3MFJA

Bovine trypsin at 0.8 a resolution, restrained refinement
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Bovine trypsin at 0.8 A and role of restraints at ultra-high resolution
rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mfjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mfjA02
2XBVA 3M7QA 1BJVA 1UK4A 2BD8A 5AHGH 1NFUA 1DXPA 3A81A 2FO9A 2GP9B 3R3GB 1O5EH 4XE4A 3UNQA 1TX8A 4TPYA 7LPRA 1D3QB 4O9VA 1SLXB 4ISOA 2GCHG 1OWHA 1EPTC 4I33A 2BTCE 3A7TA 3LT3A 1AU8A 1ESBA 4Y0ZE 4QT8C 2VWLA 4JMYA 1C1SA 1JXPA 2OC1A 3GYLB 4ABIA 2F9PA 2FMJA 4X1SU 1YCPK 4PROA 1J14A 4RN6A 1BBRH 1O5CB 4LZ4B 1HAYB 2ZGJA 1TNIA 1UK3A 1H9HE 2BLOA 1N6XA 4U2WA 5A8XA 2PUXB 3OX7U 4X2YA 1JMOH 2ZCHP 3LH3A 3SJ9A 3EA9A 1ELGA 2D1JA 2QF0A 1KXAA 1V2UT 2FX6A 3HGNA 1EAXA 2FLRH 1D6WA 2ZHWH 1O2HA 1CSOE 3TITA 5GIBA 3PWBA 1NPMA 4MNWA 4CHAC 1C5PA 3BV9B 1BMMH 1RGQA 1K1JA 3SNCA 3TK9A 1FAXA 1QNJA 3PMAB 4XBBA 3VB4A 4DGJA 3PYHA 1C5MD 2D2DA 1K1LA 4K69A 2SGEE 2BXUH 5EW2H 2ZC9H 1MTSA 4K8YA 2FS8A 2FTMA 4THNH 2ZO3H 3MH5A 1GBFA 1XUHA 1AKSB 1RRKA 2VH0A 5SGAE 5B6OA 1RFNA 6LPRA 1DWEH 4BAHB 3S9BA 2Q6GA 4H42U 2O9QA 3M5NA 2C8WB 1HAXB 5EW1H 3LJOA 1RTKA 2BOHB 1GJ9B 5F6MA 1V2MT 3KHVA 1EATA 1HPGA 1UCYK 3GY2A 1ANEA 1SGFA 5GCHF 1TX6A 1A0HB 4ZKRU 2ZU2A 5T6GA 2C8YB 4O3TA 3K6YA 1HUTH 3DUXH 1TQ7B 1W11U 2V0BA 1W8BH 1XUKA 1ZPBA 2HRVA 3UUZA 1C1MA 1MTVA 3L33A 1FONA 3UOUA 1OWEA 3E6PH 5A09A 4NWLA 2A7JA 2FP7B 3BTEE 2XBWA 3SNBA 1DS2E 1AQ7A 1HGTH 2G55A 3BTFE 1EP6A 2ZGCA 2F9OA 2WV4A 2C4FH 1CGHA 2PV9B 2RG3A 1AVGH 1ZPCA 2WV5A 4A5TS 1C2KA 3SO3A 4MPWA 3RMOH 2SGQE 3A8CA 3LONA 2GKVE 3D49H 1VR1H 1TOMH 3ATMA 3KNXA 1TRMA 4O97A 4ZXXH 4ABGA 3MU8A 2XW9A 2FOHA 2ZCLP 4NG9H 4XOJA 1O3CA 5A0BA 3LGYA 2XRCA 1SVPA 2F9VA 1S6FA 2FM2A 3M36A 2ZHEH 5EOKA 2WINI 1MKWH 3A7YA 1V2QT 5DP4A 1IQEA 3BEFB 3M5MA 5A2MH 1JIRA 4B73A 2C8XB 2BYAX 1K1MA 3LU9B 2GZ8A 2Y7ZA 2QF3A 1GI7B 2HNTC 1SGCA 4NIYA 3VB3A 1CO7E 5EPYA 1W13U 4FXGH 1O3PB 5FPSA 1Y3VA 1DICA 2BXTH 3F9GA 3ODDA 4XFQA 1C2DA 3M3SA 1BIOA 2R3UA 4NA8A 1GBTA 2G4TA 1SG8B 1SSXA 3A89A 1BJUA 1V2OT 2WPHS 1O3EA 1GCTB 7KMEH 1T8NA 4D9QA 3SUFA 1V2LT 1O2ZA 4LOYH 1XKAC 1YM0A 1GHZA 4KTCA 2STBE 1DUEA 4YO9A 2O8TA 3QK1A 3MHWU 4WH6A 1OXGA 1HAGE 1YBWA 2Y5HA 1WQSA 1GHAG 2NU4E 2PTCE 1BTZA 1C4U2 2GX4A 1H1BA 1XVOA 1J8AA 5EU8A 1GVLA 3T26A 1UVUH 2I6QA 1K1NA 1GVKB 4BOHA 1K9OE 3O8CA 3QZQA 1TWXB 2A4OA 4X6MA 2H9EH 1UVPA 2GMTC 4GUXA 2FI5E 1PQ5A 4I31A 1SGFG 1Y3XA 2XNIA 1KXBA 2PKSC 3IWMA 1YF4A 4J1YA 4JZEH 1P2IA 2P3UB 1TONA 5FCRA 1WV7H 2GV6A 2BVXH 1WTHD 4FVDA 1LPZB 1RIWC 1PPGE 2LPRA 1NU7B 4WXVA 1C2JA 1W14U 3MNCA 1BRUP 1C5YB 1O36A 3U8RH 3CP7A 1YPJH 2TBSA 3E16B 2ZFPH 3M7TA 4GHTA 4AYYB 1DT2A 3VXFH 4OS5A 2OBOA 2IPHA 3CENA 3F9FA 5AVDA 1FY1A 4O3UA 5A8YA 1GI9B 4AFUA 1Y3UA 1TNGA 2H6MA 4INLA 3UOPA 2PFEA 1ZGVA 1GBCA 1YCPH 2ZFSA 4KELA 3SV8A 3TK5A 1SQTA 2OXSA 4UFDH 1TA2A 1NRSH 3QX5H 1SLWB 1GMCG 2Q1JA 5F03A 6ESTA 5HM2A 2ZPQA 2ZIQH 1IQKA 1GJ7B 1G3BA 4BANB 2Z3DA 2A4QA 1O3HA 4KTUA 3UQVA 4NA7A 2VWMA 1B0FA 1NRQH 1QJ6B 1OS8A 2ZDAH 3MYWA 4MG3A 2A2XH 1MTUA 1KIGH 7ESTE 1QHRB 1YKTA 3MTYA 1Y3WA 2KAIB 1GBBA 1X7AC 2ZWLH 5A0AE 1OWDA 1KXEA 4BTTB 5GDSH 3SGQE 1F7ZA 1MBQA 2B8OH 2A4GA 4WY3A 2K1QA 4X2XA 4IMQA 2ODQA 2BDBA 1N8OB 2BOKA 2P3TB 2ZU5A 3LC3A 1PPBH 2HPPH 1G2LA 2WUBA 2Y81A 1C4V2 3LGIA 4UDWH 1O2NA 1TGTA 3B9FH 1TX7A 5J4QA 1BT7A 1SFQB 3A84A 3KEEA 1BRCE 5DO4H 1V2VT 4Q7YA 1U6QA 5ESTE 1L1JA 4OGYA 3TGJE 1BB0B 2G81E 5HM9A 5JBTA 2O8WA 1Z6EA 3N7OA 1UTPA 1VGCC 1B7XB 1Y59T 2XC5A 1QL8A 2IOTA 3ATLA 1QL9A 1ELCA 3I77A 4A7IB 2QYIA 3NUMA 5L2ZH 5FHTA 4D9RA 1GJ4H 2FOBA 2ZFFH 3HATH 3RDZA 3ZYDA 1O3OA 2HPQH 1GI5A 5E0GA 1AMHA 1BHXB 2XC0A 3FP8E 3H5CB 1ETSH 2OQ5A 2Z3CA 1LHCH 1PPEE 5TCCA 2BY9X 2PSYA 1V2JT 2Y82A 1KLTA 1ELVA 3GY4A 2C93B 1G3EA 1F2SE 1QA0A 1S81A 1TLDA 2VJ1A 4NZLA 4BAKB 2GMTB 3RXHA 1D6RA 4K1EA 1DITH 1HFDA 4UONA 1ANDA 3LOXA 1O34A 1O2RA 1DX5M 1EJAA 1RIWB 2PUQH 2BVSH 3RXQA 2ZTXA 3H7OA 1O2TA 1EB1H 2C8ZB 2ZG0H 1V2WT 5C20A 1XXDA 2JH6D 1AKSA 1IQGA 1K22H 1LO6A 1MD7A 1FY3A 1MU8B 5FXLA 1FNIA 1O2GH 5CHAB 2A5IA 3F9EA 1GHBF 1D3TB 1QB9A 2QY0B 1P2JA 5EODA 5CE1A 1L4ZA 1NC6A 3RUOA 1JOUB 1KDQB 4GCHF 1Z6JH 1GWAA 1W2KH 1QRZA 3U98H 1PQ8A 5ESBA 1C2HA 1SLUB 1E36B 4ZROA 2Y5FA 4AN7A 1MTNC 4AFQA 1VCPA 5JBAS 3ZVDA 1TMUH 4NSVA 1S0QA 1EAUA 2R0KA 1QRWA 2FYQA 2YNAA 3MI4A 2WPJS 1YPKH 4ABDA 1V2NT 2A0QB 2STAE 3ZZ4A 1E0FD 1OWJA 3FP6E 3TK6A 1HJAB 1EJMA 1O5BB 4UD9H 2HGTH 1P06A 2IN2A 3RU4T 1Q3XA 3BG4B 5AF9H 1Z71A 3M7UA 1IAUA 5BRRE 1BBRE 1G9IE 1CU1A 3Q3KA 4B74A 1TPOA 3S7HB 3NPSA 2QXHA 1SMFE 4RKJB 3UY9A 1P10A 4DG4A 1Y5AT 1HB0B 3UREA 4AFSA 2EI6A 4A92A 3AW1A 1ACBE 1GI4A 1N1LA 1UTMA 2W26A 2GCHF 4FU7A 1GDUA 1AIXH 1A1RA 2G00A 3U8TH 1P03A 1SLVB 2ZDVH 2B5TB 2R0LA 4K2YA 3RXIA 2AH4X 1GJDB 4X0WU 4GVUA 2F9BH 5C5NA 2QV1A 1NESE 2ZHQH 1GPZA 5C67A 1BTYA 4YT7H 1BITA 3RP2A 3TGIE 1NRPH 1YC0A 3PMHB 1C9PA 3F9HA 1AFQB 1EB2A 2VWNA 2VIWA 2ZU1A 3RM2H 7GCHF 1ANCA 4BAOB 2OTVA 4SGBE 3RXLA 1FDPA 3QGJA 4LK4A 2HLCA 3C27B 1UMAH 1T4UH 3RXAA 1AWFH 1ZRKA 4GLYA 2LNCA 2CXVA 5G4BA 1TB6H 1EKBB 2VINA 2PGQB 