3MFJA

Bovine trypsin at 0.8 a resolution, restrained refinement
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Bovine trypsin at 0.8 A and role of restraints at ultra-high resolution
rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mfjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mfjA02
2XTTB 3KCGH 4GHTA 1CBWB 1QRZA 7GCHG 3LIWA 1OP0A 3MH4A 4FUHA 5EXLA 3RXCA 2VWLA 1O2NA 1GBAA 1OOKB 4ABDA 4MPWA 1YKTA 2VGCB 1W8BH 1J17T 1IQIA 1GHYH 1IQJA 1LCYA 1C1WH 1AWFH 1OSSA 1ANBA 1OYTH 2BQ6B 2ZZUH 3A85A 4X2VA 4ABBA 1VCWA 4I8HA 2P93A 4B71A 5EOKA 1UO6A 4A6LA 2JETB 4A7IB 1N6YA 5I25A 1B0EA 4OGXA 1EPTA 1YM0A 1LHGH 4IS5A 2AGEX 2AIQA 2HPQH 2VIOA 4YTAA 1SQTA 4ZHMU 1XM1A 1BMMH 1H9HE 1P04A 4CBOA 3OTJE 2BDBA 1MCVA 5IYTA 1DVAH 2WV4A 4FU9A 3E1XB 3B23B 4UD9H 3O8CA 2GX4A 4INHA 3H7TA 4NCYA 3RXMA 5K7RA 2OC8A 1UCYE 5F8ZA 5DP7A 5L6NH 2FOCA 1TNGA 3IWMA 1P8VC 4D7GA 4FUIA 5FXLA 3LJJA 1BA8B 1YPKH 1AVXA 5GCHG 3MTYA 9LPRA 1LHCH 5JBCS 4AORA 1C9TA 2EI7A 1UJ1A 2VNTA 2FOBA 2ZU5A 3H7OA 1G3CA 3Q3XA 1PPHE 1Y3WA 1AWHB 3GCOA 1KDQB 1EQ9A 1W13U 1ZOMA 4M7GA 4Y8ZA 4XDEA 1C1UH 2TGDA 2TGPZ 2XC4A 2W7UA 1VJ9U 4DG4A 4Y0ZE 1BMLA 1B7XB 2F9OA 3U69H 1VGCB 4ZAEA 1SVPA 3PTBA 1MTVA 1HAZB 2BLQA 3SV8A 1ELAA 3ZZAA 4LOYH 1HFDA 2QA9E 4UFEH 2JETC 1E36B 3VGCB 2ANWA 3SJKA 1T4UH 3WY8A 1DPOA 2DE8A 3KIDU 2J92A 1QB6A 2ODPA 3EA9A 2R0LA 2A7JA 3RM2H 2XRCA 1DY9A 2ZGJA 1VCPA 3UQVA 5T3HA 2K1QA 1C2KA 4D7FA 3ZYDA 3ITIA 4MPXA 1LMWB 4Q7ZA 1GBJA 1O3AA 5JB8S 4U30A 2RDLA 2P8OC 3GY6A 4I8GA 1EZUC 1AZZA 1VR1H 1QGFA 1TMUH 3SGAE 1V2OT 1BBRK 1FNIA 1RTLA 1S6FA 1K1LA 3QZQA 2ZI2H 3PMAB 1P2QA 1TE0A 1TNLA 1GHWH 1ZPCA 3HGPA 5ESBA 3MU8A 3EA7A 4JYTA 3UOPA 2FX6A 2BZAA 4D9QA 1OWHA 1PPZA 2XBWA 1O2JA 4LZ4B 1C4U2 2PW8H 4GPGA 2D26C 1FLEE 1HAHH 2FX4A 1G2MA 4VGCB 1RTFB 1V2TT 1YCPH 2PR3A 1ETSH 2ODYB 3MFJA 4DCDA 5LGOA 1P9SA 2SNVA 1TMBH 3HPTB 1DFPA 1O3JA 1EB1H 2FS9A 4MDSA 1AFEH 1SI5H 1VGCC 3ATLA 1PPEE 1BMNH 1NT1A 1H4WA 3K9XB 1RIWB 3SNBA 2FIRH 4NWLA 3RXLA 1IOEA 2BVRH 1FDPA 1DANH 2ODQA 4H6TA 5EPYA 1V6DA 4PROA 4WVPE 4K1TA 2GVFA 2Q6FA 3HATH 2Z9GA 5F8TA 3UWJH 2O8TA 2HGTH 3ZVCA 2RA0A 3OX7U 1F5LA 1W0YH 3UPEA 3OYPA 4FUBA 3GY8A 4ISNA 4IBLH 3QTVH 1ABIH 2TGTA 7LPRA 1JIMA 4O3TA 1P06A 2ZP0H 3TK6A 3UTUH 1XKBC 2VB0A 4E7RG 1W14U 4LK4A 1O39A 1Z8RA 2QXHA 4BAKB 3VB3A 3RXDA 1O3GA 6GCHF 1TNJA 4YOGA 2M5TA 4ABAA 1NRQH 1XVOA 1K1MA 4VGCC 4XOJA 5FBIA 2WUBA 4Q80A 4MNWA 1G3EA 3SO3A 1GBLA 1YF4A 3BTGE 1FV9A 1FJSA 2SFAA 2ZF0H 3MOCA 1F0RA 2XCFA 1OWKA 1TAWA 2B7DH 3GY5A 3A7ZA 1DWBH 3H5CB 3LDXH 4UDWH 1GHAF 2PKAB 3PV4A 1TGCA 1V2WT 4I8JA 3S69A 5DPAA 3TITA 4Q2KA 2DUCA 4CBNA 1MD8A 1F0UA 1OYQA 3DFJA 5C5NA 4YM9A 1YGCH 5A0AE 1HRTH 1EOLA 1QBVH 4CRAA 2ZGHA 2VIDA 1LVBA 1OP8A 3NZIA 4AN7A 1BTWA 3ZVEA 2WPHS 3LGVA 2TGAA 1DUEA 2P3UB 4LZ1H 1O37A 1ABJH 1NFWA 1UHBB 5LH8A 2QXGA 3V7TA 2A4QA 1EZSC 1RD3B 2ZWLH 2PV9B 1AKSA 2KAIA 1HCGA 1SGPE 2WPMS 2F9BH 3L3TA 1A5IA 1GI0A 3M7QA 2Z3EA 4X0WU 4AB9A 2VIVA 4IN1A 4WF8A 4K3JA 1O3LA 4JZEH 3UQOA 3P8GA 2QN5T 3RXBA 1A5GH 1NZQH 1KXCA 2JKHA 4A1XA 4NSYA 2FPZA 3TH3H 2WPKS 1ARCA 1F0TA 3E8LA 2A7HA 3SORA 1NPMA 4FU8A 1XUFA 1LHDH 1KXAA 2BVSH 1INCA 1YYY1 3FP7E 4BAOB 1O2YA 3V0XA 2GP9B 4BAMB 2NWNA 1XMNB 1O2XA 1C2GA 1C5PA 3KHVA 4RKOB 1LVOA 4Y11E 1TA6A 1CHGA 1EAUA 4I7YH 3BF6H 5A09A 2A31A 4CRDA 1GJDB 1T8LA 1UVOA 2BQ7B 2XC5A 3MHWU 3V13A 2Y82A 1O2ZA 3C27B 1UTNA 4JYUH 1AFQC 2G4UA 3EE0B 1ZYOA 2R0KA 3MMGA 1FY1A 1WQSA 2GZ9A 1TGBA 1ZGIA 4HGCA 1MTUA 4NGAH 2BD2A 1P3EA 1TX8A 1C5WB 1FIZA 2VWOA 3SU1A 1VJAU 1GJBB 1S5SA 5DGJA 3PM3A 4NIWA 1YPGH 1AUTC 1ESBA 2Y7ZA 2FLBH 3QGNB 2UUFB 5BRRE 5AVDA 3GYLB 3TH4H 1MKXK 1O3KA 1TNIA 7ESTE 2CV3A 1ID5H 4OGYA 3RXJA 3SNEA 2ESTE 1ELEE 2XWBI 6CHAC 4J2YB 2A4GA 1RS0A 4ABFA 3QK1A 1ELGA 4DY7B 1TPSA 1AE8H 1EAXA 3RXOA 1BJUA 2F91A 1FAKH 2SGEE 1SFIA 2Y5FA 5CE1A 1W7GH 1P2OA 5AFZH 1SHYA 1AVGH 4E05H 1MTSA 3LJOA 4OS6A 2BVXH 3MNCA 2FI3E 1L1NA 2YNAA 1C1QA 3ZZ7A 6GCHG 3E6PH 1DWCH 1XX9A 4I32A 2H2ZA 1UK3A 3SNDA 2O8UA 2UWLA 1K2I1 1SGCA 2A5AA 1G30B 3N7OA 1D9IA 1KTSB 3Q76A 4FUDA 2XW9A 5C67A 1Z8IB 1C2JA 3PO1C 1GWAA 1SQAA 2BOKA 2FOFA 1TGNA 2W26A 1F5RA 1HYLA 2OCVB 4TWWA 3SUEA 3TJVA 3LGTA 2BY5X 3QO6A 3U9AH 1QR3E 4AFSA 4Y79A 1TABE 2Y5GA 1P3CA 1MAYA 1ELBA 1GHAG 4X1QU 3E16B 3KQEA 4Y6DA 2OTVA 2P3TB 3P8FA 1O5DH 1T8OA 5T6DA 3T25A 3LU9B 3UNQA 1WUNH 1YPHE 3Q3KA 2Y5HA 3GDSA 2GT8A 2G52A 1OP2A 1UCYK 2ZFRH 3RUOA 2VH0A 1O5AB 2Z9KA 4Y10E 4CRBA 3UNRA 3IG6B 2WV5A 1O5GH 5SGAE 1WYKA 3O8DA 1V2VT 2BDIA 3RXFA 4SGAE 1SLUB 2BOHB 1BRCE 2HVXA 1YCPM 4UE7H 4X2YA 3MH5A 1DWEH 2BDYA 2GDDA 1DXWA 3U8TH 4Y0YE 2O8LA 5A8YA 2RCEA 1SFQB 1SGFG 2Y81A 4MNYA 5A0CA 1TLDA 2V3OH 3RU4E 3NKKA 1K1OA 3GCHC 2HPPH 5G4BA 5EGMA 2A32A 2V3HH 3DT0H 2AGGX 2J95A 1P12E 3L33A 5E8EH 3RLWH 3S9CA 1D6RA 1ZHRA 2XYAA 4YT7H 2PKSB 2XBXA 5FX5A 1GL1A 1SLVB 3VEQB 1IQHA 3B8JA 4K8YA 5C20A 8LPRA 3SUDA 8GCHF 1G32B 2ZDKA 3TNSA 1KDQA 2W7SA 2GCHF 4HTCH 1UTJA 1HIAA 4RKJB 3AW1A 1C2IA 1DS2E 1ZMNA 1N8OB 2VVCA 3GY3A 1HAVB 1QB1A 1ZTJA 2C90B 1KLJH 1GDUA 3KQDA 3MI4A 5LPFA 3SQEE 1PYTC 1W10U 3FZZA 2P94A 2ZDAH 4ABHA 1BBRH 4J1YA 