4B3NA 1YRZA 5FP4A 1YFXA 5FK8A 4YM2A 2GMEA 1W3VA 4QDQA 5GLUA 3LF7A 1LJ7A 4DQAA 3GGLA 1RINA 1QKQA 2GP5A 3AP4A 1MEC3 3IPVB 3ROUA 5ABJC 2CHHA 3O5SA 4S2HA 3WD5A 4YZ4A 4AEDB 5L7OC 2EXJA 3ACGA 1R082 4WM7B 1DHKB 1OURA 1F8VA 1WD3A 3RFRA 3DGTA 3A22A 4QQPA 4WBBA 1UPSA 2VMIA 4LOTA 5CKNA 2AYHA 2OXBA 4UWDA 4YSFA 3BODA 2WO7A 3LDKA 5LA1A 3BU0A 1BBT2 1H1AA 3ZFEC 1UMZA 3PUIA 4ATFA 4MO3M 5JR7B 5HPOA 1XYNA 1QJU3 3MW2A 1FT9A 1NZCA 2YDEA 4QX1A 4YRDA 1AR72 2B42B 3R4SA 4COVA 1RMU1 4CU8A 1O4ZA 2Q8EA 3VKLA 2LS6A 2XDVA 5BNOB 1JHJA 2W91A 4R9CA 1NX9A 2ORZA 2NMNA 1HQWA 3M3EA 4QX0A 2FBEA 3VD4A 4X6QB 1W2AX 3E6CC 2R063 1JUHA 4N43C 5I8SA 1TMF1 2GP3A 5FAXA 2C4XA 5FPBA 4XTMA 4N9HA 1W2TA 1WLTA 1CAUA 3U07A 2ZKLA 4QB1A 2ZGRA 4LITA 4HBNA 4V1PA 1JI6A 2WLQA 1AXKA 4ZZ8A 3KGLA 2PHLA 4WZCA 4LKDA 1JS9A 2ZZQA 3VV1A 1BK0A 3POGA 1RUH1 4ASMB 3B94A 1DLLA 1OD5A 2JD4A 5JSOA 3NNGA 2N7GA 2WNUC 3KWVA 4NHYA 5D21A 4WVMA 2W3JA 4NN0A 5HI0A 3POWA 5K8SA 2ET1A 4R8HA 2QQPA 1V6JA 2EXHA 3AP6A 4W65A 4AHWA 4IGQA 1A78A 2HWF3 2WZEA 3U11A 3ZXJA 2ZABA 4ARXA 2Z4FA 4TZDA 4QGNA 1OUXA 5EJ3A 1ND3A 3WR0A 2R32A 4AEJA 3IMMA 4LBQD 3WNMA 4A42A 3WP6A 2NLRA 2R041 4FPJA 3ZFFA 2XXZA 1ONAA 1PZ7A 4FTSA 2BDRA 1QXPA 1KQRA 4GZ9A 4DUWA 5F3EA 1H9PA 1AR92 1WA4A 4LNVA 4FOQA 1CD3G 4P9IA 5FYVA 5KR7A 3BTAA 5I0SA 4B1MA 2VH9A 3USUA 2WFPA 3WV6A 4DY3A 4P9JA 5HCHA 1H1IA 1OLQA 1C8M2 1RYYA 2V09A 1C4RA 3PU3A 3JBG2 5DAWA 5FDBA 1B35A 1PMIA 3HBKA 2NQYA 4UAPA 1R091 1WCSA 4XHXA 4AHYA 4AQTA 3VBFC 2P6CA 3BTXA 1FPN2 2VNGA 2VZUA 2X09A 3WNKA 1OA2A 4XJWA 1BEV2 3D3AA 2WKKA 4NVPA 5CEHA 1BYHA 1QOSA 2HWD2 3CO2A 5F5QA 1OD3A 2K46A 3UV9A 4B4RA 4BMEA 1F35A 3TN91 1QJX2 3VGIA 4A7YA 1KRIA 3WF2A 1OQEA 4UF0A 3PNAA 1LOAA 1QEXA 4PQQA 1NOVA 1TNRA 4JC1A 1GP4A 3MZHA 3DECA 4FFFA 3M70A 4AEKA 1UCXA 5KHGA 2CAUA 3ZFFB 2A1XA 1CAWA 5I0RA 2A6ZA 3ZDVA 4QX7A 4URAA 3AFKA 2KM2A 3WVJA 3M8LA 1UU5A 1AR82 4N53C 4ZPIA 1OF4A 1IPJA 3N3HA 5CG9A 4XEZA 3RYPA 4A45A 5G04L 1DU3D 1VMHA 2UU8A 3USUB 3GCWA 4LIUA 5JMCA 2E51A 2AEYA 2XG3A 3WCSA 2UURA 1B35B 3I54A 4QKNA 3THPA 4A2UA 5FPXA 5I8YA 3M4FA 4DOUA 3ZR5A 1SPPB 5ERLA 5F1RA 1HRV3 4L0PA 1COV1 2A3XA 4XQDA 1TME2 4MZUA 2OVUA 1QJY1 1U5XA 1H4HA 3NNMA 3PMSA 3NJYA 