3MFFB

1f1e8hu tcr
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
242
structure length
242
Chain Sequence
MKVTQMPRYLIKRMGENVLLECGQDMSHETMYWYRQDPGLGLQLIYISYDVDSNSEGDIPKGYRVSRKKREHFSLILDSAKTNQTSVYFCASSLAGTGNYEQYFGPGTRLTVTEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor alpha chain
publication title An alternative conformation of the T-cell receptor alpha constant region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 59
structure length 242
sequence length 242
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mffB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mffB02
5EIVA 3EDKA 1CZ8L 1C7SA 1VHPA 4YO0A 3VFOB 5E99L 4F80A 5C2UB 1NJ9A 4I0PC 4Z7WF 3QZWA 4DKDC 2UV3A 3CVHL 4QRTB 3CCHA 4XHQA 4Z77B 2H2SC 1UWEL 5E00B 5BXFB 3BOVA 3VRJA 1EDQA 4QHLB 1FL5A 3TN0C 3EW3B 3P9LA 4CN6A 3OAZK 4LSTH 3MUGB 1M6OA 3QI9D 1CBVL 2A83B 4I0PA 1CR9L 4O02L 4XC1L 4B0MM 4K3HA 4Y16C 5C0FA 4MNHB 4M5ZL 4XCCH 2BVYA 4JRXD 1NCWL 1FYHB 1LEKB 3FT2B 3TNNA 4K3DL 1RZ7H 3ZYJA 3LHPH 4UINL 3TN0A 2CXGA 5JQ6L 3EO9H 5EBLB 3L6FB 4NRYA 3MJ9L 1CXIA 4JG1H 4A6YA 5ID1A 5CIPB 3RY5A 2RGSA 1P4LA 4Y16A 4WI6A 1NCBL 4PRDA 3CFBB 1AD0A 4YBHA 2J5LC 1A1NA 5ETUA 1HHJB 2GK0B 1IZJA 4YE4H 1Z2KA 2FJFB 5DQDL 3QFJE 4HULB 4RZCB 1I8KA 3RUGF 1EEZA 4OB5H 4JRYD 2CR6A 5IG7B 4PD4J 5LG1A 3K4ZA 3QDGA 3UTPD 5DVOA 4KK8D 4R96A 1DBAH 4R8WH 3CPLA 3VFNA 5E70A 1HKFA 4PGBB 5FM5O 5DD1H 4Z7WA 4FP8L 4MAYD 2CUMA 3P0YL 5L0QB 3S96A 5JR1L 3BPCA 1J0YA 3QQ3A 3JTSB 4PLKC 5IM7B 3DSFH 4LLDA 1DQJB 4RWHA 2EC8A 4P5TC 3RGVC 2IGFL 1D9KB 2NNAB 2CO6B 4KVCL 4M7JH 2BHYA 4OKVA 4O2FA 3QQ4A 4TQEH 5L2KE 5E2TL 1DL7H 5LCVH 1JTPA 4GKNB 1WAAF 2DKSA 1FNEA 4K71C 3I50H 3VFRA 3OJ2C 4P5TA 2XRAH 3BW9B 3RGVA 2MKWA 5ESAA 1KB9K 1FBIL 5D96C 3CSYA 3GJFA 4Y5VC 4K9EL 5DJZB 4MAUH 4NKQB 3QJFA 2DD8H 3S4SA 4F7EB 3HLAB 4F7TB 4MB3A 5D72L 3AS0A 3RWIA 3FO2B 3LSOA 2EH7H 2C1OB 1T7XA 4LHUA 1OAKL 3RUGA 1XCQA 2OMNA 1KXQE 2ATKA 2CO7B 4X6BA 5IMMA 3LPWA 2CK0H 4O51B 1U8KB 4XPAH 4S2SA 5C3TA 1JF6A 2VXVH 4Y5VA 4WV1B 3WL9A 3AB0B 4EI5D 1Q0XH 4GBXC 5A2LH 5FUZH 5MP6L 5D7IF 2VDPL 3ZYZA 3LKPB 5FV2A 4AEHH 3MYZA 3TIDB 1MVFA 1YMME 2DF3A 5C1MB 1A0QL 5EUOF 4ENEC 4NHCL 3WUWG 1FYTD 3DV6A 2R0WL 2EDFA 1JP5A 4LKCB 1J5OH 2W92A 2QADD 3VFPA 5IJVB 1NUFA 4GBXA 4PS4H 5EU7E 1Y0LB 1S78D 2IANA 4YXHH 2GFBA 4HKXB 3MBEC 4GRMB 1BFVH 4JFZH 2IAMB 5IK3A 5KSBB 4YK4B 1PSKL 1J87A 4GXVH 2XOTA 1S7SA 2DQIH 2AGJL 4MD5B 1WAAA 1R0AH 3QT2A 4X7CC 4Z7UB 4APQD 1S5IL 4N5ED 1QR1A 4L4TA 2Q8BL 5D7LD 3F58H 2H8PA 1RIVL 3GJFH 4XGZB 5HYQA 3MBEA 3BKCH 1UXWB 4OM0H 3LS4H 5C6WH 2BY2A 4KRPD 4YHNA 5KSAB 4L8CA 4PRHD 5F6HI 3RVVD 3QWRA 5F7UA 1VFAB 3EYQD 3E8UH 3DVGB 4WFED 1ETZB 3RWDB 3IFPB 5HHOD 1T6VN 1KENL 4OZGB 1NC4B 2I27N 3KPTA 2NLJA 4NQDD 3HPJB 2D31B 4DJMA 4YXKH 1TVHB 4HIEB 1OF2A 1U41A 3MJ7B 1ZVHA 4PP1D 4I3SH 4OZFB 1S9VA 5I8CA 5C0BD 1V7ML 2R4RH 5L88L 3V5KA 3LAFA 3NTCL 2ATPB 5HHQA 5ILTH 2HKHH 4MQXC 5J0BA 4Q6IB 5D7IA 5HDQH 3V52H 1QPPA 1I75A 2BC4A 4ODXA 3B4NA 1WBYA 3MLZH 4U6XA 5EUOA 3S88L 3O6FC 2G75B 2BNUB 4I5BB 3TVMC 2DJSA 4NQSB 5EZLB 3CVIH 1UCBL 4LBEA 1SJEA 3EHBC 1TPXB 3BDYL 3QDJA 3GBNH 2PXYD 1AGBB 3LMJL 1SM3H 2Z31C 2ZUSA 3BPNB 4LSQL 3KPPA 5E5MB 3ZT7A 5I1JL 1A6AA 1NMBL 3CZFA 3O6FA 4XP4L 1VADB 3TVMA 2B5IC 2NY5L 2F54A 2I60H 2BNRE 4QXUH 4HAFA 1K9TA 1MJ7L 4FTVB 3BP5B 2Z31A 2FD6L 1B3JA 3MCG1 3QUMB 3MJ8B 1KTLA 3TPKA 1NCAL 1NPUA 1BAFH 1JWUB 1FO0L 3MPCA 5KW9H 1PX4A 3NZ8B 4XAWH 3VWKC 2YD7A 3NZHL 2DM4A 4JZJC 3I2CH 2CDGB 2AJSL 3S35H 1J0ZA 3S3SA 2PNDA 3MCLH 4YHYC 3GK8H 2WMPA 4K8RC 4ZXBD 4CMHC 4YHPA 4F7CA 4ZFOL 5L8KB 5MEOB 3KYAA 4H1LH 2FX7L 3A6CL 3JUYA 2CRZA 4NN5C 1YNLH 2CJUH 43CAB 3VWKA 3RVTD 1EK3A 1KXVC 3QDHA 1G9NH 4JZJA 2NCMA 5LWYL 3SE9L 4QY8A 4O9HH 4DKEH 4Q97A 2WAHA 3ARGD 5FV1L 3LKNA 3RL1A 4KMLB 3ARYA 5ID0B 4JPKL 1MFBL 4OIIL 3O3EA 3GB7B 4X9FA 4XMPL 4XRCA 1YPZE 4WFHE 4FQPA 4CRPA 5J06A 5C0RL 3ZHDA 2OJZH 4QRRE 3STZA 4NQEB 4OLVL 4PV9A 4ONGH 3O2VL 4NZTH 3QG7L 5FYKL 1RZIA 1L6ZA 3CMOL 4HF5H 4XPHL 4Y5YC 4LSPL 1IGTA 1K4CA 1XH3A 2NX5B 4P4KB 3DBXA 2DQJL 5ICYA 4RDQF 3VCLB 2X70B 4TNVK 1BD2D 3JVGC 1I85C 3BKML 1N7ML 3S5LA 1FPTH 3RZCD 2YMXL 1J7VR 5HGDB 5JW3L 3T2OA 3ILPB 3B6SA 5I1KH 3JTTA 4XNUL 1E28A 1DUZA 4N0UB 5T3ZD 4B7IA 2O5ZL 4Y5YA 4ZUTA 4QOKA 3SJVE 4FFWD 3JVGA 3SCMD 1I85A 4PRAA 3SDXF 1BBJB 2V9TA 3QR2A 4P59H 3DWTA 2L4OA 4Y4KB 5JO5B 1WWAX 3MLUH 3FQRA 2DBJA 4KHXL 3QNXB 3HG1A 1DBML 2NY2B 3ETBF 1LK3H 1R6VA 1NGWA 1KJ2A 3P40A 2B2XL 4KV5E 3MV8A 1YEHH 4ELME 2FCBA 5F7WC 2BCKA 1I7RA 2V17L 4X8JB 1E4XH 1BHGA 3EYFA 3LH2H 1BOGA 4U1IB 2I9LB 5IIEA 1P6FA 5K9OA 3GKWH 5FYKU 2VAAB 2E9IA 2OSLB 3SGKC 1TZHA 3MRKA 4N0FB 2ED9A 1OARH 1DDHB 4PR5A 1OD9A 2H32H 4HUXA 1SMAA 5KTEL 1EAPA 3KR3H 2Z4QB 2ITDA 3L3IB 1PZUB 3DUHA 4PLJC 5GGSA 3N85H 1AJ7H 5CWSB 4BQCA 3BHBB 3IJSA 3S36L 4ZO9A 5IB5B 5IB4B 4YHZL 5E9DE 3SGKA 1WZ1H 4LPXA 3D2UD 4U05A 5E8NB 1VCAA 4R7NB 1JGDA 4GKSB 5FYJE 2D3VA 5GS2H 1AQDA 3VFWB 3EOTL 2DQHL 5F3HB 1C08B 4HH9B 4KKBD 2P5WB 4MWFB 1HYSC 3SDXA 1QFWH 5KVDH 5LQBL 1I9JL 1ZT7B 1ZK9A 4Y7MA 1I7ZA 2IG2H 4Z7NF 1OTSD 2VLRD 3DETC 4QWWC 4HWEL 1QSED 1MJJB 3GSNB 4M1CD 