1GHBF 1QY6A 1W12U 1Z7KA 2BM2A 5FAHA 1QJ1B 2VH6A 3RM0H 1NRPH 1WU1A 1GI6A 1GMCF 1MCTA 1GVKB 1HV7A 2ZHDA 3PYHA 2IOTA 1C5OH 2AFQB 3A89A 4JZDH 1T7CA 2QXIA 4BXWA 1GBEA 3A83A 3SI4H 1O2VA 1ZSKA 2ASUB 1V2JT 1ZMLA 2GZ7A 1GGDB 3MNSA 5DKMA 4BAHB 3BEUA 4ZUHA 1GBMA 2BD5A 4A1TA 4THNH 2UWPA 1HXFH 3EAJA 2AYWA 1SGEE 2BQWB 4ZKOU 3PROA 4NIYA 4OS1A 2CMYA 1K1NA 1CGJE 2ZNKH 1SPJA 3ZZ8A 3VB6A 2Z9LA 1GVLA 1C5ZB 1SB1H 1TQ0B 2BD3A 1O38A 4YLQH 4AX9H 2ZU3A 3QN7A 1C2LA 1GJ8B 4YLUA 1C5SA 1A1RA 2BZ6H 5ABWA 4Y71A 2SGQE 5C1YA 1O5EH 2H9EH 3RXPA 2F9PA 4JK5A 1A7SA 1PPFE 5DP3A 3SU0A 2GGVB 5EXMA 2ZTXA 1CU1A 1IAUA 3EYDA 1YC0A 4DVAU 5L2YH 2ZPQA 4OS4A 4DGJA 1GBBA 3LGIA 5HM2A 1GMHF 1ARBA 1SLWB 4CH8B 1D4PB 4ISIH 4NFFA 2ZO3H 4MG3A 1EJAA 5GIBA 1V2QT 1EATA 4AFUA 2A5IA 1ESTA 3A88A 1Z1IA 2WINI 3D49H 3FP6E 2I6QA 2ZU4A 1JMOH 4Q7YA 1C5QA 1DWDH 2O8MA 2A1DB 1IQGA 1O3FA 4MTBA 1QRWA 4OS5A 1LQDB 2NU3E 1TMTH 2C3SA 3RXEA 1EP6A 1ELCA 2GMTB 1CBWC 3HKIB 1TPOA 4E7NA 1AD8H 5CHAB 4B2AA 2OQ5A 2VGCC 1J16A 1TNKA 2H5DA 2GZ8A 4DOQA 2R2MB 3LC3A 3UR6A 3RXHA 3MNXA 3QZRA 1GGDC 1KIGH 2H1UA 1CE5A 2F9NA 4ZHAA 2XBVA 1NS3A 3UREA 5JPMH 2VJ1A 3FZDA 2EI6A 3LH3A 3BTDE 1EUFA 1V2MT 3M3SA 5LPEA 1FPCH 2ZGCA 1BUIA 1K22H 3S9AA 3VB5A 1IHTH 1QBOA 3A8DA 3ZZCA 1GI8B 1ZJDA 1CGIE 2A0QB 2VU8E 1C5TA 2VIWA 3MU1A 1O2WA 1S6HA 3TGKE 4ABGA 2PUXB 1L0ZA 1C2MA 2Y7XA 1NN6A 1S0QA 2BY9X 1VITF 3RC4A 1AVWA 1AY6H 3LGWA 1ELTA 4TPYA 4AZ2B 4BTIB 1TX7A 3BTME 2P95A 1ANDA 1TALA 8GCHG 1GI1A 3A87A 2A4RA 1G37A 1ETRH 1F92A 2GCHG 1O2LA 1UVUH 2PGBB 1M9UA 1QL7A 1AHTH 4XFQA 1SQOA 3B9FH 1TX6A 3SJ9A 1ORFA 2A45B 1EPTB 2B9LA 1BJVA 2ANMH 1C4Y2 4RSPA 3M35A 4YESB 2SNWA 1PJPA 1S83A 1F5KU 1GHBG 1XXDA 1BB0B 4ABJA 1W7XH 2GMTC 1A3BH 1Y5UT 3CS0A 4FUEA 1O3MA 1NRRH 2G5VA 4WMDA 5CHAC 1Z6EA 1GMCG 3ZZDA 1SHHB 4KELA 4UFGH 1O0DH 2QY0B 2GTBA 4D9RA 1G9IE 1GJ5H 5C1UA 4ZH8A 1Z8JB 4B1TA 2WPIS 1O5FH 3CENA 3DA9B 1H8DH 1ZLRA 2HNTE 2J34A 4R8TB 1QURH 5C3NA 2GDEH 2ZHFH 3VGCC 3W94A 1S85A 5BPEA 1C9PA 1O3PB 3ZZ6A 3Q77A 3PB1E 3IITA 3BN9A 3RC6A 3V12A 1HXEH 2FI4E 3CP7A 2OXSA 1FY8E 1GHZA 1C2DA 1EASA 5J4QA 3ENSB 3RP2A 5A0BA 3EQ0H 5E2OA 3V3MA 1LVMA 1LPGB 1YLCA 3T29A 2HLCA 1UVSH 1GJCB 2BLOA 2PSXA 5C2ZA 1MZAA 1UTPA 3OU0A 2FYRA 1H1BA 4ZXXH 1TBRH 1AGJA 1GJ6A 4NA9H 2IPHA 3M3TA 1THSH 5T6FA 1GMHG 4X6PA 1XUJA 2BD8A 1UVTH 1C5VA 2ZDNA 4CRGA 3KQCA 4F49A 2GD4B 1MKXH 1MU6B 3U8OH 1P0SH 4YOIA 3RXGA 4NG9H 5K0HA 3T5FH 2FODA 5DJ7A 1A0JA 2QF3A 3RDZA 4UFFH 3BIVH 4D8NA 2J2UA 3E90B 1O2KA 6ESTA 1AE5A 2F83A 3QLPH 1ELVA 4FVDA 2QGRA 1GBFA 5EPNA 1GDNA 1O32A 4GVUA 4X6NA 3BTEE 3F1SB 4BOHA 1JBUH 3EGKH 1QJ6B 1BQYA 1RIWC 3BEFB 2QC2A 5DP6A 3AAVA 1UTKA 3F9HA 4FUFA 5E2PA 3RXUA 1D6WA 1TPPA 2C4FH 4OS2A 3ELAH 3URCA 4MVNA 2VWNA 1V2LT 3ZV8A 3Q00A 3A8AA 4FXGH 3MO6A 1ZPBA 1UTQA 2NU1E 3RXRA 1MD7A 2XXLA 3MU4A 3CS7A 1XUIA 3GCNA 4OS7A 3SUGA 3FAOA 5GXPA 5DP5A 1T8NA 2BD4A 3O8BA 4XSKU 1UK4A 3NXPA 1Y3XA 1MAXA 2ZGXH 1BTXA 1T8MA 3RXIA 1P2MA 3ATWA 3FVFB 3RLYH 1ANEA 4R0IA 3KGPA 1QTFA 4I8KA 2QIQA 1UK2A 3F6UH 1VITG 3O8RA 3SGBE 1UCYH 2JH0D 4A92A 1Q2WA 2F9VA 3DUXH 2FWWA 1Y5AT 2YOLA 2NU2E 1H9IE 1VITH 4NZQA 1FAXA 4ASHA 2AMPA 1TOMH 4X6MA 2PUQH 4ABEA 2W3IA 4BANB 5GJ4B 4NIXA 1SGDE 1Z1JA 1YCPK 4ISOA 3PWBA 3F9EA 4TY7A 3LOXA 2UWOA 2BTCE 1AB9B 5EU8A 4AOQA 1LVYA 3ATMA 3JZ1B 1K9OE 1RXPA 4IMQA 2ZKSA 4KGAA 5I46H 3P92A 3KF2A 3MU5A 2BHGA 2IJOB 1LO6A 1MH0A 4NSVA 1NFYA 4JZ1A 1AQ7A 1FZZA 1ZTLA 1YPHC 1GDQA 1O2UA 2J9NA 2STBE 4O9VA 4X2XA 3SZNA 2Z6BD 1G36A 2H9TH 1O2TA 4CHAB 1D3QB 1QA0A 4KKDA 1UTLM 3SJIA 5IDKA 3BIUH 3RXSA 1GCDA 2DE9A 1F2SE 1EZXC 1DITH 4K1SA 1W0ZU 2C8WB 5ETXA 2UUKB 3D23A 1BRAA 2B0FA 3FFGA 3T28A 1UMAH 1IQLA 1CA8B 2R3UA 1CGHA 2B8OH 3A7WA 2QF0A 1HB0B 3U1IB 3PLKA 3PTNA 1WBGB 2ZECA 3BV9B 4INLA 1EX3A 3T26A 1PPGE 1ZGVA 1LHEH 1C2EA 2D2DA 1C1PA 3SHCH 3A8BA 1FUJA 1GCTB 3A7VA 3NCLA 4IGDA 1ZZZA 4H6SB 3MH7A 1IQFA 1C5RA 5DO4H 1PPBH 1OX1A 2BDGA 4WY3A 1P09A 2OD3B 3SOSA 4DIIH 1EOJA 2GCTB 2QXJA 3P95A 1GJ9B 1BZXE 1LKBA 1BTYA 1DT2A 1MKWK 4CREA 1MBQA 1L1GA 1V2KT 4MQAA 2BXUH 3SU2A 5HYOA 1FMGA 2OQUA 2A2QH 2AEIH 1O5BB 1H8IH 2W3KA 4MPUA 1FN8A 3TK5A 3A7YA 1FXYA 1ACBE 2HRVA 1FIWA 2Y80A 1AKSB 4GAWA 1E34B 4KTCA 2KAIB 3TJUA 1KLIH 3LC5A 3T62A 3A82A 2FO9A 1GL0E 1K1JA 1TBQH 1XXFA 4KTUA 2LPRA 2UUYA 1DXPA 1C1OA 1ZRKA 1XUHA 2AH4X 3K2UA 4CHAC 1O2HA 1A3EH 1WOFA 4B75A 3M5MA 4Y7BA 1WV7H 3ZVAA 2Y6TA 2ALPA 5HMAA 4O97A 1YPEH 2ZDVH 2G5NA 2QCYA 2GV6A 2R9PA 3FP8E 4CH2B 2CN0H 2B5TB 1Y3UA 5EW2H 5DK1A 1Z71A 2FXRA 3RXTA 4WWYA 5GWZA 1RRKA 1B0FA 4LXBH 4YOJA 3RMLH 1GG6B 3BG4B 2ZTZA 2AERH 1EJNA 1SSXA 1FQ3A 2PLXA 2PHBA 5DG6A 1LHFH 1C1MA 3M5OA 3BTHE 1AN1E 4MLFB 5L30H 1NFUA 2Z7FE 3S0NA 1FPHH 4ESTE 3NWUA 1WTHD 1JXPA 2FS8A 2QV1A 1MQ6A 1TOCB 4YT6H 3URDA 2BY8X 3GDVA 4Y8YA 4X1RU 1HDTH 3STJA 1HAOH 2J94A 2V35A 3VB7A 1IQNA 1SGFA 3K6YA 1AUJA 3PLPA 3NK8A 3SUFA 1C4V2 1QHRB 2Z3CA 3RMMH 1DY8A 4JZIA 3TJOA 3TLOA 4U2WA 5ESTE 1O2RA 1CO7E 1OWDA 2BLWA 2BDAA 2AIPA 3RXQA 1CVWH 5JBBS 3SNAA 4X8TH 3M7TA 5EW1H 1TRYA 1FN6A 4U01A 1AZ8A 1S0RA 1EZQA 3UUZA 2Q6GA 1NFXA 7KMEH 1ZR0A 1WCZA 3ZYEA 3SU5A 1J8AA 1SGYE 4KTSA 2FZZA 