3BEUA 1Z1JA 2FPZA 1HLTH 1BRBE 2A2QH 2BDCA 1A5HA 2AMQA 3MNXA 4IC6A 1GI3A 2PW8H 2G4UA 2VIOA 3TJNA 4TPIZ 1HRTH 1O3BA 3GCNA 1SGQE 2XBYA 1VJAU 4TWWA 1ZJKA 2ZF0H 5T3HA 4A6LA 1TALA 1TNLA 1LPGB 1FLEE 2BDGA 4X8VH 1E38B 5AFZH 5GXPA 1O35A 3VB7A 3Q3YA 3GY7A 2F9UA 4I8JA 3TH3H 5LPRA 3LH1A 4JZ1A 3GY8A 2HOBA 5PTPA 1PFXC 1AZZA 2ZECA 3S9AA 1T8LA 3QWCH 2VIQA 2H9HA 1GMHG 1EASA 3JZ2B 9LPRA 2TIOA 1HXEH 5EXMA 1G32B 3RXVA 3IG6B 5F8ZA 4WH8A 2QXGA 3PLBA 4BTIB 1IQHA 3E0PB 3BTTE 1FY8E 3GY6A 1BTPA 3NXPA 3BTHE 2FOEA 3OY6U 5HMAA 4D7GA 1F0TA 3GCOA 4AZ2B 3EAJA 1SOZA 4BNRA 3M37A 1ZHMA 3ATKA 4DY7B 1T31A 4YM9A 5DK1A 1XKBC 1GGDB 1AFEH 5L30H 2J38A 1T7CA 4MPVA 1QTFA 2B0FA 1ZLRA 2DE8A 3NZIA 4IW4E 1O3NA 2BD7A 2Z3EA 2SGDE 3A88A 1FJSA 2ESTE 1P09A 1GCTC 1OKXA 4MPUA 3PM3A 3RXUA 1SL3A 1ZHRA 5EGMA 1PQ7A 1MZDA 1XX9A 1K1OA 3STIA 4B2AA 5HGGA 2SNVA 3RXMA 1THSH 4JK5A 2H2ZA 1AO5A 3BTWE 2VVUA 1SPJA 4YESB 1SGDE 2H1UA 1GBEA 3W94A 1ZJDA 3K2UA 3BF6H 1C1PA 1SGRE 3UIRA 2Q6FA 1LMWB 1LHEH 1ZTKA 2NU0E 3SI3H 1AGJA 1FIZA 1OP2A 4ISHH 5ETXA 3MWIU 1W7GH 4Y7AA 1DANH 2EI8A 2FOGA 2O8LA 1AN1E 2AERH 1KTSB 1Q31A 1Z8JB 3GCHC 1C1QA 2AEIH 3KQEA 4Q80A 1E34B 4K5ZA 4HTCH 3RLYH 3MH7A 5IDKA 2P3FH 2GT8A 4A1XA 4HI3A 4IS5A 1O2QA 1P9SA 4JZDH 5IYTA 3DFLA 1A46H 1C5QA 1KLJH 3BIVH 1QCPA 1MKXK 1DSUA 3SN8A 3ODFA 3QUMP 3A7WA 4TWYA 1PYTD 1P01A 1RTLA 3BTKE 2HWLB 2DE9A 1C5VA 1YP9A 1CVWH 2Z9KA 2GT7A 1N6YA 3ZZ6A 3TIUA 1GI8B 2ZFTA 1NFWA 4JYTA 4Z6AH 5BPEA 1TBRH 4CBOA 1C2EA 1Q2WA 3HKJB 3MMGA 2B7DH 1HAVA 1KDQA 1FAKH 3E0NB 4AORA 1AD8H 1P12E 3SQEE 1E37B 3RXDA 1A61H 3W95A 4B2CA 2ZCKP 3RXJA 1ZOMA 2PSXA 1THRH 2NU1E 3AAUA 4JZFH 1O37A 1ZGIA 4K1SA 1A0JA 2UUFB 3TJVA 4TY7A 1SGNE 1JRTA 4F49A 3JZ1B 1O39A 2GV7A 4FVBA 1N8OC 6CHAC 1XUJA 3MOCA 1SBWA 3S7KB 1QURH 3VXEH 3V0XA 1ZSKA 1TAWA 4YLUA 3PLPA 4UFFH 1HAOH 2QCYA 1VITH 4H6TA 5LH8A 1GBMA 3SORA 1O3GA 1WYKA 2W3KA 4U01A 5DP5A 4Y6DA 4OGXA 2TGPZ 3GISB 1CHGA 1GJAB 1O2OA 4ISLA 4YOIA 3BTGE 1INCA 1O2KA 1SGIB 1C5LH 4CRCA 1UCYE 3F68H 4MPXA 1ZTJA 2FXRA 4FUJA 2AFQB 1O3IA 2Q6DA 1SGEE 2VWOA 3FVFB 1TGSZ 2A1DB 3U8OH 1O0DH 4YOGA 2SFAA 4E7RG 2G8TA 1O2YA 3PMBB 1O3KA 4DVAU 4NSYA 5K0HA 4K60A 2WYJA 3SW2B 3LJJA 1YLDA 3A8DA 4Q7XA 2ZFRH 4BTUB 3VEQB 1C1OA 3IITA 2D26C 5DP3A 2F3CE 1F5KU 3K65B 1H4WA 4CBNA 2AS9A 2F91A 3FZZA 3ENSB 1BUIA 3URCA 2ODPA 9ESTA 2H9TH 4X1NU 1G2MA 2FS9A 1F5RA 1P2MA 2BLVA 1T8OA 1LHFH 1GG6B 1YLCA 1KSNA 2PHBA 1DOJA 1O2UA 3GCHB 3RXGA 4H4FA 2F83A 5FPYA 2ZI2H 2ZQ1A 2P95A 6GCHG 3NCLA 4DOQA 1UVTH 1GJ5H 3SJKA 2Z7FE 1AZ8A 5CHAC 1Y8TA 2VU8E 3RC5A 2VIPA 1BQYA 3ATWA 3BTQE 1EZQA 5I25A 1GHYH 2ANWA 4NWKA 1FY4A 2TGDA 3AAVA 3STJA 4ABEA 1LVMA 4UFEH 2VB0A 2BQ7B 1O5FH 4WMEA 5LPEA 3H7TA 1IQJA 1Y3YA 3MNBA 3K6ZA 1C1VH 4JK6A 4UFGH 3AW0A 5FX6A 1AVXA 1D9IA 1DVAH 1IOEA 3S0NA 5EG4A 3RXPA 3ATIA 3T27A 1BMLA 1GDQA 1FV9A 3KN2A 3OYPA 3RXBA 4CRFA 4YLQH 2H5CA 2NU3E 2W7SA 1IQNA 1BCUH 1C1WH 1HJAC 3MO9A 2AIQA 3ZZ3A 3MO3A 5TCAA 3ELAH 3GY3A 4D7FA 1TIOA 2QAAA 3RMMH 5ABWA 5TJXA 3ZZDA 1GMDF 1P9UA 3BG4C 1TABE 1EAWA 1CHOF 1BTWA 4MVNA 3GDUA 1EAIA 1P02A 2JH0D 6CHAB 4KP0A 1E35B 1Y5BT 2ZU3A 4MLFB 1A3BH 1HXFH 5JBBS 4I32A 3M35A 2VVVA 4NIWA 1OWKA 1ELEE 1IQMA 4KKDA 4MNVA 1QB1A 3U69H 2OQUA 1GBJA 1O2LA 1VITG 4D8NA 3SBKA 1TBZH 2BQWB 3MU5A 3DD2H 1DWBH 1K2I1 2QGRA 3U9AH 2P16A 3GOVB 5J4SA 1IQIA 1TRNA 3RU4E 2R3YA 1GCDA 1TRYA 2OC8A 1V2ST 3V13A 3O8RA 3G01A 1C2LA 1S5SA 4NGAH 1XVMA 1DY8A 5FAHA 2BZ6H 2J94A 2ZFQH 1CA8B 4B76A 2BZAA 2JH5D 1UTQA 3BSQA 2P94A 4ZKSU 4FUCA 4ZKNU 3B8JA 1GJ6A 2ASUB 3PB1E 3RXOA 1D3PB 1MKXH 2Z94A 1QIXB 1NZQH 2A4RA 3LC5A 5AFYH 1L4DA 2THFB 1GJCB 1AFQC 1V2PT 1WUNH 3PO1B 1QY6A 4M7GA 4MTBA 2GDDA 2G5VA 1NRRH 5E0HA 2BD3A 1F0SA 3GYMA 2F9NA 1O5DH 1TPSA 4FUBA 5GJ4B 1BTHH 2BDYA 1KY9A 1NFYA 1A5IA 1KXFA 1MUEB 1NS3A 2B9LA 1XUGA 1O2XA 3T62A 1S84A 1QFKH 1WU1A 5EQRA 4GSOA 4ZMAH 2PTNA 4XDEA 3ZVCA 4X2VA 3GCTG 1YYY1 1S0RA 4FUFA 1Z8IB 5FX5A 8KME2 3I29A 1NM6A 2BQ6B 1OOKB 3SUEA 1NFXA 1PJPA 2WYGA 4JYUH 4AGKA 1BDAA 3SJOA 2P59A 1GI2A 2FX4A 3GDVA 3BN9A 1EZXC 1DSTA 3M3VA 1ZR0A 1GJ8B 1S83A 1C9TA 3DHKH 2CF9H 1NROH 1P04A 1AE8H 4LZ1H 1PQAA 4KTSA 4R8TB 1H8DH 3KQBA 1NTPA 1TFXA 1L1GA 2PKAB 1C1UH 3A7VA 3BG8A 3QTVH 2OBQA 5T6DA 3UFAA 4I7YH 3P8FA 3T2NA 1LHDH 1QB6A 4FUEA 1FPCH 2GGVB 2JETB 3EE0B 4BAMB 2BLWA 1MCTA 2ZGHA 1B5GH 4BXWA 2ZTYA 1F5LA 4OS2A 1SB1H 2OCVB 4AB9A 5K7RA 3RC6A 1C2MA 5A8ZA 4D76A 3E3TA 2AMPA 2BY8X 1TPAE 4FUDA 4UEHH 1HYLA 2AGEX 1XM1A 2WPIS 3KCGH 3QGNB 5LPFA 3SZNA 5CMXH 1J15A 3CS0A 4NFFA 2J34A 1P2QA 1L2EA 1GGDC 2HNTE 4ZH8A 1WBGB 1CE5A 3MU1A 2ALPA 1GBAA 2WPKS 1G37A 1A7SA 3ESTA 3SV6A 5EQSA 1GMHF 1FIWA 2BLQA 4INKA 1J17T 1TNHA 2ZTZA 3OU0A 3BTDE 5DKMA 1SHYA 1ELFA 2H5DA 1MAYA 1ZPZA 1YCPM 1O3LA 5DP7A 1ID5H 1ETRH 2J9NA 3EA8A 2ODYB 1O3FA 5C1YA 2A5KA 1MZAA 3A87A 3BIUH 4IC5A 2BY6X 2A45B 2GDEH 5DGJA 2J92A 2ALVA 3LGUA 3P92A 4ABAA 1EJNA 3C1KA 5E0JA 1PPZA 3DFJA 3SU5A 1O2SA 1S82A 5C2ZA 4E06H 4O03A 1OYQA 1VCQA 5C3NA 1C5NH 5FCKA 4R0IA 5GWZA 1RJXB 1DDJA 2G52A 1EZSC 2ZHDA 1CBWB 3P8GA 1FZZA 1SGPE 1ZMNA 2OD3B 2R2MB 3RXEA 2EA3A 1O3DA 3ZVAA 8GCHG 4U32A 1O2IA 3V3MA 1DM4B 1TNKA 