5C08B 3MXVH 2AAVA 1NKOA 1I9RL 4MJ5A 4ISVB 1EO7A 1UJ3C 4PJEE 5BVPL 5T33L 2Q6WB 2QSQA 1NCCL 2ZG3A 4WI9A 1T66C 1MRDL 3MV9A 3PWNB 3L95A 4UUJB 3DUUB 2D7QA 1U91B 2L7JA 3BIKA 4CU8A 5DEFB 3PJSA 1UC6A 5F7LB 1A1MA 4HIXH 4FZ8H 4YDLB 1LP9B 1UJ3A 5D8JL 1KB9J 4IRSD 1BMGA 3MODH 3BKYH 1BGXL 3G9AB 4XMKL 1EUTA 2AERT 3RVXC 2BXYA 5IMOA 1LQSR 4G6FD 4MJIA 1EZVX 5CGTA 3HS0B 3H9HB 1EH9A 4ZS6D 2UWEF 4HX1A 2XTJC 1WZMA 4E0RB 2FB4H 3C09C 3EYUH 1KEMH 5JDSB 2WANA 2YWZA 3N1GC 4OUOA 3DXAB 4YBQD 4GG8B 3S37X 5IQ9A 1JZ5A 1ZT1B 4O58H 1R5VB 2DAVA 2R4SL 2FJHB 4NJ9L 2W0LA 4Y19B 4MX7B 5I1HL 4M6OH 1N6UA 3VI3F 3VXPA 2HT3D 1TJGH 4RX4D 2EKJA 3W2DH 3VGEA 5D1ZD 1QFPA 4NM4L 3DI3B 3R1GH 1EERB 4POZC 4HS6A 1AXSB 3AMLA 3C8KA 4KKLC 4ZTPL 1G6RL 3LS5H 1WF5A 4PRPE 4WUUD 1OAYH 4OAWB 1HHGA 4WI8A 3K1KC 4V1DE 3P9MA 1YQ2A 3NCYS 5E08H 3MNWB 4LLQA 1RIUH 1Y6KR 1OGAB 1B0GB 5JW4N 4MHHI 3VGAB 4XBEH 5CJQL 1ZMYA 4GMSH 3GSOB 4MDIA 3SDCB 1WZKA 1JPGB 4BUGA 3RKDD 1A5FL 3BH9A 5JHDB 2IPTH 3MRFA 2IF7A 3DRTB 1WEJL 1GIGH 1AQKH 3MLSL 2UWEA 1EZVY 3RNQA 3GJEB 4U2YA 5DC4B 3G5VB 4HKJB 3RJDA 2HJFA 1G84A 3GHEH 4QLRA 1MCPH 4K23H 1OAQH 5C0AB 4I13B 1F4YH 2CLVA 4QRUB 3PABB 5I1LB 2OP4L 4YHML 5FF6B 2JB6A 3MRMB 5IQ7L 4OF3A 2FATL 1PGRB 3PE9A 1EGJH 1PQZB 2EIEA 3K8LA 1CGSL 5FECA 1B0RA 3HC0B 2AXFB 1CG9A 1RU9L 4MD4A 2APWA 4G8GA 3TYFA 3QQ9C 3DHMA 4YDKH 5FB8B 3PDGA 5IMLA 1U8JA 2J8UE 4TUOB 5CP3A 1LO5B 2Q3AA 3M8OH 5GZND 3AS1A 2WBWB 1TVBB 4G8EB 4MJ6A 3B9KB 4KQ4L 5GGTH 4PY8J 3PWPA 4LLMA 1FFNA 5GJTL 1S7WB 4NN6C 1JK8A 4OLZL 2YPLA 2Y6SD 1MCEA 1GHFL 4OZ4B 5DD0L 3QPXH 4LHQB 5JOFA 5F1NB 3RVUD 4NQCD 1KULA 3T4AB 3O2DL 4GAGL 1U3YA 5AAMA 4JPVH 3RAJH 5DEGA 5D2LB 5K9QG 5K9KB 5MEQB 4NGHL 3REVB 2WM0A 2VLMD 1I7TA 5D5ME 1E6JL 2DLHA 5CZXC 3IDXL 5I9QC 1S5HA 3T8XB 2RCSL 3UYRL 2JCCF 1NEZA 1HQRA 2FRGP 2J6EL 4H88H 1FSKB 4JKPH 4WGWB 4ZUVA 3VA2C 5EU6A 5FGCB 3FOMA 5CINL 1K3IA 4GQPH 5C2BH 4OBRA 3U0PA 4XXDB 5GSRB 3W9EB 3X17A 3O9WC 4JFDA 2GJ6B 4IDLA 1F00I 1KPRA 4LCWE 4OD1H 1GAFH 1T0PB 4UT9L 3VFUA 2VDRL 5DHVB 3Q5YA 1C1EL 1IAIL 2YPKB 3T0AA 1HH6B 3RHWF 4JVWA 3H0TB 1KPUB 2DQDH 1P2CA 4R2GC 3QDMB 4FQHB 2CXKA 4Q74A 4XC1H 2AK4D 3O9WA 1A3QA 3D69A 1JFQH 4LPWA 5T1LA 4HBQA 2FX9L 4K3DH 3WFBL 2IBZY 4NUJB 1T2JA 3WKNA 1V8HA 3LQMA 3QEHA 4UTAH 3DURA 3MJ9H 3TT3H 3ARFB 1WZLA 4HLZH 4WO4B 1S9XB 3IS0X 4MA7L 3EDDA 5HVWA 2COQA 4LAJH 4OJFH 3N9GH 2JCCA 3GEWB 5DQDH 3D39E 3LEVH 1YN6B 2XY1A 2VUOA 2XA3A 4GG6E 5TPWH 1SJVA 2RFXB 4ALAH 4QCIB 1QYGL 3IU3A 1FVDA 1FRGL 3E2HB 4YDIL 5E6YA 2CR3A 4NDMB 1EFXB 3P3YA 3IT8D 4P5TD 2LU4A 1FFRA 2P8LA 2IMNA 3QH3A 4I77L 4U1MB 5MEPB 2H6PB 2JELH 3RGVD 4MXWH 3NCFB 2H26A 4J1UB 1EBAA 4JFOA 3ULVF 4X6DF 1ZSDA 5T3ZL 4BUHA 3EYOA 2X4RA 3X12B 4ZNEE 3QUML 3BGFC 5H35A 4EDWH 3MRJB 4NQVA 5CZKA 2KQNA 2JTDA 4KVCH 2EXWD 2C3HA 4OLYH 1QUNA 4CVZA 2DTSA 5E2TH 3O6MH 3BSZH 1D7FA 5F3BA 1QACA 2VH5H 4RGNB 4L3EE 4OLXL 5KVEH 4FNLL 5IFHH 1KFAH 4NP4L 3LQZB 3V7AE 3QFJB 5IVZB 4JM2D 1IEAB 4U1LA 1BM3H 1S7VB 4G8IB 4Y1AD 4X6CE 2OL3H 1FBIH 4XPTL 3RU8L 4EKXA 5LVEA 3AGVA 1RUKL 3QXDA 3OPZH 2EKSA 4HWUA 2YZ1A 4S0SD 3IFOB 4QXGL 4PJ8D 2E8ZA 5FYLE 1YECL 1F2XK 1QLRB 4HWBA 1T1XA 3FB6A 1FLRL 4WVRA 5I1CH 5SWZE 4XCYA 4X7TA 4PJHE 4Z95H 2EDEA 3OKOA 2XQBL 3FT4B 3QNZA 4PTUA 5JHLL 1AGFB 2VDPH 4P3DA 5L2KB 5DURD 4DKFL 4X6DA 1XGUB 1U8LA 1CYGA 3O3DB 2DDQL 4O4YH 1NH6A 1IILE 4KTDL 4BJLA 5DA0B 4HC1L 3FQXA 5ALBL 1DJSA 1IGMH 4HWZA 2BSED 1H5BC 3ULUH 4M7KH 1JL8A 1JHLL 4U6YB 4AT6A 2YBRB 1M71A 4LPTA 2A6JB 5I1EH 5KVGL 4L9DA 5ITBL 1JVKA 2AJVH 5BV7H 2OR9H 5J8OA 1DP0A 2N7AA 1XGPA 3IU4L 3WUWA 2UUDK 3MOAH 3TO4D 1MUJB 3QBTB 1GC1C 2AXHA 1YEJL 1RIHH 5D7JC 1XF5A 2Q8BH 2QQNH 1ZV5A 1H5BA 3HI1B 3F6IA 3C5SB 5IFAH 4QNPF 2OI9C 5T3XE 3WUZA 4MLSA 3QIBD 4WENB 4E9LA 1YN7A 5A2JH 1AI1L 1E4XI 1ORSB 3D0VA 3DI2B 3LQAH 1JGEA 1U3HD 4G6KH 2K7PA 5FA3B 4M8QA 4YJZL 1UZ8A 4F9LC 3HTLX 1N0LA 4U1NB 1YMMB 2AJUH 5D7JA 5J6HB 1QFUH 4HIJB 1IGFL 1GZQB 1YEIL 4B41A 5TE7L 1KENH 2BERA 4N0YL 3WFZA 3S3JA 2P24A 1MCFA 3X11A 1RMFL 5KSUB 3O3AA 4UQ3A 3GMPA 4H0GA 2W65B 3CNKA 3ULVH 2F54D 5L88H 3TH2T 4FQCH 4LNRB 5ELIA 4E5XB 4F9LA 5HHME 4K07A 2GTZB 4RNRB 4KQ3L 3PWLB 5KSVA 1LO3L 1NBVL 1GZPA 4MJ2A 1DTUA 5AZEL 1U8QA 4TPRH 3LMJH 3TP4A 2NW3B 2IH1A 5HSFA 1P7KB 2OS7A 4X4ZA 2MCPL 3WIIL 3BESR 1RFDL 3RQ3A 4M6AA 1QFWI 3OWEA 3U36B 5I1JH 5D6CA 1NMBH 3FFDA 4U31A 5CEZD 2OQJA 3WHXB 2AKRB 5CLWA 1VEPA 5L6YL 1F3DH 3VWJC 2F5BL 2HN7A 1DEEB 2FIKB 3GSNL 4MA1B 3BUYA 2X4NB 3EGSB 1DZBA 3H7BA 2RQ8A 3OX8A 3FOLB 1ROWA 4YC2B 4G3YL 2DKMA 1OCWH 1CN4A 4DVRL 4YHOH 4X9BA 3VWJA 1DANT 1FG2B 3IXAB 3QHFH 2NZIA 3ELAT 4KDWA 1EEYA 2X4QB 4H5SA 3BE1H 2OTWB 5I16A 2VQUA 4P5MB 1T5WB 2FGZA 2X4UA 2UZXB 1DUYB 3REWB 5B8CC 4Y5XB 1GYAA 2YKLH 1QZ1A 1LE9A 5BJTB 2CDEA 3BWUC 2P5EE 4W6XB 5KS9E 2OZ4L 5HYJE 3MRPB 3WNOA 1BVKB 5EWIH 4QRSA 1ZE3C 3U2SA 5A2KH 4IRJB 3HRZA 4UB0H 4GMTL 3PHOA 5B8CA 4U0RB 5D2NC 4P4RB 1K5NA 4ZTOL 2E7LC 4JHBA 1MCBA 1MRFH 5H94B 1NUDA 1JRHL 1R24A 5DJXB 2WBJB 5B3NA 3C6LB 3TIEA 1A22B 3TFKC 2PN5A 5HI5C 4FXKA 3WD5H 5D2NA 1VSCA 3C8HA 2E7LA 4JDVB 4CU7A 5H37H 3ZO0A 5JW3H 3DSNA 2XWJB 1T80A 1KJVA 3P4LA 3RTQC 3GRWA 2UYLB 4OGAD 1VPOL 