3ZV9A 1NO9H 3QWCH 3PMBB 1PQAA 1D3DB 5L2ZH 1QCPA 3D62A 3ATIA 4BAQB 1BRUP 1C2HA 2WPLS 1LQEA 5FPSA 1P10A 4ISLA 1YPMH 1GBDA 1AO5A 1P05A 4ZKSU 1AI8H 3RU4T 1TB6H 3BTTE 9ESTA 1K1IA 4AGKA 5JDUB 1V2NT 4K8BA 2XBYA 3KQBA 3C1KA 2P3FH 1A61H 1AIXH 2O8WA 4Y76A 1GMDF 1S84A 3MO3A 4NIVA 1O30A 1DDJA 2Z3DA 1BTZA 4Q7XA 4A1VA 1XVMA 3BG4C 1G3DA 2LNCA 1GI5A 3HK6B 1O3DA 2AMDA 4TY6A 1P57B 3E0NB 3P17H 2BLVA 4B2BA 2ZFSA 1EAIA 1HJAB 1TWXB 1QIXB 3K65B 1DLEA 4NA7A 2CF8H 5JBAS 1O2IA 1VZQH 2J4IA 3VXFH 3GY4A 1O35A 5AHGH 1DUAA 5GPIB 1PQ7A 2CXVA 2AS9A 1G2LA 1WSSH 1AMHA 2R3YA 3KNXA 1A0HB 2ZFQH 3VXEH 4XBBA 2PKSC 2YNBA 2EC9H 1ZPZA 2FTMA 5E0GA 3TH2H 1TBZH 3TNTA 4GUXA 5F6MA 1UVPA 3HK3B 3PLBA 2WYGA 1B5GH 2I6SA 3FANA 3R3GB 1THPB 1GBTA 2EI8A 1BCUH 3RXAA 2TPIZ 2ZU1A 2VWMA 1HPGA 3R0FA 4X2WA 5A8XA 1N8OC 4BNRA 1MZDA 5JYIA 4K5ZA 1NESE 3PMJA 2V0BA 2PFEA 1WTGH 4GLYA 1YPLH 5DP4A 2P8OB 2GKVE 2RA3A 1CT4E 1T32A 3SV9A 3OY6U 1O3HA 2CGAA 2ZQ2A 2P59A 1KXFA 3E0PB 3RXVA 2WUCA 3DHKH 3SU6A 1TA2A 2FDAA 1EP5A 3S9BA 1V2PT 3M7UA 2FP7B 2VVUA 2F3CE 3NPSA 3M36A 3TIUA 2R2WU 2ZG0H 2HALA 2HNTC 1SMFE 1O36A 4WH8A 2ULLA 3STIA 3SV6A 1Q3XA 1O2MA 4X1SU 3AASA 3OY5U 4B76A 1QL9A 2ILNA 3VPKA 1TQ7B 5A8ZA 1TYNA 5TJXA 2OUAA 1ETTH 2ZFTA 1IQMA 1BIOA 1HIAB 1SC8U 1SOTA 4K2YA 1V2UT 4O03A 3S7KB 2FM2A 1NC6A 5EG4A 3A81A 1KY9A 1HJAC 4AYYB 1RJXB 5JBTA 1ZHMA 4FUCA 1MTNB 5A2MH 1NROH 4NZLA 1C1TA 3KEEA 4SGBE 3U8RH 4K60A 1J15A 3T2NA 4MNVA 1DOJA 2FOMB 2FOEA 3ZZBA 1AU8A 2G55A 3E91A 3TU7H 3QTOH 1E37B 3UFAA 1HNEE 5HM9A 1BOQA 3SN8A 4B2CA 4NA8A 4X8VH 2OBOA 1NU9A 3UR9A 4BTTB 3RU4D 3A80A 2BD9A 3MWIU 5B6OA 4UFDH 2FOHA 1OPHB 3TJNA 3TGIE 1QQ4A 1O3IA 1IQEA 3LT3A 1C5UA 2ZDMA 2QYIA 1V3XA 1RGQA 4IN2A 1FI8A 1OWEA 1E0FD 1QQUA 2TBSA 1HAPH 4DJZB 3GYMA 1SG8B 5C1XA 1GI4A 1UTOA 2OC7A 2F9UA 3BSQA 1SLXB 2PKAA 2ZGBH 2ZPSA 3LPRA 4FVBA 1A5HA 1WQVH 2BY7X 2V6NA 4X1NU 1QNJA 1TRMA 1F7ZA 1OXGA 1GPZA 1L4ZA 2BXTH 2PWXA 1QRXA 2C8ZB 2ZFPH 1PFXC 2GT7A 1HAXB 2BDHA 1C1RA 2FI5E 5EQSA 3NUMA 1O2OA 3M61U 3ZZ9A 3UNSA 4DT7B 1GMDG 3PWCA 3GY7A 5EQRA 3A86A 2Z9JA 2CHAB 4TYDA 2A7CA 3M3VA 1UHBA 5HXFA 1C5MD 3ZVBA 2FMJA 3LGUA 4X1PU 1TGSZ 2A5KA 1MTNC 1CQQA 4IMZA 4KP0A 2D8WA 4D76A 2OLGA 1SGNE 1TONA 3UWIA 1SL3A 1HAGE 1TGTA 3M5LA 3HKJB 2ZDLA 1KLTA 2STAE 1C5XB 2OINA 4DW2U 1J9CH 2ANYA 1GI7B 1BMAA 4JYVH 1HUTH 2G51A 3SW2B 4A5TS 4U32A 4F4OC 1MU8B 1J14A 1V2ST 3UY9A 3L6PA 3P70B 1E38B 4QT8C 1P01A 3QX5H 3SNCA 1LTOA 2C93B 3S7HB 1BHXB 4ABIA 2Q1JA 2O9QA 3RMOH 1ZTKA 1O2QA 1OWJA 3AVZA 2WPJS 1GI3A 3GCTF 3ZZ4A 2ZA5A 2ZEBA 1NRSH 1THRH 3M5NA 4X6OA 3QGJA 1BDAA 1EPTC 3D65E 3LH1A 4GSOA 1CHOF 5E0HA 2ZTYA 4K1EA 1TIOA 1KSNA 3ZVFA 1O2SA 5TCAA 1K21H 3ZZ5A 5TCCA 1LDTT 4HI3A 3SU3A 4H42U 2PSYA 4TWYA 1Y3YA 1C5NH 1L2EA 1MKWH 3P8OA 4BXSA 1MTWA 1NRNH 1EKBB 1O34A 1C1VH 2HNTF 1HGTH 1XUKA 3BEIB 4FU7A 5LPRA 4Z0KA 4GCHF 2BX4A 3GDUA 1RTKA 4CR9A 1BITA 1E35B 2BDCA 2CJIA 2CHAC 2ZQ1A 1CSOE 1DSUA 4AB8A 4FUGA 3SJ8A 4DIHH 4WMEA 2G4TA 4AFQA 1QB9A 1F0SA 1CT2E 1Y3VA 1Z8GA 4NFEA 2G8TA 1L1JA 5E0JA 3BTQE 4AFZA 1D3TB 1PYTD 3SV2H 1YP9A 2XCNA 1DICA 4X8UH 3ESTA 5H4IB 1C1NA 4AYVB 2BY6X 1Q31A 1NTPA 1Y8TA 1O5CB 3P8NA 2XNIA 1NU7B 1P2KA 1AFQB 1P9UA 2SGAA 6LPRA 1G3BA 3P6ZB 3EDXB 4CR5A 3ATKA 4AG2A 1ZRBA 1FY5A 3TK9A 4ZXYH 1BBRE 1P02A 1QFKH 2Z9IA 3TPIZ 1CT0E 3G01A 1EAWA 2ALVA 1JOUB 3RC5A 1V2RT 5FCRA 2G00A 1O3OA 3I29A 2THFB 5FPYA 2ZCKP 5FCKA 2BB4A 1HAIH 2ZHQH 1ELDE 1ESAA 4K69A 1W2KH 1BT7A 1SOZA 3A7XA 2VIQA 4Y7AA 1XKAC 1PQ5A 1ANCA 4AG1A 1GJAB 5F8XA 3U1JB 1ZSLA 2PTNA 1FONA 2C8XB 5FX6A 6CHAB 2SGDE 3BTFE 2ZC9H 3SV7A 3RMNH 4IC5A 1D3PB 3BG8A 4H4FA 5F03A 2Q6DA 1Y5BT 2BMGB 2FESH 3LKWA 1LKAA 1O2PA 3ODDA 2H9HA 4CRFA 4UONA 4XBDA 3W95A 3E3TA 1C5YB 4Z6AH 2P16A 5PTPA 1BRBE 1TFXA 2ZCHP 4DURA 5JB9S 2ZFFH 1SGTA 2J38A 2A4OA 1P2JA 1ZMJA 1BTHH 4ZROA 3PO1B 2IN2A 1GJ4H 1NM6A 2SGPE 3HGNA 4FUJA 1O33A 2EEKA 1EXFA 1GBHA 1LPZB 2HOBA 3MU0A 5T6GA 1H9LB 1O31A 1QBNA 1DLKB 1P2NA 4JMYA 1O3BA 1U6QA 3PMHB 1KXBA 1A0LA 3A7TA 3QDZB 3GICB 2ZIQH 2A2XH 3KN2A 1PQ8A 1GBIA 1K28D 1FY3A 5DP9A 2AGIX 2FOAA 1YPJH 2FTLE 3AW0A 2VINA 1GBKA 4XE4A 7GCHF 3SU4A 3I78A 3RXKA 3SHAH 1GHVH 4TPIZ 2PGQB 3LGYA 5C5OA 2TRMA 4O3UA 1RFNA 1BTUA 1GVZA 3Q3YA 5GDSH 1EB2A 3UOUA 3GY2A 4JZFH 3A84A 2ANKH 1SR5C 3LONA 1YLDA 1SGQE 3GCTG 4WXVA 4WJG2 2WYJA 1A46H 1KTTB 5CMXH 1PPCE 1CHOG 2D1JA 1IQKA 1HAVA 4MNXA 2ZPRA 3VFEA 1DE7H 1Z6JH 4NWKA 1P2IA 2CF9H 5HGGA 3ZVDA 1AB9C 1N6XA 3GCHB 1IHSH 2GV7A 1MUEB 1XUGA 3OSYA 2PTCE 3BTWE 3KL6A 4ZHLU 4HFPB 2JH6D 3GISB 1W11U 4GCHG 1HJ9A 1OKXA 1GI9B 1YBWA 2ZCLP 4WXIA 1O2GH 5FHTA 4YO9A 4ZKNU 1L4DA 5EODA 4ZMAH 1LPKB 2QAAA 1KYNA 4IW4E 1W3CA 3VB4A 1CA0B 2ZU2A 4BTUB 1OWIA 2AMQA 1ELFA 4CRCA 4XBCA 1C2FA 3F68H 2FLRH 4GHQA 4I33A 4MPVA 1NY22 5GCHF 1C5LH 1P03A 2H6MA 4RN6A 4YZUA 4HZHA 1ZJKA 2NU4E 3BTKE 4I31A 2ZHEH 1TRNA 3T27A 4X8SH 1SGRE 1HLTH 1JRTA 1A2CH 1T4VH 4INKA 1O3NA 1DSTA 1O3EA 1GCTC 2FYQA 3K6ZA 4JCNA 4B74A 1OS8A 4WH6A 4WMFA 2FEQH 2TIOA 2HWLB 3I77A 1C1SA 1HBTH 3DFLA 1BHXF 1GI2A 1FY4A 1O3CA 3AAUA 1K1PA 1JWTA 3JZ2B 3MH6A 1TPAE 2GCTC 5AF9H 2VVVA 2OC1A 1S82A 1UTMA 1ZSJA 1DM4B 3MO9A 8KME2 1JRSA 2SGFE 2RG3A 3SQHE 1KXDA 4I8LA 2BD7A 2FOGA 2NU0E 1EJMA 5FPTA 3MYWA 2EA3A 2UUJB 5EXNA 5AFYH 2G81E 1ZHPA 3DD2H 5FBEA 2OP9A 1MBMA 1QL8A 1MMJN 3ZZ3A 1WAYB 4UEHH 1QJ7B 1DX5M 4E06H 8ESTE 1KXEA 1QA7A 1T31A 1MQ5A 3F9FA 3ODFA 3QUMP 2BX3A 2OBQA 5EQQA 5DP8A 3TVJB 3MNBA 1HJ8A 1HAYB 2H5CA 1SGIB 1Y59T 1GHXH 3ZVGA 3M37A 5J4SA 3SJOA 4JK6A 1CA0C 3UIRA 2ZHWH 3EA8A 3GOVB 4IC6A 1BTPA 3TGJE 1GBCA 1GJ7B 1JIRA 2VIPA 4AGJA 4B73A 2BYAX 3SBKA 1S81A 1N1LA 3F9GA 3U98H 3SGQE 1VCQA 1P11E 4ZKRU 1TNHA 3SI3H 2Z94A 3A8CA 1X7AC 2OC0A 2JH5D 2XC0A 4Y8XA 1GG6C 2XWAA 2C8YB 1A4WH 1SBWA 4ISHH 2W5EA