3GF6A 2J42A 1Y43B 2VOXA 4HZFA 3PVNA 5FZ1A 4FP2A 3ZM8A 4HN1A 4FPLA 1HXS3 2DCJA 2FDJA 4Q5OA 4CCCA 3N9NA 4UXAA 4EV0A 2BP6A 3J7MA 4JGYC 1CAWB 1DF0A 4Y5SA 3UESA 1Y7BA 3LEIA 4OHXA 4E4HA 3DXTA 1UY1A 2CYFA 3AYEA 5C8CC 2IC1A 3P1IA 1AYM3 5HV4A 1QGLA 3M2MA 2RMU2 4AVAA 1W05A 4GD4A 3KCCA 3I3QA 2IXIA 1SZBA 4ZS2A 1L7QA 3UKNA 1GFF2 1V6IA 3VKNA 4HKOA 4RS5B 3WG2A 4PF5A 4YW1A 5J48A 5FYUA 4CTEA 5C4WB 2XJSA 5FZHA 4COZA 4NWWA 2VZTA 2DUPA 2K9ZA 4K20A 4UW4A 5F32A 3K77A 5FYMA 5AC91 4PLNA 2GN3A 1ZBA2 3I59A 4LBNA 3OBAA 4I01A 4P9WA 3KT1A 5A7WB 4CE8A 3A4UA 4QXBA 3LKJA 4K9SA 3ZYIB 3AYAA 2RR13 3AJZA 2ZGTA 3T2PA 3TWIA 4OHVA 5DAPA 4CA9A 1SEFA 2ES3A 3MHZA 1X9TA 3AZVA 3ILNA 3B9IA 1DQ5A 2YBSA 5DPNA 5K0UA 4RGGA 3T08A 2BPA2 1HB3A 2FDKA 1WUVA 1EAH3 2BNNA 2B8MA 2WS93 5JLVA 3T0BA 4OI0A 4LHLA 1LU1A 2RVAA 4PI0A 1EV13 2WBKA 3E97A 3LAGA 1PIV3 3LA2A 3WG1A 3IWZA 5I91A 1J1TA 3OSDA 4NAOA 3T2QA 1S0FA 4MGIE 3VKOA 4A41A 5CVRA 1W8ZA 4AXOA 1ZRDA 1RUD2 2ETEA 4GALA 2W1SA 3DEMA 4NHKA 1KFXL 4EN0A 1A8MA 4DEVA 5I0UA 4HL0A 4M0HA 5J7MA 3PDQA 4EN8B 3HR9A 2FCTA 1N47A 2C6SA 1C8NA 3CZJA 3J7LA 1UYYA 4LXLA 2Y8KA 3KQRA 3U1XA 4IE5A 4PIZA 1GR3A 4TSVA 4ET7A 4XJ9A 5A6XA 1PO11 2GC3A 1CJDA 3WNLA 4KL1A 4L8QA 2F4PA 3MUZ1 5FPZA 1BLZA 4W6YA 3PMEA 4CP1A 5ABJA 4CEYB 5FZKA 2OX0A 5L7OA 2HWB2 4IEVA 1HQLA 4IQPA 5JAXA 3KT4A 2BV4A 4I3PA 4AE2A 4XC9A 2HJIA 2YGLA 2AH2A 1QH6A 4KWLA 2JG9C 4BK5A 3ZFEA 4TLFA 2PLV3 3MW4A 1GWKA 3WG4A 3ZN5A 2RS11 3C7FA 1OUSA 2R073 1BMV1 1XSRA 4ZHNA 3N9MA 1IS3A 2HWE3 5FZBA 3NQHA 3HWJA 1H8VA 4Z92B 2WT0A 4BM8A 2D40A 1UKRA 4AI9A 5EIYB 3KSCA 2F4LA 1CAVA 1H1MA 3DYPA 4L2NA 3NJVA 4AK3A 5IAVA 4AWDA 2JENA 3U0ZA 3A0NA 2BERA 3FUQA 2BNMA 1POV1 5ABJB 2HWC3 4HPKB 1GNHA 1GMMA 1FNZA 2VCMA 2Y6JA 4N9IA 3UJQA 4HONA 4ZU4A 5L7OB 2AACA 1HRI2 2OUHA 3WT3A 5T5OA 5JCTA 1LAJA 1SLCA 2WZR2 4YFWA 1SLAA 2FDIA 1SHWB 1VBB2 5LBFA 2GZWA 3RSJA 1YQ5A 4CPBD 1YQ6A 1D0GA 4QAWA 3VBSC 1GYKA 4ES8A 1HB2A 4TTGA 1OVPA 2D97A 1W28A 2QQLA 3ZSEA 1JTZX 5K4LA 5T5LA 3AYDA 1VE0A 1VBD1 2QQOA 2JE8A 3FBYA 2B46X 1RUC3 4XPVA 2JDAA 2RM23 3WDYA 5C71A 4KU8A 1NE6A 3S5AA 5DQ0A 1GLHA 1PMJX 5GLWA 1TVGA 1CAVB 2BRTA 3A21A 4NPRA 4Y3OA 5B4NA 3NJXA 1AX2A 2ZOEB 2DCTA 4Q1RA 2DVBA 2DCZA 3KQ4B 3OUJA 2SBAA 4XOGA 2XBO1 3AMPA 3WNPA 4YNIA 4Y5TA 5BPXA 2VMFA 2HH9A 4Q4W1 5H9RA 1LODA 1F9KA 2XJQA 4FFHA 3KF3A 2OA2A 1UY3A 3RYKA 5F9TA 2PYTA 3SNMA 2J1TA 2E26A 4XUTA 4O7XA 2HWB3 3VBFA 2YU2A 5JOXA 4OMCA