2O5ZH 1BWWA 3MZGB 3RVWD 3V4PH 5I1IH 3HUJF 4O2CA 1EMTL 1MCOL 4YIQA 3IJHA 1A6WL 3FRUA 5CEXB 3FB8B 4WNQA 3UTSE 2Y23A 3RTQA 3CFDA 2ZUQC 1UKSA 1U2HA 2FHFA 2PO6B 2F19L 1GCFA 1ES0B 1MIMH 3QDAA 5DRNB 4QRRB 4ZAKD 5INDB 4HKZA 3DUSB 2G60H 2IANE 3VXTA 2JJSC 3DIFA 2XWTA 3GFUA 3OR6A 4YFLI 2GUOA 1B0WA 2D9CA 3WV0A 3TBTA 2PW2B 1XR9B 3S34L 1QBLL 5CCKH 4KUCD 5IV2B 1H8OA 3HA0A 2J8OA 2BNRD 2JJSA 2XG4A 4XWGL 5CJOH 4GKZB 4J4PC 3SJVB 1UACL 1DE4A 2YXMA 1NANH 1FL6A 1Q94B 2NY4C 5FAAA 1HYSD 5IFJB 5CBEB 5I8EA 5C0IB 1D3CA 5CD3A 1WWCA 1RZJH 2A6IB 1CI5A 3MV9D 5GS1B 1EPFA 4TVPH 5T5NF 1MH5B 4HCRH 3HE6B 5DJAB 1FV1A 4X5XA 3EOTH 4J4PA 3FFCD 1EV2E 4G7VL 4WW1A 4BH8B 3WN5C 3HUJA 3KYNA 5D7IE 1FVEA 1AGCA 4I1NB 4U1JA 5B39G 3HR5B 5D7KE 5EUOE 4OD2A 5F7EH 3GI8L 1T66D 4I8DA 3RX7A 3VFTA 4EI5B 5DTFA 3FO1B 3T65A 3QDJE 5GJSL 4K55A 3B2VL 2X4TA 2YXFA 3WN5A 4S11A 5ITFB 1KTKE 2ADGA 3GBLA 1CFNB 2IQ9L 1KIPB 4P3WA 3S35X 1A3LL 1HXYB 2AQ2A 2EYTB 4BELD 1NCCH 3RWCB 5C70A 5E9DB 1F02I 5T1MA 4XVJL 1ZGLB 5HY9B 3BP7A 2MTPA 1J05B 1Q9WB 3BXNA 4LVNB 3STLB 2VIRA 5HGAA 4FOMA 2C4FU 1A6TB 2X5PA 1LEIA 5C0CA 3F7QA 5GS0D 1EJOL 1FFOA 3U7AA 1RJZA 1YYML 3KPRA 1GPOL 4NNPL 4D0BB 4U49A 3IXTA 1MCWW 5DS8A 4ZO8A 4X4YB 5CHNA 1H3UA 2XA8H 4UTBH 4J2XA 5GISL 4KK6D 5C0GA 5DFTA 5J11B 3OXSB 2NQCA 1NC2D 4PRHB 4XC3L 3QRFM 1P9MC 1TCRA 1HSBA 4S1RL 4WWKC 2NXZD 3CK0H 4M1GL 2G9HB 1CL7L 1CLZL 2AEPL 1QD0A 4OTXL 3F7VB 4Y4FD 2R4SH 1CICC 2X4PA 5I1HH 2ZP0T 5EO0B 3IF1A 1MPAL 1TVDA 2X7LA 2E7MA 4QGTA 2JIXD 4HJJL 1I9EA 1NLDL 4AIOA 1D6VL 1A02N 3U0TB 4H8WC 1P9MA 4NM4H 3DOSA 4M7LH 3SO5A 1J11A 2MMXA 4WWKA 5F9DC 1DVFB 5EBWB 2VLLB 1N6VA 2R2HA 4TYUA 3MYJB 1CICA 4RFEB 5JOEA 5E6ID 4YHKL 4UNVA 2CLRB 2D7NA 1GSMA 4ODSL 4FFYL 4HQQH 4R4ND 1U93A 1YNTB 4KPHL 2X1WL 2XXMB 1IAKA 1TQBC 2DICA 2DBLL 4XMLL 2EE6A 2W9DH 1L7TL 5CIPH 1KNOB 4JJHA 4OQTA 4NQUA 2E27H 4DK6A 2BMKA 4ODBD 1U8MB 1UB6A 4P9HH 1ZHNA 1CDCA 5TF1L 1YMHA 5L8LB 4OF8A 3MRRA 4DUVA 3SY0B 4PGCB 1SYVB 4CMMA 1NGQH 2QR0B 1SY6L 5HD8D 3HB3C 2NY1C 2XZCH 3V6ZA 5BS0A 5K59F 4IMLB 1XGRA 5TDPB 5FYJD 1G1CA 4QOKE 4HIIA 4NO3B 3GMLB 1IM9B 5C09D 1N4XL 1LDPL 1FCCA 2OP4H 1F97A 3DX8A 8CGTA 5DUPL 2HLFD 2QSVA 1CIDA 3SDYL 1I1FA 2APTA 4JFFD 1XF3A 3PWUA 4LHJB 2IADA 1P5VA 5T1KB 1IGJA 5ANME 1OP5K 3MV8E 5DGQA 1MCQA 3CU1A 4EDXA 3VXNB 4NO0B 4JZNA 4OCLC 1O7SA 2ZSWA 9CGTA 3CIQA 3TJHD 2LTQC 3MV7A 4PBVC 3MGTA 4NKIH 5CSBA 3T77B 3ARGB 4PV8A 4WEUD 1J8HE 2V9QA 2FEEL 4Q6YA 1W0YT 3QULA 4UDTB 1CXHA 4NWUL 4U1HB 1CDGA 3QIUB 3WFEL 1D5IL 1IFHL 1IGCL 1QLEH 3MRIA 5GJTH 3RWJA 3IDIB 1QNZL 1U8HB 1H3PL 1YY9D 1JWMB 1GHFH 1NBYB 2C3VA 2ED7A 4QRQA 5BZWB 2OK0H 1D5ZA 2HTKD 5GZOD 5JIHA 4IRZH 3O2DH 4ZG1A 2P8PA 5CZXD 3VH8B 1NAKL 5FHBL 2ZCKL 3WIHA 2IFGA 5C9JB 1TLKA 2CKBL 3F5WB 3EFFA 4Z8FL 2BXZA 3RZCB 3OJVC 1ND0A 4JFDD 3ALPA 4Q0XH 2GTWA 2NY0C 3P4OA 5TDOB 2GJZA 1CS6A 1MQKL 3SPVB 1BX2B 3OKKA 5A40E 1DLHB 2RCSH 1XF2A 3VXSD 1DQQB 1GGTA 2EYSA 2BJML 4URTB 4M3KB 1KCSL 2C7UA 5J1AB 3U9PH 4HJ0D 1BQHB 4JO4H 4OZIF 5KVFH 4KTEL 4PRPD 3T0WA 4XB7A 43C9B 2O26U 4JDZB 1RZKL 2YZ8A 4ZO7A 5E8OB 1N0XL 5AG8A 1QEWA 5EFIA 1B4JH 3ZE0F 1XCTA 5I6XC 4I48B 1T22A 4JFHE 3RKPA 2N1KA 3UTZB 3WNMA 2P46B 1U6AL 3KPSD 2CH8A 1JTOA 3V6OE 4HZLB 1A7NH 5DA4A 2GSIA 1UM6H 2WINA 3C2SA 3C5JB 4MJIE 3KPOB 1FNLA 1Q9KB 1QSFE 4PYHA 4E41B 3O2WL 4JGMA 3VGDA 3WIHH 3BKJL 5CP7A 4NQXA 1AXTH 1X5KA 3WKML 1R3KB 3NCBB 4TUJA 1WGOA 2M8XA 4GAJH 1YYLL 3X13B 4BK5A 4OZFH 2V2WB 3T0EC 3BJLA 3OHXA 1JWSA 2AI0L 2Y4SA 3VXUE 1V7NH 4LOUC 4N1HB 4BSVA 3UCRA 3KLHD 1A7PL 4J7RA 1ZGLP 4RAVA 3GSXA 3CDGA 2VXSH 2AP2A 2F53D 1WBXB 4UQ2A 4NKDB 2XTJE 5C6TH 2AABL 1OQOA 3C60B 1HXMA 4J8RA 3VXMA 4MA7H 1RUML 4H20L 2ZOKB 3I6GB 5F9AC 3T0EA 2EEDA 3A6OA 3ARBC 2R1YB 4GLRH 5C8JB 2PR4H 3MCKA 4LCWB 3Q6GL 5FO8B 5IESL 1A7RL 1QYGH 3L5HA 3LIZH 3RP1A 4YDIH 4OZIA 1CD9B 2NXYB 3KPNA 5E2WH 4C56D 5DJCA 3O4LE 3FO0H 3BMVA 5E5UB 3HMXA 3KPLB 1LEGA 4XP6H 3LKOA 1XIWD 1T2QL 3ARBA 1KCKA 4QTIH 3V6FB 3KS0H 1INQB 3QUMH 3OL2A 3T0XA 3PWJA 3VDBA 3DROB 4YQXL 2FX8L 1YEDA 2W60B 4CGTA 3UJIL 2PW1B 4ZQKB 4JDTL 5LXGH 2HT2C 5GIRA 1W72B 2BK8A 1MCJA 3CMGA 5H2BA 4IRSB 3VG9C 1UKTA 4G9DA 4OIBA 4OLXH 4Z7QE 4JO2L 5ISZA 4QRPA 4YDVB 1LE5B 4G6FB 3UTTB 4F7MB 1CGUA 1G0YR 3QUZD 3V8CA 4KJWC 1JNJA 4OSUL 3AAZB 3UJTL 3VXRB 3W0WE 5JXAH 4OFYD 4I3GA 3QEQD 1EHLH 3LRSA 4JHWL 2D7PA 5FKAA 1FE8L 3NFPA 4QXGH 1N5YH 3HC4L 2JJWA 1U8NB 3KYOA 2QQQA 1OGTB 3WEXB 4R6UA 5D1XC 3WS3A 3EZJB 2VXTH 4U6VH 4MCYB 5HVGB 2FIRT 4PTTA 3MLTB 4X98B 4NO2B 1QHPA 1G7MA 3BPLC 3GMMB 3PWPE 1I1AB 3UPCA 4NWTL 5IUSA 1M1SA 4L3EB 5D1XA 3HI5L 2YPLE 2BSSA 5E2JA 1FL3A 1MJUH 1RK0A 2XN9E 3CC5A 1MVUA 5CSZB 3ZTJG 2C4XA 1MAJA 2MHAA 2FO4B 5KANI 3V8OA 4X6CB 1PVHA 2OTUA 4K3JL 4NM8L 1MIEH 4MA8H 4N1CA 4JY6B 2ADJB 2YUVA 3MXWH 3LEYL 3GMQB 5KVGH 1PYWA 5HI4C 4ZFZA 5JIPA 2AEIT 2H3NB 5KN5B 2ADIA 4D3CH 3PDOB 3QUYC 1PX3A 5ADOH 3B8YA 1JF1A 1XF4B 4K3EH 4ONFH 5ESVA 5BMFL 1FC1A 5SWZB 2BOBA 2ESVB 4PJ9C 4PJHB 2FR4B 2YN5A 3WLBA 1I3RB 4I18B 1TNNA 4TTGA 5GS0L 3D39D 2VDKL 1FZOA 2DTML 3ARED 4AG4H 4PJ5A 3QUYA 3GGWA 2DYPA 1CGXA 2EDKA 3U7WL 1E6OL 1CK0H 2APBA 3E3QC 2IBBA 3SGDH 1A2YB 1A4KB 