chains in the Genus database with same CATH superfamily
2XTTB 3OTPA 3KCGH 4GHTA 1CBWB 1QRZA 7GCHG 3LIWA 1OP0A 3MH4A 4FUHA 5EXLA 3RXCA 2VWLA 3OFND 1O2NA 1GBAA 1OOKB 4ABDA 4MPWA 1YKTA 2VGCB 1W8BH 1J17T 1IQIA 1GHYH 1IQJA 1LCYA 1C1WH 1AWFH 1OSSA 1ANBA 1OYTH 2BQ6B 2ZZUH 3A85A 4X2VA 4ABBA 1VCWA 4I8HA 2P93A 4B71A 5EOKA 1UO6A 4A6LA 2JETB 4A7IB 1N6YA 5I25A 1B0EA 4OGXA 1EPTA 1YM0A 1LHGH 4IS5A 2AGEX 2AIQA 2HPQH 2VIOA 4YTAA 1SQTA 4TSFD 4ZHMU 1XM1A 1BMMH 1H9HE 1P04A 4CBOA 3OTJE 3N7DA 2BDBA 5GNDA 1MCVA 5IYTA 1DVAH 2WV4A 4FU9A 3E1XB 3B23B 4UD9H 3O8CA 2GX4A 4INHA 3H7TA 4NCYA 3RXMA 5K7RA 2OC8A 1UCYE 5F8ZA 5DP7A 5L6NH 2FOCA 1TNGA 3IWMA 1P8VC 4D7GA 4FUIA 5FXLA 3EE7A 3LJJA 4P02A 1BA8B 1YPKH 1AVXA 5GCHG 3MTYA 9LPRA 1LHCH 5JBCS 4AORA 1C9TA 2EI7A 1UJ1A 2VNTA 2FOBA 2ZU5A 3H7OA 1G3CA 3Q3XA 1PPHE 1Y3WA 1AWHB 3GCOA 1KDQB 1EQ9A 1W13U 1ZOMA 4M7GA 4Y8ZA 4XDEA 1C1UH 2TGDA 2TGPZ 2XC4A 2W7UA 1VJ9U 4DG4A 4Y0ZE 1BMLA 1B7XB 2F9OA 3U69H 1VGCB 5KEDA 4ZAEA 1SVPA 3PTBA 1MTVA 1HAZB 2BLQA 3SV8A 1ELAA 3ZZAA 4LOYH 1HFDA 2QA9E 4UFEH 2JETC 1E36B 3VGCB 2ANWA 3SJKA 1T4UH 3WY8A 1DPOA 2DE8A 3KIDU 2J92A 1QB6A 2ODPA 3EA9A 2R0LA 2A7JA 3RM2H 2XRCA 1DY9A 2W6JD 2ZGJA 1VCPA 3UQVA 5T3HA 2K1QA 1C2KA 4D7FA 3ZYDA 3ITIA 4MPXA 1LMWB 4Q7ZA 1GBJA 1O3AA 5JB8S 4U30A 2RDLA 2P8OC 3GY6A 4I8GA 1EZUC 3OEED 4TT3D 1AZZA 1VR1H 1QGFA 1TMUH 3SGAE 1V2OT 1BBRK 1FNIA 1RTLA 1S6FA 1K1LA 3QZQA 2ZI2H 3PMAB 1P2QA 1TE0A 1TNLA 1GHWH 1ZPCA 3HGPA 5ESBA 3MU8A 3EA7A 1SQRA 4JYTA 3UOPA 2FX6A 2BZAA 1BMFD 4D9QA 1OWHA 1PPZA 2XBWA 1O2JA 4LZ4B 1C4U2 2PW8H 4GPGA 2D26C 1FLEE 1HAHH 2FX4A 1G2MA 4VGCB 1RTFB 1V2TT 1YCPH 2PR3A 1ETSH 2ODYB 3MFJA 4DCDA 5LGOA 1P9SA 2SNVA 5CDFE 1TMBH 3HPTB 1DFPA 1O3JA 1EB1H 2FS9A 4MDSA 1AFEH 1SI5H 1VGCC 3ATLA 2J98A 2KCOA 1PPEE 1BMNH 1NT1A 1H4WA 3K9XB 1RIWB 3SNBA 2FIRH 4NWLA 3RXLA 1IOEA 2BVRH 1FDPA 1DANH 2ODQA 4H6TA 5EPYA 1V6DA 4PROA 4WVPE 4K1TA 2GVFA 2Q6FA 3HATH 2Z9GA 5F8TA 3UWJH 2O8TA 2HGTH 3ZVCA 2RA0A 3OX7U 1F5LA 1W0YH 3UPEA 3OYPA 4FUBA 3GY8A 4ISNA 4IBLH 3QTVH 1ABIH 2TGTA 7LPRA 1JIMA 4O3TA 1P06A 2ZP0H 3TK6A 3UTUH 1XKBC 2VB0A 4E7RG 1W14U 4LK4A 1O39A 1Z8RA 2QXHA 4BAKB 3VB3A 3RXDA 1O3GA 6GCHF 1TNJA 4YOGA 2M5TA 4ABAA 2QF5A 1NRQH 1XVOA 1K1MA 4VGCC 4XOJA 5FBIA 2WUBA 4Q80A 4MNWA 1G3EA 3SO3A 1GBLA 1YF4A 3BTGE 1FV9A 1FJSA 2SFAA 2W6ID 2ZF0H 1F0RA 3MOCA 4F48B 2XCFA 1OWKA 1TAWA 2B7DH 3GY5A 3A7ZA 1DWBH 3H5CB 3LDXH 4UDWH 1GHAF 2PKAB 3PV4A 1TGCA 1V2WT 4I8JA 3S69A 5DPAA 3TITA 4Q2KA 2DUCA 4CBNA 1MD8A 1F0UA 1OYQA 3DFJA 5C5NA 4YM9A 1YGCH 5A0AE 1HRTH 1EOLA 1QBVH 4CRAA 2ZGHA 2VIDA 1LVBA 1OP8A 3NZIA 4AN7A 1BTWA 3ZVEA 2WPHS 3LGVA 2TGAA 1DUEA 2P3UB 4LZ1H 1O37A 1ABJH 3DCLA 1NFWA 1UHBB 5LH8A 2QXGA 3V7TA 2A4QA 1EZSC 1RD3B 2ZWLH 2PV9B 1AKSA 2KAIA 1HCGA 1SGPE 2WPMS 2F9BH 3L3TA 1A5IA 1GI0A 2HVYB 3M7QA 2Z3EA 4X0WU 4AB9A 2VIVA 4IN1A 4WF8A 4K3JA 1O3LA 3F3BA 4JZEH 3UQOA 2M2AA 2QN5T 3P8GA 3RXBA 1A5GH 1NZQH 1KXCA 5HIYA 2JKHA 4A1XA 4NSYA 2FPZA 3TH3H 2WPKS 1ARCA 4HG6A 1F0TA 3E8LA 2A7HA 3PV2A 3SORA 1NPMA 4FU8A 1XUFA 1LHDH 3U28C 1KXAA 4YXWD 2BVSH 1INCA 1YYY1 3FP7E 4BAOB 2YMSB 1O2YA 3V0XA 2GP9B 4BAMB 2NWNA 1XMNB 1O2XA 1SKYE 1C2GA 1C5PA 3KHVA 4RKOB 1LVOA 4Y11E 1TA6A 1CHGA 1EAUA 4I7YH 3BF6H 5A09A 2A31A 4CRDA 1GJDB 1T8LA 1UVOA 1QZ8A 2BQ7B 2XC5A 3MHWU 2Y82A 3V13A 1O2ZA 3C27B 1UTNA 4JYUH 1AFQC 2G4UA 3EE0B 1ZYOA 2R0KA 2J97A 3MMGA 1FY1A 1WQSA 2GZ9A 1TGBA 1ZGIA 4HGCA 3H09A 1MTUA 4NGAH 2BD2A 1P3EA 1TX8A 1C5WB 1FIZA 2VWOA 3SU1A 1VJAU 1GJBB 1S5SA 5DGJA 3PM3A 4NIWA 1YPGH 1AUTC 5C17A 1ESBA 2Y7ZA 5T1VA 2FLBH 3QGNB 2UUFB 5BRRE 5AVDA 3GYLB 3TH4H 1MKXK 1O3KA 1TNIA 2EQNA 7ESTE 2CV3A 1ID5H 4OGYA 3RXJA 3SNEA 2ESTE 1ELEE 2XWBI 6CHAC 4J2YB 2A4GA 1RS0A 4ABFA 3OE7D 3QK1A 1ELGA 4DY7B 1TPSA 1AE8H 1EAXA 3RXOA 2AHME 1BJUA 2F91A 1FAKH 2SGEE 1SFIA 2Y5FA 5CE1A 1W7GH 1P2OA 5AFZH 1SHYA 1AVGH 4E05H 1MTSA 3LJOA 4OS6A 2BVXH 3MNCA 2FI3E 1L1NA 2YNAA 1C1QA 3ZZ7A 6GCHG 3E6PH 1DWCH 1K0HA 1XX9A 4I32A 2H2ZA 1UK3A 3SNDA 2O8UA 2UWLA 1K2I1 1SGCA 2A5AA 1G30B 3N7OA 1D9IA 1KTSB 2LELA 3Q76A 4FUDA 2XW9A 2YMSC 5C67A 1Z8IB 1C2JA 2EY4C 3PO1C 1NBME 3KYGA 1GWAA 1SQAA 4FETA 2BOKA 1YY3A 2J5UA 2FOFA 1TGNA 3N7EA 2W26A 1F5RA 1HYLA 2OCVB 4TWWA 3SUEA 3TJVA 3LGTA 2BY5X 3QO6A 3U9AH 1QR3E 4AFSA 4Y79A 1TABE 2Y5GA 1P3CA 1MAYA 1ELBA 1VKYA 2XOKD 1GHAG 4X1QU 3E16B 1FX0B 3KQEA 4Y6DA 2OTVA 2P3TB 3P8FA 1O5DH 1T8OA 3F2HA 5T6DA 3T25A 3LU9B 3UNQA 1WUNH 1YPHE 3Q3KA 2Y5HA 3GDSA 2GT8A 2G52A 1OP2A 1UCYK 2ZFRH 3RUOA 2VH0A 1O5AB 2K0QA 