2AGGX 4Y0YE 1K28D 4Y76A 4BXSA 1TOCB 2D8WA 2A32A 1C1TA 1QRXA 3RM0H 4XBCA 2ZU4A 3I78A 1AI8H 1AWHB 4ZHMU 3RXSA 3P95A 2PR3A 1MQ6A 1CQQA 1GJBB 4I8KA 1EP5A 1NO9H 2FI4E 2XWAA 5JB8S 2RDLA 5GPIB 1TA6A 3RU4D 1QJ7B 4KGAA 2OLGA 1QR3E 1V2RT 4ZHAA 1AVWA 3E91A 1HAPH 2ZDNA 5E8EH 1HJ8A 4NCYA 3QLPH 1O31A 1P2NA 3KL6A 2ANMH 4MNYA 2WPMS 1ELAA 3WY8A 3MH6A 4WXIA 1ARBA 5LGOA 1BTXA 3FFGA 1HNEE 3QN7A 2ZA5A 4CRBA 3ZYEA 3URDA 4XBDA 1C5OH 3UNSA 1TNJA 1FN6A 1GDNA 1QJ1B 2A7HA 3QDZB 5T6FA 2OC0A 3EGKH 4AG2A 1O3JA 1HAZB 2A31A 4WF8A 3ZVEA 2Y6TA 1Z7KA 3V12A 2XBXA 1FN8A 1A2CH 1PPHE 2GCTB 3TH4H 2ZEBA 1SQAA 4WVPE 4Y79A 3SU1A 1Z8GA 1JIMA 4DCDA 2KAIA 1MH0A 2W3IA 1GBHA 1K1PA 1DLEA 3BTME 2FTLE 1C1RA 1EUFA 1OYTH 1LCYA 1VJ9U 2ZGXH 1GHXH 4FU8A 1TGCA 1LHGH 4XSKU 3HK6B 3SV7A 3KQDA 3UNRA 1JWTA 3A7ZA 3VGCB 1XMNB 2ZGBH 3OY5U 2CHAC 2Z6BD 2PLXA 5EXNA 2QIQA 1FQ3A 1O33A 2SNWA 1O2VA 1KXDA 4GAWA 2P8OB 1G30B 4CR5A 3SJIA 1AUJA 4FUIA 4MNXA 1HIAB 1HAIH 3P70B 7GCHG 2FOCA 4ISNA 3HGPA 3V7TA 2FYRA 1BOQA 1KLIH 4ESTE 3QZRA 1CGIE 4VGCC 1Z1IA 2EI7A 2HNTF 3SV9A 3VFEA 2FIRH 2HVXA 1O2MA 1GG6C 3KF2A 3LKWA 1AB9C 1OWIA 1ZTLA 3TLOA 1GI6A 4AOQA 3TNTA 4DIHH 1AHTH 1DXWA 4FUHA 1ZYOA 1YPMH 4I8LA 4Q2KA 3EA7A 4AYVB 2BY7X 3SU4A 4JCNA 5EQQA 1P05A 1GHAF 2R9PA 4LXBH 5FBIA 4B1TA 2CV3A 2ZHFH 5FBEA 5L6NH 3U1JB 1C1NA 4CRAA 2XTTB 3T5FH 1C5XB 4DT7B 1ZZZA 2PWXA 1WQVH 2GZ9A 1CA0B 2V35A 3UPEA 1C5UA 1BHXF 5JYIA 3SNAA 4X1PU 5F8TA 1ANBA 1BTUA 4MQAA 4AX9H 1MU6B 3MFJA 1GVZA 1TGNA 4ZXYH 3F6UH 4ASHA 1J16A 4ZAEA 3LGTA 1NRNH 1W0ZU 1MCVA 5DPAA 3ZZBA 1JRSA 3OSYA 1O2WA 1WCZA 2RA0A 4DIIH 2CGAA 4E7NA 2O8MA 4JZIA 1WSSH 1SGYE 3E8LA 6GCHF 2CF8H 3RC4A 1DPOA 1FXYA 1GHWH 3E90B 4IN1A 2VH6A 3P8OA 1L0ZA 2QA9E 4YZUA 1A3EH 2BX3A 3KGPA 4Z0KA 3RXFA 3SJ8A 3QTOH 3SUGA 1GBLA 1UO6A 2BVRH 2J2UA 2PKAA 1BZXE 4K8BA 1QQUA 3O8DA 4OS1A 2ZZUH 1GMCF 1NN6A 1C5ZB 2FEQH 4DJZB 1GBDA 4FUGA 2GVFA 2XWBI 5E2PA 4YOJA 1TYNA 3P17H 3ZV8A 1L1NA 1HBTH 1C5TA 4NA9H 3RXRA 1P3CA 4ISIH 1EPTB 2Z9JA 1ZSLA 1LQDB 2BM2A 1OX1A 3U1IB 2XYAA 1ELBA 3L3TA 1ZMLA 2TPIZ 3SUDA 5L2YH 3Q77A 1MBMA 4HFPB 2CHAB 3LDXH 4HGCA 1FUJA 1A5GH 1XXFA 3MNSA 4K3JA 1DFPA 1KYNA 4JYVH 4Y8YA 3PMJA 1TMBH 4CR9A 4ZKOU 3QO6A 2BD5A 2ZNKH 1O32A 2BDHA 5H4IB 2BD9A 3PROA 1SR5C 3P8NA 1DLKB 3SGBE 2QC2A 5FPTA 1F92A 5E2OA 1OP0A 3A86A 1IQFA 1ABJH 1V6DA 3PO1C 2C3SA 3PLKA 2FZZA 4X1QU 2OINA 4ABHA 1PYTC 3GDSA 2BDIA 1VZQH 1ELTA 1O30A 1VITF 2W5EA 2Z9IA 5JBCS 3LIWA 1UHBB 4VGCB 1C5RA 4CHAB 2YNBA 2BB4A 1QL7A 4OS4A 3L6PA 1A4WH 1AB9B 1T32A 5GCHG 3AASA 3RLWH 3UTUH 3M61U 4AGJA 1BRAA 1W12U 2ZDMA 4ABJA 1C5WB 2Y7XA 3A85A 3PTBA 2UWOA 2ZQ2A 2WUCA 4IBLH 3FANA 2CMYA 3ITIA 4E05H 1M9UA 3TPIZ 1HAHH 3K9XB 3HK3B 3D23A 1TPPA 2XCFA 1V2TT 1UJ1A 1O3AA 1O5AB 1ORFA 3DA9B 1IHTH 3D65E 4A1TA 2ANYA 3SGAE 3T25A 1MD8A 3A8AA 1HDTH 1LKAA 2FI3E 1SQOA 3RXKA 1YPHE 3NKKA 1EX3A 1ZMJA 4YT6H 3Q76A 4RKOB 1G36A 2UWLA 2SGFE 3ZZ9A 3R0FA 2FOMB 4Y7BA 2FDAA 1YPEH 3E1XB 2ZKSA 4MDSA 1UTOA 3GCTF 1QBNA 2BX4A 2JETC 2OP9A 2FLBH 4ABFA 1EXFA 1W7XH 4X6PA 3TNSA 3ZVFA 4CRDA 1UK2A 3ZZ8A 1ELDE 5C5OA 5EXLA 2EC9H 5I46H 3D62A 1C5SA 2J95A 4GPGA 1OP8A 1QBOA 4DURA 1ZHPA 3LGWA 2ILNA 1C4Y2 2UUKB 4SGAE 1OSSA 1C2FA 3M5LA 1IQLA 2C90B 5DG6A 3TVJB 3M3TA 5JDUB 1PPCE 1EQ9A 1DWDH 3VPKA 4AG1A 4CREA 3VB6A 2OUAA 2Y5GA 1W10U 3ZZ5A 3GICB 1P0SH 4IMZA 3SU6A 3GY5A 1GI0A 2QXJA 1QA7A 3LPRA 3TH2H 1EOJA 1LPKB 2ULLA 4INHA 4X2WA 2JKHA 4TYDA 3RMLH 3EQ0H 3PV4A 1ZSJA 1UTNA 1CT4E 3A7XA 1G3DA 3MO6A 1O38A 3ZZ7A 1BA8B 1THPB 1GL1A 2AGIX 4UE7H 4NZQA 1C2IA 4A1VA 1TQ0B 5JPMH 1LDTT 1W3CA 1B0EA 2BMGB 2GD4B 3T28A 4Y10E 1WOFA 3TJUA 2RA3A 2OC7A 1QQ4A 1LTOA 3UWIA 2FWWA 3T29A 2V6NA 1T4VH 1RD3B 1EZUC 3VB5A 2ZP0H 1F0RA 2UUYA 4ZHLU 2UWPA 2FOAA 3UQOA 3B23B 2AYWA 1RXPA 2V3HH 1UCYH 4Y71A 3A8BA 1CBWC 1HJ9A 4HZHA 1F0UA 1CGJE 2M5TA 3SNDA 4I8HA 4J2YB 3PWCA 1RS0A 3SHCH 1SC8U 4X8TH 1HIAA 2Z9LA 1DE7H 1D3DB 1NY22 1UTJA 3ZZCA 1P2OA 3SOSA 1UVSH 1SFIA 4AB8A 1BBRK 2J4IA 2VGCC 3RXTA 2SGAA 1YPLH 1ESTA 3FP7E 4WWYA 4NIXA 3M5OA 5JB9S 2ZDLA 1TMTH 1WAYB 4CH8B 3HKIB 2A7CA 4H6SB 8LPRA 2VIVA 1K1IA 4X8SH 3RMNH 1KXCA 1LQEA 1TBQH 1WTGH 2NWNA 2PKSB 1SOTA 4OS7A 2ZDKA 1P2KA 3OTJE 4CRGA 2BD4A 3ZV9A 3FAOA 1LKBA 1YPGH 1ARCA 4NIVA 1GI1A 3UWJH 8GCHF 4ZUHA 2QN5T 4I8GA 2SGPE 1A0LA 4AFZA 1C2GA 4RSPA 4U30A 3KIDU 1HAVB 3SU3A 2RCEA 2FESH 1GMDG 2HALA 2NU2E 2VIDA 3UR6A 2IJOB 1CT2E 1G3CA 1MAXA 1NT1A 2ZPSA 1MTWA 1CHOG 4B2BA 1P8VC 5A0CA 2EEKA 1ETTH 3O8BA 1T8MA 2WPLS 1O2JA 1Z8RA 1W0YH 3UR9A 3SV2H 1YGCH 4F4OC 5DJ7A 5C1XA 1TE0A 3LGVA 5HYOA 3DT0H 4TY6A 1GL0E 4IGDA 4DW2U 2PGBB 1XUFA 2V3OH 2GCTC 1PPFE 1O2PA 2TGAA 1EOLA 3HPTB 4GHQA 4ABBA 2AIPA 1GBKA 4CH2B 3ZVBA 1H8IH 1NU9A 2UUJB 2A5AA 1GHVH 2CJIA 1HV7A 1V2KT 1JBUH 4Y11E 3VGCC 1BMNH 1AE5A 4WMFA 3SU0A 1LVYA 2AMDA 1SI5H 5DP6A 3SNEA 1BMAA 1XUIA 5DP8A 1QGFA 2VVCA 3TU7H 1MQ5A 2BY5X 2P8OC 5C1UA 1H9IE 1ABIH 2I6SA 1SGTA 4YTAA 1FY5A 2TGTA 5DP9A 1ZRBA 4Y8ZA 3BEIB 1EPTA 3Q00A 1D4PB 1RTFB 3A83A 3PTNA 1V3XA 4X6NA 4B71A 5HXFA 1UVOA 2FODA 3S69A 1FMGA 3SHAH 1MMJN 1GBIA 2BD2A 3MU0A 1VGCB 1K21H 4Y8XA 4WMDA 4NFEA 2W7UA 1P3EA 1S85A 1OPHB 2ZPRA 3A80A 2XC4A 1MKWK 2G5NA 1O5GH 1UTLM 4BAQB 2GZ7A 3TGKE 1LVBA 3Q3XA 3SU2A 1GHBG 1J9CH 2GTBA 4IN2A 2YOLA 3SQHE 3SI4H 2VNTA 4GCHG 8ESTE 1FPHH 3S9CA 2XCNA 2VGCB 5EPNA 3ZZAA 3NWUA 2CN0H 1UHBA 4X6OA 3EDXB 3A82A 2Y80A 1CA0C 2O8UA 4Q7ZA 2XXLA 1TGBA 1ESAA 2G51A 3EYDA 1AY6H 2DUCA 1SHHB 1QBVH 2BDAA 2QXIA 2TRMA 3AVZA 1FI8A 2BHGA 1H9LB 1HCGA 2FOFA 2R2WU 2P93A 4FU9A 4K1TA 1VCWA 1CT0E 1S6HA 1IHSH 3FZDA 1DWCH 2ANKH 3TJOA 1P57B 1DY9A 1Y5UT 1AUTC 3RXCA 2Z9GA 1LVOA 4X1RU 1DUAA 3P6ZB 5F8XA 4WJG2 4OS6A 3MU4A 1O3MA 3MH4A 1KTTB 3NK8A 3CS7A 1UTKA 1P11E 1YPHC 4B75A 1MTNB 4X8UH 3KQCA 3ZVGA 3F1SB