chains in the Genus database with same CATH topology
1N1SA 5BV6A 1X8MA 1X7NA 4KU7A 1G9BA 2DUQA 4OULA 2ZGLA 1IOAA 1ZRRA 2E7AA 4SLIA 4GMP1 1LEDA 4A7ZA 3GALA 2CGNA 2QJVA 2E9QA 1XRUA 4QPYA 5I8TA 2DUOA 2PHWA 1G9FA 3APBA 3H50A 2ZHMA 3S0MA 1DGRN 3MLLA 2MEV2 4A3XA 4N53A 4LBQB 3OBTA 4JAAA 2PN5A 4Y24A 2GH2A 2DYCA 2VW0A 1W0PA 2V5YA 4FXGB 1CIWA 1GQHA 5A3MA 4HMZA 3JQXA 4JV4A 4RFT0 3AMHA 1AJOA 1YXWA 2CGPA 1LESA 1VP6A 3WLUA 3WXPA 1RB8G 4PBOA 2DURA 2ZA9A 2Q30A 3DV8A 5KHIA 3SISA 4URTA 4IERA 2SLIA 3FUOA 1G7YA 1RMU3 3H0OA 2ZGPA 2YMZA 4JGYA 3TNQA 2WJSA 2GNMA 1UIKA 5C8CA 3TNPB 1VIWB 1XNBA 3ZXKA 3VBUB 1TMF3 4Q0VA 4CYDA 2JXAA 3DUIA 3CLPA 4K1YA 4QU2A 5T55A 3B01A 2VVDA 3VBOC 1COV2 5DUUA 1RUH3 4BYYA 1QJY2 2A6XA 3FMGA 2CTVA 2VQ0A 4CZSA 4C1XA 2P2KA 1AR61 3AKPA 2ZX4A 3PJYA 3POYA 1S0IA 1QQP1 4JGYB 4YGBA 2WSVA 4HLTA 5D1IA 5EWSA 5C8CB 3I2DA 4LBLA 1S2BA 1NCRC 5E8AA 2A6WA 4JGZB 2R043 1RHI2 3PHMA 4AW7A 3B5LB 4S2FA 4Y1ZA 2XJRA 1HV0A 2BFUS 4YG6A 3LOIA 5A3LA 4FO9A 1CN1A 1PM7A 4XMIA 1RUF2 2R16A 1PO22 1R093 2C1FA 5B2GB 3VZMA 2D6NA 4HK8A 4D7YA 3VKMA 1FOD2 1R1A2 3TN93 4AI3A 4NWVA 5T54A 1U12A 4MGKE 1NLRA 1RUE2 3MIGA 4IEZA 2H6BA 4INDA 4ZU7A 1H8TC 3WUDA 2JG9A 2NP0A 4YLZA 4CDXC 4LE4A 4LO5B 3RJRA 4DRRA 1RUI1 1GZWA 4R4ZA 4F7ZA 4SBVA 3B69A 3C3VA 3NKGA 3LCPA 4QD2A 1MQTC 4O9GA 5JOWA 3RMXA 4RR3B 4IV3C 2ZMLA 1AYN2 1NA1C 2B9UA 4EN9B 1VBA1 2DF7A 3ZPYA 1COV3 2B45X 5EZWA 5CA6A 1QJY3 1QDCA 1UW8A 2P34A 3HMYA 4IEPA 3AXDA 4D7TA 4G9SB 3UKTA 4OI4A 1VBE2 5FREA 2P3KA 4BWOA 2IXJA 1S0BA 2JG9B 1VAMA 4FPHA 4U36A 1OQDA 4QT6A 3VBSA 3DF0A 2I07B 1WW5A 4Q4V1 4P9XA 2R49A 3NV2A 3FHIB 1ASJ1 2VQAA 2ZPXA 4QQ2A 3HBZA 5JWPA 2DVDA 2KXLA 3DPRC 5ACA2 3CJXA 3S7IA 4KG0A 4WZFA 2TNFA 4MLOA 2XKPA 5AC93 2PLV1 1ZZ6A 1ZREA 3ZIXA 1QHDA 2I45A 3VL8A 3FX3A 1O4TA 4YVSC 4DY5A 4Q4X2 3T2TA 2GH8A 2WQZC 3GBWA 4PIXA 3MFAA 4BMBA 4HKWA 3ZSKA 4UBHA 1JN2P 1PGW1 5T5PA 1MEC2 5IT6A 4HANA 3JB8A 2JEMA 2CNAA 2VUAA 1KXGA 3J8F1 2ILMA 3RJ2X 4KGGA 4RSUA 1FXZA 3I8TA 