1EXUB 4LLUB 4PJ9A 4KMTH 4HUVA 8FABA 1CXEA 5D1QB 1VACA 2AEQL 1X5AA 4M9PA 1S8DB 7FABL 4OCMC 4KUZH 1BECA 1FGVL 1NANI 1ZHKB 2PYEB 2YA2A 4JPWL 3BWAA 3UBXB 2GSGA 4UIMB 3DO7A 5K9JH 5F97E 5F88B 2GHWB 1LO3H 2W9EL 4R26L 3EDFA 2MPAH 4X80L 1D6EA 4HV8A 4EUPG 5E4EC 3JWDH 3OB0K 5GGUA 1YJDL 4PJBF 4DK3A 4KKNA 5DQ9A 2MCPH 5BOZG 1S7UA 4HFWA 1RFDH 5KOMC 1MI5A 1JV5A 3MV01 3RJQB 5SWSD 1F8TL 1U92A 1KACB 1H3WM 3S98A 5L6YH 2V9RA 3X3GL 3O41A 4YO0B 3GSNH 4KWUA 5T1DL 1NJ9B 2VQTA 2YSSA 3QZWB 5F9OH 3CCHB 1X5FA 2DIJA 3CSGA 5MERA 3VRJB 3OG6B 1FL5B 3P9LB 1IVLA 1I3UA 4WI7A 4GXUN 1HSAA 1KN2L 1M6OB 4I0PB 3D0LA 1JGVL 3GI9L 4V2CB 5C0FB 3AY4C 5FYJL 2PTTA 3G9VA 3TNNB 3VA6A 3MUZ1 1UENA 5IOPA 3TN0B 4EOWH 4NRYB 3OSKA 2B4CC 3WLWD 2GY5A 3TPUA 1FH5H 1ADQA 1NDMA 3ME0A 3MRBA 4A6YB 5ID1B 1K8DA 1P4LB 4Y16B 4PRDB 3AY4A 4DGVL 1AD0B 2BY0A 5MENA 1A1NB 1WBZA 2F5AL 3MO1A 5ETUB 3WNLA 1AGDA 1BIIA 4PJBA 2VLJA 5HI5D 1T7YA 1V05A 1ZLSL 4XNQA 4ZSOA 1I8KB 1EEZB 4K2UH 3PQYD 3VDCA 4LCUA 3QDGB 2X05A 1QPXA 3MRGA 4R96B 2J5LB 3E0GA 2B0SL 3CPLB 3VFNB 3CVHA 5EZIL 4HUWA 4UIKH 3RY6C 4Z7WB 5TDNA 1G9ML 4QHNA 1Z0MA 1F4AA 4M7LT 2EYRA 3S96B 3BPCB 3QQ3B 1GOHA 3F8UB 1UZ6F 4M03A 5FYJU 4LLDB 1VEMA 2I5YH 4HT1H 1YDPA 4PJFF 1CT8A 4OKVB 4O2FB 2VZTA 3QQ4B 1EMTH 2EIZA 3RY6A 3VH8G 3ESVF 1CLOH 3ULVE 4QHUA 2RBLA 1TIUA 5FO7A 3ARDC 5HHMD 3ZTNL 2FGWL 1FNEB 3PGFH 3D9AH 4RBPH 1MNUH 3VFRB 4P5TB 4P2RA 3RGVB 2F19H 2WIIA 5F7HA 5ESAB 3I3BA 5GRJL 1B88A 3JBG7 3JXAA 5HHNA 2CPCA 4WEMB 3CSYB 3GJFB 1TJHH 1LO4H 2R69L 1NGXA 1U3ZA 5HDBF 1O5DT 4M8VA 1BJ1H 3QJFB 5HXMA 3ARDA 3S4SB 2YRZA 2NY7L 1A4JA 35C8L 5I0DA 3IDUA 4K71B 3RWIB 2NY4D 2VSCA 3LSOB 3Q1SL 5AUMA 2LAAA 2AJXH 1UFUA 1U8IA 1IZKA 4LHUB 3S34H 4UU9A 3RUGB 1XCQB 3C2AL 2ATKB 3CZJA 1TZGL 4X6BB 5IMMB 5D96B 5DK0A 1IEBA 4S2SB 3RWEA 4Y5VB 3WL9B 2DQTL 1S3KL 1CVSC 4IJ3C 3ARUA 1YEGL 4GS7C 2O5XL 1L9NA 4HPYL 1I8MA 5F1IA 2EXYC 1GGBL 1VB9A 3PG2A 3FMGL 3DV6B 4HZAA 3MLPA 3QUKA 2HFGL 4LU5L 2WUCL 4HMDA 3VFPB 3CDCA 4GBXB 4G9FE 2NR6D 4MSWA 1DBKL 4JLRA 5C3LD 3KLDA 4K9EC 4HXBH 2IANB 4KY1H 4PJFA 2GFBB 3TLRA 3PHQA 5IK3B 2E5EA 3FAWA 5ABDE 1S7SB 4RAHA 4KVNL 4J3WA 4PJXF 3UZQA 1X5XA 3GI8H 3BPOC 5HYSG 1QR1B 4L4TB 3FTGA 5I18H 3D25A 2H8PB 1WLHA 4JO1L 5BRZA 2V2XA 4KRMB 3GHBH 2P5ED 3B2VH 3MBEB 5HYQB 3U30C 5HYJD 3QYCA 5TQ2H 5IBTL 4YHNB 4L8CB 4JCLA 4Z5RA 1FHGA 5B39A 3INUH 4L4VE 2ZPKL 1CXFA 2EEBA 5F8QC 5I66A 4XVJH 3L5XH 4AYFA 5HJ3A 1RJYA 2NLJB 2ENYA 2RR3A 4AEFA 4ODHH 1OF2B 2KKQA 4MQ7A 3P73A 5I8CB 1S9VB 3H9ZA 4OFDA 3V5KB 5HHQB 1N5AA 5D7IB 4LIQH 1AFVL 1CDYA 3QP3A 4WWKD 2YD6A 4KU1A 1IL1A 2BC4B 4ODXB 3QO0A 4R4FH 1WBYB 4U6XB 5EUOB 4F9PC 2ZKHH 3QUXD 5EIQA 4IOFD 4YGAB 4LBEB 1SJEB 2V5MA 3QDJB 2VE6A 3LB6C 2VJXA 4EZMA 5D6DC 4OCSL 4S1RH 3RNKA 3F12A 1SJHA 4NYLA 5GPRA 5SX4H 3BEVA 1OWWA 3KPPB 1A6AB 2VR4A 4F9PA 4XP9H 3CZFB 3O6FB 4A2MA 1J1XL 5DHVH 3TVMB 3AC0A 3KXFE 4PJXA 3UTSD 4D0DA 4Z0BL 2HT4D 1ZAGA 1C7TA 5DJ8A 2F54B 3ECBA 1FNSL 5D6DA 1YNKH 4YUEL 4LARL 4JHZA 2Z31B 1Z3GL 1KTLB 2VXUH 5T5FL 3HNVL 1NFIA 3N1QC 3H6JA 4OCWH 4PGDA 4X9GA 4TUKL 3FZUD 1K8IA 3GIVA 2B5IB 3RDTC 4KJQD 3TBYA 2X4OA 1A3RL 2X40A 2HJLA 3N06B 1L7TH 2V5YA 3WYRA 4YAQA 1RV6X 4S1DC 4Y8AA 4F7CB 2DIAA 2CRMA 4YHPB 3ZDZF 4GLRI 4G80A 3E6HA 5D2NE 2MWCA 4WCYL 4JN2A 2Q86A 3HPLA 1GVIA 3VWKB 3RDTA 4XPBH 4HS8L 4JZJB 2NY5C 4QY8B 1IMHC 1XGTA 3BZDA 3H8NA 3HNTH 4TVPE 1P7QD 4YHYB 4CMHB 2L0DA 4X0KA 4XX1G 2XV6B 3LKNB 1PBYA 3RL1B 3ET9F 1RUPL 4NN5B 1OAXH 4OI8A 4KI1A 5F9WC 1DQDH 1IC4H 4W6YB 3O3EB 1ZKAA 4LSVL 3BQUC 4XRCB 5D7KD 2B1AL 2WLYA 3MC0A 2R0KL 4JFEA 3STZB 4PV9B 1I8IA 1AC6A 3JWOH 1RZIB 3AROA 1EA9C 3D3VD 1I1YA 5DYOA 3WFCH 1IGTB 1K4CB 3SKUD 1A6ZA 1XH3B 1FO0A 3JSSA 1SYSA 2YA0A 3DBXB 5ICYB 4R9HA 1FC2D 4KKCD 3BQUA 3S5LB 4D94A 2YPVH 2PUQT 1AO7D 3MA7A 3B6SB 3KLAA 4NRXA 3JTTB 4ZFOA 1E28B 1DUZB 4NWUH 4PJ7F 4OFIA 3L1OL 3G6AA 4JHAH 4Y5YB 4ZUTB 3WFEH 1IFHH 2HG5A 1RURL 1KB5L 5ALCH 4QOKB 4FS0A 2CGRH 4KAQL 1A9EA 2XFXA 3L3JA 4PRAB 1H3PH 4HJGA 4GQ9L 3VW3L 5A3ID 3OTTA 3FN0H 5TQ0H 1XT5A 4HFUH 3MOBL 3UBXG 4ELKA 2F9BT 2GAZA 3FQRB 2O5YL 4AIXA 3ZYIA 4AY0A 3VRLF 2VDML 1PD6A 1NEUA 1NAKH 2HJKA 3HG1B 4JM4H 2A77H 1NGWB 1KJ2B 5DT1H 3NMEA 3IFNH 3GDBA 1UWGL 3MV8B 4PRID 1HI6A 5F7KC 2CQVA 3W82A 4Z8FH 3Q6FA 2BCKB 1I7RB 3EYFB 5MHSE 1BOGB 2EIDA 5DI8A 5IIEB 5I19H 5DO2D 5K9OB 4KJPC 1BFTA 1TZHB 3MRKB 3NFSL 1CGWA 1BJMA 4RWYH 1MRCH 4PR5B 4HUXB 4WU7A 4XPGL 1EAPB 1IRAY 3SKJH 2ITDB 4BQ8A 2DI8A 1OQXA 5GGSB 1H0DA 2DWDA 5I15L 4KTEH 3IJSB 3RRQA 4LEXH 1W0WA 3BD4A 4RCAA 5FYLL 1N0XH 3LZFH 1DSFL 2VLKA 1JGDB 3AFLA 4EBQL 2YUXA 3NABL 1OP3H 2I9TA 5IBUG 1AQDB 2Q87A 4PJ7A 1U6AH 3KPRE 1KTDA 4GW5A 3S97C 1MFCH 4AK1A 3SDXB 4DW2L 1AH1A 5C0EA 4CADA 2XKSA 1JBJA 1I7ZB 4YGVA 5JUEH 4JFYA 3SGDI 2ZUWA 1PFCA 1QRNA 4GRWF 3GKZA 1ZLVH 4LSTL 3QHTC 5GS2D 2W0PA 4MJ5B 3Q5TA 3QHZH 1MHHA 4OF7A 4F58L 4S1SH 4XCCL 1QO3A 3FQTA 3MV9B 3L95B 1QR4A 1G7PA 3UEZA 5EBGA 1RZ7L 3BIKB 3LHPL 3PJSB 2QLVB 1A1MB 1RUMH 1A6UL 4PLOB 3QI9C 4JG1L 1UJ3B 4F37F 5T3XL 4PJCF 5I17A 1FGNL 4DQOH 4JREC 1A7RH 2X42A 1MCIA 2DN7A 5IMOB 1JI1A 4MJIB 5I76A 5JXED 1J8HD 4OB5L 2HT2D 3GSVA 4HX1B 1QKZH 5JDJA 3QI9A 