chains in the Genus database with same CATH superfamily
2XBVA 3M7QA 1BJVA 1UK4A 2BD8A 5AHGH 1NFUA 1DXPA 3A81A 2FO9A 2GP9B 3R3GB 1O5EH 4XE4A 3UNQA 1TX8A 4TPYA 7LPRA 1D3QB 4O9VA 1SLXB 4FETA 4ISOA 2GCHG 1OWHA 1EPTC 4I33A 2BTCE 3A7TA 3LT3A 1AU8A 1ESBA 3GS9A 4Y0ZE 3CNRA 4QT8C 2VWLA 4JMYA 1C1SA 1JXPA 2OC1A 3GYLB 4ABIA 2F9PA 2FMJA 4X1SU 1YCPK 4PROA 1J14A 4RN6A 1BBRH 1O5CB 4LZ4B 1HAYB 2ZGJA 1TNIA 1UK3A 2AHME 1H9HE 2BLOA 1N6XA 4U2WA 5A8XA 2PUXB 3OX7U 4X2YA 1JMOH 2ZCHP 3LH3A 3SJ9A 3EA9A 1ELGA 2D1JA 2QF0A 1KXAA 1V2UT 2FX6A 3HGNA 1EAXA 5IK2D 2FLRH 1D6WA 2ZHWH 1O2HA 1CSOE 3TITA 5GIBA 3PWBA 1NPMA 4MNWA 4CHAC 1C5PA 3BV9B 1BMMH 1RGQA 1H8ED 1K1JA 3SNCA 3TK9A 1FAXA 1QNJA 3PMAB 4XBBA 3VB4A 4DGJA 3PYHA 1C5MD 3OAAD 2D2DA 1K1LA 4K69A 2SGEE 2BXUH 5EW2H 2ZC9H 1MTSA 4K8YA 2FS8A 2FTMA 4THNH 2ZO3H 3MH5A 1GBFA 2KCYA 1XUHA 1AKSB 1RRKA 1E79D 2VH0A 5SGAE 5B6OA 1RFNA 6LPRA 1DWEH 4BAHB 3S9BA 2Q6GA 4H42U 2O9QA 3M5NA 2C8WB 1HAXB 5EW1H 3LJOA 1RTKA 2BOHB 1GJ9B 5F6MA 1V2MT 3KHVA 1EATA 1HPGA 1UCYK 3GY2A 1ANEA 1SGFA 4FOUC 5GCHF 1TX6A 1A0HB 4ZKRU 2ZU2A 1COWD 2C8YB 4O3TA 5T6GA 3K6YA 1HUTH 3DUXH 4Q63A 1TQ7B 1W11U 2V0BA 1W8BH 1XUKA 1ZPBA 2HRVA 3UUZA 1C1MA 1MTVA 3L33A 1FONA 3UOUA 1OWEA 3E6PH 5A09A 4NWLA 2A7JA 2FP7B 3BTEE 1YLNA 5KGOA 2XBWA 3SNBA 1DS2E 1AQ7A 1HGTH 2G55A 3BTFE 1EP6A 2ZGCA 2F9OA 2WV4A 2C4FH 1CGHA 2PV9B 2RG3A 1AVGH 1ZPCA 4F55A 2WV5A 4A5TS 1C2KA 3SO3A 4MPWA 3RMOH 2SGQE 3A8CA 3LONA 2GKVE 3D49H 1VR1H 1TOMH 3ATMA 3KNXA 1TRMA 4O97A 4ZXXH 4ABGA 3MU8A 2XW9A 2FOHA 2ZCLP 4NG9H 4XOJA 1O3CA 5A0BA 3LGYA 2XRCA 1SVPA 2F9VA 1S6FA 2FM2A 3M36A 2ZHEH 5EOKA 2WINI 1MKWH 3A7YA 1V2QT 5DP4A 1IQEA 3BEFB 1SKYE 3M5MA 5A2MH 1JIRA 4B73A 2C8XB 1E1RD 2BYAX 1K1MA 2J98B 3LU9B 2GZ8A 2Y7ZA 2QF3A 1GI7B 2HNTC 1SGCA 4NIYA 3VB3A 1CO7E 5EPYA 2YMSD 1W13U 4FXGH 1O3PB 5FPSA 1Y3VA 5EJ1A 1DICA 1KMHB 2BXTH 3F9GA 3ODDA 4XFQA 1C2DA 3M3SA 1BIOA 2R3UA 4NA8A 1GBTA 2G4TA 1SG8B 1SSXA 3A89A 1BJUA 1V2OT 2WPHS 1O3EA 1GCTB 2KCOA 7KMEH 1T8NA 4D9QA 3SUFA 1V2LT 4RT0A 1O2ZA 4LOYH 1XKAC 1YM0A 1GHZA 3OE7D 4KTCA 2STBE 1DUEA 4YO9A 2O8TA 3QK1A 3MHWU 4WH6A 1OXGA 1HAGE 1YBWA 2Y5HA 1WQSA 1GHAG 2NU4E 2PTCE 1BTZA 1C4U2 2GX4A 1H1BA 1XVOA 1J8AA 5EU8A 1GVLA 3T26A 1UVUH 2I6QA 1K1NA 1GVKB 4BOHA 1K9OE 3O8CA 3QZQA 5HIZA 1TWXB 2A4OA 4X6MA 1UW7A 2H9EH 1UVPA 2GMTC 4GUXA 2FI5E 1PQ5A 4I31A 1SGFG 1Y3XA 2XNIA 1KXBA 2PKSC 3IWMA 1YF4A 4J1YA 4JZEH 1P2IA 2P3UB 1TONA 5FCRA 1WV7H 2GV6A 2BVXH 1WTHD 4FVDA 1LPZB 1RIWC 1PPGE 2LPRA 1NU7B 4WXVA 1C2JA 1W14U 3MNCA 1BRUP 1C5YB 1O36A 3U8RH 3CP7A 1YPJH 2TBSA 3E16B 2ZFPH 3M7TA 4GHTA 4AYYB 1DT2A 3VXFH 4OS5A 2OBOA 2IPHA 3CENA 3F9FA 5AVDA 1WXRA 1FY1A 4O3UA 4XD7D 5A8YA 1GI9B 4AFUA 1Y3UA 1TNGA 2H6MA 4INLA 3UOPA 2PFEA 1ZGVA 1GBCA 1YCPH 2ZFSA 4KELA 3SV8A 3TK5A 1SQTA 3FKSD 2OXSA 4UFDH 1TA2A 1NRSH 3QX5H 1SLWB 1GMCG 2Q1JA 5F03A 6ESTA 5HM2A 2ZPQA 4TSFD 2ZIQH 1IQKA 1GJ7B 2WHXA 1G3BA 4BANB 2Z3DA 2A4QA 2KFWA 1O3HA 4KTUA 3UQVA 4OM9A 4NA7A 2VWMA 1B0FA 1NRQH 1QJ6B 1OS8A 2ZDAH 3MYWA 4MG3A 1FX0B 2A2XH 1MTUA 1KIGH 7ESTE 1QHRB 1YKTA 3MTYA 1Y3WA 2KAIB 1GBBA 1X7AC 2ZWLH 5A0AE 1OWDA 1KXEA 4BTTB 5GDSH 3SGQE 1F7ZA 1MBQA 2B8OH 2A4GA 4WY3A 2K1QA 4X2XA 3N7DA 4IMQA 2ODQA 2BDBA 1N8OB 2BOKA 2P3TB 2ZU5A 3LC3A 1PPBH 2HPPH 1G2LA 2WUBA 2Y81A 1C4V2 3LGIA 4UDWH 1O2NA 1TGTA 3B9FH 1TX7A 5J4QA 1BT7A 1SFQB 3A84A 3KEEA 1BRCE 5DO4H 1V2VT 4Q7YA 1U6QA 5ESTE 1L1JA 4OGYA 3TGJE 3FO8D 1BB0B 2G81E 5HM9A 5JBTA 2O8WA 1MABB 1Z6EA 3N7OA 1UTPA 1VGCC 1B7XB 1Y59T 2XC5A 1QL8A 2IOTA 3ATLA 1QL9A 1ELCA 3I77A 4A7IB 2QYIA 3NUMA 5L2ZH 5FHTA 4D9RA 1GJ4H 2FOBA 2ZFFH 3HATH 3RDZA 3ZYDA 1O3OA 2HPQH 1GI5A 5E0GA 1AMHA 1BHXB 2XC0A 3FP8E 3H5CB 1ETSH 2OQ5A 2Z3CA 1LHCH 1PPEE 5TCCA 2BY9X 2PSYA 1V2JT 2Y82A 1KLTA 1ELVA 3GY4A 2C93B 1G3EA 1F2SE 1QA0A 1S81A 1TLDA 2VJ1A 4NZLA 4BAKB 2GMTB 3RXHA 1D6RA 4K1EA 1DITH 1HFDA 4UONA 1ANDA 3LOXA 2J97A 1O34A 1O2RA 1DX5M 1EJAA 1RIWB 2PUQH 2BVSH 3RXQA 2ZTXA 2F43B 3H7OA 1O2TA 1EB1H 2C8ZB 2ZG0H 3F3BA 1V2WT 5C20A 1XXDA 2JH6D 1AKSA 1IQGA 1K22H 1LO6A 1MD7A 1FY3A 1MU8B 5FXLA 1FNIA 1O2GH 5CHAB 2A5IA 3F9EA 1GHBF 1D3TB 1QB9A 2QY0B 1P2JA 5EODA 5CE1A 1L4ZA 1NC6A 3RUOA 1JOUB 1KDQB 4GCHF 1Z6JH 1GWAA 1W2KH 1QRZA 3U98H 1PQ8A 5ESBA 1C2HA 1SLUB 1E36B 4ZROA 2Y5FA 4AN7A 1MTNC 4AFQA 1VCPA 5JBAS 2RFKC 3ZVDA 1TMUH 4NSVA 2W6ID 1S0QA 2YMSB 1EAUA 2R0KA 1QRWA 2FYQA 2YNAA 3MI4A 2WPJS 4B6FA 1YPKH 4ABDA 1V2NT 2A0QB 2STAE 3KQ5A 3KYFA 3ZZ4A 1E0FD 1OWJA 3FP6E 3TK6A 1HJAB 1EJMA 1O5BB 4RT1A 4UD9H 2HGTH 