1AZDA 2Q0AA 4XXAA 5FTTC 2PAKA 3O0XA 4NHLA 1QJU2 4LUMA 3VKFC 3H8UA 1ZZ9A 5E1RA 1PO13 1OI6A 2G9GA 3D6EA 3BALA 4AI1A 4OZXA 1DQ6A 2R062 2ZGOA 3JB4C 1YCIA 3NAPA 2I74A 1Z7S1 5KHKA 2LM3A 5FFOC 1RUNA 1RC6A 2OIIA 3BOPA 5BNPA 1DZTA 2VOWA 4UBGA 1D4M1 1UF2C 2GC0A 2WZPP 4L97A 5KXEA 1V9U1 1GQGA 1HDKA 1JYCA 3IDCB 2A70A 4Y1VA 1W6MA 2RS13 1KFUL 3QOPA 4Q27A 1DGWX 4CDWC 4YFZA 2RJLA 4BCUA 1BJQA 4JQRA 3GBFA 3VDDC 2QE3A 4AF9A 2HWF2 2WNVC 1CAXA 3QH7A 3OY8A 1KS5A 3MF9A 1A6CA 4XHBA 5FO7B 1QNWA 5LK5A 3WUCA 4XJZA 2A3WA 3JUUA 3NAPB 5JIUA 1POV3 2ERFA 4R9AA 1RVF1 3K48A 1MZFA 1H2LA 5CFDA 2EIGA 3VBOA 3WINE 5BNPB 2RS51 2YXSA 3ZSJA 2XWBB 1QMJA 1LHOA 1QNYA 2W39A 1J59A 1WLDA 4QM9A 3CEWA 2DWRA 1W2UA 1ZZ7A 4MGYE 4FPKA 1W6MB 1SBDA 1XNDA 2NMOA 3VZOA 1VBD3 4FPFA 2HKXA 3N36A 1XNKA 1NY71 1NCRA 1V6NA 1F2NA 4AGRA 4F83A 4BLJA 3VLBB 4AQ6A 5DZEA 4CRQA 2JX9A 3IIAA 3RMYA 4FPGA 4AGGA 4M3CE 1FI2A 4K40A 2AUYA 2RHPA 4Y22B 5AFEA 2GDFA 2XBO3 5CFDB 4B7EA 4IETA 4LA2A 4LBJA 1Q8PA 2FMYA 2D98A 4Q4W3 4FBFA 2GN7A 1TQ5A 2DVGA 5H9PA 1OOPA 3MIDA 5JI9A 2TUNA 3RI9A 2DCKA 2VOVA 2E6VA 2YROA 2XHKA 3KD4A 4QPIC 5GZGA 2K0GA 3RDIA 1W6OA 1HRV2 1V6KA 3MYXA 3MLJA 1NCRB 3AMNA 3R4UA 1NXD1 4GMP3 1VB4A 3MI8A 5GZCA 1MS1A 4CEWC 3ZYGA 3AX4A 4CDXA 1QOOA 3WQ7A 4Z8BA 3G6JB 2P37A 1HXS2 4C1WA 1RUOA 3PLQA 4GWMA 4C0HA 2GC2A 5GALA 5BY5A 2LALA 1MQTA 1AYM2 2JE9A 3VBHC 1OOPB 1LTEA 1WCKA 3MW3A 2KA3A 3CL1A 4IV3A 1N3OA 1NA1A 2DVAA 2GNDA 3B3QE 1CAUB 4MXWA 2EALA 4CP0A 3VHNA 1TNFA 1WBLA 4C91A 1ZVFA 1IKPA 3LB9A 5F6KA 1Z78A 4OLLA 1LULA 3LGRA 1C5HA 3KT7A 1CX4A 4RA0A 4Y5Z0 3E5QA 3WDVA 1F5JA 4PLOA 1ENRA 4XDQA 5GLZA 1EYBA 4WVMB 4CDXB 2RR12 4AYUA 1UAIA 2PTMA 1URXA 1X33A 4NR1A 4FOYA 3PTYA 3GBGA 3JCIA 4E2GA 1EAH2 2WS92 2WFF3 1MQTB 4LLFA 1ND3B 5AVAA 1EV12 4MX3A 3ACLA 1NA1B 1WMFA 3DPRA 1PIV2 3ETQA 2UY9A 2R0HA 1O3SA 4MXWB 4OHYA 3GHNA 4QXKA 2ZX3A 3AMQA 1SFNA 2WL1A 4P5HA 4GIQA 4XZPA 2IFRA 4UW6A 4P9LA 2IXHA 5JZGA 2EXIA 4YVSA 3KLSA 4YZ5A 3BIWE 5AVPA 3CF6E 1FATA 1AR63 1R1ZA 1X50A 2NM1A 4LUKA 1QQP3 4XMAA 2WT2A 4DXZA 5DUWA 2IXLA 3WP5A 3N7LA 1RGSA 4BIFA 4COYA 2ZHKA 1CESA 4XQ4A 3ILFA 3NL1A 1F5FA 2ZGQA 5C6CA 3ZN6A 2MHFA 3FBMA 4DS0A 4I0WB 4BQ1A 5AFBA 2R0FA 5FO8B 3O0WA 