3DSGA 2Z9KA 4Y10E 4CRBA 3UNRA 3IG6B 2WV5A 1O5GH 5SGAE 1WYKA 3O8DA 1V2VT 2BDIA 3RXFA 4SGAE 1SLUB 2BOHB 1BRCE 2HVXA 1YCPM 4UE7H 4X2YA 3MH5A 4XRNA 5HIZA 1DWEH 2BDYA 2GDDA 1DXWA 3U8TH 4Y0YE 2O8LA 5A8YA 2RCEA 1SFQB 1SGFG 2Y81A 4MNYA 2KFWA 1TLDA 2V3OH 5A0CA 3RU4E 3NKKA 1K1OA 3GCHC 2HPPH 5G4BA 5EGMA 2A32A 2V3HH 3DT0H 2AGGX 2J95A 1P12E 3L33A 5E8EH 3RLWH 3S9CA 1D6RA 1ZHRA 2XYAA 4YT7H 2PKSB 2XBXA 5FX5A 1GL1A 1SLVB 3VEQB 1IQHA 3B8JA 4K8YA 5C20A 8LPRA 3SUDA 8GCHF 1G32B 2ZDKA 3TNSA 1KDQA 2W7SA 2GCHF 4HTCH 1UTJA 1HIAA 4RKJB 3AW1A 1C2IA 1DS2E 1ZMNA 1N8OB 2VVCA 3GY3A 2L6OA 1HAVB 1QB1A 1ZTJA 2C90B 1KLJH 1GDUA 3KQDA 3MI4A 5LPFA 3SQEE 1PYTC 1W10U 3FZZA 2P94A 2ZDAH 4ABHA 1BBRH 4J1YA 1GHBF 1QY6A 1W12U 1Z7KA 2BM2A 5FAHA 5HKKD 1QJ1B 2VH6A 3RM0H 1NRPH 1WU1A 1GI6A 1GMCF 1MCTA 1GVKB 1HV7A 2ZHDA 3PYHA 2IOTA 1C5OH 2AFQB 3A89A 4JZDH 1T7CA 2QXIA 4BXWA 1GBEA 3A83A 3SI4H 1O2VA 1ZSKA 3N99A 2ASUB 1V2JT 1ZMLA 2GZ7A 1GGDB 2PP6A 3MNSA 5DKMA 4BAHB 3FO8D 3BEUA 4ZUHA 1GBMA 2BD5A 4A1TA 4THNH 2UWPA 1H8ED 1HXFH 3EAJA 2AYWA 1SGEE 2BQWB 4ZKOU 3PROA 4NIYA 4OS1A 2CMYA 1K1NA 1CGJE 2ZNKH 1SPJA 3ZZ8A 3VB6A 2Z9LA 1GVLA 1C5ZB 1SB1H 1TQ0B 2BD3A 1O38A 2JJ1D 2VBCA 4YLQH 4AX9H 2ZU3A 3QN7A 1C2LA 1GJ8B 4YLUA 1C5SA 1A1RA 2BZ6H 5ABWA 4Y71A 2SGQE 5C1YA 1O5EH 1UW7A 2H9EH 3RXPA 2F9PA 4JK5A 1A7SA 1PPFE 5DP3A 3SU0A 2GGVB 5EXMA 2ZTXA 4ACBA 1CU1A 1IAUA 3EYDA 1YC0A 2IPQX 4DVAU 5L2YH 2ZPQA 4OS4A 4F55A 4DGJA 1GBBA 3LGIA 5HM2A 1GMHF 1ARBA 1SLWB 4CH8B 1D4PB 4ISIH 4NFFA 2ZO3H 4MG3A 1EJAA 5GIBA 1V2QT 1EATA 4AFUA 2A5IA 1ESTA 3A88A 1Z1IA 2WINI 3D49H 3FP6E 2I6QA 2ZU4A 1JMOH 4Q7YA 1C5QA 1DWDH 2O8MA 2A1DB 1IQGA 1O3FA 4MTBA 1QRWA 4OS5A 1LQDB 2NU3E 3F0PA 1TMTH 4RT0A 2KR7A 2C3SA 5C0TA 3RXEA 1EP6A 1ELCA 2GMTB 1CBWC 3HKIB 1TPOA 4E7NA 1AD8H 5CHAB 4B2AA 2OQ5A 2VGCC 1J16A 1TNKA 2H5DA 2GZ8A 4DOQA 2R2MB 3LC3A 3UR6A 3RXHA 3MNXA 3QZRA 1GGDC 1KIGH 2H1UA 1CE5A 2F9NA 4ZHAA 2XBVA 1NS3A 3UREA 5JPMH 2VJ1A 3FZDA 2EI6A 3LH3A 3BTDE 2CK3D 1EUFA 1V2MT 3M3SA 5LPEA 1FPCH 2ZGCA 1BUIA 1K22H 3S9AA 3VB5A 1IHTH 1QBOA 3A8DA 3W1EA 3ZZCA 1GI8B 1ZJDA 1CGIE 2A0QB 2VU8E 1W0KD 1C5TA 2VIWA 3MU1A 1O2WA 1S6HA 3TGKE 4ABGA 2PUXB 1L0ZA 1C2MA 2QF4A 2Y7XA 1NN6A 1S0QA 2BY9X 1VITF 3RC4A 1AVWA 1AY6H 3LGWA 1ELTA 4TPYA 4AZ2B 4BTIB 1TX7A 3BTME 2P95A 5FL7D 1ANDA 1TALA 4FOUC 1GI1A 3A87A 8GCHG 2A4RA 1G37A 1ETRH 1F92A 2GCHG 1O2LA 1UVUH 2PGBB 1M9UA 1QL7A 1AHTH 4XFQA 1SQOA 3B9FH 1TX6A 3SJ9A 1ORFA 2A45B 1EPTB 2B9LA 1BJVA 2ANMH 1C4Y2 4RSPA 3M35A 4YESB 1YWUA 2SNWA 1PJPA 1S83A 1F5KU 1GHBG 1XXDA 1BB0B 4ABJA 1W7XH 2GMTC 1A3BH 1Y5UT 3CS0A 4FUEA 1O3MA 1NRRH 2G5VA 4WMDA 5CHAC 1Z6EA 1GMCG 3ZZDA 1SHHB 4KELA 4UFGH 1O0DH 2QY0B 2GTBA 4D9RA 1G9IE 1GJ5H 5C1UA 4ZH8A 3F2GA 1Z8JB 4B1TA 2WPIS 1O5FH 3CENA 3DA9B 4B6EA 1H8DH 1ZLRA 2HNTE 2J34A 4R8TB 1QURH 5C3NA 2GDEH 2ZHFH 3VGCC 3W94A 1S85A 5BPEA 1C9PA 1O3PB 3ZZ6A 3Q77A 3PB1E 3IITA 3BN9A 3RC6A 2KM0A 3V12A 1HXEH 2FI4E 3CP7A 4AC9A 2OXSA 1FY8E 1GHZA 1C2DA 1EASA 5J4QA 3ENSB 3RP2A 5A0BA 3EQ0H 5E2OA 3V3MA 1LVMA 1LPGB 1YLCA 3T29A 2HLCA 1UVSH 2HLDD 1GJCB 2BLOA 2PSXA 5C2ZA 1MZAA 1UTPA 3OU0A 2FYRA 1H1BA 4ZXXH 1TBRH 1AGJA 1GJ6A 4NA9H 2IPHA 3M3TA 5CHBA 1THSH 5T6FA 1GMHG 4X6PA 5IK2D 1XUJA 2BD8A 1UVTH 2WSSD 1C5VA 2ZDNA 4CRGA 3KQCA 4F49A 2GD4B 1MKXH 1MU6B 3U8OH 1P0SH 4YOIA 3RXGA 4NG9H 5K0HA 3T5FH 2FODA 3WWFA 5DJ7A 1A0JA 2QF3A 3RDZA 4UFFH 3BIVH 4D8NA 2J2UA 3E90B 1O2KA 6ESTA 1AE5A 2F83A 3QLPH 1ELVA 4FVDA 3AK5A 2QGRA 1GBFA 5EPNA 1GDNA 1O32A 4GVUA 4X6NA 3BTEE 3F1SB 4BOHA 1JBUH 3EGKH 1QJ6B 1BQYA 1RIWC 3BEFB 2QC2A 5DP6A 3AAVA 1UTKA 3F9HA 4FUFA 5E2PA 3RXUA 1D6WA 1TPPA 2C4FH 4OS2A 3ELAH 3URCA 4MVNA 1WXRA 2VWNA 1V2LT 3ZV8A 3Q00A 3A8AA 4FXGH 3MO6A 1ZPBA 1UTQA 2NU1E 3RXRA 1MD7A 2XXLA 3MU4A 3CS7A 1XUIA 3GCNA 4OS7A 3SUGA 3FAOA 2WV9A 5GXPA 5DP5A 1T8NA 2BD4A 3O8BA 4XSKU 1UK4A 3NXPA 1Y3XA 1MAXA 2ZGXH 1BTXA 1T8MA 3RXIA 1P2MA 3ATWA 3FVFB 3RLYH 1ANEA 4R0IA 3KGPA 1QTFA 4I8KA 2QIQA 1UK2A 3F6UH 4ZCNA 1VITG 3O8RA 3SGBE 1UCYH 5C0UA 2JH0D 2J98B 4A92A 1Q2WA 2F9VA 3DUXH 2FWWA 1Y5AT 2YOLA 2NU2E 1H9IE 1VITH 4NZQA 3PRDA 1FAXA 4ASHA 2AMPA 1TOMH 4X6MA 2PUQH 4ABEA 2W3IA 3OEHD 4I86A 4B6FA 4BANB 5GJ4B 4NIXA 1SGDE 1Z1JA 1YCPK 4ISOA 3PWBA 3F9EA 4TY7A 3LOXA 2UWOA 2BTCE 1AB9B 5EU8A 4AOQA 1LVYA 3ATMA 3JZ1B 1K9OE 1RXPA 4IMQA 2ZKSA 4KGAA 5I46H 3P92A 3KF2A 3MU5A 2BHGA 2IJOB 1LO6A 1MH0A 4NSVA 1NFYA 4JZ1A 1AQ7A 1FZZA 1ZTLA 1YPHC 1GDQA 1O2UA 2J9NA 2STBE 4O9VA 4X2XA 3SZNA 2Z6BD 1G36A 2H9TH 1O2TA 4CHAB 1D3QB 1QA0A 4KKDA 1UTLM 3SJIA 5IDKA 3BIUH 3RXSA 1GCDA 2DE9A 1F2SE 1EZXC 1DITH 4K1SA 1W0ZU 2C8WB 5ETXA 2UUKB 3D23A 1BRAA 2B0FA 3FFGA 3T28A 1UMAH 1IQLA 1CA8B 2R3UA 1CGHA 2B8OH 3A7WA 2QF0A 1HB0B 3U1IB 3PLKA 3PTNA 1WBGB 2ZECA 3BV9B 4INLA 1EX3A 3T26A 1PPGE 1ZGVA 1LHEH 1C2EA 2D2DA 1C1PA 3SHCH 3A8BA 1FUJA 1GCTB 3A7VA 3NCLA 4IGDA 1ZZZA 4H6SB 3MH7A 1IQFA 1C5RA 5DO4H 1PPBH 1OX1A 2BDGA 4WY3A 1P09A 2OD3B 3SOSA 4DIIH 1EOJA 2GCTB 2QXJA 3P95A 1GJ9B 1BZXE 1LKBA 1BTYA 1DT2A 1MKWK 4CREA 1MBQA 1L1GA 1V2KT 4MQAA 2BXUH 3SU2A 5HYOA 1FMGA 2OQUA 2A2QH 2K8IA 2AEIH 4ACAA 2V3MA 1O5BB 1H8IH 2W3KA 4MPUA 