1P06A 2IN2A 2KM0A 3RU4T 1Q3XA 3BG4B 5AF9H 1Z71A 3M7UA 1IAUA 5BRRE 1BBRE 1G9IE 1CU1A 3Q3KA 4B74A 1TPOA 3S7HB 3NPSA 2QXHA 1SMFE 4RKJB 3UY9A 1P10A 3PRDA 4DG4A 1Y5AT 1HB0B 3UREA 4AFSA 2EI6A 4A92A 3AW1A 3OEED 1ACBE 1GI4A 1N1LA 1UTMA 2W26A 2GCHF 4FU7A 1GDUA 1AIXH 1A1RA 2J98A 2G00A 3U8TH 1P03A 1SLVB 2ZDVH 2B5TB 2R0LA 4K2YA 3RXIA 2AH4X 1GJDB 4X0WU 4GVUA 2F9BH 5C5NA 2QV1A 1NESE 2ZHQH 1GPZA 5C67A 1BTYA 3PRBA 4YT7H 1BITA 3RP2A 3TGIE 1NRPH 1YC0A 3F0OA 1C9PA 3PMHB 3F9HA 1AFQB 1EB2A 2VWNA 2VIWA 2ZU1A 3RM2H 7GCHF 1ANCA 4BAOB 2OTVA 4SGBE 3RXLA 1FDPA 3QGJA 4LK4A 2HLCA 3C27B 1UMAH 1T4UH 2GJGA 3RXAA 1AWFH 2HLDD 1ZRKA 4GLYA 2LNCA 4ACBA 2CXVA 5G4BA 1TB6H 1EKBB 2VINA 2PGQB 1WDIA 3BEUA 1Z1JA 2FPZA 1HLTH 1BRBE 2A2QH 2BDCA 1A5HA 2AMQA 3MNXA 4IC6A 1GI3A 2PW8H 2G4UA 2VIOA 3TJNA 4TPIZ 1HRTH 1O3BA 3GCNA 1SGQE 2XBYA 1VJAU 4TWWA 1ZJKA 2ZF0H 5T3HA 4A6LA 1TALA 1TNLA 1LPGB 1FLEE 2BDGA 4X8VH 1E38B 5AFZH 5GXPA 1O35A 3VB7A 3Q3YA 3GY7A 2F9UA 4I8JA 3TH3H 5LPRA 3LH1A 4JZ1A 3GY8A 3VG8A 2HOBA 5PTPA 1PFXC 1AZZA 2ZECA 3S9AA 1T8LA 3QWCH 4I86A 2VIQA 2H9HA 1GMHG 4Q4LA 1EASA 3JZ2B 9LPRA 2TIOA 1HXEH 2WZQA 5EXMA 1G32B 3RXVA 3IG6B 5F8ZA 4WH8A 2QXGA 3PLBA 4BTIB 1IQHA 3E0PB 3BTTE 1FY8E 3GY6A 1BTPA 3NXPA 3BTHE 2FOEA 3OY6U 5HMAA 4D7GA 1F0TA 3GCOA 3UAIC 3EAJA 4AZ2B 1SOZA 4BNRA 3M37A 1ZHMA 3ATKA 4DY7B 1T31A 4YM9A 5DK1A 1XKBC 1GGDB 1AFEH 5L30H 2J38A 1T7CA 4MPVA 1QTFA 2WSSD 2B0FA 1ZLRA 2DE8A 3NZIA 4IW4E 1O3NA 4ASUD 2BD7A 2Z3EA 2SGDE 3A88A 1FJSA 2ESTE 1P09A 1GCTC 1OKXA 4MPUA 3PM3A 4B6EA 3RXUA 1SL3A 1ZHRA 5EGMA 1PQ7A 1MZDA 1XX9A 1K1OA 3STIA 4B2AA 5HGGA 2SNVA 3RXMA 1THSH 4JK5A 2H2ZA 1AO5A 3BTWE 2VVUA 1VKYA 1SPJA 4YESB 1SGDE 2H1UA 1GBEA 3W94A 1ZJDA 3K2UA 3BF6H 1C1PA 1SGRE 3UIRA 2Q6FA 1LMWB 1LHEH 1ZTKA 2NU0E 3SI3H 1AGJA 1FIZA 1OP2A 4ISHH 5ETXA 3MWIU 1W7GH 4Y7AA 2JJ1D 1DANH 2EI8A 2FOGA 2O8LA 1AN1E 2AERH 1KTSB 1Q31A 1Z8JB 3GCHC 1C1QA 2AEIH 3KQEA 4Q80A 1E34B 4K5ZA 4HTCH 3RLYH 3MH7A 5IDKA 2P3FH 2GT8A 4A1XA 3N99A 4HI3A 4IS5A 1O2QA 1P9SA 4JZDH 5IYTA 3DFLA 2JJ2D 1A46H 1C5QA 1KLJH 3BIVH 1QCPA 1MKXK 1DSUA 3SN8A 3ODFA 3QUMP 3A7WA 4TWYA 1PYTD 1P01A 1RTLA 3BTKE 2KCPA 2HWLB 2DE9A 1C5VA 1YP9A 1CVWH 2Z9KA 2GT7A 1N6YA 3ZZ6A 3TIUA 1GI8B 2ZFTA 1NFWA 4JYTA 4Z6AH 5BPEA 1TBRH 4CBOA 1C2EA 1Q2WA 3HKJB 3MMGA 2B7DH 1HAVA 3OTPA 1KDQA 1FAKH 3E0NB 4AORA 1AD8H 1P12E 3SQEE 1E37B 3RXDA 1A61H 3W95A 4B2CA 2ZCKP 3RXJA 1ZOMA 2PSXA 1THRH 2NU1E 3AAUA 4JZFH 1O37A 1ZGIA 2L6OA 1A0JA 2UUFB 4K1SA 3TJVA 4TY7A 1SGNE 1JRTA 4F49A 5GNDA 3JZ1B 1O39A 2GV7A 4FVBA 1N8OC 6CHAC 1XUJA 3MOCA 1SBWA 3S7KB 1QURH 3VXEH 3V0XA 5C17A 1ZSKA 2K8IA 1TAWA 4YLUA 3PLPA 4UFFH 1HAOH 2QCYA 1VITH 4H6TA 5LH8A 1GBMA 3SORA 1O3GA 3OEHD 1WYKA 2W3KA 4U01A 5DP5A 4Y6DA 1NBME 2TGPZ 4OGXA 3GISB 1CHGA 1GJAB 1O2OA 4ISLA 4YOIA 3BTGE 1INCA 1O2KA 1SGIB 1C5LH 4CRCA 1UCYE 3F68H 4MPXA 1ZTJA 2FXRA 4FUJA 2AFQB 1O3IA 2Q6DA 2XNDD 1SGEE 2VWOA 4ACAA 3FVFB 1TGSZ 2A1DB 3U8OH 1O0DH 4YOGA 2SFAA 4E7RG 2G8TA 1O2YA 3PMBB 1O3KA 4DVAU 4NSYA 5K0HA 4K60A 3MQKC 2WYJA 3SW2B 3LJJA 1YLDA 3A8DA 4Q7XA 2ZFRH 4BTUB 3VEQB 1C1OA 3IITA 2D26C 5DP3A 2F3CE 1F5KU 3K65B 1H4WA 4CBNA 2AS9A 2F91A 2WV9A 3FZZA 3ENSB 1BUIA 3URCA 2WPDD 4P00A 2ODPA 9ESTA 2H9TH 4X1NU 1G2MA 2FS9A 1F5RA 1P2MA 2BLVA 1T8OA 1LHFH 1GG6B 1YLCA 1KSNA 2PHBA 1DOJA 1O2UA 3FOAA 3GCHB 3RXGA 4H4FA 2F83A 5FPYA 2ZI2H 2ZQ1A 2P95A 6GCHG 3NCLA 4DOQA 1UVTH 1GJ5H 3SJKA 2Z7FE 1AZ8A 5CHAC 1Y8TA 2VU8E 3RC5A 2VIPA 1BQYA 3ATWA 3BTQE 1EZQA 5I25A 1GHYH 2ANWA 3OFND 4NWKA 2K0QA 1FY4A 2TGDA 3AAVA 3STJA 4ABEA 1LVMA 4UFEH 2VB0A 2BQ7B 1O5FH 4WMEA 5LPEA 3H7TA 1IQJA 1Y3YA 3MNBA 4AC9A 3K6ZA 1C1VH 4JK6A 2YMSC 4UFGH 3AW0A 5FX6A 1AVXA 1D9IA 1DVAH 1IOEA 3S0NA 5EG4A 3RXPA 3ATIA 3T27A 1BMLA 1GDQA 1FV9A 3KN2A 3OYPA 3RXBA 4CRFA 4YLQH 2H5CA 2NU3E 2W7SA 1IQNA 1BCUH 1C1WH 5HKKD 1HJAC 3MO9A 2AIQA 2JDID 3ZZ3A 3MO3A 5TCAA 4F48B 3ELAH 3GY3A 4D7FA 1TIOA 2QAAA 3RMMH 5ABWA 5TJXA 3ZZDA 1GMDF 1P9UA 3BG4C 1TABE 1EAWA 1CHOF 1BTWA 4MVNA 2LP6A 3GDUA 1EAIA 1P02A 2JH0D 6CHAB 4KP0A 1E35B 1Y5BT 2ZU3A 4MLFB 1A3BH 1HXFH 5JBBS 4I32A 3M35A 2VVVA 4NIWA 1OWKA 1ELEE 1IQMA 4KKDA 4MNVA 1QB1A 3U69H 2OQUA 3PV5A 1GBJA 1O2LA 1VITG 4D8NA 3SBKA 1TBZH 2BQWB 3MU5A 3DD2H 1DWBH 1K2I1 2QGRA 3NRLA 3U9AH 2P16A 3GOVB 5J4SA 1IQIA 1TRNA 3RU4E 2R3YA 1GCDA 1TRYA 2OC8A 1V2ST 2KCAA 3V13A 3O8RA 3G01A 1C2LA 1S5SA 4NGAH 1XVMA 1DY8A 5FAHA 2BZ6H 2J94A 2ZFQH 1CA8B 4B76A 5C0UA 2BZAA 2JH5D 1UTQA 3BSQA 2P94A 4ZKSU 4FUCA 4ZKNU 3B8JA 1GJ6A 2ASUB 3DCLA 3PB1E 3RXOA 1D3PB 1MKXH 2Z94A 1QIXB 1NZQH 2A4RA 1K0HA 3LC5A 5AFYH 1L4DA 2THFB 1GJCB 1AFQC 1V2PT 1WUNH 3PO1B 1QY6A 4M7GA 4MTBA 2GDDA 2G5VA 1NRRH 5E0HA 2BD3A 1F0SA 1EFRD 3GYMA 2F9NA 1O5DH 1TPSA 4FUBA 5GJ4B 1BTHH 2BDYA 1KY9A 1NFYA 1A5IA 1KXFA 1MUEB 1NS3A 2B9LA 1XUGA 1O2XA 3T62A 1S84A 1QFKH 1WU1A 5EQRA 4GSOA 2L74A 2PTNA 4ZMAH 4XDEA 3ZVCA 4X2VA 3GCTG 1YYY1 1S0RA 4FUFA 1Z8IB 5FX5A 8KME2 3I29A 5FL7D 1NM6A 2BQ6B 1OOKB 3SUEA 1NFXA 1PJPA 2WYGA 4JYUH 4AGKA 1BDAA 3SJOA 2P59A 1GI2A 2FX4A 5C94A 3GDVA 3BN9A 1EZXC 1DSTA 3M3VA 1ZR0A 1NBMD 1GJ8B 1S83A 1C9TA 3DHKH 2CF9H 1NROH 1P04A 1AE8H 