1IS6A 2PHRA 1LGCA 1RIRA 3N7JA 5CIRA 4Z2WA 1I1EA 1VJ2A 2PLV2 4AGVA 1KS4A 4J6GA 4XFBA 2XLGA 5J3UA 2R072 3V56A 3S30A 5JZGB 1RUG1 2HWE2 3Q9OA 2Z79A 1RUJ1 4MSVA 3N4MA 3OD4A 3ZYJB 5FMOS 1LOCA 2YHJA 5J96B 2VVEA 2ZX1A 1QF3A 3C2UA 3FLTA 3UKVA 3ZO0B 4D3WA 2XVLA 5JIAA 5JOYA 3FFQA 3NWKA 5JSPA 3DKWA 5KXBA 1FMD1 2HWC2 1ZZBA 4FOWA 3J8F2 2GNBA 1Q3EA 1HIXA 4FAGA 5JPNB 3RRDA 4XFIA 4XF1A 4MUVA 4CDWA 1KDKA 1RUI3 3J9SA 1DQ1A 3ENRA 1NYWA 1VB2A 1YLLA 4FSJA 4Z82A 3VDDA 1PGL2 4EWAA 3MIEA 5I93A 4H7MA 4DPNA 2WNVA 5J36A 1VBA3 1RUC2 4Q0UA 3ZIWA 2RM22 5BNQA 5FOBB 4AI8A 1H4GA 3P3PA 4X6RB 4DZGA 1G9AA 3TBDA 1S55A 1MZ6A 1IGOA 1V70A 1D2QA 3I59B 4ISQA 4ES9A 3O0VA 3MPPG 1Q5OA 3WOGA 3WY6A 1WCDJ 4AEMA 4ZKTB 1OHFA 1YFWA 4DNYA 3JZVA 4Q4V3 4F3JA 5KBFA 2H0BA 1ASJ3 1X82A 4Y1UA 1C57A 3H7YA 4K8FA 5T3NA 4A7KA 4IV1C 5K0UB 5BXXA 2XH6A 3JD73 2WIIB 4Q29A 2WNVB 1JH5A 1VRH1 1C3HA 4DFSA 3SCFA 3KS7A 1CPNA 4HN0A 3GZUC 1XQNA 3AYCA 4XJAA 5DZGA 1RVF2 1ULEA 2TBVA 4IEWA 1FAYA 4Q26A 5EFUA 2CAVA 4QX5A 2ZGKA 3M3CA 4D69A 1YI9A 2VGDA 3MPBA 4GB31 3BPZA 1C5IA 3J26N 4N43A 3AMMA 2DFCA 1I6XA 3LSEA 3D82A 4NOTA 4K7JA 4HFSA 1KDMA 3MIFA 1LU2A 4BE3A 4IEYA 1MS9A 4UW5A 4QPIA 1W39A 3SLIA 3J8F3 3TYJA 4YW2A 1NY72 1LECA 3AXEA 3WW1A 3ZFGC 3URFA 1OSGA 5JSRA 3MDPA 4XBNA 1OLRA 2WNUA 3ZFEB 4CEWA 3WZ1A 1PZ8A 1ENSA 3WX5A 2ZZJA 1DDLA 1RMU2 3OF1A 3R6SA 4XFHA 1N3PA 1HX6A 1QH7A 2D5HA 4N43B 1QXRA 3VBHA 3GZTB 1LGNA 1TMF2 3AKQA 2ZHLA 1W0OA 1TEIA 3LWCA 4MH0E 4RHV1 1Z7S3 2ZMNA 1N3QA 2HEWF 3H9AA 1UL9A 3A0KA 4S2GA 1D4M3 2PA7A 2WC2A 1UZYA 3ZMNA 1V9U3 1YWKA 3KMHA 1RUH2 1H2MA 1LOFC 1RITA 2Q5TA 1ZRFA 3IDEA 2WNUB 4CEWB 3R05A 5E88A 3N7MA 3WG3A 2FMDA 4LA3A 2O1QA 2P3JA 2DVFA 3FC0A 4N7IA 5F6LB 1DG6A 2XVGA 2PHXA 3EXUA 4XJ8A 4XF0A 3WDXA 4L11A 5FCCA 2Q1ZB 3EO6A 3VBHB 1SCRA 1OQ1A 2JG8C 2QDRA 2WSUA 5DDJ1 1WD4A 2VULA 1AHSA 1ZBE1 1RVF3 4Y20A 1LB2A 4WV8A 4X8NA 3SITA 2R042 3IKWA 1O4YA 3U4XA 2YY1A 4C0BA 2RS53 3FLPA 4G3YC 4LHKA 4XFGA 4Q4Y1 1DFQA 3WHUA 1IQAA 1WMDA 2RS33 4PLMA 4XIOA 1R092 3VBFB 2PHDA 2JICA 3E5UA 1XXNA 4GH4C 1MZEA 5H9QA 2UWBA 3TN92 5K7PA 1AL21 5GLTA 4QMAA 5JI7A 5FO9B 3D0JA 1FNYA 3SMHA 4W6XA 1OPMA 4M3CA 3LA7A 3TAYA 4FTBA 4N53B 1W6NA 1QXJA 4PQ9A 5EYYA 