1CTOA 4BFBD 4D2NA 5E1AA 4FXLA 3WE6A 4RIRA 1DBAL 4R8WL 4JRXA 5F70A 4NSKA 1T0NA 5DD1L 4YQXH 5IQ9B 4KJWD 3UJIH 3VGGA 3R0NA 4KRNA 3VXPB 2XTJB 1ZA3A 2PETA 4P2QD 4EXPX 4O2EA 3DSFL 3C09B 4KK8C 3KPMA 4IIQC 3UC0L 1OD7A 1AR2A 3H3PH 2BZDA 12E8L 4M7JL 1EVTC 3C8KB 4HS6B 4PJDF 4TQEL 5F7FA 4MAYC 4OSUH 1HHGB 1DL7L 1NSNH 4UILH 5LCVL 1KN4H 5D1XD 4JRYA 4I9WD 3P9MB 1U8PA 1FZMA 3OB0H 5IEKA 3I50L 5HDOA 1KCVL 2XRAL 4IIQA 4A6YL 2MQCA 4YLQT 2I25N 3HE7C 3MLVH 4LLQB 2F58H 5KVMC 5DUBA 4CW1A 3DX7A 4MAYA 1AKJD 4LVHC 1UADC 5KSBE 4MDIB 4MAUL 3MV7E 4PJCA 1GOFA 2P43B 1CFVL 3QWQB 2R15A 3BH9B 5EDXA 2XACC 3MRFB 3HE7A 5D71H 2G5BA 2UWEB 3RNQB 1KLUA 2R56L 4JKMA 2CK0L 2HJFB 4N9GA 1DR9A 2VXVL 3HI5H 3ZKXC 4G8FA 4RMRA 4L8DA 5FUZL 4DWHA 1NLBH 2BVOA 2CLVB 2YUWA 4PJAF 2E6QA 5HVFB 4KKAD 5JZ7C 4AEHL 2JB6B 3B9AA 1QSFD 3BD3A 4LGSB 1CU4L 3RZWA 3S7GA 3L9RA 5K59E 2VTFA 1A47A 5GHWH 4P23D 4DEPC 5FECB 1B0RB 4FQQA 3ZZ1A 1RSFA 1J5OL 1G6RA 1CG9B 4PJ9D 2EDNA 4PS4L 4YH6A 3K8KA 3G5YA 4MD4B 4G8GB 5D93C 3SE8H 3TYFB 5FK9A 3E6FA 4YXHL 5IMLB 2WP3O 5GRXG 3VG0H 3VXUD 1BFVL 1U8JB 4JFZL 4PJDA 1PLGH 3SOBH 4Z78A 2Z93A 5IROC 4GXVL 2E6PA 1MWAA 3LN5A 4MJ6B 1CFQA 4L5FH 5DRXA 2QADC 3PWPB 1J18A 1PAMA 3F58L 2P47B 4LLMB 1FFNB 4OIAA 2X1XR 1G0DA 2HVKA 3BKCL 3WXVH 1JK8B 3F7YA 4NRZA 3HKFA 2YPLB 2PYFA 4OM0L 4Y2OA 4YBLC 1FYTA 5IROA 2PF6A 5JOFB 4FZEH 1VERA 4NCC2 2RHEA 1MFDH 4APQC 4N5EC 3O4LD 4F33A 1HEZA 3QG6A 1NGPH 3WO3B 4FTVE 4NN6B 4YXKL 4LKXA 4XTRD 5DEGB 1IC1A 3EJYC 1UWXH 4KRPC 4I3SL 4ZOCA 3RVVC 2BRRH 3IVKA 5LGKA 5ILTL 2HKHL 2BVQA 1I7TB 4PJAA 5C07A 3EYQC 1X7QA 4APQA 5EO1A 3V52L 4NC1E 5ACZA 5D7LA 1PY4A 3MLZL 1S5HB 3DYPA 3LV3A 1NEZB 2ICCA 1HQRB 1YJDH 3O3BA 5AYQA 3CVIL 3FCTA 1BF2A 4PP1C 5GS3A 3O8XD 3GBNL 4P9MH 3R06A 1S7RA 1SM3L 4HGKC 4ZUVB 1INEL 5EU6B 4ETQA 4KZDH 4K3GA 3FOMB 5I9QB 5HHOA 1BPVA 3U0PB 4NQDA 4EUPA 1HNGA 5B4MD 3T0EE 1U8OA 3MUY1 4JFDB 5C0BA 4EIZC 3VRIA 2PXYC 2I60L 4J6RL 4QXUL 1KPRB 2X41A 3FB7A 5JW5A 2AJYH 3VFUB 1JUFA 5HYFA 5GSVA 1BAFL 3KDMA 1P2CB 1K6QH 2QSCH 5KW9L 4MNQD 3O9WB 3OKEA 1JGVH 1J1PH 2PXYA 3D69B 3PDDA 4ODUA 1RHHA 5T1LB 3L3KA 5J1SC 4H26A 3S35L 3MCLL 3EOAA 1GL4B 1Q9LA 2VZ1A 1S9YA 5D4QA 4BKLA 3QEHB 1YNLL 3DURB 1KCRH 2CJUL 4R2GB 2C1PA 2A6KA 2QTEA 5IT2H 1G9NL 1VFMA 1ZVSA 1X5JA 1FG9C 3KJ4C 3QIWC 2CIKA 4N0UE 1V3LA 2JCCB 4DKEL 4ZXBC 2J6EA 5SX4I 5ISZE 4QRPE 3BEWA 3TJEL 4LSRL 4U6TA 1GGCL 3IU3B 1FVDB 1P84K 3RVTC 3S5LG 5MI0C 2P8LB 3ARWA 2ICWA 3QH3B 3CFJA 1QVOA 4DGYH 3QIWA 4RMTA 2H26B 2XWBA 4JFOB 3BDXA 4ZXBA 2OJZL 1ZSDB 4ONGL 3EYOB 4S1QH 2X4RB 4NZTL 2NW2A 3OZ9H 2HWZH 4HF5L 4G6AD 5H35B 3ZDYF 4TULL 5DJYA 5AWNH 3FQUA 4NQVB 2F74A 3CFKA 1J12A 4YDJA 4ESKA 3IFLH 3RX5A 4BZYA 1H9VA 1FPTL 5DJ0A 5CMAA 4LLWA 1I7UA 1R3LA 3SQOH 3SEPA 4CVZB 1UQSA 3QAZC 3OJDA 5F3BB 4UNUA 1CLYH 5J12C 3VGHA 3BGFB 4GSDH 1MLCA 1QSVA 5EUKA 4U1LB 1FP5A 2WUBL 1KJ3H 4R3SA 1ZLUH 4Q9RL 4P59L 5FCSH 2VKWA 4EN3D 3MLUL 4NBYB 5EZJA 5ESQA 2GQHA 2R69H 1IJ9A 4K8RL 2EKSB 1ITBB 1LK3L 2V5TA 2M2DA 35C8H 3MFGB 3RL2A 4FFWC 1F58L 4ODVL 1BD2A 3SCMC 1YEHL 4N1EA 4M48H 5C6PB 1JHKH 1E4XL 3LH2L 4PD4K 1T1XB 2Z0BA 3FB6B 3GKWL 1DN0A 4HMEA 1M7DA 2EC9T 4F15C 1ORQA 4XCYB 4MVBD 4X7TB 4LRNH 2BVEA 1KJMA 3OKOB 1OARL 3FO9A 3QNZB 4PTUB 5BRZD 5C08E 1RULH 3NGBC 4P3DB 2JJTC 3SCMA 3KR3L 4TTDD 4X6DB 4U1KA 4Z7VF 1U8LB 2D0HA 4PJ5E 3TV3H 4XVUD 4MZ2A 3DNKA 3U4AA 2FEEI 3N85L 3TYGH 3FQXB 1MY5A 1ONQA 2X1PA 2WUCH 4OV5A 3GM0A 1N64L 4HWZB 1WZ1L 4FG6D 1QP1A 4U6HA 4C4KO 2JJTA 1MCSA 3MRCA 4AT6B 1M71B 1KT2A 2Z91A 3L7FA 3O0RH 4DUXA 2VXQH 2V6HA 4DTGH 1XGPB 3WUWB 3MTRA 1AE6H 1XF5B 5I75C 1QFWL 5KVDL 1H5BB 1E27A 1OT2A 2IG2L 4ZDHA 2H41A 4I2XA 2ARWA 1NDGA 3ULUD 3K1DA 3PGDA 1RQ5A 1YN7B 4AEIH 3D0VB 1MI5E 1JGEB 3MXVL 4R97C 4M8QB 1IBGL 2ZPKH 1UZ8B 2W91A 4KKBC 1T04A 4ZOAA 3EUUA 5D70H 5I30L 5D7JB 3D2UA 2VL4A 5ECJE 5HYSA 5I8KH 3WCYA 2P24B 5F89A 3X11B 5JOPD 2OI9B 4OFVA 3O3AB 1OTSC 4WY7H 4UQ3B 3GMPB 4JY5H 1T21A 4M1CC 5DZOA 4HIXL 4O00A 1DBJH 4FZ8L 3LY6A 3HAEA 4HC1A 4MZ3A 4Z7VA 3RFZC 1JNNH 4NZUH 5KSVB 3MODL 1GZPB 2VLRA 1A7BA 1QSEA 3LD8C 3N50A 4GT7A 1U8QB 1JPFA 5K93A 2IH1B 3DHJA 2FH6A 4DVBA 3FN9A 4F2MA 1CIUA 1OGAE 1X9QA 5D6CB 2FB4L 1GH7A 3EYUL 2QQKL 2WK2A 3VFSA 3FFDB 1KEML 2CDFA 2OQJB 1J1XH 1SMOA 4KROD 3EFDH 3P2TA 4WFGD 4Z0BH 2I26N 2HFEA 4IBLT 4X5LA 4O58L 1OP9A 2JKXA 4YNYA 2IFFH 4ZS6C 5MENE 2HN7B 4GJTB 4M6OL 1DANU 2R2BA 4PY7A 1F90H 1I9IH 1TJGL 2VLJE 4QTHA 3W2DL 3BUYB 3H7BB 3BGAA 3R1GL 3OX8B 1ZTXH 2WWKO 5C0AE 2ITCA 2XT1B 3LS5L 3MREA 3M07A 1MFEH 4YBQC 3VWJB 1OAYL 1A3RH 4XHJD 3OGCA 1OVZA 1EEYB 4H5SB 2HT3C 2D03H 3P77A 5I16B 4LCYA 2DLFL 1JCKA 2X4UB 5E08L 5D1ZC 2NY6C 4XWOD 4YR6A 1LD9A 2P49B 4P48A 1RIUL 4M3JA 1YQVH 2WSKA 3HC3H 5KZCB 4XBEL 3BQUD 1LE9B 3SDAD 4GMSL 4WJ5A 1OSPH 2CDEB 3D18A 2BVPA 4I0KA 4RX4A 1NCDL 4P2OD 5ICXA 5D1ZA 2IPTL 1KXTB 3CH8A 1B6DA 4QRSB 2E7BA 4V2BA 1GIGL 3U2SB 4ZPTA 3HRZB 2Z35A 3PHOB 5B8CB 2VERN 4WUUA 3VD4A 1EO8H 2BOCA 4C83A 1K5NB 2F8XC 1U58A 4K23L 1OAQL 5EOTA 3FONA 1F4YL 3RKDC 5F7NC 3LEXA 1M05A 2I07A 1R24B 4G42A 4Y4HD 4LDLB 4OCXH 4X83A 1HCFX 3TIEB 2KDGA 1W72H 3L3DA 3NA4A 1EGJL 4FXKB 5D2NB 5JPMA 3U4EA 5D2LE 3QCUH 