3MFKA

Ets1 complex with stromelysin-1 promoter dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein C-ets-1
publication title Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mfkA00
3U9GA 1XCVA 4N9IA 1FOKA 1S29A 3T0YA 5BPIA 2FEZA 4I01A 4KN7X 5CYVA 5LHHA 2MC3A 4RS8A 4LB6B 3Q5FA 3ZMUA 1BN5A 3EYYA 3EETA 5DCMA 3OV8A 3WGIA 5ILVA 2HYFA 1TQPA 2FBKA 1OMIA 5HDKA 4GXOA 2M5WA 1OKRA 3KLOA 1IN6A 4HQEA 1ZAOA 4IJAA 1KU9A 5D5VB 3LFKA 2DQRA 5FLXZ 2BV6A 3E5XA 4WF2A 2OAZA 4QLCU 4U0VA 4HZFA 1KQ8A 2QQBA 4UNOA 1QO0D 2UZKA 2EB7A 2JPBA 1J5YA 5K1YA 2FSWA 4XLPF 1XGOA 4MQVA 1YLFA 3ZMTA 3DP7A 2ZKZA 1G4DA 2J5OA 1J59A 2W24A 4IRIA 3R4KA 1IRFA 3JTGA 2UWMA 2VBWA 3F21A 2FA5A 2JSCA 1Z1DA 1SD7A 5HOOA 5E18F 1REPC 2XASA 2QVOA 3HRMA 1SD5A 1S8NA 4HLXA 2PLYA 4ESJA 3GYHX 1BI3A 3F3XA 2DI3A 4IXAA 3C1DA 3WE2A 3WU0A 2FNAA 1W7PB 5E8GA 5LBQA 4AIJA 3CJNA 1GXPA 1Z6RA 1JGSA 2ZXJA 1KU3A 2ZCWA 2Q0OA 3MEXA 3N97A 2LF8A 2F5DA 3PQJA 3TKYA 5KK1A 1IXCA 2R7FA 3RKYA 4FHTA 5J6XA 1BIBA 2EA4A 4QWQA 2XHKA 4OMYA 2H6BA 1UHWA 1FC3A 4KDPA 3T5XA 3ZMZA 3MCZA 2GA1A 5F64A 4LG0B 1I27A 1YFHA 2V1DA 2BE5F 5DEQA 2XAJA 5BPDA 4UUVA 3HTUA 4AVPA 1FY7A 2NAZA 2MA3A 1R23A 2GIVA 5LRSA 5FD6A 3GF2A 5L3EA 1B59A 3FF5A 2F5FA 1X3UA 2F2EA 3IWFA 2XAHA 4GO1A 2W85A 3IKTA 1YS6A 4HF0A 2P6TA 3BPXA 1ZN2A 3DPTA 5CVIA 3ZN1A 4EJTA 3KEOA 1PUEE 1R1UA 5LRRA 3VODA 3KLNA 4OOIA 1LQ1A 2VOPA 3GUDA 2QLZA 4GYGA 3CUQB 1I1SA 4DQ2A 1FYLA 3GLXA 3K1MA 3DXJF 2M30A 4Y13A 2G7HA 2EFPA 2KIUA 3M7GA 1FP2A 2M8EA 4N0BA 5D4SA 3QPTA 2E7XA 5LHGA 1ZRDA 4CICA 2A69F 1OYWA 3T8TA 3NEUA 1T6SA 2Y48A 4FT8A 2VBXA 2L02A 1T0FA 4A0XA 5DYMA 2DPDA 1XB4A 4Q4ZF 3G3ZA 1XD7A 4EGYA 4I2OA 3K69A 3HTSB 2WTEA 3TO9A 2EV6A 2P7CB 5IT9K 3KETA 3WTTC 1KU7A 1XGSA 4KIFA 2PQ8A 1OYYA 3IL2A 5ILUA 5DD8A 2KRFA 4HV6A 1KQ0A 3GZ5A 5ICFA 2P5VA 