1IS5A 2WFF1 3CU7A 4I3GA 3KCYA 3AKSA 4LT5A 1S0JA 5JVVA 3AM2A 1ZA4A 3N35A 3D4KA 1POV0 5FQ0A 2Y0IA 2D6KA 4GA9A 4AEDC 1R081 3I7DA 4WM7C 1Q8QA 1APNA 2OYZA 3HT1A 4YW5A 3V0BA 2ZHNA 1BBT1 1JHNA 5H9SA 3ELNA 3ST7A 1WLCA 3K51A 4I30A 1AR71 3E6BA 5DUVA 4HVRA 4HVOA 1W6NB 1JW6A 1GKBA 2YC0A 3EHKA 5CG8A 5BNOC 3IMNA 4FPYA 1G9DA 4E27A 3ASIA 2FQPA 4JCKA 1J58A 2ZGNA 4XJUA 3H3UA 3O7OA 2EF6A 2D6MA 5AC92 3M3OA 4AHZA 2MNGA 5FQ0B 3FE5A 2XJTA 2IXCA 1VAVA 1AJKA 1RJ8A 2LUWA 3PVOA 5DXDA 3SH5A 4FPEA 4AQSA 3RI8A 3VUOA 3M3QA 3WW2A 2EA7A 3V0BB 2Y0OA 3H1WA 4IV1A 4AVCA 5LRSA 1LKNA 4ATEA 2DV9A 1NG0A 4OHZA 1BCXA 1B09A 1W6PA 1W6QA 3HIFA 3R4DB 4Z07A 3NV4A 4O9EA 1UPIA 1YNAA 2ZAHA 4XIKA 4GMP0 1XYOA 4C90A 5IK4A 4EWDA 2BW8A 5LRRA 3AFGA 2FHRA 3KZ4C 1PK6C 1RTVA 4Y4YA 1EP0A 1AL0G 4IXLA 5DUXA 1J1LA 3WNXA 2JJ6A 1YO8A 1GBGA 1AR91 4K6BA 1QWRA 4PJYA 1PO12 3SH4A 2PFWA 4YARA 1HLCA 2VECA 1C8M1 3QLQA 4HVQA 3JBG1 3CJIC 3KM5A 1Q8OA 3LOBA 2B39A 5A32A 4IV1B 1JUIA 1TE1B 2D6OX 1U5ZA 1FPN1 1N1YA 4LO4B 1DZQA 1W6PB 1BEV1 1SLLA 1IZ3A 3ZFGA 2HWD1 2X5IC 4E2QA 4H55A 2WLPA 2VY0A 2D5FA 1QJX1 2WT1A 1PZ9A 2BFUL 4LO7A 2B5HA 3VL9A 2RS12 5TSWA 1BMV2 3HQXA 5CFCC 3JU9A 1GZWB 3AKTA 4E2SA 1RUG3 2YUEA 4LHNA 1EPWA 3JD71 1RUJ3 1LHNA 2PAMA 2HEYF 3OYWA 4FVVA 1DYKA 1AR81 1UIJA 3ZYRA 4I2OA 2FZ2A 1V00A 1SMVA 4S2DA 1FYUA 2XKOA 5FRAA 4Z1VA 4EN7B 1FMD3 1SFYA 1QDOA 2QFEA 2NPIA 4B8EA 1TME1 2UY8A 2HYKA 2OZ6A 3OGJA 1LOFA 3WQ0A 2JKBA 4XILA 2Z5WA 3VBSB 3OJBA 4LR4A 1V6MA 4XFFA 4M0NA 1DQ2A 2Z2SB 2XUMA 1REFA 2CY6A 1VBD2 1FV2A 4Q0QA 4U2AA 3OYWB 2A75A 2EAAA 2JG8A 3ZVXA 1IPKA 2RMU1 4R9DA 4BOWA 1RL3A 1A8DA 2VVFA 5CB7A 1LR5A 2BWAA 3WDTA 3ZX7A 4RS5C 4D7SA 1JXNA 2E63A 5C4WC 2ZBJA 2XBO2 4KG8A 1OMIA 3SHRA 4JRLA 4Q4W2 3T1LA 1ZBA1 4H7LA 1N1TA 4JDNA 3TB0A 5GM0A 4LE3A 3W59A 3QCWA 1K5MC 2DTWA 3H1MA 2RJKA 4B4PA 2AREA 4OI1A 4GH4A 5BYNA 4OI2A 1O3RA 1VRH3 1WGPA 4YVWC 3AP7A 1CONA 1BVP1 2XJUA 1MR5A 4FXKB 4FCAA 5DDJ2 3OTFA 3WDUA 1J3RA 2XJPA 2IFWA 3V0AA 4PDWC 1RUD1 2IWGB 1PHMA 4MVTA 5J09A 4AVVA 4GB33 2UYAA 2BEOA 2VUJA 3T1MA 3P3NA 5IUQA 1SBEA 2BVVA 4RQPC 4LBOA 1OPOA 1A3KA 4HKLA 3IPVA 1U5IA 4QM8A 4CEYC 3ZDSA 5KHHA 3AK0A 2OUJA 4X8PA 4AEDA 2DFBA 1GANA 1VALA 1AL22 1XE7A 4LTAA 