4WTZG 1BJ8A 2CD0A 3UZEA 3BO8A 4YDKL 1YEEH 2YEZA 1KJVB 5BZDA 1X44A 1J88A 3M8OL 1XZ0A 4XP5H 3M17A 2NTFA 1MAMH 1RURH 4O2CB 4ACPA 2VWEC 1MFAL 4XAKE 4YIQB 3H9SA 3IJHB 3HI6H 3VW3H 4JGJA 2KH2B 3FRUB 32C2A 5GGTL 5EO9A 1FJ1A 3MOBH 3ZDXF 3ZSTA 4WNQB 2BFVH 2O5YH 2NY3D 3RTQB 2VDMH 3CFDB 5SV3A 1UZ6E 3OAUL 4P46D 2OZ4A 4HK3N 4J3TA 4LLYA 5FGCE 5GZNC 3QPXL 4HKZB 2XZAH 2HKFH 3ARVA 2DQUH 3VXTB 3TWCH 2W9LA 3DIFB 2XWTB 3OR6B 1MHEA 1NMAH 4XI5D 5F71A 2GUOB 5F1SA 4AIZA 3ULSA 4JPVL 3RAJL 3CFIC 3TBTB 2ZUQB 5LBSH 2Y6SC 3N1PC 1VFOA 3KXFD 4PGEA 4XPGH 4N8CH 3A0OA 3R8BB 4K94H 2PCPA 1D5XA 3QDME 3T2NH 5HDBE 1GGIH 4WI5A 5I15H 1DE4B 4LP4A 1FL6B 5E5RB 2DS4A 4DZ8A 3I85A 5I8EB 5E2UH 1KIUA 5DRZA 3WNNA 5CD3B 4HS3A 4HUUA 4NQCA 3UMTA 4JKPL 3V4VL 5HI3C 3S8WA 1WTLA 1QBMH 1FV1B 4X5XB 1P84J 4PJGF 1F4HA 5C2BL 4WW1B 3GIZH 1U2CA 4O5LL 1RZ8A 3KYNB 1ACYH 3EJZC 3HUJB 1FVEB 2NY4B 5IMKA 1AGCB 4U1JB 4DW2H 4ZUWA 2EH8H 5I74C 4OD2B 3MRLA 1GOGA 1UM4L 1GAFL 4OD1L 4FQXC 3VFTB 5ENWA 5DTFB 3UYPA 3T65B 1MREH 1NBZA 2XNAA 3KHQA 2Z8VC 4P49A 4TVPD 2X4TB 4ODTH 5DD3H 2DQDL 3WN5B 1LILA 3VD3A 4ZYKA 3VMNA 2ADGB 5FKPA 3VE0A 3HZKA 3PL6D 3HFMH 2VC2H 4F58H 1JFQL 3WJLC 4FQXA 3QPQD 1OLLA 3N1FC 5T1MB 3BP7B 1K2DA 3BXNB 1KYOJ 3R8QA 2VIRB 5HGAB 1MCLA 1IC5H 1A6UH 4UTAL 1LMKA 4M61A 5F9JA 3EYSH 5I1GL 5C0CB 1LEIB 3SDDD 3TT3L 2FH8A 3ROLA 1FFOB 1RJZB 5T3XH 4QF1A 2OMBA 3IS1X 3KPRB 1FGNH 3IXTB 3WJLA 4RGNE 4OJFL 5DS8B 3N9GL 1WFOA 4JGUA 5CHNB 3LEVL 5C0GB 1PZ5A 3GUTA 5TPWL 4ALAL 2RB8A 3ZE2F 2KZWA 1CF8H 4YXLH 2AK4A 1K4DA 1S9WA 3NIDF 1HE7A 1SEBA 5F7DA 1TCRB 1HSBB 2JELL 4PJGA 4HUNB 4MXWL 4JM2F 2K9UA 4UAOC 4D9QD 3TF7C 4U3CA 4RMSA 2HTLC 3Q5OA 4HGMA 3L3HA 2BNQD 2X4PB 3IF1B 3U46A 3RPIA 1LO2L 4EDWL 2X7LB 2H1PL 4ZUUA 3T4YA 1CD1A 1OTTD 1WITA 1UXSA 3UC0H 1LK2A 3HE7D 2R1WA 2X89D 12E8H 2VN7A 1N3NA 1WSST 4WWKB 5ADPH 3MNVA 4OLYL 5MHSD 3O45A 2R2HB 3GSQA 4TSCH 1CICB 4CVUA 3O6ML 3BSZL 3SHSA 4GAFB 5KVEL 2VH5L 5IFHL 1KFAL 1KIQA 3OXRA 4OI7A 4JFEE 3V0WH 1U93B 1ZLWK 1BM3L 4IDJL 1KCVH 1IQDA 1IAKB 4PB9L 4U0QB 4A6YH 2EXWC 2OL3L 2BMKB 1UB6B 4QT5A 1ZHNB 3OPZL 1YMHB 2D7MA 2DLTA 1CFVH 3BAEH 3MRRB 4JM2C 4CMMB 3BISA 1G0XA 1TQBB 5JZ7D 3N1MC 3V6ZB 5BS0B 2QL1A 1XGRB 1KCUH 2R56H 2WW8A 1CQKA 1FORH 4HIIB 1VKXA 2VITA 5I1CL 3ZDZE 4Z95L 1CGTA 4JM2A 4PJ8C 4OUUA 5HHVH 3DX8B 2NY1B 3PXHA 1XR8A 4Y1AA 4XNZC 1I1FB 1RZFH 1CU4H 2Z92A 4O4YL 1NGZA 1XF3B 3PWUB 5FOBA 2IADB 1IGJB 1N8ZA 5IB1A 1IGML 2VR9A 4EDXB 1C5CH 5LGJA 1PG7W 3ULUL 4JZNB 3ARRA 2AV1A 4M7KL 4PJ8A 2ZSWB 3IETA 3BFOA 4BQ9A 2Y06L 5I1EL 1I8LC 3MV7B 3MGTB 2AJVL 5BV7L 3UX9B 4PV8B 2OR9L 2LFGA 5FYKE 1X4ZA 5J6GA 3MOAL 3TGXA 3QULB 3BZ4A 5C07D 1HHIA 1CFTA 1RIHL 1F6AA 2QQNL 3OF6D 1D9KD 4KGLA 4JEGB 3ZMRA 4AENA 3AXLA 3MRIB 5IFAL 3RWJB 1CGVA 1I8LA 2LTQB 3EJYD 3MRDA 2C3VB 2OR8A 4QRQB 1JGUH 1SY6A 4RISH 3LQAL 1CDUA 4G6KL 1D5ZB 4XCEA 3TO4C 4EQ3A 4WHTA 2P8PB 2AJUL 5I71C 2J8HA 1QFUL 4BH7A 1UM5H 3EFFB 3IAPA 2HP4A 3QIBC 1FNGA 1W0VA 4K7FA 3C8DA 1ND0B 1QQDA 1U3HC 3ULVL 3ZE1E 4FQCL 2GTWB 3TO4A 4TSAH 3P4OB 2GJZB 3MSPA 3DYMA 2AQ3A 3OKKB 3VRLE 2KZ1B 3SKOA 2CRYA 3V5DA 1XF2B 1N59A 3NACH 2EYSB 4HHAA 3VGFA 3QIBA 1RAMA 3RBSA 3VFGH 2C7UB 1E4KC 1U3HA 4MLIA 1OW0C 4TPRL 2NY0B 3K2UH 1H3TA 1INEH 2HAZA 2Q8AL 4NO5A 5DHYA 3FHAA 3F6LA 1QEWB 5EFIB 1XCTB 2ADFH 5HPMA 1B4RA 1E4KA 1T22B 1OW0A 4J6RH 5CKGA 5GGRA 1PJ9A 3IDJA 3FJTA 4LEOA 2IAMD 3V7AG 4HBCH 3RWFA 2GSIB 3QXAA 2WINB 2MCG1 3Q2CA 2BRQA 1IEHA 4JAMA 4LSSH 2CKBA 4Z0XA 3MBXL 5CP7B 1OCWL 4NQXB 5I6XB 2RAMA 4YHOL 3RHWK 1C16A 4N5UA 3QHFL 2DLIA 4TUJB 4JRXE 4FABH 1QFWM 3QIWD 4PPTA 4PREA 4CDGC 2WV3A 4MNGA 3OHXB 1JWSB 3BE1L 4BSVB 1YY8A 2C26A 3MMEA 5CJ8A 5KSAD 4CVWA 4RAVB 3GSXB 3CDGB 4ZUSA 3MQIA 1FDLH 2EDXA 4X6EA 1RZKC 4UQ2B 5SWQA 4MS8C 2DJUA 2SEBA 1HXMB 2YKLL 3LCYA 5M7QA 1LNUA 4J8RB 3VXMB 3GM8A 4GRWE 5DFVC 3T04D 2LAGB 1NC4D 3WMSA 3T0EB 2XG5A 3K8MA 1NUGA 2P8MA 3TJEH 4LSRH 4LVEA 1OWRM 4MMZC 3MCKB 2QHRH 5DEZA 1GGCH 1IC7H 1EBPA 5EWIL 4JRYE 4OZIB 4UB0L 3KPNB 4XPFH 1CFSA 5DJCB 2C3WA 2A74A 1LEGB 3LKOB 1MRFL 3IDNA 3ARBB 3CXDH 1VGEL 5E94A 4MQTB 3H2WA 2HYMA 3PWJB 4NKOA 4UBDD 4TULH 2O61A 3WD5L 3DRQA 5IW6A 1YEDB 1L0XA 4FQ2H 4LSUH 4ZODA 5GIRB 5H2BB 2YOCA 1QA9A 5DMGC 4OF6A 4G9DB 3EJJX 3GZKA 3JZ7A 4FTVD 1FIEA 3L3GA 5ISZB 4QRPB 4MHHG 3V4PL 5I1IL 2ICEA 2WUBH 5B3JE 4Q9RH 4KUCF 4WFFD 3BVNA 3L7EA 3K80A 3VG9B 4WU5A 1QHOA 3UZVB 4OGAC 3LRSB 4K8RH 1I3VA 5FKAB 1MIML 4W70A 3NFPB 3QWOA 3RVWC 1F58H 2G60L 4ODVH 3KYOB 1FAIH 5JTWA 3WS3B 1TNMA 1HQ4A 4WHYH 4PTTB 5FUCC 4FHBD 1G7MB 4LNVA 4JFPA 2QEJA 5CCKL 4ZAKC 3BN9D 1FFPA 4U3HA 5D1XB 5BO1H 2BSSB 2HRPH 1FL3B 5CJOL 5I0ZA 1FYTE 1RK0B 1WFTA 2FDBP 3CC5B 1MVUB 5GRVK 1N64H 2MHAB 3IJYA 3BPLB 3BP6A 2OTUB 1JYNA 1JE6A 2CRIA 2IH3A 4ZAKA 1RZJL 4M6ML 5EZOL 5FHAL 2H9GA 5DJ6A 4NQED 3DJ9A 1PYWB 4TVPL 4ZFZB 4HCRL 2DWEA 1A1OA 3W11D 3QCTL 1Q0YH 2R9HC 2NX5D 2EECA 2ADIB 4P4KD 1YPZF 3PP3K 5DMJB 5EIIA 4OF5A 5D7LE 2MQ3A 1JF1B 5EOQH 5ESVB 5F7EL 2C9AA 2BNRA 2BOBB 1HWGB 3P0VH 1KJ2H 3WLBB 1WFUA 4UV4H 4PRHE 1JZ8A 1IBGH 5D7SH 1FZOB 5I30H 4PJ5B 3QUYB 3GGWB 2DYPB 5HHOE 4Y4KD 4ODWA 2LU3A 4PJ9B 4R90H 4HUVB 8FABB 5C0BE 1VACB 3FFCA 