3MZYA 5E1WA 2IPQX 1OPCA 5EEHA 2NYXA 1BI0A 1U5TB 1G3TA 3QP6A 3FM3A 2K02A 1WKMA 4KT5C 2BYVE 1HQCA 4M9ZA 2A5YB 4D0PA 4WK8F 3FZVA 2DK8A 3WTUC 5J8CA 3CO6C 1O3SA 1R5HA 2Z33A 1XDUA 5HVQC 2J5PA 4EJOA 4KMFA 1CF7A 1FT9A 3OOPA 1YIOA 2FMLA 4P96A 3F8NA 5HS7A 2P8TA 3P7NA 2ISZA 4H0EA 2PI0A 5AIQA 4CGZA 1QQIA 6PAXA 3GFLA 4OIRF 2DT5A 3BROA 3LA3A 1GXQA 1U3EM 1PDNC 1EH6A 4EJVA 3E3VA 5AONA 5CVRA 3KP3A 1K78B 1SFEA 1PP8F 4F7ZA 3BY6A 2RVCA 1U2WA 3QU3A 4A12A 2EV0A 1LNWA 1ZARA 3LQQA 2FBHA 1JE8A 4JBAA 4HX4A 2VONA 3R60A 4YIFA 5IT9Z 5JFRA 4FX4A 1STZA 2DU9A 1SMYF 2GXGA 2O3FA 4A5NA 1F5TA 1QNTA 1UB9A 4EMSA 2CG4A 2QM3A 2RN7A 1GVJA 3E5UA 2RQPA 2VN2A 1QZZA 2DAOA 2HQNA 2OBPA 2FU4A 5D5UB 1O3RA 2K4BA 2G7UA 2VC0A 4KUMA 1MDMA 3JAMK 4MEYF 2JPCA 4HDVA 2R7DA 4ZH4F 2ZJ2A 4P55A 3KCCA 3HIFA 4M72A 1YW7A 5LGNA 5BOXA 1MJ9A 4BYYA 1G3YA 3NRVA 4XBFA 2UXNA 1Z05A 5FLXK 1K79A 1J75A 1FBUA 3TO7A 4O3MA 1J7KA 4R79A 3SZTA 3J7AO 4LLLA 1ZGAA 2HTJA 1Q1HA 5F6FA 4Q5SF 4M6XA 4CO8A 3ZPLA 4UV9A 4P9UA 1EH7A 1YW9A 1MZBA 3M8FA 5D6EA 3KZYA 1DPUA 2FRHA 2HQRA 1MKMA 3CTAA 1AOYA 5L3BA 3HYIA 1WWXA 3F8CA 1BM9A 4LK1F 1BI2A 3S2WA 1DP7P 3I4PA 2L4AA 3F8MA 3B02A 3MAJA 3C7JA 3ZMSA 2XKOA 1FPQA 2A68F 4BNCA 4L0ZB 4AD9A 4EVIA 5FFXA 3IRQA 3ABTA 2X0LA 3KP2A 1JHHA 2ESNA 2X4HA 4BHCA 3P9IA 5D4RA 5ICEA 4PZJA 1QPMA 3GFIA 2AXLA 4I7HA 1J0RA 1DUXC 2WWYA 1EH8A 3LAPA 4GYIA 1IN8A 1CGPA 1XSXA 3KFWX 2P4WA 3KP7A 2LSOA 2DTRA 2ZNYA 5D6FA 5D5XB 2HYGD 3WTVC 3SFZA 1H0MA 4WXHA 3JAMZ 2PN6A 3VB2A 2IA0A 2K86A 2PG4A 3RPUA 4HAMA 1FSEA 1EV7A 1R1VA 1YYVA 2EV5A 2HDCA 4L18B 3DV8A 2ISYA 1GHCA 1FNNA 3K1PA 4IF4A 2W25A 2GXBA 1P2FA 3J80K 4MQ9F 3ISPA 5J8FA 2IRFG 3EUHA 5DUKA 3WE3A 2RV8A 3JSOA 3BWGA 4AIHA 2QUFA 2PMUA 4IHTA 1ZREA 4OIOF 2VODA 4HF1A 5E8IA 5H6RA 5BQTA 1V4RA 4ENNA 4NB5A 3KP6A 2XUBA 4I0AA 4EM2A 