4LZ1H 1PQAA 4KTSA 1S6LA 4R8TB 1H8DH 3KQBA 1NTPA 1TFXA 1L1GA 2PKAB 1C1UH 3A7VA 3BG8A 3QTVH 2OBQA 5T6DA 3UFAA 4I7YH 3P8FA 3T2NA 1LHDH 1QB6A 4FUEA 1FPCH 2GGVB 1OHHD 2JETB 3EE0B 4BAMB 2BLWA 1MCTA 2ZGHA 1B5GH 4BXWA 2ZTYA 1F5LA 4OS2A 1SB1H 2OCVB 3DSGA 4AB9A 5K7RA 3RC6A 3WWBA 1C2MA 5A8ZA 5DSFA 4D76A 3E3TA 2AMPA 2BY8X 1TPAE 4FUDA 4UEHH 1HYLA 2AGEX 1XM1A 2WPIS 3KCGH 3QGNB 5LPFA 3SZNA 5CMXH 1J15A 3CS0A 4NFFA 2J34A 1P2QA 1L2EA 1GGDC 2HNTE 4ZH8A 1WBGB 1CE5A 3MU1A 2ALPA 1GBAA 2WPKS 1G37A 1A7SA 2V3MA 3ESTA 3SV6A 5EQSA 1GMHF 1FIWA 2BLQA 4INKA 1J17T 1TNHA 2ZTZA 3OU0A 3BTDE 5DKMA 1SHYA 1ELFA 2H5DA 1MAYA 1ZPZA 1YCPM 1O3LA 5DP7A 1ID5H 1ETRH 2J9NA 3EA8A 2ODYB 5C0TA 1O3FA 5C1YA 2A5KA 1MZAA 3A87A 3BIUH 4IC5A 2M2AA 2BY6X 2A45B 2GDEH 5DGJA 2J92A 2ALVA 3LGUA 3P92A 4ABAA 1EJNA 3C1KA 5E0JA 1PPZA 3DFJA 3SU5A 1O2SA 1S82A 5C2ZA 4E06H 4O03A 1OYQA 3EE7A 1VCQA 5C3NA 1C5NH 5FCKA 4R0IA 5GWZA 1RJXB 1DDJA 2G52A 4DT4A 1EZSC 2IJD1 2ZHDA 1CBWB 3P8GA 1FZZA 1SGPE 1ZMNA 2OD3B 2R2MB 3RXEA 2EA3A 1O3DA 3ZVAA 3F2HA 4M9FA 8GCHG 4U32A 1O2IA 3V3MA 1DM4B 1TNKA 2AGGX 4Y0YE 1K28D 4Y76A 4BXSA 1TOCB 2D8WA 2A32A 1C1TA 1QRXA 3RM0H 4XBCA 2ZU4A 3I78A 1AI8H 1AWHB 4ZHMU 3RXSA 3P95A 2PR3A 1MQ6A 1CQQA 1GJBB 4I8KA 5EJZA 1EP5A 1NO9H 2FI4E 2XWAA 5JB8S 2RDLA 5GPIB 1TA6A 3RU4D 1QJ7B 4KGAA 2OLGA 1QR3E 1V2RT 4ZHAA 1AVWA 3E91A 1HAPH 2ZDNA 5E8EH 1HJ8A 4NCYA 3QLPH 1O31A 1P2NA 3KL6A 3PV2A 2ANMH 4MNYA 2WPMS 1ELAA 3WY8A 3MH6A 4WXIA 1ARBA 5LGOA 1BTXA 2PP6A 3FFGA 1HNEE 3QN7A 2ZA5A 3N7EA 4CRBA 3ZYEA 3URDA 4XBDA 1C5OH 3UNSA 3UB0A 1TNJA 1FN6A 1GDNA 4TT3D 1QJ1B 2A7HA 3QDZB 5T6FA 2OC0A 3EGKH 4AG2A 1O3JA 1HAZB 4RI0A 2A31A 4WF8A 3ZVEA 2Y6TA 1Z7KA 3V12A 2XBXA 1FN8A 1A2CH 1PPHE 5CHBA 2GCTB 3TH4H 2ZEBA 1SQAA 4WVPE 4Y79A 3SU1A 1Z8GA 1JIMA 4DCDA 2KAIA 1MH0A 2W3IA 5EIYA 1GBHA 1K1PA 1DLEA 3BTME 2FTLE 1C1RA 1EUFA 1OYTH 1LCYA 1VJ9U 2ZGXH 1GHXH 4FU8A 1TGCA 1LHGH 4XSKU 3HK6B 3SV7A 3KQDA 3UNRA 1JWTA 5T1VA 3A7ZA 3VGCB 1XMNB 3SYJA 2ZGBH 3OY5U 2CHAC 2Z6BD 2KZ4A 2PLXA 5EXNA 2QIQA 1FQ3A 1O33A 2SNWA 1O2VA 1KXDA 4GAWA 2P8OB 1G30B 3F0PA 4CR5A 3SJIA 1AUJA 4FUIA 4MNXA 1HIAB 1HAIH 3P70B 7GCHG 3FN8A 2FOCA 2CK3D 4ISNA 3HGPA 3V7TA 2FYRA 1BOQA 1KLIH 4ESTE 3QZRA 1CGIE 4VGCC 1Z1IA 2EI7A 2HNTF 3SV9A 3VFEA 2FIRH 2HVXA 5CDFE 1O2MA 1GG6C 3KF2A 3LKWA 1AB9C 1OWIA 1ZTLA 3TLOA 1GI6A 4AOQA 3TNTA 4DIHH 1AHTH 1DXWA 4FUHA 1ZYOA 1YPMH 4I8LA 4Q2KA 3EA7A 4AYVB 2BY7X 3SU4A 4JCNA 5EQQA 1P05A 1W0JD 1GHAF 2R9PA 4LXBH 5FBIA 4B1TA 2CV3A 2ZHFH 5FBEA 5L6NH 3U1JB 1C1NA 5EJLA 2QF4A 4CRAA 2XTTB 3T5FH 1C5XB 4DT7B 1ZZZA 2PWXA 2F4LA 1WQVH 2GZ9A 1CA0B 2V35A 3UPEA 1C5UA 1BHXF 5JYIA 3SNAA 4X1PU 5F8TA 1ANBA 1BTUA 4MQAA 4AX9H 1MU6B 3MFJA 1GVZA 1TGNA 4ZXYH 3F6UH 4ASHA 1J16A 4ZAEA 3LGTA 1NRNH 1W0ZU 1MCVA 5DPAA 3ZZBA 1JRSA 3OSYA 1O2WA 1WCZA 2RA0A 4DIIH 2CGAA 4E7NA 2O8MA 4JZIA 1WSSH 1SGYE 3E8LA 6GCHF 2CF8H 3RC4A 1DPOA 1FXYA 1GHWH 3E90B 4YXWD 4IN1A 2VH6A 3P8OA 1L0ZA 2QA9E 4YZUA 1A3EH 2BX3A 3KGPA 4Z0KA 3RXFA 3SJ8A 3QTOH 3SUGA 1GBLA 1UO6A 2BVRH 2J2UA 2PKAA 1YY3A 1BZXE 4K8BA 1QQUA 3O8DA 4OS1A 2ZZUH 1GMCF 1NN6A 1C5ZB 2FEQH 4DJZB 1GBDA 4FUGA 2J5UA 2GVFA 2XWBI 5E2PA 4YOJA 1TYNA 4ZCNA 2IPQX 3P17H 3ZV8A 1L1NA 1HBTH 1C5TA 4NA9H 3DSOA 3RXRA 1P3CA 4ISIH 1EPTB 2Z9JA 1ZSLA 1LQDB 2BM2A 1OX1A 3F2FA 3U1IB 2XYAA 1ELBA 3L3TA 1ZMLA 2TPIZ 3SUDA 5L2YH 3Q77A 1MBMA 2XOKD 4HFPB 2CHAB 3LDXH 4HGCA 4Z1MD 1FUJA 1A5GH 1XXFA 3MNSA 4K3JA 1DFPA 1KYNA 4JYVH 4Y8YA 3KYGA 3PMJA 1TMBH 4CR9A 4ZKOU 3QO6A 2BD5A 2ZNKH 1O32A 2BDHA 5H4IB 2BD9A 3PROA 1SR5C 3P8NA 1DLKB 3SGBE 2QC2A 5FPTA 1F92A 5E2OA 1OP0A 3A86A 1IQFA 1ABJH 1V6DA 3PO1C 2C3SA 3PLKA 2FZZA 4X1QU 2OINA 4ABHA 1PYTC 3GDSA 2BDIA 1VZQH 1ELTA 1O30A 1VITF 2W5EA 2Z9IA 5JBCS 3LIWA 1UHBB 4VGCB 1C5RA 4CHAB 2YNBA 2BB4A 1QL7A 4OS4A 3L6PA 1A4WH 2V7QD 1AB9B 1T32A 5GCHG 3ZIAD 3AASA 3RLWH 3UTUH 3M61U 4AGJA 1BRAA 1W12U 2ZDMA 4ABJA 1C5WB 2Y7XA 3A85A 3PTBA 2UWOA 2ZQ2A 2WUCA 4IBLH 3FANA 2CMYA 3ITIA 2VBCA 4E05H 1M9UA 3TPIZ 1HAHH 3K9XB 3HK3B 3D23A 1TPPA 2XCFA 1V2TT 1UJ1A 1O3AA 1O5AB 1ORFA 3DA9B 1IHTH 3D65E 4A1TA 2ANYA 3SGAE 3T25A 1MD8A 3A8AA 1HDTH 1LKAA 2FI3E 1SQOA 3RXKA 1YPHE 5B6LA 3U28C 3NKKA 1EX3A 1ZMJA 4YT6H 3Q76A 4RKOB 1G36A 2UWLA 2SGFE 3ZZ9A 3R0FA 2FOMB 4Y7BA 2FDAA 1YPEH 3E1XB 2ZKSA 4MDSA 1UTOA 3GCTF 1QBNA 2BX4A 2JETC 2OP9A 2FLBH 4ABFA 1EXFA 1W7XH 4X6PA 3TNSA 3ZVFA 4CRDA 1UK2A 3ZZ8A 1ELDE 5C5OA 5EXLA 2EC9H 5I46H 3D62A 1C5SA 2J95A 4GPGA 1OP8A 1QBOA 4DURA 1ZHPA 3LGWA 2ILNA 1C4Y2 2UUKB 4SGAE 1OSSA 1C2FA 3M5LA 4HG6A 2OK5A 1IQLA 2C90B 5DG6A 3TVJB 3M3TA 5JDUB 1PPCE 1EQ9A 1DWDH 3VPKA 4AG1A 4CREA 3VB6A 2OUAA 2Y5GA 1W10U 3ZZ5A 3GICB 1P0SH 2HVYB 4IMZA 3SU6A 3GY5A 1GI0A 2QXJA 1QA7A 3LPRA 3TH2H 1EOJA 1LPKB 2QE7D 2ULLA 4INHA 4X2WA 2JKHA 4TYDA 3RMLH 3EQ0H 3PV4A 1ZSJA 1UTNA 1CT4E 3A7XA 1G3DA 3MO6A 1O38A 5KEDA 3ZZ7A 1BA8B 1THPB 1GL1A 2AGIX 4UE7H 4NZQA 1C2IA 4A1VA 1TQ0B 5JPMH 1LDTT 1W3CA 1B0EA 2BMGB 2GD4B 3T28A 4Y10E 1WOFA 3TJUA 2RA3A 2OC7A 5F53A 1QQ4A 1LTOA 3UWIA 2FWWA 3T29A 2V6NA 1T4VH 1RD3B 1EZUC 2EQNA 3VB5A 2W6JD 2ZP0H 1F0RA 2UUYA 4ZHLU 2UWPA 2FOAA 3UQOA 3B23B 2AYWA 1RXPA 