4U1GC 2NY2D 5T5NG 3BWAB 1WFNA 2GSGB 3DO7B 1HINL 2Q7YA 4MXVF 2X44D 5SX5H 3DGCR 3FQWA 1D6EB 4UTBL 2XA8L 4HUMB 1E4WL 4HV8B 3V79C 3F7RA 5DQJA 5GGUB 3ALWA 1Y6MR 4A2LA 4ELMF 3C9NA 1XGYH 5DQ9B 1S7UB 4HFWB 3ES6A 5GS0C 1CWVA 1MI5B 1JV5B 1VFBA 2R2EA 2WZPD 2QQKH 1U92B 2GI7A 3CK0L 1YPZA 4OI9A 1Z5LA 3PV7A 4KK6C 5KG9A 1DQTA 3O41B 5E4EB 3F65A 2E7CA 5CILH 1JI2A 3OKYA 4OT1H 1OOAA 1F11A 2NPLX 2YSSB 2BDNH 4AMKL 5JNYA 2NY6D 2ENSA 3UBXI 4M7LL 5MERB 5AG9A 4JFQA 1VGKA 4POUB 1Z0NA 2NXZC 2P5WD 1FIGL 3MRNA 3TO2A 4Y4FC 1HSAB 1NC2A 3CAFA 3D0LB 3QA3A 3NPZB 4HQQL 1JNHA 2DLFH 2DQGL 5C08D 2W9DL 2PTTB 4E42A 3UROR 5ICZA 5IOPB 4QEGA 2E27L 1JHTA 3MRQA 4Z7OF 3M45A 4Y4FA 5I1DA 4P9HL 5E6IC 3TPUB 1NDMB 3MRBB 4LGPB 5DR5H 1K8DB 1NCDH 2JIXA 4R4NC 1OL0A 1NGQL 2Y36H 1F4XH 4X4XA 2MQ0A 5MENB 1WBZB 2AQ1A 2XZCL 3MO1B 1SVCP 1AGDB 1BIIB 1Z9OA 4ELMA 4PJBB 1YEKH 2VLJB 3B2UD 4PJEF 3THMH 1JNLL 3RI5K 4XNQB 4ZSOB 3LRGA 3H9SD 5E6IA 4U3XA 3TESA 2VDQH 4LCUB 5IB3A 5C86A 4NPYA 4YPGA 3TA3C 3MRGB 4UDUA 5HD8C 3MLYH 3OAZH 3TH4T 4M6NH 1HILA 5F6HJ 3CVHB 4HDIA 3GMOA 4HUWB 4OQ1A 4JFXA 3DTXA 1B9ZA 5IEHA 3RIAF 5EC1A 5TDNB 1BD2E 4QHNB 5DVNA 1Z9MA 3MFFA 2AS5M 4H1LG 1P1ZA 2EYRB 1TMCB 1BEYH 3TA3A 4OLWH 1CDHA 3DXAD 3LN4A 2HLFC 1YDPB 4JRWA 5T3ZE 4NKIL 1CT8B 4Y19D 2AVGA 3DARA 2EIZB 1MFAH 3KNBA 3WO4C 1UH4A 5LJYH 4WGVB 4HXAL 4B50A 5C09A 4QHUB 5FO7B 1QLEL 4Y88A 3ZDYE 3HMWH 4G6MH 4WTZA 4P2RB 3P4MA 3OAUH 4LK4A 3TJHC 1RJLA 2WIIB 1MF2H 4JFFA 3SKMA 5EU5A 2PTVA 5HHNB 1V3JA 2OK0L 3NH7H 3WNKA 4KMQA 4IRZL 4HIHA 1NGXB 1NCNA 1G9MC 3ARDB 4KGJA 5DLMH 1A4JB 2CUIA 5C92A 2IBZX 1OGAD 4IOIA 1DEDA 4PJEA 3IKKA 5IKCA 4X6FA 5AUMB 1YY9C 1U8IB 4UU9B 4Q0XL 2R29L 3SDCD 2HTKC 4DAGH 5DK0B 5CAYB 5GZOC 1IEBB 3DVIA 3B3IA 3RWEB 4E41E 3VD5A 1HOCA 2H45A 5JHDD 5HI3D 1QLFA 5LKNA 1WTGT 3EJZD 3VI4E 1WVZA 1I8MB 4LQFH 3HCVA 3K7UA 5F1IB 3V5HA 3BUTA 4YFEA 5C0AD 5CP3H 2DQFA 1NAMA 4FN0A 3U9PL 1JZ7A 4JO4L 3QUKB 5IW1A 1SEQH 3MLXH 4FQXD 4KK5C 5KVFL 3V4VH 4IJ3B 4MSWB 4JLRB 4GS7B 3V2AR 2P7TA 4PJFB 1RHFA 4O5LH 2AXGA 3PHQB 4GFTB 1B4JL 1XMWA 3BZEA 3QJHA 5FA4A 3HR6A 2FBOJ 3KYMA 1UM4H 4HJ0C 3VXQA 1PDKA 3CLEH 2VLRE 3MGOA 1QSEE 1A7NL 2ZNWA 5JMOC 2R0ZH 3FTGB 3D25B 1UM6L 5BRZB 2V2XB 4JG0H 2Z8WC 3T2PA 3VXSA 3VU2A 1LO0L 3ZKND 3WIHL 3HHRB 5TE4H 3B9KD 2LU7A 1AXTL 4Z5RB 5B39B 4NJAH 3AS2A 5DD5H 4F57H 1MJ8H 2J8UF 2YR3A 4GAJL 1OHQA 3BPOB 4PRPA 4X8XA 5DJDA 5F8RC 5I66B 1FLTX 1V7NL 4V1DA 5HJ3B 1RJYB 3S6CA 3UDWC 3U30B 2VXSL 2Z8RA 3IDYC 5I1GH 4MQ7B 3GSUA 3P73B 1OB1A 5C6TL 1CCZA 3S37H 3KPSA 1N5AB 2CIIA 2RIKA 1T3FA 2XKUA 3B8SA 2MNUA 1IL1B 1JPSL 3QO0B 2HMIC 2HTLD 3UTTE 3KLHC 4RFNC 2Z9TA 3QISA 2PR4L 4LVOC 4K7PH 3UDWA 1TETH 3LIZL 3VXRE 2FHBA 4RQQA 5E2WL 2VE6B 1REIA 1L0YA 3FO0L 3RNKB 3F12B 4EJ1C 1SJHB 2LQRA 4NYLB 4XP6L 3TM6A 3BEVB 1R5WA 1ZT4A 2BSRA 4X7EC 4QTIL 1BVLA 1S9KC 5TFSL 1T89C 5D5MF 4PJXB 2F53A 4D0DB 1DQLH 1LO2H 2H1PH 3LKQA 3OKMA 5DJ8B 3ECBB 4XVSH 3EO0A 4NCC1 1SQ2N 1EAJA 4OGZA 1P53A 4RFOL 5LXGL 5DK2A 3LKSA 1XIWC 4OCRH 5F6IC 1AD9A 1UB5A 2DM7A 2AK1L 2FLBT 3ZYOA 1F3JA 1ZEAH 2D4DA 1NFIB 2D0FA 1J86A 1T89A 2GJ6D 4PGDB 3PP4L 2E6JA 2J8UA 3ZHLA 1K8IB 3GIVB 4C56A 1WT5C 1DQMH 5TF0A 4IDJH 3TBYB 4CDHA 2X4OB 4PB9H 5A2FA 2HJLB 1JYVA 4XX1E 3LPGA 2R1XA 4YAQB 1XIWA 5KJRH 3U83A 3QDMD 5FUOH 4G80B 3E6HB 5JXAL 4KI5E 4JN2B 3OKDA 1EHLL 2Q86B 3HPLB 1R3JA 1T0MA 3RDTB 1WT5A 1N5YL 3QUZC 4PJIF 25C8H 1WISA 1SHMA 1XGTB 2E9JA 3MJ6A 2VXTL 5LGHL 4U6VL 2DQEH 1KGCD 2AV7A 4X0KB 3ARFD 1U42A 3AUVA 2ESVE 2FEDC 4WO4D 4LL9A 5DMKA 3UYOD 3QUZA 5CZVH 3CFCH 4DGIL 3OKNA 3NAAL 4FFVD 1MJUL 5D5MA 3EDJA 4JFEB 4HWNA 4AM0A 3CDFA 1I8IB 2ZG2A 3WBDA 4OFYA 2VWEE 3P30H 2LE9A 3QEQA 1IGYA 5F9WB 1I1YB 5DYOB 4XNMA 5GGQL 3V4UL 1UG9A 1A6ZB 1MIEL 1FO0B 3WFDH 1SYSB 2D2OA 3H3BC 4MA8L 1JYWA 4UNTA 3MXWL 4HGWA 4GG6F 1OSZA 3BQUB 2PYEE 2Y06H 1W8OA 4AQOA 5EOCL 3MA7B 3KLAB 4NRXB 4D3CL 4ZFOB 2W07A 4HEPG 1XF1A 5IF0A 3G6AB 1QOKA 2ERJC 2HG5B 5ADOL 2FSEA 1AGEA 4K3EL 4HK0A 4ONFL 1A9EB 2XFXB 3L3JB 3PWVA 4HJGB 4WEBH 4RGND 2JF1A 3W39A 2RJMA 4ELKB 2GAZB 3QFJD 4NQCE 1UH2A 5I1AA 4HWBH 4PJIA 4AG4L 2HJKB 3CX5J 15C8H 1B2WH 1WK0A 1CK0L 5TE6H 3LDBC 4KRLB 4FXGA 1HI6B 3Q6FB 4B7LA 1EHAA 4M00A 4KMTL 5DI8B 1GJIA 4XH2A 2VLME 4KUZL 4GRLC 3ZDXE 3AREC 5K9JL 1A7QH 2ZWLT 4WU7B 2MPAL 1A7OH 3ZHKA 4NFBA 2X4SA 3BDBA 1AY1H 1HIMH 4JQXC 1AR1C 3JWDL 3CU7A 1H0DB 2DWDB 2V7HA 3D39A 2ID5A 4GRLA 2MKLC 5L2KD 3AREA 4CVXA 1W0WB 2Q8AH 4GG6A 3DGGA 3BP4A 5E8DH 4M4PA 2VLKB 3B5TA 1KB5A 2ORBH 4JANA 5C7XH 2DOCA 2I9TB 3G04A 4JQXA 4PJ7B 2MFNA 2C3XA 3KG5A 5CJXC 5EBMA 1KTDB 4GW5B 3MUJA 2IMMA 1MHPH 1HH9A 3ARQA 2VQ1A 2YD4A 5F9OL 4ZNEA 5C0EB 1TJIL 4CADB 1GC1H 1B90A 4YGVB 4JFYB 2E3VA 3EBAA 3OB8A 2X6MA 1QRNB 4WTWA 3MBXH 4MS8D 3QDGE 3GSWA 2ICES 5CJXA 2EIBA 5DFVD 4M43H 4R4BA 5FDYA 3CUPA 1MHHB 4Z7WE 2VDOH 3SGJC 5SWSA 3RA7L 1QO3B 3FQTB 1G7PB 4X99A 4KHTH 1YMMD 4EOWL 3D1MC 4OM1L 2BY1A 1CGYA 4XBGA 1FH5L 4D9RE 5E56A 3RI5F 1UA6H 3SGJA 2CKNA 5I17B 3SO3C 3EO1A 4OGYL 3T08A 1FVCA 4BFIA 4GAYA 5I76B 4X5WA 5IVXF 1G9EA 3WLWC 3GSVB 4K2UL 4LP5A 2ARJA 3QI9B 1N6QH 2CLZA 4J3SA 3UTQA 2FJGA 3B9VA 2BHZA 3F62A 5E1AB 3WE6B 1UH3A 2B39A 