1FN8A 3TK5A 3A7YA 1FXYA 3GS9A 1ACBE 2HRVA 1FIWA 2Y80A 1AKSB 4GAWA 1E34B 4KTCA 2KAIB 3TJUA 1KLIH 3LC5A 3T62A 3A82A 2FO9A 1GL0E 2KCYA 1K1JA 1TBQH 1XXFA 3CNRA 4KTUA 2LPRA 2UUYA 1DXPA 1C1OA 1ZRKA 1XUHA 2AH4X 3K2UA 4CHAC 1O2HA 1A3EH 1WOFA 4B75A 3M5MA 4Y7BA 1WV7H 3ZVAA 2GJGA 2Y6TA 2ALPA 5HMAA 4O97A 1YPEH 5EIYA 2ZDVH 2G5NA 2QCYA 2GV6A 2R9PA 3FP8E 4CH2B 2CN0H 2B5TB 1Y3UA 5EW2H 1W0JD 2QE7D 1Z71A 2FXRA 5DK1A 3RXTA 4WWYA 5GWZA 1RRKA 1B0FA 4LXBH 4YOJA 3RMLH 1GG6B 3BG4B 2ZTZA 2AERH 1EJNA 1SSXA 1FQ3A 2PLXA 2PHBA 5DG6A 1LHFH 1C1MA 3M5OA 3BTHE 1AN1E 4MLFB 5L30H 1NFUA 2Z7FE 3S0NA 1FPHH 4ESTE 3NWUA 1WTHD 1JXPA 2FS8A 2QV1A 1MQ6A 1TOCB 4YT6H 3URDA 2BY8X 3GDVA 4Y8YA 4X1RU 1HDTH 3STJA 1HAOH 2J94A 2V35A 3VB7A 1IQNA 1SGFA 3K6YA 1AUJA 3PLPA 3NK8A 3SUFA 1C4V2 1QHRB 2Z3CA 3RMMH 1DY8A 4JZIA 3TJOA 3TLOA 4U2WA 5ESTE 1O2RA 1CO7E 1OWDA 2BLWA 2BDAA 2RDEA 4P00A 2AIPA 3RXQA 1CVWH 5JBBS 3SNAA 4X8TH 3M7TA 5EW1H 1TRYA 1FN6A 4U01A 1AZ8A 1S0RA 1EZQA 3UUZA 2Q6GA 1NFXA 7KMEH 1ZR0A 1WCZA 3ZYEA 3SU5A 1J8AA 3NRLA 1SGYE 4KTSA 2FZZA 2OK5A 3ZV9A 1NO9H 3QWCH 3PMBB 1PQAA 1D3DB 2IJD1 5L2ZH 1QCPA 3D62A 3ATIA 4BAQB 1BRUP 1C2HA 2WPLS 2WZQA 1LQEA 5FPSA 1P10A 4ISLA 1YPMH 1GBDA 1AO5A 3ZIAD 1P05A 4ZKSU 1AI8H 3RU4T 1TB6H 3BTTE 9ESTA 1H8HD 1K1IA 3KQ5A 4AGKA 5JDUB 1V2NT 4K8BA 2XBYA 3KQBA 2F4LA 3C1KA 2P3FH 1A61H 1AIXH 2O8WA 4Y76A 1GMDF 1S84A 3MO3A 4NIVA 1O30A 1DDJA 2Z3DA 1BTZA 4Q7XA 4A1VA 1XVMA 3BG4C 1G3DA 2LNCA 1GI5A 3HK6B 1O3DA 2AMDA 4TY6A 1P57B 3E0NB 3P17H 2BLVA 4B2BA 2ZFSA 1EAIA 1HJAB 1TWXB 1QIXB 3K65B 1DLEA 4NA7A 2CF8H 5JBAS 1O2IA 1VZQH 2J4IA 3VXFH 3GY4A 1O35A 5AHGH 1DUAA 5GPIB 1PQ7A 2CXVA 2AS9A 1G2LA 1WSSH 1AMHA 2R3YA 3KNXA 1A0HB 2ZFQH 3VXEH 1KMHB 4XBBA 2PKSC 2YNBA 2EC9H 1ZPZA 2FTMA 5E0GA 3TH2H 1TBZH 3TNTA 4GUXA 5F6MA 4M9FA 1UVPA 3HK3B 3PLBA 2WYGA 1B5GH 2I6SA 3FANA 3R3GB 1THPB 1GBTA 2EI8A 1BCUH 3RXAA 2TPIZ 2ZU1A 2VWMA 1HPGA 3R0FA 4X2WA 5A8XA 2F43B 1N8OC 2RFKC 4BNRA 1MZDA 5JYIA 4K5ZA 1NESE 3PMJA 2V0BA 3SYJA 2PFEA 1WTGH 4GLYA 1YPLH 5DP4A 2P8OB 2GKVE 2RA3A 1CT4E 1T32A 3SV9A 3OY6U 1O3HA 1MABB 2CGAA 2ZQ2A 2P59A 1NBMD 1KXFA 3E0PB 3RXVA 2WUCA 3DHKH 3SU6A 1TA2A 2FDAA 1EP5A 3S9BA 1V2PT 3M7UA 2FP7B 2VVUA 2F3CE 3NPSA 3M36A 3TIUA 2R2WU 5EJLA 2ZG0H 2HALA 2HNTC 1SMFE 1O36A 4WH8A 2ULLA 5KGOA 3STIA 3SV6A 1Q3XA 1O2MA 4X1SU 3PRBA 3AASA 3OY5U 4B76A 1QL9A 2ILNA 3VPKA 1TQ7B 5A8ZA 1TYNA 3FKSD 5TJXA 2OUAA 1ETTH 2WPDD 2ZFTA 1IQMA 1BIOA 1HIAB 1SC8U 1SOTA 4K2YA 1V2UT 4O03A 3S7KB 2FM2A 1NC6A 5EG4A 3A81A 1KY9A 1HJAC 4AYYB 1RJXB 5JBTA 1ZHMA 4FUCA 1MTNB 5A2MH 3VG8A 1NROH 4NZLA 1C1TA 3KEEA 4SGBE 3U8RH 4K60A 1J15A 3T2NA 4MNVA 1DOJA 2FOMB 2FOEA 3ZZBA 1AU8A 2G55A 3E91A 3TU7H 3QTOH 1E37B 3UB0A 3UFAA 3F0OA 1HNEE 5HM9A 1BOQA 3SN8A 4B2CA 4NA8A 4X8VH 2OBOA 1NU9A 5EJZA 3UR9A 4BTTB 3RU4D 3A80A 2BD9A 3MWIU 5B6OA 4UFDH 2FOHA 1OPHB 3TJNA 3TGIE 5B6LA 1QQ4A 1O3IA 1IQEA 3LT3A 1C5UA 2ZDMA 2QYIA 1V3XA 1RGQA 4IN2A 1FI8A 1OWEA 1E0FD 1QQUA 2TBSA 1HAPH 4DJZB 3GYMA 1SG8B 4ASUD 5C1XA 1GI4A 1UTOA 2OC7A 2F9UA 3BSQA 1E1QD 1SLXB 2PKAA 2ZGBH 2ZPSA 3LPRA 4FVBA 1A5HA 4DT4A 1WQVH 2BY7X 2V6NA 4OM9A 4X1NU 1QNJA 1TRMA 1F7ZA 1OXGA 2KX4A 1GPZA 1L4ZA 2BXTH 2PWXA 1QRXA 2C8ZB 2ZFPH 1PFXC 2GT7A 1HAXB 2BDHA 1C1RA 2FI5E 3UAIC 2YMSD 3OAAD 5EQSA 3NUMA 1O2OA 3M61U 3ZZ9A 3UNSA 4DT7B 1GMDG 3PWCA 3GY7A 5EQRA 3A86A 2Z9JA 2CHAB 1E1RD 2A7CA 3M3VA 4TYDA 1UHBA 5HXFA 1C5MD 3ZVBA 2FMJA 5KECA 2XNDD 3LGUA 4X1PU 1TGSZ 2A5KA 1MTNC 1CQQA 4IMZA 4KP0A 2D8WA 4D76A 2OLGA 1SGNE 1TONA 5EJ1A 3UWIA 1SL3A 3FOAA 1HAGE 1E79D 1TGTA 3M5LA 3HKJB 2ZDLA 1KLTA 2STAE 1C5XB 2OINA 4DW2U 1J9CH 2ANYA 1GI7B 1BMAA 4JYVH 1HUTH 1WDIA 2G51A 3SW2B 4A5TS 4U32A 4F4OC 1MU8B 1J14A 1V2ST 3UY9A 3L6PA 3P70B 1E38B 4QT8C 3SZEA 1P01A 3QX5H 3SNCA 1LTOA 2C93B 3S7HB 1BHXB 4ABIA 2Q1JA 2O9QA 3MQKC 3RMOH 1ZTKA 1O2QA 1OWJA 3AVZA 2WPJS 1YLNA 1GI3A 3GCTF 3ZZ4A 2ZA5A 2ZEBA 1NRSH 1THRH 3M5NA 4X6OA 3QGJA 1BDAA 1EPTC 3D65E 3LH1A 4GSOA 1CHOF 5E0HA 2ZTYA 4K1EA 1TIOA 1KSNA 3ZVFA 4Z1MD 1O2SA 5TCAA 1K21H 3ZZ5A 5TCCA 1LDTT 4HI3A 3SU3A 4H42U 2PSYA 4TWYA 1Y3YA 1C5NH 1L2EA 1MKWH 3P8OA 4BXSA 1MTWA 1NRNH 1EKBB 1O34A 1C1VH 2HNTF 1HGTH 1XUKA 3BEIB 4FU7A 5LPRA 4Z0KA 4GCHF 2BX4A 3GDUA 1RTKA 4CR9A 1BITA 1E35B 2BDCA 2CJIA 4XD7D 2CHAC 2ZQ1A 1CSOE 1DSUA 4AB8A 2JIZD 4FUGA 3SJ8A 4DIHH 4WMEA 2G4TA 4AFQA 1QB9A 1F0SA 1CT2E 1Y3VA 1Z8GA 3PV5A 4NFEA 1OHHD 2G8TA 1L1JA 5E0JA 3BTQE 4AFZA 1D3TB 1PYTD 3SV2H 3WWBA 1YP9A 2XCNA 1DICA 4X8UH 3ESTA 5H4IB 2KCPA 1C1NA 4AYVB 2BY6X 1Q31A 1NTPA 1Y8TA 1O5CB 3P8NA 2XNIA 1NU7B 1P2KA 1AFQB 1P9UA 2SGAA 6LPRA 1G3BA 3P6ZB 3EDXB 4CR5A 3ATKA 4AG2A 1ZRBA 1FY5A 4RT1A 4ZXYH 3DSPA 1BBRE 3TK9A 1P02A 5C94A 1QFKH 2Z9IA 3TPIZ 1CT0E 3G01A 1EAWA 2ALVA 1JOUB 3RC5A 1V2RT 5FCRA 2G00A 1O3OA 3I29A 2THFB 5FPYA 2ZCKP 5FCKA 2BB4A 1HAIH 2ZHQH 4Q63A 1ELDE 1ESAA 4K69A 1W2KH 4RI0A 1SOZA 1BT7A 3A7XA 2VIQA 4Y7AA 1XKAC 1PQ5A 5F53A 1ANCA 4AG1A 1GJAB 1COWD 5F8XA 3U1JB 1ZSLA 2PTNA 1FONA 2C8XB 5FX6A 6CHAB 2SGDE 3BTFE 2ZC9H 3SV7A 3RMNH 4IC5A 1D3PB 3BG8A 4H4FA 5F03A 2Q6DA 3KYFA 1Y5BT 2BMGB 2FESH 3LKWA 1LKAA 1O2PA 3ODDA 5DSFA 2H9HA 4CRFA 