2V3HH 1UCYH 4Y71A 3A8BA 1CBWC 1HJ9A 4HZHA 1F0UA 1CGJE 2M5TA 3F2GA 3SNDA 4I8HA 4J2YB 3PWCA 1RS0A 3SHCH 1SC8U 4X8TH 1HIAA 2Z9LA 1DE7H 1D3DB 1NY22 1UTJA 3ZZCA 1P2OA 1BMFD 3SOSA 1UVSH 1SFIA 4AB8A 1BBRK 2J4IA 2VGCC 3RXTA 2SGAA 1YPLH 1ESTA 3FP7E 4WWYA 4NIXA 3M5OA 5JB9S 2ZDLA 1TMTH 1WAYB 2QF5A 4CH8B 3HKIB 2A7CA 4H6SB 8LPRA 2VIVA 3WWFA 1K1IA 4X8SH 3RMNH 1KXCA 1LQEA 1TBQH 1WTGH 2NWNA 2PKSB 1SOTA 4OS7A 2ZDKA 1P2KA 3OTJE 1H8HD 4CRGA 2BD4A 3ZV9A 3FAOA 5HIYA 1LKBA 1YPGH 1ARCA 4NIVA 1GI1A 3UWJH 8GCHF 4ZUHA 2QN5T 4I8GA 4P02A 2SGPE 1A0LA 4AFZA 1C2GA 4RSPA 4U30A 3AK5A 2RDEA 3KIDU 1HAVB 3SU3A 2RCEA 2FESH 1GMDG 2HALA 2NU2E 2VIDA 3UR6A 2IJOB 1CT2E 1G3CA 1MAXA 1NT1A 5DN6D 2ZPSA 1MTWA 1CHOG 4B2BA 2JIZD 1P8VC 5A0CA 2EEKA 1ETTH 3O8BA 1T8MA 2WPLS 1O2JA 1Z8RA 1W0YH 3UR9A 3SV2H 1YGCH 4F4OC 5DJ7A 5C1XA 1TE0A 1YWUA 3LGVA 5HYOA 3DT0H 4TY6A 1GL0E 4IGDA 3DSPA 4DW2U 2PGBB 1XUFA 2V3OH 2GCTC 1PPFE 1O2PA 2TGAA 1EOLA 3HPTB 4GHQA 4ABBA 2AIPA 1GBKA 4CH2B 4XRNA 3ZVBA 1H8IH 1NU9A 2UUJB 2A5AA 1GHVH 2CJIA 3W1EA 1HV7A 1V2KT 1JBUH 4Y11E 3VGCC 1BMNH 1AE5A 4WMFA 3SU0A 1LVYA 2AMDA 1SI5H 5DP6A 3SNEA 1BMAA 1XUIA 5DP8A 1QGFA 2VVCA 3TU7H 1MQ5A 2BY5X 2P8OC 5C1UA 1H9IE 1ABIH 2I6SA 1SGTA 4YTAA 1FY5A 2TGTA 5DP9A 1ZRBA 4Y8ZA 3BEIB 1EPTA 1SQRA 3Q00A 1D4PB 1RTFB 3A83A 3PTNA 1V3XA 4X6NA 4B71A 5HXFA 1UVOA 2FODA 3S69A 1FMGA 3SHAH 1MMJN 1GBIA 2BD2A 3MU0A 1VGCB 1K21H 4Y8XA 4WMDA 4NFEA 2W7UA 1P3EA 1S85A 1OPHB 2ZPRA 3A80A 2XC4A 3H09A 1MKWK 2G5NA 1O5GH 1UTLM 4BAQB 2GZ7A 3TGKE 1LVBA 3Q3XA 3SU2A 1GHBG 1J9CH 2GTBA 4IN2A 2YOLA 3SQHE 3SI4H 2VNTA 4GCHG 8ESTE 1FPHH 3S9CA 2XCNA 2VGCB 5EPNA 2LELA 3ZZAA 3NWUA 2CN0H 1UHBA 3SZEA 4X6OA 3EDXB 1W0KD 3A82A 2Y80A 1CA0C 2O8UA 4Q7ZA 2XXLA 1TGBA 1ESAA 2G51A 3EYDA 2EY4C 1AY6H 2DUCA 5KECA 1SHHB 1QBVH 2BDAA 2QXIA 2TRMA 3AVZA 1FI8A 2BHGA 1H9LB 1HCGA 2FOFA 2KR7A 2R2WU 2P93A 4FU9A 4K1TA 1VCWA 1CT0E 1S6HA 1IHSH 3FZDA 1DWCH 2ANKH 3TJOA 1P57B 1DY9A 1Y5UT 1AUTC 3RXCA 2Z9GA 1LVOA 4X1RU 1DUAA 3P6ZB 3WW7A 5F8XA 4WJG2 4OS6A 1QZ8A 3MU4A 1O3MA 3MH4A 1KTTB 3NK8A 3CS7A 1UTKA 1P11E 1YPHC 4B75A 1MTNB 4X8UH 1E1QD 3KQCA 3ZVGA 2KX4A 3F1SB
chains in the Genus database with same CATH topology
2XBVA 3M7QA 1BJVA 1UK4A 2BD8A 5AHGH 1NFUA 1DXPA 3A81A 2FO9A 2GP9B 3R3GB 1O5EH 4XE4A 3UNQA 1TX8A 4TPYA 7LPRA 1D3QB 4O9VA 1SLXB 4ISOA 2GCHG 1OWHA 1EPTC 4I33A 2BTCE 3A7TA 3LT3A 1AU8A 1ESBA 4Y0ZE 4QT8C 2VWLA 4JMYA 1C1SA 1JXPA 2OC1A 3GYLB 4ABIA 2F9PA 2FMJA 4X1SU 1YCPK 4PROA 1J14A 4RN6A 1BBRH 1O5CB 4LZ4B 1HAYB 2ZGJA 1TNIA 1UK3A 1H9HE 2BLOA 1N6XA 4U2WA 5A8XA 2PUXB 3OX7U 4X2YA 1JMOH 2ZCHP 3LH3A 3SJ9A 3EA9A 1ELGA 2D1JA 2QF0A 1KXAA 1V2UT 2FX6A 3HGNA 1EAXA 2FLRH 1D6WA 2ZHWH 1O2HA 1CSOE 3TITA 5GIBA 3PWBA 1NPMA 4MNWA 4CHAC 1C5PA 3BV9B 1BMMH 1RGQA 1K1JA 3SNCA 3TK9A 1FAXA 1QNJA 3PMAB 4XBBA 3VB4A 4DGJA 3PYHA 1C5MD 2D2DA 1K1LA 4K69A 2SGEE 2BXUH 5EW2H 2ZC9H 1MTSA 4K8YA 2FS8A 2FTMA 4THNH 2ZO3H 3MH5A 1GBFA 1XUHA 1AKSB 1RRKA 2VH0A 5SGAE 5B6OA 1RFNA 6LPRA 1DWEH 4BAHB 3S9BA 2Q6GA 4H42U 2O9QA 3M5NA 2C8WB 1HAXB 5EW1H 3LJOA 1RTKA 2BOHB 1GJ9B 5F6MA 1V2MT 3KHVA 1EATA 1HPGA 1UCYK 3GY2A 1ANEA 1SGFA 5GCHF 1TX6A 1A0HB 4ZKRU 2ZU2A 5T6GA 2C8YB 4O3TA 3K6YA 1HUTH 3DUXH 1TQ7B 1W11U 2V0BA 1W8BH 1XUKA 1ZPBA 2HRVA 3UUZA 1C1MA 1MTVA 3L33A 1FONA 3UOUA 1OWEA 3E6PH 5A09A 4NWLA 2A7JA 2FP7B 3BTEE 2XBWA 3SNBA 1DS2E 1AQ7A 1HGTH 2G55A 3BTFE 1EP6A 2ZGCA 2F9OA 2WV4A 2C4FH 1CGHA 2PV9B 2RG3A 1AVGH 1ZPCA 2WV5A 4A5TS 1C2KA 3SO3A 4MPWA 3RMOH 2SGQE 3A8CA 3LONA 2GKVE 3D49H 1VR1H 1TOMH 3ATMA 3KNXA 1TRMA 4O97A 4ZXXH 4ABGA 3MU8A 2XW9A 2FOHA 2ZCLP 4NG9H 4XOJA 1O3CA 5A0BA 3LGYA 2XRCA 1SVPA 2F9VA 1S6FA 2FM2A 3M36A 2ZHEH 5EOKA 2WINI 1MKWH 3A7YA 1V2QT 5DP4A 1IQEA 3BEFB 3M5MA 5A2MH 1JIRA 4B73A 2C8XB 2BYAX 1K1MA 3LU9B 2GZ8A 2Y7ZA 2QF3A 1GI7B 2HNTC 1SGCA 4NIYA 3VB3A 1CO7E 5EPYA 1W13U 4FXGH 1O3PB 5FPSA 1Y3VA 1DICA 2BXTH 3F9GA 3ODDA 4XFQA 1C2DA 3M3SA 1BIOA 2R3UA 4NA8A 1GBTA 2G4TA 1SG8B 1SSXA 3A89A 1BJUA 1V2OT 2WPHS 1O3EA 1GCTB 7KMEH 1T8NA 4D9QA 3SUFA 1V2LT 1O2ZA 4LOYH 1XKAC 1YM0A 1GHZA 4KTCA 2STBE 1DUEA 4YO9A 2O8TA 3QK1A 3MHWU 4WH6A 1OXGA 1HAGE 1YBWA 2Y5HA 1WQSA 1GHAG 2NU4E 2PTCE 1BTZA 1C4U2 2GX4A 1H1BA 1XVOA 1J8AA 5EU8A 1GVLA 3T26A 1UVUH 2I6QA 1K1NA 1GVKB 4BOHA 1K9OE 3O8CA 3QZQA 1TWXB 2A4OA 4X6MA 2H9EH 1UVPA 2GMTC 4GUXA 2FI5E 1PQ5A 4I31A 1SGFG 1Y3XA 2XNIA 1KXBA 2PKSC 3IWMA 1YF4A 4J1YA 4JZEH 1P2IA 2P3UB 1TONA 5FCRA 1WV7H 2GV6A 2BVXH 1WTHD 4FVDA 1LPZB 1RIWC 1PPGE 2LPRA 1NU7B 4WXVA 1C2JA 1W14U 3MNCA 1BRUP 1C5YB 1O36A 3U8RH 3CP7A 1YPJH 2TBSA 3E16B 2ZFPH 3M7TA 4GHTA 4AYYB 1DT2A 3VXFH 4OS5A 2OBOA 2IPHA 3CENA 3F9FA 5AVDA 1FY1A 4O3UA 5A8YA 1GI9B 4AFUA 1Y3UA 1TNGA 2H6MA 4INLA 3UOPA 2PFEA 1ZGVA 1GBCA 1YCPH 2ZFSA 4KELA 3SV8A 3TK5A 1SQTA 2OXSA 4UFDH 1TA2A 1NRSH 3QX5H 1SLWB 1GMCG 2Q1JA 5F03A 6ESTA 5HM2A 2ZPQA 2ZIQH 1IQKA 1GJ7B 1G3BA 4BANB 2Z3DA 2A4QA 1O3HA 4KTUA 3UQVA 4NA7A 2VWMA 1B0FA 1NRQH 1QJ6B 1OS8A 2ZDAH 3MYWA 4MG3A 2A2XH 1MTUA 1KIGH 7ESTE 1QHRB 1YKTA 3MTYA 1Y3WA 2KAIB 1GBBA 1X7AC 2ZWLH 5A0AE 1OWDA 1KXEA 4BTTB 5GDSH 3SGQE 1F7ZA 1MBQA 2B8OH 2A4GA 4WY3A 