3CDHA 2YX4A 1R5GA 1P4XA 1ZRCA 2RNJA 2PJPA 3F23A 5CLSA 1OR7A 1R58A 1UHMA 5BS6A 3HRSA 4OMZA 2L4MA 1TNTA 3QU6A 3I54A 1SAXA 3FHZA 3W6KB 3ECHA 3GFMA 5IT3A 3G73A 3L9FA 1R00A 2ZFWA 2XRNA 1YTYA 1USSA 1P92A 3V7CA 4LD5A 1PP7U 1S7AA 4OU0A 2HS5A 1P6RA 3E6BA 3E97A 2Z3YA 1F4KA 1U78A 3KP4A 2FQ3A 2AS5F 3FXUA 3KZZA 2OA4A 1HW2A 2MH2A 3EYIA 2EJRA 1FP1D 2VT3A 3V8JA 2IJLA 2QENA 4HLYA 3V8KA 1YG2A 1TQMA 2IVMA 3HSEA 3H3UA 1KYZA 1W7PA 2W57A 1ZH5A 3J80Z 5FO5A 2JZYA 3M9AA 1T2KA 2YX7A 4L9NA 3I71A 4G94A 1P4WA 5CVVA 5HLHA 3LAJA 5DD4A 2LNBA 3TDUC 4YIIA 2D1HA 2E1NA 4G7HF 1IZ1A 4LB5A 2HZTA 1H9GA 2E1CA 1KGSA 4LG0A 4CDGA 1D3YA 1ODDA 1IN4A 2ETHA 3FXQA 1HKSA 5JVTA 3WGGA 1FYKA 2DW4A 3GFJA 1D8JA 3SQNA 1XN7A 2CYYA 3M8EA 3ERED 4UVCA 2DQLA 1U5TC 3MZHA 4EQQA 2L3DA 2CWEA 4PGHA 1H9TA 5JI6A 1LVAA 1T38A 2H6CA 5L3CA 2DLLA 3I0TA 5CVUA 1R22A 2ELHA 3K2ZA 1D5VA 1YQAA 5JHUA 2EFQA 2G9WA 2DK5A 2NS0A 2XROA 2VC1A 4IRGA 1G6NA 3DKWA 4LMYA 1K6OA 3O6BB 3RYPA 1TW3A 5E17F 2GWRA 1TBXA 2Q2EA 1VTNC 2VE9A 2V1UA 3BJ6A 2BBYA 3GO5A 3HSRA 3ULQB 1FBQA 1R7JA 2BEOA 1XCBA 4L5JA 3LA7A 3GVAA 2JTVA 4G8XA 4RB3C 4G9YA 1KYWA 4O5VA 4YG2F 4YFXF 5ILSA 5D8KB 1HSTA 3QRFF 3RTRA 4GCVA 3I64A 3QPHA 1G3SA 2DBBA 3W6JB 2DO7A 4GGGA 2NNNA 2HEOA 2A6EF 4LJZF 5LGUA 1RUOA 4HA8A 3D5LA 2LKPA 2CSOA 3R0AA 1HW1A 1Z9CA 3BDDA 2BGCA 4A6EA 3FWEA 4BHPA 3M1EA 2F5CA 2XIGA 4YFKF 5LEKA 3PQKA 2V1XA 4FX0A 2FE3A 3CO7C 2ACJA 3VEPA 2V79A 5FFZA 4MHGA 3E6CC 3H92A 4BXUA 3K1NA 1BOAA 3REOA 5FB2A 2Z9OA 4ENJA 3SXYA 5HDGA 1RI7A 5HDNA 2ZMEB 4I98B 4N9HA 4M74A 4ENMA 4M9SA 3NQOA 1O57A 1U5TA 5LLQA 3TDZC 1XGMA 1IW7F 1YW8A 4MNUA 2FF4A 4OINF 5K5OA 1BC7C 3ML6A 4ASNA 1FX7A 1FLIA 1G3WA 5AIPA 3ZN0A 3Q9VA 5L3DA 2PEXA 3F6VA 2NRAC 1BBYA 2YR2A 2XAFA 2NNYA 2EWNA 1KQ9A 2GQQA 4PDKA 4IVNA 2FMYA 1JHFA 1W7PD 3T1BA 4WX9A 2XAGA 1FYMA 