2RS31 4KWJA 4LBMA 3VHPA 2XGXA 5HCAA 3V0AB 3ALQA 3UL2A 5EYXA 1H0BA 1J3PA 4KH9A 3MEPA 3PVEA 1CAXB 2PHTA 5BNOA 3BU7A 2EAKA 4RHV3 2WFF2 3OY8B 3THTA 2EVXA 4P9YA 2WA3A 2ATFA 1S0DA 3KCXA 1ZM1A 5FLJA 3VBOB 2BGCA 2DU1A 4ZU5A 5L36A 3GNEA 3B00A 5HCFA 1XE8A 1XNCA 2AGSA 2XVKA 3GHMA 1HRI1 3AZXA 2WZR1 4KGQA 1VBB1 4Q8LA 4ORFA 1ZZCA 1AR62 1CJPA 4F8AA 1QQP2 2O0OA 4H14A 1I5ZA 3GZAA 4JRAA 4YZ1A 2ZGSA 5DDJ3 2VMHA 2YYOA 2AR6A 4FPOB 4AFCA 5KHJA 1OFSA 1QU0A 3NV1A 1MVEA 1QOTA 1ZBE3 4LO6B 1H8TA 1VBC3 3U10A 3BCWA 1NQJA 3ZMOA 1LOBA 2JE7A 4AVBA 1PK6A 3NV3A 1J3QA 3B9CA 4Q4Y3 1WW6A 3OGGA 2D3SA 4XBQA 2R1BA 5A33A 2NN8A 4XW3A 3AP5A 2QNKA 5CNAA 2CL2A 1ND2C 3X29B 3CJIA 4JDOA 4XQWA 1MVQA 3ECQA 2D6PA 1S1AA 5GZEA 1ENXA 1W6OB 4Q1PA 4AVTA 4BH9A 1AL23 4G4FA 4DINB 5K9YA 1JOJA 2X5IA 2D43A 1H8TB 1BKZA 4FAHA 5GJ6A 3VZNA 3R0RA 2PHUA 2R6QA 3BOWA 1SLTA 1PK6B 5CFCA 2ZJCA 3H1YA 3NVCA 1RUI2 1EY2A 1JYIA 1YHFA 4QGMA 3SCGA 4TWTA 4XXPA 2MEV1 1NE4A 2GALA 4ITCA 1NXMA 4IV3B 3G7DA 4QQLA 5JDBA 2AENA 5IK8A 4LO8A 5A33B 3WQ1A 1VBA2 3VBRC 4L99A 1L3JA 4BLIA 2VMGA 3CJIB 4B4QA 4IL7A 1HKDA 3WDWA 2H0VA 3E5XA 2QZ2A 1R083 5LK7B 4Q2FA 3AP9A 4GQ7A 1D2SA 4E4DX 2XWJB 1T6GC 2X5IB 4M3CF 4J1XA 5BNNC 1BBT3 1VR3A 1VLNA 4R9BA 1C1LA 4Q4V2 3VHRA 1FX5A 2OZJA 3KB5A 1AR73 1LGBA 1MS0A 2GAUA 5CFCB 4AFDA 1ASJ2 3QD6A 3IM0A 1S2KA 1AX1A 2VNRA 3JD72 3RWNA 2ZTNA 1NLSA 3DPRB 3VBUC 2A71A 3ILRA 4WM8C 2F6BA 2ET7A 4IESA 4RS5A 5C4WA 2WWSA 1KJRA 4GULA 2CGOA 4Y1XA 2GMPA 3S7EA 4CDQC 1YFUA 4YVSB 3IBMA 4I0AA 1Y3TA 1V6LA 3VN4A 1BQPA 4MXVA 2BWCA 4XF4A 4R4XA 4YYOA 1K5MA 3OD0A 1PGW2 5L73A 2GNTA 2PELA 3RPQA 1DIWA 3RNSA 3N7KA 4WVWA 3M1HA 3ZN6B 4YVWA 2E7QA 1X8EA 1XU1A 1XYPA 2UYBA 1BK1A 4IEXA 3ATGA 4P14A 4JGZC 1RHI1 4PDWA 2VPVA 3OPZA 4EROA 5SV5A 1AR93 2Y38A 2YV8A 2OPKA 2D44A 1H30A 1LOEA 3I4IA 3CNAA 4RQPA 2O8OA 4QHBA 1C8M3 1S0EA 4Q0PA 3JBG3 1G9CA 2BTVC 1RUF1 2Z42A 4K3UA 1PO21 1Z7S2 1GSLA 1K5MB 1FPN3 3MICA 1MS8A 1QJZA 1BEV3 3L2YA 1LOGA 1ENQA 1O5UA 2XL9A 2HWD3 2Q8OA 2QCSB 4CEYA 1D4M2 1D0HA 2E53A 1FOD1 1R1A1 1PVXA 1QJX3 4YVWB 1OA4A 1V9U2 1RUE1 4KWKA 4CDWB 2FZ1A 1IHMA 3RYRA 1I9RA 4PDWB 3WW4A 3ZYPA 1ULGA 1MZ5A 3VDDB 5FMOL 2H6CA 4JDMA 4OFGA 1AR83 1LHVA 5CADA 1S0CA 