2K1QA 4X2XA 4IMQA 2ODQA 2BDBA 1N8OB 2BOKA 2P3TB 2ZU5A 3LC3A 1PPBH 2HPPH 1G2LA 2WUBA 2Y81A 1C4V2 3LGIA 4UDWH 1O2NA 1TGTA 3B9FH 1TX7A 5J4QA 1BT7A 1SFQB 3A84A 3KEEA 1BRCE 5DO4H 1V2VT 4Q7YA 1U6QA 5ESTE 1L1JA 4OGYA 3TGJE 1BB0B 2G81E 5HM9A 5JBTA 2O8WA 1Z6EA 3N7OA 1UTPA 1VGCC 1B7XB 1Y59T 2XC5A 1QL8A 2IOTA 3ATLA 1QL9A 1ELCA 3I77A 4A7IB 2QYIA 3NUMA 5L2ZH 5FHTA 4D9RA 1GJ4H 2FOBA 2ZFFH 3HATH 3RDZA 3ZYDA 1O3OA 2HPQH 1GI5A 5E0GA 1AMHA 1BHXB 2XC0A 3FP8E 3H5CB 1ETSH 2OQ5A 2Z3CA 1LHCH 1PPEE 5TCCA 2BY9X 2PSYA 1V2JT 2Y82A 1KLTA 1ELVA 3GY4A 2C93B 1G3EA 1F2SE 1QA0A 1S81A 1TLDA 2VJ1A 4NZLA 4BAKB 2GMTB 3RXHA 1D6RA 4K1EA 1DITH 1HFDA 4UONA 1ANDA 3LOXA 1O34A 1O2RA 1DX5M 1EJAA 1RIWB 2PUQH 2BVSH 3RXQA 2ZTXA 3H7OA 1O2TA 1EB1H 2C8ZB 2ZG0H 1V2WT 5C20A 1XXDA 2JH6D 1AKSA 1IQGA 1K22H 1LO6A 1MD7A 1FY3A 1MU8B 5FXLA 1FNIA 1O2GH 5CHAB 2A5IA 3F9EA 1GHBF 1D3TB 1QB9A 2QY0B 1P2JA 5EODA 5CE1A 1L4ZA 1NC6A 3RUOA 1JOUB 1KDQB 4GCHF 1Z6JH 1GWAA 1W2KH 1QRZA 3U98H 1PQ8A 5ESBA 1C2HA 1SLUB 1E36B 4ZROA 2Y5FA 4AN7A 1MTNC 4AFQA 1VCPA 5JBAS 3ZVDA 1TMUH 4NSVA 1S0QA 1EAUA 2R0KA 1QRWA 2FYQA 2YNAA 3MI4A 2WPJS 1YPKH 4ABDA 1V2NT 2A0QB 2STAE 3ZZ4A 1E0FD 1OWJA 3FP6E 3TK6A 1HJAB 1EJMA 1O5BB 4UD9H 2HGTH 1P06A 2IN2A 3RU4T 1Q3XA 3BG4B 5AF9H 1Z71A 3M7UA 1IAUA 5BRRE 1BBRE 1G9IE 1CU1A 3Q3KA 4B74A 1TPOA 3S7HB 3NPSA 2QXHA 1SMFE 4RKJB 3UY9A 1P10A 4DG4A 1Y5AT 1HB0B 3UREA 4AFSA 2EI6A 4A92A 3AW1A 1ACBE 1GI4A 1N1LA 1UTMA 2W26A 2GCHF 4FU7A 1GDUA 1AIXH 1A1RA 2G00A 3U8TH 1P03A 1SLVB 2ZDVH 2B5TB 2R0LA 4K2YA 3RXIA 2AH4X 1GJDB 4X0WU 4GVUA 2F9BH 5C5NA 2QV1A 1NESE 2ZHQH 1GPZA 5C67A 1BTYA 4YT7H 1BITA 3RP2A 3TGIE 1NRPH 1YC0A 3PMHB 1C9PA 3F9HA 1AFQB 1EB2A 2VWNA 2VIWA 2ZU1A 3RM2H 7GCHF 1ANCA 4BAOB 2OTVA 4SGBE 3RXLA 1FDPA 3QGJA 4LK4A 2HLCA 3C27B 1UMAH 1T4UH 3RXAA 1AWFH 1ZRKA 4GLYA 2LNCA 2CXVA 5G4BA 1TB6H 1EKBB 2VINA 2PGQB 3BEUA 1Z1JA 2FPZA 1HLTH 1BRBE 2A2QH 2BDCA 1A5HA 2AMQA 3MNXA 4IC6A 1GI3A 2PW8H 2G4UA 2VIOA 3TJNA 4TPIZ 1HRTH 1O3BA 3GCNA 1SGQE 2XBYA 1VJAU 4TWWA 1ZJKA 2ZF0H 5T3HA 4A6LA 1TALA 1TNLA 1LPGB 1FLEE 2BDGA 4X8VH 1E38B 5AFZH 5GXPA 1O35A 3VB7A 3Q3YA 3GY7A 2F9UA 4I8JA 3TH3H 5LPRA 3LH1A 4JZ1A 3GY8A 2HOBA 5PTPA 1PFXC 1AZZA 2ZECA 3S9AA 1T8LA 3QWCH 2VIQA 2H9HA 1GMHG 1EASA 3JZ2B 9LPRA 2TIOA 1HXEH 5EXMA 1G32B 3RXVA 3IG6B 5F8ZA 4WH8A 2QXGA 3PLBA 4BTIB 1IQHA 3E0PB 3BTTE 1FY8E 3GY6A 1BTPA 3NXPA 3BTHE 2FOEA 3OY6U 5HMAA 4D7GA 1F0TA 3GCOA 4AZ2B 3EAJA 1SOZA 4BNRA 3M37A 1ZHMA 3ATKA 4DY7B 1T31A 4YM9A 5DK1A 1XKBC 1GGDB 1AFEH 5L30H 2J38A 1T7CA 4MPVA 1QTFA 2B0FA 1ZLRA 2DE8A 3NZIA 4IW4E 1O3NA 2BD7A 2Z3EA 2SGDE 3A88A 1FJSA 2ESTE 1P09A 1GCTC 1OKXA 4MPUA 3PM3A 3RXUA 1SL3A 1ZHRA 5EGMA 1PQ7A 1MZDA 1XX9A 1K1OA 3STIA 4B2AA 5HGGA 2SNVA 3RXMA 1THSH 4JK5A 2H2ZA 1AO5A 3BTWE 2VVUA 1SPJA 4YESB 1SGDE 2H1UA 1GBEA 3W94A 1ZJDA 3K2UA 3BF6H 1C1PA 1SGRE 3UIRA 2Q6FA 1LMWB 1LHEH 1ZTKA 2NU0E 3SI3H 1AGJA 1FIZA 1OP2A 4ISHH 5ETXA 3MWIU 1W7GH 4Y7AA 1DANH 2EI8A 2FOGA 2O8LA 1AN1E 2AERH 1KTSB 1Q31A 1Z8JB 3GCHC 1C1QA 2AEIH 3KQEA 4Q80A 1E34B 4K5ZA 4HTCH 3RLYH 3MH7A 5IDKA 2P3FH 2GT8A 4A1XA 4HI3A 4IS5A 1O2QA 1P9SA 4JZDH 5IYTA 3DFLA 1A46H 1C5QA 1KLJH 3BIVH 1QCPA 1MKXK 1DSUA 3SN8A 3ODFA 3QUMP 3A7WA 4TWYA 1PYTD 1P01A 1RTLA 3BTKE 2HWLB 2DE9A 1C5VA 1YP9A 1CVWH 2Z9KA 2GT7A 1N6YA 3ZZ6A 3TIUA 1GI8B 2ZFTA 1NFWA 4JYTA 4Z6AH 5BPEA 1TBRH 4CBOA 1C2EA 1Q2WA 3HKJB 3MMGA 2B7DH 1HAVA 1KDQA 1FAKH 3E0NB 4AORA 1AD8H 1P12E 3SQEE 1E37B 3RXDA 1A61H 3W95A 4B2CA 2ZCKP 3RXJA 1ZOMA 2PSXA 1THRH 2NU1E 3AAUA 4JZFH 1O37A 1ZGIA 4K1SA 1A0JA 2UUFB 3TJVA 4TY7A 1SGNE 1JRTA 4F49A 3JZ1B 1O39A 2GV7A 4FVBA 1N8OC 6CHAC 1XUJA 3MOCA 1SBWA 3S7KB 1QURH 3VXEH 3V0XA 1ZSKA 1TAWA 4YLUA 3PLPA 4UFFH 1HAOH 2QCYA 1VITH 4H6TA 5LH8A 1GBMA 3SORA 1O3GA 1WYKA 2W3KA 4U01A 5DP5A 4Y6DA 4OGXA 2TGPZ 3GISB 1CHGA 1GJAB 1O2OA 4ISLA 4YOIA 3BTGE 1INCA 1O2KA 1SGIB 1C5LH 4CRCA 1UCYE 3F68H 4MPXA 1ZTJA 2FXRA 4FUJA 2AFQB 1O3IA 2Q6DA 1SGEE 2VWOA 3FVFB 1TGSZ 2A1DB 3U8OH 1O0DH 4YOGA 2SFAA 4E7RG 2G8TA 1O2YA 3PMBB 1O3KA 4DVAU 4NSYA 5K0HA 4K60A 2WYJA 3SW2B 3LJJA 1YLDA 3A8DA 4Q7XA 2ZFRH 4BTUB 3VEQB 1C1OA 3IITA 2D26C 5DP3A 2F3CE 1F5KU 3K65B 1H4WA 4CBNA 2AS9A 2F91A 3FZZA 3ENSB 1BUIA 3URCA 2ODPA 9ESTA 2H9TH 4X1NU 1G2MA 2FS9A 1F5RA 1P2MA 2BLVA 1T8OA 1LHFH 1GG6B 1YLCA 1KSNA 2PHBA 1DOJA 1O2UA 3GCHB 3RXGA 4H4FA 2F83A 5FPYA 2ZI2H 2ZQ1A 2P95A 6GCHG 3NCLA 4DOQA 1UVTH 1GJ5H 3SJKA 2Z7FE 1AZ8A 5CHAC 1Y8TA 2VU8E 3RC5A 2VIPA 1BQYA 3ATWA 3BTQE 1EZQA 5I25A 1GHYH 2ANWA 4NWKA 1FY4A 2TGDA 3AAVA 3STJA 4ABEA 1LVMA 4UFEH 2VB0A 2BQ7B 1O5FH 4WMEA 5LPEA 3H7TA 1IQJA 1Y3YA 3MNBA 3K6ZA 1C1VH 4JK6A 4UFGH 3AW0A 5FX6A 1AVXA 1D9IA 1DVAH 1IOEA 3S0NA 5EG4A 3RXPA 3ATIA 3T27A 1BMLA 1GDQA 1FV9A 3KN2A 3OYPA 3RXBA 4CRFA 4YLQH 2H5CA 2NU3E 2W7SA 1IQNA 1BCUH 1C1WH 1HJAC 3MO9A 2AIQA 3ZZ3A 3MO3A 5TCAA 3ELAH 3GY3A 4D7FA 1TIOA 2QAAA 3RMMH 5ABWA 5TJXA 3ZZDA 1GMDF 1P9UA 3BG4C 1TABE 1EAWA 1CHOF 1BTWA 4MVNA 3GDUA 1EAIA 1P02A 2JH0D 6CHAB 4KP0A 1E35B 1Y5BT 2ZU3A 4MLFB 1A3BH 1HXFH 5JBBS 4I32A 3M35A 2VVVA 4NIWA 1OWKA 1ELEE 1IQMA 4KKDA 4MNVA 1QB1A 3U69H 2OQUA 1GBJA 1O2LA 1VITG