4UONA 4XBDA 3W95A 3E3TA 1C5YB 4Z6AH 2P16A 5PTPA 1BRBE 1TFXA 2ZCHP 4DURA 5JB9S 2ZFFH 1SGTA 2J38A 2A4OA 1P2JA 1ZMJA 1BTHH 4ZROA 3PO1B 2IN2A 1GJ4H 1NM6A 2SGPE 3HGNA 4FUJA 1O33A 2EEKA 1EXFA 1GBHA 1LPZB 2HOBA 3MU0A 5T6GA 1H9LB 1O31A 1QBNA 1DLKB 1P2NA 4JMYA 1O3BA 1U6QA 3PMHB 1KXBA 2JJ2D 1A0LA 3A7TA 3QDZB 3GICB 2ZIQH 2A2XH 3KN2A 1PQ8A 1GBIA 1K28D 2WHXA 1FY3A 5DP9A 2AGIX 2FOAA 1YPJH 2FTLE 3AW0A 2VINA 1GBKA 2JDID 4XE4A 2V7QD 7GCHF 3SU4A 3I78A 1EFRD 3RXKA 3SHAH 1GHVH 4TPIZ 2PGQB 3LGYA 5C5OA 2TRMA 4O3UA 1RFNA 1BTUA 1GVZA 3Q3YA 5GDSH 1EB2A 3UOUA 3GY2A 4JZFH 3A84A 2ANKH 1SR5C 3LONA 1YLDA 1SGQE 3GCTG 4WXVA 4WJG2 2WYJA 1A46H 1KTTB 5CMXH 1PPCE 1CHOG 2D1JA 1IQKA 1HAVA 4MNXA 2ZPRA 3F2FA 3VFEA 1DE7H 1Z6JH 4NWKA 1P2IA 2CF9H 5HGGA 3ZVDA 1AB9C 1N6XA 3GCHB 1IHSH 2GV7A 1MUEB 1XUGA 3OSYA 2PTCE 3BTWE 3KL6A 4ZHLU 4HFPB 2JH6D 3GISB 1W11U 4GCHG 1HJ9A 1OKXA 1GI9B 1YBWA 2ZCLP 4WXIA 1O2GH 5FHTA 4YO9A 4ZKNU 1L4DA 5EODA 4ZMAH 1LPKB 2QAAA 1KYNA 4IW4E 1W3CA 3VB4A 1CA0B 2ZU2A 4BTUB 1OWIA 2AMQA 1ELFA 2KZ4A 4CRCA 4XBCA 4Q4LA 1C2FA 3F68H 2FLRH 4GHQA 4I33A 4MPVA 1NY22 5GCHF 5DN6D 1C5LH 1P03A 2H6MA 4RN6A 4YZUA 4HZHA 1ZJKA 2NU4E 3BTKE 4I31A 2ZHEH 1TRNA 3T27A 4X8SH 1SGRE 1HLTH 1JRTA 1A2CH 1T4VH 4INKA 1O3NA 1DSTA 1O3EA 1GCTC 2FYQA 2KCAA 3K6ZA 4JCNA 4B74A 1OS8A 4WH6A 4WMFA 2FEQH 2TIOA 2HWLB 3I77A 1C1SA 1HBTH 3DFLA 1BHXF 1GI2A 1FY4A 1O3CA 3AAUA 1K1PA 1JWTA 3JZ2B 3MH6A 1TPAE 2GCTC 5AF9H 2VVVA 2OC1A 1S82A 3DSOA 1UTMA 1ZSJA 1DM4B 3MO9A 8KME2 1JRSA 2SGFE 2RG3A 3SQHE 1KXDA 4I8LA 2BD7A 2FOGA 2NU0E 1EJMA 5FPTA 3MYWA 2EA3A 2UUJB 5EXNA 5AFYH 2G81E 1ZHPA 3DD2H 5FBEA 2OP9A 1MBMA 1QL8A 1MMJN 3ZZ3A 1WAYB 4UEHH 1QJ7B 1DX5M 4E06H 8ESTE 1KXEA 1QA7A 1T31A 1MQ5A 2LP6A 3F9FA 3ODFA 3QUMP 2BX3A 2OBQA 5EQQA 5DP8A 3TVJB 3MNBA 3FN8A 1HJ8A 1HAYB 2H5CA 1SGIB 1Y59T 1GHXH 3ZVGA 3M37A 5J4SA 3SJOA 4JK6A 1CA0C 3UIRA 2ZHWH 3EA8A 3GOVB 4IC6A 1BTPA 3TGJE 2L74A 1GBCA 1GJ7B 1JIRA 2VIPA 4AGJA 4B73A 2BYAX 3SBKA 1S81A 1N1LA 3F9GA 3U98H 3SGQE 1VCQA 1P11E 4ZKRU 1TNHA 3SI3H 2Z94A 3A8CA 1X7AC 2OC0A 2JH5D 2XC0A 4Y8XA 1GG6C 1S6LA 2XWAA 2C8YB 3WW7A 1A4WH 1SBWA 4ISHH 2W5EA
chains in the Genus database with same CATH topology
2XTTB 3KCGH 4GHTA 1CBWB 1QRZA 7GCHG 3LIWA 1OP0A 3MH4A 4FUHA 5EXLA 3RXCA 2VWLA 1O2NA 1GBAA 1OOKB 4ABDA 4MPWA 1YKTA 2VGCB 1W8BH 1J17T 1IQIA 1GHYH 1IQJA 1LCYA 1C1WH 1AWFH 1OSSA 1ANBA 1OYTH 2BQ6B 2ZZUH 3A85A 4X2VA 4ABBA 1VCWA 4I8HA 2P93A 4B71A 5EOKA 1UO6A 4A6LA 2JETB 4A7IB 1N6YA 5I25A 1B0EA 4OGXA 1EPTA 1YM0A 1LHGH 4IS5A 2AGEX 2AIQA 2HPQH 2VIOA 4YTAA 1SQTA 4ZHMU 1XM1A 1BMMH 1H9HE 1P04A 4CBOA 3OTJE 2BDBA 1MCVA 5IYTA 1DVAH 2WV4A 4FU9A 3E1XB 3B23B 4UD9H 3O8CA 2GX4A 4INHA 3H7TA 4NCYA 3RXMA 5K7RA 2OC8A 1UCYE 5F8ZA 5DP7A 5L6NH 2FOCA 1TNGA 3IWMA 1P8VC 4D7GA 4FUIA 5FXLA 3LJJA 1BA8B 1YPKH 1AVXA 5GCHG 3MTYA 9LPRA 1LHCH 5JBCS 4AORA 1C9TA 2EI7A 1UJ1A 2VNTA 2FOBA 2ZU5A 3H7OA 1G3CA 3Q3XA 1PPHE 1Y3WA 1AWHB 3GCOA 1KDQB 1EQ9A 1W13U 1ZOMA 4M7GA 4Y8ZA 4XDEA 1C1UH 2TGDA 2TGPZ 2XC4A 2W7UA 1VJ9U 4DG4A 4Y0ZE 1BMLA 1B7XB 2F9OA 3U69H 1VGCB 4ZAEA 1SVPA 3PTBA 1MTVA 1HAZB 2BLQA 3SV8A 1ELAA 3ZZAA 4LOYH 1HFDA 2QA9E 4UFEH 2JETC 1E36B 3VGCB 2ANWA 3SJKA 1T4UH 3WY8A 1DPOA 2DE8A 3KIDU 2J92A 1QB6A 2ODPA 3EA9A 2R0LA 2A7JA 3RM2H 2XRCA 1DY9A 2ZGJA 1VCPA 3UQVA 5T3HA 2K1QA 1C2KA 4D7FA 3ZYDA 3ITIA 4MPXA 1LMWB 4Q7ZA 1GBJA 1O3AA 5JB8S 4U30A 2RDLA 2P8OC 3GY6A 4I8GA 1EZUC 1AZZA 1VR1H 1QGFA 1TMUH 3SGAE 1V2OT 1BBRK 1FNIA 1RTLA 1S6FA 1K1LA 3QZQA 2ZI2H 3PMAB 1P2QA 1TE0A 1TNLA 1GHWH 1ZPCA 3HGPA 5ESBA 3MU8A 3EA7A 4JYTA 3UOPA 2FX6A 2BZAA 4D9QA 1OWHA 1PPZA 2XBWA 1O2JA 4LZ4B 1C4U2 2PW8H 4GPGA 2D26C 1FLEE 1HAHH 2FX4A 1G2MA 4VGCB 1RTFB 1V2TT 1YCPH 2PR3A 1ETSH 2ODYB 3MFJA 4DCDA 5LGOA 1P9SA 2SNVA 1TMBH 3HPTB 1DFPA 1O3JA 1EB1H 2FS9A 4MDSA 1AFEH 1SI5H 1VGCC 3ATLA 1PPEE 1BMNH 1NT1A 1H4WA 3K9XB 1RIWB 3SNBA 2FIRH 4NWLA 3RXLA 1IOEA 2BVRH 1FDPA 1DANH 2ODQA 4H6TA 5EPYA 1V6DA 4PROA 4WVPE 4K1TA 2GVFA 2Q6FA 3HATH 2Z9GA 5F8TA 3UWJH 2O8TA 2HGTH 3ZVCA 2RA0A 3OX7U 1F5LA 1W0YH 3UPEA 3OYPA 4FUBA 3GY8A 4ISNA 4IBLH 3QTVH 1ABIH 2TGTA 7LPRA 1JIMA 4O3TA 1P06A 2ZP0H 3TK6A 3UTUH 1XKBC 2VB0A 4E7RG 1W14U 4LK4A 1O39A 1Z8RA 2QXHA 4BAKB 3VB3A 3RXDA 1O3GA 6GCHF 1TNJA 4YOGA 2M5TA 4ABAA 1NRQH 1XVOA 1K1MA 4VGCC 4XOJA 5FBIA 2WUBA 4Q80A 4MNWA 1G3EA 3SO3A 1GBLA 1YF4A 3BTGE 1FV9A 1FJSA 2SFAA 2ZF0H 3MOCA 1F0RA 2XCFA 1OWKA 1TAWA 2B7DH 3GY5A 3A7ZA 1DWBH 3H5CB 3LDXH 4UDWH 1GHAF 2PKAB 3PV4A 1TGCA 1V2WT 4I8JA 3S69A 5DPAA 3TITA 4Q2KA 2DUCA 4CBNA 1MD8A 1F0UA 1OYQA 3DFJA 5C5NA 4YM9A 1YGCH 5A0AE 1HRTH 1EOLA 1QBVH 4CRAA 2ZGHA 2VIDA 1LVBA 1OP8A 3NZIA 4AN7A 1BTWA 3ZVEA 2WPHS 3LGVA 2TGAA 1DUEA 2P3UB 4LZ1H 1O37A 1ABJH 1NFWA 1UHBB 5LH8A 2QXGA 3V7TA 2A4QA 1EZSC 1RD3B 2ZWLH 2PV9B 1AKSA 2KAIA 1HCGA 1SGPE 2WPMS 2F9BH 3L3TA 1A5IA 1GI0A 3M7QA 2Z3EA 4X0WU 4AB9A 2VIVA 4IN1A 4WF8A 4K3JA 1O3LA 4JZEH 3UQOA 3P8GA 2QN5T 3RXBA 1A5GH 1NZQH 1KXCA 2JKHA 4A1XA 4NSYA 2FPZA 3TH3H 2WPKS 1ARCA 1F0TA 3E8LA 2A7HA 3SORA 1NPMA 4FU8A 1XUFA 1LHDH 1KXAA 2BVSH 1INCA 1YYY1 3FP7E 4BAOB 1O2YA 3V0XA 2GP9B 4BAMB 2NWNA 1XMNB 