5DMGD 1VGEH 4RIRB 3IDGA 5DJ2A 4JRXB 3EZ8A 4PRBA 4JREB 1ERNA 1FNFA 4PP2A 2LV4A 4NSKB 3G5ZA 3EOBA 1T0NB 4UIKL 5DD6A 1JF5A 5JW4M 3RWHA 1NFKA 3KVQA 4MD0A 5CLTA 5IVNA 3RUGE 1ZA3B 3ORJA 5IGXH 3KPQA 3L3OA 2VZUA 4LASL 4RA3A 2HVJA 4O2EB 3MROA 3KPMB 4GRWB 2AJZA 2I5YL 2PTUA 4HLZG 4HT1L 1KCLA 3NIDE 2DMCA 4JE4B 2V2TA 4FQIH 3MLWH 1CE1L 3NA9H 3WIFA 4NCDA 1CLOL 4Q9QH 1P4BL 4Q9CA 5KAQG 4Y1AE 4JRYB 3I9GH 3PQYA 4N0CC 4TNWF 1QTYT 1U8PB 1YUHA 1IQWH 1FZMB 4RGMC 5IEKB 3PGFL 5FDWA 3D9AL 1MNUL 4IIQB 4ETYA 3HZVA 4NNYA 3W5MA 5DUBB 5AYUH 5LAXA 4CW1B 3DX7B 4MAYB 1TJHL 1LO4L 3NIFF 4PJCB 2YS4A 4UT7H 1WAAE 4CN4A 1A9BA 3HE7B 3AM8C 2N7BA 2AJXL 4L4TE 5IVXA 2G5BB 1MCDA 1KLUB 4N9GB 3QEUA 1NGYA 1ZXQA 3CFEA 4DZBA 4LVHB 4M7ZC 3A67H 4WW2F 4G8FB 3JUZA 4L8DB 5EC2A 2BVOB 4JPIA 3LN9A 4IRJD 2R9HD 1EIBA 5HHPA 1CD0A 3AM8A 1AHWC 5KS9F 2JK5A 1WWWX 3L9RB 3GRWH 4M6MH 3U7YL 5C0ND 5EZOH 5FHAH 4DN3H 1WUNT 4FQQB 4OFPA 4KDVA 1G6RB 4FFZH 3SN6N 3LRHA 3ZKXB 2WBJD 1UVQA 3C6LD 3G5YB 2FO1A 1WQVT 3CLFH 2E7HA 3QCTH 1G7IA 3E6FB 1PG7H 4HXBL 4KY1L 5FK9B 3FQNA 1GXEA 4RAUA 4RGOH 4PJDB 1TZIA 1AHWA 4Z78B 2Z93B 1FN4A 1VDGA 2B1HH 2Q7NA 1MWAB 3LN5B 1CFQB 4DEPB 4MXQC 5TJWK 5DRXB 2A2QT 3PNWA 2NR6C 3ARZA 2UZYB 4BSJA 5D93B 5I18L 1JZ3A 3GHBL 3MRHA 2YD8A 2HVKB 3F7YB 4Z76A 4NRZB 5B38G 2PYFB 3QNYA 4ZFFA 5TQ2L 1FYTB 4LAQH 4ORGA 4WW2C 3INUL 4RRPG 1G7JA 2QADB 1LHZA 5GGVH 1H3VA 4DN4L 3L5XL 4F33B 1HEZB 4WFHD 4WUKH 2ED8A 2F54E 3QG6B 2PO6D 1DFBH 2YRLA 2VB5A 5F21B 4QRRD 1PEWA 1UEMA 4ODHL 4LKXB 4MDJA 4HMCA 2NZ9C 4YBLB 1BVZA 3DX6A 1HINH 4WW2A 3IVKB 4GW1A 3KLSA 2BVQB 3FRPG 4LIQL 4PJAB 5C07B 4L8BA 4APQB 1X7QB 5EO1B 2EE3A 5ACZB 5D7LB 3U4BH 1E4WH 2VDLH 4I4WA 4R4FL 3LV3B 2P5EA 1OPGH 2ZKHL 5KS9A 4WRLA 3O3BB 5HYJA 1Q9OA 3FCTB 4MNGE 4KRPB 5TH2A 2B7DT 2K7QA 4F7PA 5TGBA 5JORA 3R06B 2YK1L 1S7RB 5CEZE 3B9DA 2Y5TA 3SJVD 3ZKQD 3I6KA 4ETQB 4MA3A 3G08A 3KJ6H 3BT2H 4FQLH 4G6JL 5F96H 5HHOB 3QUXC 4XP9L 4NQDB 3TZVC 4EUPB 4IOFC 3CH1A 4AMKH 1U8OB 5C0BB 3VRIB 2DM3A 3K46A 2YHGA 1KUMA 2C5DC 3HE6D 5IHZA 3DX9A 1YNKL 3FB7B 5JW5B 4QYOA 2ZSVA 1JUFB 1FIGH 2VXUL 2NTSP 2ZUUA 5GSVB 3QUXA 3TZVA 3KDMB 4OCWL 4DCQA 4H0HB 4LFHD 1WCBA 1M7IA 3BRDA 2HT4C 3OKEB 2PXYB 5FO9A 2R8SH 3U6RA 4ODUB 1RHHB 1OTUD 2DQGH 2QKIA 2JB5H 3L3KB 3UAJD 4H26B 3MLRL 2EDTA 1IAIM 4ZD3H 1R5IA 4L29A 3EOAB 2YRPA 4AH2A 5JPNA 1IKNC 1Q9LB 1T1WA 2H2PC 3TNMA 1S9YB 1OLZA 4BKLB 3BZFA 3UTSA 3FZUC 2C1PB 2A6KB 4XPBL 5E9DD 3TA3D 4KJQC 1ZVSB 2CIKB 3HNTL 2EDJA 1L7IH 5M95B 3BEWB 4EIGB 1IKNA 4XNXH 1JNLH 4N68A 1HHKA 3UJJH 1J0HA 2X9YA 1OAXL 5ERWA 5E2VH 5IHUH 1DQDL 1IC4L 4G7YH 4JQIH 3I02A 5GGRY 4NN7C 4HH8A 1T20A 4D8PA 2ICWB 3NN8A 3CFJB 2AXJA 1QVOB 2VISA 3KJ4B 3QIWB 4S0TD 3HG1E 1BQSA 2P45B 2XWBB 4ZXBB 3BH8A 3GSRA 5D9SA 3O6KL 4BZ1H 1UKQA 2NW2B 3JWOL 1TDQA 1N2RA 3WFCL 3IYLW 2FBJH 5DJYB 3FQUB 1KPVA 2F74B 3CFKB 5MI0B 2QV2A 3PHSA 4YDJB 1FZKA 1OY3B 2VDNH 2YPVL 4EVNA 3VGBA 1G9NC 5DJ0B 1YZZA 4LLWB 5CMAB 1P7QA 5EN2A 1I7UB 1R3LB 4NBZB 4RMQA 4HG4J 3HZMA 4H8WH 1RK1A 1UQSB 3OJDB 3FT3A 4HXAH 4OQTH 3M1BA 4EI6A 1BLNA 1MLCB 4JHAL 5EUKB 5DRWA 4H1LA 5ALCL 2CGRL 4HPOH 1DVFD 4KKCC 5FUCE 1A14H 4OD3H 4R3SB 5E0QA 5SV4A 3FN0L 4CKVX 4PY8I 4LF3A 5TQ0L 4D9LL 2XI9A 4HFUL 4U1SA 1IM3A 5EZJB 5ESQB 3QAZB 3D3VA 3G5XA 5I73C 5J12B 3VD7A 4IEFB 1KG0A 2EC9U 4JM4L 2A77L 1H8NA 2ZOLA 5DT1L 3RL2B 4TOYH 3IFNL 1BD2B 2BSTA 3UXFA 5A3IC 3SDXE 5AZ2L 1JPTH 1U9KA 2NYYD 4NKMA 5H37G 1KLGA 5I19L 2R29H 1DN0B 5DHXB 1AO7A 1M7DB 2J3SA 3O6LL 4ZOBA 2W59A 3GNMH 4KK5D 1ORQB 1MAKA 1TCMA 5KANG 1JGLH 1KJMB 1BWMA 5GRUH 3FO9B 2A1WH 2Y7QA 3TCLA 4RWYL 3W9DA 1MRCL 1S7QA 4UOJA 3SCMB 1CVRA 4U1KB 3SKJL 2E9BA 1IM9D 5DO2C 1CTNA 3JV6A 4CNIA 1ONQB 4F15B 3MV9E 4OV5B 4LEXL 5A43C 2AJ3A 5C9KA 4V1DD 5I2IA 1OAZL 1RZGA 3FFCE 3NGBB 4U6HB 1SBSL 3LZFL 4H0IA 3MRCB 2OJEA 4BZ2L 5J13C 5CUSH 3B83A 4PRIA 5DVKA 5T1KD 3V7MA 1KT2B 1X5ZA 2Z91B 3L7FB 1T5XA 2Q76A 2UY7A 4B5EA 1W8NA 4NO0D 1T4KA 1MFCL 4XBPA 1NKRA 1CXLA 2E8YA 1E27B 4ZDHB 1JTTA 5JUEL 2IPKA 1LO0H 4I2XB 3QEGL 1NDGB 4J3OC 4LCCC 4NUGH 3PGDB 4POYA 2XZQL 3D85A 4IHOA 4QHMA 3QIUD 4GUPA 2F15A 5CD5D 1T04B 2EDYA 2XXCB 5I75B 4PG9A 2VZSA 3D2UB 2HMID 3QHZL 3TBSA 5HYSB 2R0LH 4S1SL 4UT6H 5BVJA 1BQLH 2OCFD 5F89B 2O93L 4LCCA 5L2JA 2KL6A 4Z7NE 2H32A 1T21B 5I8OH 5GGSY 1G7HA 1P4IH 4R97B 3KHOA 4PUBL 2CMRH 1DLFH 2Q3ZA 3HAEB 5H8DA 4XCNA 1JPSH 4Z7VB 4CJ0A 4ZFGL 2UUDH 4TRPH 4EXKA 4DQOL 1J0JA 2VLRB 3HZYA 4YHLL 1QSEB 2FWOA 1IGIH 1JPFB 2R23A 5EORH 2J88H 4DVBB 2D0GA 1S7XA 3ZT5A 1QKZL 4GOSA 4F2MB 5J9PA 1J1OH 2GITA 5AAWA 4UOW0 1DN2A 1F3RB 3VFSB 5TFSH 2G2RA 2CDFB 2J2ZA 2HFFA 4OZHF 3LD8B 4MXVE 1F6LL 4XP1H 3TEUA 2IALA 2MSPA 2HFEB 4HK3J 5DUMH 5JXEC 4YNYB 4RFOH 1TENA 4KXZH 5ANMA 2R2BB 2UWEE 4PY7B 1C12A 4NNXA 4QTHB 2AK1H 2X9WA 4F3FA 3PP4H 3H3PL 1JZ6A 1NMCC 5IB2A 2ITCB 3MREB 1RI8A 2DL2A 5JXEA 1I3GH 3IDMA 4UILL 1NSNL 5DFWH 1J8HA 1KN4L 3OGCB 4E41D 3P77B 3VI3E 4NC0B 4LCYB 4WDIA 2FNBA 2ZCLL 4YR6B 1LD9B 2FEDD 3MLVL 2IPUG 1BZ9A 2F58L 2V5SA 4G8GE 3K0WA 4WI4A 3O11A 3GMRA 4WJ5B 3D18B 5LGHH 2BVPB 5FFLA 4P2QA 2FYYA 5ICXB 5D1ZB 2NY6B 3C60D 3HMXH 4NZRH 1MEXH 5C09E 5D71L 1BF8A 4ZPTB 2FL5A 2Z35B 4YFLF