1U5YA 1HQNA 1SLIA 4RQPB 1F31A 4COUA 4EN6B 3O12A 1EPZA 1NCQC 4RR3C 1AYN1 1REEA 1ZYBA 1HW5A 2A6VA 2TEPA 1D4VB 2XJVA 1LCLA 3NJZA 1KD7A 1TME3 4OHWA 2RS52 4HPKA 4XETA 4YW3A 3LSDA 1PVC1 4OUMA 5D8AC 2RS32 2W68A 1VBE1 1ULDA 3QBQA 5I0TA 2ZMKA 4AHXA 4ASLA 4YM0A 3H3ZA 4UW3A 3IT8A 3LZZA 4XE9A 2RMU3 4PIYA 4FQ4A 2Q1MA 4KNCA 2C5DA 4HSLA 1FV3A 4Y26A 5ACA1 1KITA 1ULCA 2UWAA 4DRVA 1YFYA 2P17A 5GKAC 5JPMB 1H2KA 5EV7A 1OKQA 1MS3A 1ZBA3 2DU0A 4PCRA 2CV6A 4DMIA 1WBFA 4XYXA 2X29A 4K21A 4YGDA 3VZLA 4Q4X1 3NKTA 1ND2A 2DCYA 1MS5A 4QPIB 2C0ZA 2VOKA 4JVAA 1ZRCA 1MEC1 2ZS6B 1S0GA 1UU4A 4AI2A 2BVBA 3WW3A 3ZXGA 1NQDA 5E16A 1RUD3 2MPFA 2NYYA 4BHPA 1GICA 4QPGC 5T52A 3HT2A 3D5OA 3SH3A 4E9KA 1QJU1 1QY4A 3V65A 2P3IA 5DG2A 3PVBB 4AG4A 1Y9QA 5JOZA 3QH6A 3D8CA 1AXZA 1VAKA 4LBQA 3AZYA 5E89A 3ZXAC 1VBC1 2ZACA 4ONUA 2LTNA 3VBRA 4Q8KA 2VG9A 1ND2B 4YZ3A 2R061 2ZCWA 3MIBA 4OVEA 4D94A 5KC5A 4QQHA 2E7TA 1IS4A 5DZFA 4CDUC 1SACA 1WLWA 3TRSB 3RQ0A 2CWMA 4DB5A 2D7FA 4LULA 4TYSA 5BNNA 2QDNA 2GMMA 3KGZA 1G6NA 4L92A 5CAZA 5KWRA 3SCHA 3J4UH 2QUOA 3NSTA 1AF9A 4L9BA 4BA6A 5T50A 1CPMA 3H7JA 2G4IA 1O7FA 3IDBB 4LBKA 3EJKA 3D0SA 3VBUA 1AVBA 2HWF1 4WM8A 2ENRA 4Y20B 3ES4A 3ZSMA 3VBRB 4AFBA 4M00A 3FJSA 4FT8A 5C9AC 3VZJA 4AFMA 1OA3A 2ARBA 1U0AA 3NAPC 4GKXA 4OUSA 5IK7A 3W9AA 5KXDA 4H3WA 2BNOA 2VXRA 1HRI3 4CDQA 2WZR3 2R1DA 3M7AA 5BNPC 4NO4A 1VBB3 5DG1A 2BBVA 5BUVA 2Z69A 3HD8B 5BNNB 3ZXFA 4I0BA 1YIFA 4Q0SA 2A73B 2D3RA 1E57A 2I2SA 5EXOA 4AVSA 4E4SA 3MGUA 1ALYA 3RS6A 1DZRA 2DTYA 4WM8B 3SXWA 3BB6A 4XTPA 3QACA 4JGZA 4PBPA 4JTOA 4M3CB 2C9AA 4N90A 2RE9A 4NHMA 1UX6A 4FOVA 1GZCA 1XU2A 4CDQB 5CFDC 4FPCA 4J1WA 1RUG2 3JQWA 1V6OA 4RGAA 1RUJ2 1CGPA 4XBLA 4ISRA 1LRHA 2ZX0A 4W6WA 5SV8A 4R52A 2ZGUA 3HAGA 3FWEA 1SBFA 4IEUA 1YYNA 2XB6C 1O5LA 1UU6A 1AXYA 1FMD2 4EWEA 2QZ3A 2WNEA 2YPJA 1HRV1 5FOJB 3MF6A 1H9WA 1MACA 1DQ4A 3M3IA 2W0XA 5C33A 2ZAAA 1YI7A 2OW4A 3MFCA 1LHWA 3B7MA 1AUYA 3ZXEA 4GKYA 1OFNA 3S6PA 1Z0HA 1LEMA 2W08A 2GSYA 1MS4A 1RJ7A 1HXS1 2IZWA 2MEV3 2D6LX 1PGSA 4YG3A 5HCBA 5HXVA 2O8QA 5CU1A 1I3HA 1N1VA 2YGMA 2G9FA 1AYM1 4AQ2A 1LHUA 4E4ZA 2XPJA 1NCQA 1DYPA 1OOPC 1Q43A 4RR3A 2W52A 4RL7A 5GLVA 1DGLA 1JBCA 3FZ3A 3DL3A 2EXKA 2GC1A 3ES1A