1O2XA 1C2GA 1C5PA 3KHVA 4RKOB 1LVOA 4Y11E 1TA6A 1CHGA 1EAUA 4I7YH 3BF6H 5A09A 2A31A 4CRDA 1GJDB 1T8LA 1UVOA 2BQ7B 2XC5A 3MHWU 3V13A 2Y82A 1O2ZA 3C27B 1UTNA 4JYUH 1AFQC 2G4UA 3EE0B 1ZYOA 2R0KA 3MMGA 1FY1A 1WQSA 2GZ9A 1TGBA 1ZGIA 4HGCA 1MTUA 4NGAH 2BD2A 1P3EA 1TX8A 1C5WB 1FIZA 2VWOA 3SU1A 1VJAU 1GJBB 1S5SA 5DGJA 3PM3A 4NIWA 1YPGH 1AUTC 1ESBA 2Y7ZA 2FLBH 3QGNB 2UUFB 5BRRE 5AVDA 3GYLB 3TH4H 1MKXK 1O3KA 1TNIA 7ESTE 2CV3A 1ID5H 4OGYA 3RXJA 3SNEA 2ESTE 1ELEE 2XWBI 6CHAC 4J2YB 2A4GA 1RS0A 4ABFA 3QK1A 1ELGA 4DY7B 1TPSA 1AE8H 1EAXA 3RXOA 1BJUA 2F91A 1FAKH 2SGEE 1SFIA 2Y5FA 5CE1A 1W7GH 1P2OA 5AFZH 1SHYA 1AVGH 4E05H 1MTSA 3LJOA 4OS6A 2BVXH 3MNCA 2FI3E 1L1NA 2YNAA 1C1QA 3ZZ7A 6GCHG 3E6PH 1DWCH 1XX9A 4I32A 2H2ZA 1UK3A 3SNDA 2O8UA 2UWLA 1K2I1 1SGCA 2A5AA 1G30B 3N7OA 1D9IA 1KTSB 3Q76A 4FUDA 2XW9A 5C67A 1Z8IB 1C2JA 3PO1C 1GWAA 1SQAA 2BOKA 2FOFA 1TGNA 2W26A 1F5RA 1HYLA 2OCVB 4TWWA 3SUEA 3TJVA 3LGTA 2BY5X 3QO6A 3U9AH 1QR3E 4AFSA 4Y79A 1TABE 2Y5GA 1P3CA 1MAYA 1ELBA 1GHAG 4X1QU 3E16B 3KQEA 4Y6DA 2OTVA 2P3TB 3P8FA 1O5DH 1T8OA 5T6DA 3T25A 3LU9B 3UNQA 1WUNH 1YPHE 3Q3KA 2Y5HA 3GDSA 2GT8A 2G52A 1OP2A 1UCYK 2ZFRH 3RUOA 2VH0A 1O5AB 2Z9KA 4Y10E 4CRBA 3UNRA 3IG6B 2WV5A 1O5GH 5SGAE 1WYKA 3O8DA 1V2VT 2BDIA 3RXFA 4SGAE 1SLUB 2BOHB 1BRCE 2HVXA 1YCPM 4UE7H 4X2YA 3MH5A 1DWEH 2BDYA 2GDDA 1DXWA 3U8TH 4Y0YE 2O8LA 5A8YA 2RCEA 1SFQB 1SGFG 2Y81A 4MNYA 5A0CA 1TLDA 2V3OH 3RU4E 3NKKA 1K1OA 3GCHC 2HPPH 5G4BA 5EGMA 2A32A 2V3HH 3DT0H 2AGGX 2J95A 1P12E 3L33A 5E8EH 3RLWH 3S9CA 1D6RA 1ZHRA 2XYAA 4YT7H 2PKSB 2XBXA 5FX5A 1GL1A 1SLVB 3VEQB 1IQHA 3B8JA 4K8YA 5C20A 8LPRA 3SUDA 8GCHF 1G32B 2ZDKA 3TNSA 1KDQA 2W7SA 2GCHF 4HTCH 1UTJA 1HIAA 4RKJB 3AW1A 1C2IA 1DS2E 1ZMNA 1N8OB 2VVCA 3GY3A 1HAVB 1QB1A 1ZTJA 2C90B 1KLJH 1GDUA 3KQDA 3MI4A 5LPFA 3SQEE 1PYTC 1W10U 3FZZA 2P94A 2ZDAH 4ABHA 1BBRH 4J1YA 1GHBF 1QY6A 1W12U 1Z7KA 2BM2A 5FAHA 1QJ1B 2VH6A 3RM0H 1NRPH 1WU1A 1GI6A 1GMCF 1MCTA 1GVKB 1HV7A 2ZHDA 3PYHA 2IOTA 1C5OH 2AFQB 3A89A 4JZDH 1T7CA 2QXIA 4BXWA 1GBEA 3A83A 3SI4H 1O2VA 1ZSKA 2ASUB 1V2JT 1ZMLA 2GZ7A 1GGDB 3MNSA 5DKMA 4BAHB 3BEUA 4ZUHA 1GBMA 2BD5A 4A1TA 4THNH 2UWPA 1HXFH 3EAJA 2AYWA 1SGEE 2BQWB 4ZKOU 3PROA 4NIYA 4OS1A 2CMYA 1K1NA 1CGJE 2ZNKH 1SPJA 3ZZ8A 3VB6A 2Z9LA 1GVLA 1C5ZB 1SB1H 1TQ0B 2BD3A 1O38A 4YLQH 4AX9H 2ZU3A 3QN7A 1C2LA 1GJ8B 4YLUA 1C5SA 1A1RA 2BZ6H 5ABWA 4Y71A 2SGQE 5C1YA 1O5EH 2H9EH 3RXPA 2F9PA 4JK5A 1A7SA 1PPFE 5DP3A 3SU0A 2GGVB 5EXMA 2ZTXA 1CU1A 1IAUA 3EYDA 1YC0A 4DVAU 5L2YH 2ZPQA 4OS4A 4DGJA 1GBBA 3LGIA 5HM2A 1GMHF 1ARBA 1SLWB 4CH8B 1D4PB 4ISIH 4NFFA 2ZO3H 4MG3A 1EJAA 5GIBA 1V2QT 1EATA 4AFUA 2A5IA 1ESTA 3A88A 1Z1IA 2WINI 3D49H 3FP6E 2I6QA 2ZU4A 1JMOH 4Q7YA 1C5QA 1DWDH 2O8MA 2A1DB 1IQGA 1O3FA 4MTBA 1QRWA 4OS5A 1LQDB 2NU3E 1TMTH 2C3SA 3RXEA 1EP6A 1ELCA 2GMTB 1CBWC 3HKIB 1TPOA 4E7NA 1AD8H 5CHAB 4B2AA 2OQ5A 2VGCC 1J16A 1TNKA 2H5DA 2GZ8A 4DOQA 2R2MB 3LC3A 3UR6A 3RXHA 3MNXA 3QZRA 1GGDC 1KIGH 2H1UA 1CE5A 2F9NA 4ZHAA 2XBVA 1NS3A 3UREA 5JPMH 2VJ1A 3FZDA 2EI6A 3LH3A 3BTDE 1EUFA 1V2MT 3M3SA 5LPEA 1FPCH 2ZGCA 1BUIA 1K22H 3S9AA 3VB5A 1IHTH 1QBOA 3A8DA 3ZZCA 1GI8B 1ZJDA 1CGIE 2A0QB 2VU8E 1C5TA 2VIWA 3MU1A 1O2WA 1S6HA 3TGKE 4ABGA 2PUXB 1L0ZA 1C2MA 2Y7XA 1NN6A 1S0QA 2BY9X 1VITF 3RC4A 1AVWA 1AY6H 3LGWA 1ELTA 4TPYA 4AZ2B 4BTIB 1TX7A 3BTME 2P95A 1ANDA 1TALA 8GCHG 1GI1A 3A87A 2A4RA 1G37A 1ETRH 1F92A 2GCHG 1O2LA 1UVUH 2PGBB 1M9UA 1QL7A 1AHTH 4XFQA 1SQOA 3B9FH 1TX6A 3SJ9A 1ORFA 2A45B 1EPTB 2B9LA 1BJVA 2ANMH 1C4Y2 4RSPA 3M35A 4YESB 2SNWA 1PJPA 1S83A 1F5KU 1GHBG 1XXDA 1BB0B 4ABJA 1W7XH 2GMTC 1A3BH 1Y5UT 3CS0A 4FUEA 1O3MA 1NRRH 2G5VA 4WMDA 5CHAC 1Z6EA 1GMCG 3ZZDA 1SHHB 4KELA 4UFGH 1O0DH 2QY0B 2GTBA 4D9RA 1G9IE 1GJ5H 5C1UA 4ZH8A 1Z8JB 4B1TA 2WPIS 1O5FH 3CENA 3DA9B 1H8DH 1ZLRA 2HNTE 2J34A 4R8TB 1QURH 5C3NA 2GDEH 2ZHFH 3VGCC 3W94A 1S85A 5BPEA 1C9PA 1O3PB 3ZZ6A 3Q77A 3PB1E 3IITA 3BN9A 3RC6A 3V12A 1HXEH 2FI4E 3CP7A 2OXSA 1FY8E 1GHZA 1C2DA 1EASA 5J4QA 3ENSB 3RP2A 5A0BA 3EQ0H 5E2OA 3V3MA 1LVMA 1LPGB 1YLCA 3T29A 2HLCA 1UVSH 1GJCB 2BLOA 2PSXA 5C2ZA 1MZAA 1UTPA 3OU0A 2FYRA 1H1BA 4ZXXH 1TBRH 1AGJA 1GJ6A 4NA9H 2IPHA 3M3TA 1THSH 5T6FA 1GMHG 4X6PA 1XUJA 2BD8A 1UVTH 1C5VA 2ZDNA 4CRGA 3KQCA 4F49A 2GD4B 1MKXH 1MU6B 3U8OH 1P0SH 4YOIA 3RXGA 4NG9H 5K0HA 3T5FH 2FODA 5DJ7A 1A0JA 2QF3A 3RDZA 4UFFH 3BIVH 4D8NA 2J2UA 3E90B 1O2KA 6ESTA 1AE5A 2F83A 3QLPH 1ELVA 4FVDA 2QGRA 1GBFA 5EPNA 1GDNA 1O32A 4GVUA 4X6NA 3BTEE 3F1SB 4BOHA 1JBUH 3EGKH 1QJ6B 1BQYA 1RIWC 3BEFB 2QC2A 5DP6A 3AAVA 1UTKA 3F9HA 4FUFA 5E2PA 3RXUA 1D6WA 1TPPA 2C4FH 4OS2A 3ELAH 3URCA 4MVNA 2VWNA 1V2LT 3ZV8A 3Q00A 3A8AA 4FXGH 3MO6A 1ZPBA 1UTQA 2NU1E 3RXRA 1MD7A 2XXLA 3MU4A 3CS7A 1XUIA 3GCNA 4OS7A 3SUGA 3FAOA 5GXPA 5DP5A 1T8NA 2BD4A 3O8BA 4XSKU 1UK4A 3NXPA 1Y3XA 1MAXA 2ZGXH 1BTXA 1T8MA 3RXIA 1P2MA 3ATWA 3FVFB 3RLYH 1ANEA 4R0IA 3KGPA 1QTFA 4I8KA 2QIQA 1UK2A 3F6UH 1VITG 3O8RA 3SGBE 1UCYH 2JH0D 4A92A 1Q2WA 2F9VA 3DUXH 2FWWA 1Y5AT 2YOLA 2NU2E 1H9IE 1VITH 4NZQA 1FAXA 4ASHA 2AMPA 1TOMH 4X6MA 2PUQH 4ABEA 2W3IA 4BANB 5GJ4B 4NIXA 1SGDE 1Z1JA 1YCPK 4ISOA 3PWBA