4WWCA 2YPRA 2STTA 1S6LA 4CXFA 4MTEA 4U7DA 2HFHA 1V3FA 2QBYB 2FBIA 4PGGA 2Q8KA 2A61A 3Q9SA 5F1RA 4WCGA 1K78A 5E1XA 5ERIA 4U7BA 3ROUA 3GEZA 3I59B 3TQNA 2HKXA 1K7AA 1D8KA 4Y15A 5K5QA 3IHUA 4RGUA 5CJ9A 1XSDA 2UXXA 3E6MA 1XGNA 1TNSA 4A2UA 5ICCA 3DPLC 4HF2A 4LFUA 4JQFA 5EEGA 2L01A 4E70A 1ZG5A 4IRHA 2MBFA 2O0YA 2QQ9A 1IXRC 4KIGA 4ZYDA 4G6DA 2VOOA 3O2PE 2FXAA 3RI4A 2PFBA 3BJOA 2STWA 1HW5A 3ZMVA 4HDUA 1ON2A 2PMHA 2H27A 2OZ6A 2XV4S 4UV8A 1XSVA 3TOBA 5LGTA 3WODF 3FXRA 2CFXA 1WQ2A 2ZNZA 4RAYA 2MLGA 1HBXG 4ENKA 4K2EA 3U1DA 1W5TA 2HGCA 4KFCA 3F6OA 1W5SA 2K27A 4G6QA 3QOPA 2RC4A 4LK0F 5DCMB 1XMAA 4R1HA 4KA4A 4DNCA 2A6HF 3VFZA 1LDJA 1SFUA 2LF7A 1W4MA 1BC8C 1J9IA 2KIMA 2QYOA 1AWCA 1SMTA 5A2QZ 2HTSA 4L9VA 2EA2A 5L3FA 4RGXA 1O3TA 3SZPA 4EM1A 1LEBA 3E6DA 2IW5A 3GX4X 1B9MA 4BAYA 4HQMA 2VXZA 2KKOA 4LGWA 1LB2A 2XVCA 4HX8A 4O6JA 4ESBA 3WTZA 3HHGA 4EV0A 3L09A 3HOTA 4WXCA 5BMZA 2RKHA 3DFGA 2M45A 5ED4A 2QZ8A 1Z6TA 4ZYGA 3HHHA 4MEXF 3TGNA 3T8RA 5DUIA 1RUNA 1XDSA 2H94A 3TO6A 4IHSA 1E17A 1HSJA 4ZZDA 3WTSC 2A3SA 3LQRA 5HLGA 2V6CA 1DDNA 1T98A 4Q48A 1Y0UA 3FMSA 4EM0B 1ZG1A 4G7ZF 5H6QA 3V4GA 4HV5A 1O7FA 4EJUA 2D45A 3P9CA 4L0YB 1IAWA 1ZYRF 3AAFA 3IKVA 1LDKB 4HW0A 2IP2A 4G7OF 4B8XA 1L3LA 1USTA 3CUQC 1TLHB 3GXOA 1JXSA 4UHTA 3LSTA 3I53A 2O8XA 1ZLJA 1QBJA 3L7WA 1KA8A 3SHFA 1C0WA 4L5IA 4A0ZA 2QQAA 5HLIA 2PBIA 4HOBA 2Y0MA 2OD5A 2DFIA 1TW2A 3PFIA 3F22A 2IA1A 2M87A 3RYRA 2GAUA 4M6YA 4OIQF 3D0SA 3HUGA 1WSUA 2EFOA 3BOQA 4XLNF 4EJWA 2HR3A 4I02A 3ZP5A 1BIAA 1E2XA 3BPVA 4KICA 3FM5A 4RGSA 4BQAA 2WC2A 3DEUA 4U0WA 2GZWA 1HXDA 3F8FA 5LHIA 5DDGA 4BH9A 4JK1X 1P4AA 5CVJA 4AWXB 1ZLKA 3BP8A 4KNYA 1DPRA 3DQVC 1S7OA 3WTXC 2H09A 1I6XA 1U6GA 1XMKA 4UXNA 4ON0A 2P7VB 1UFMA 2TDXA 4CYDA 4KN4X 2D2WA 3RKWA 2W84A 5H20A 4L9TA 4M73A 1O7LA 1U8RA 1FWZA 2MH9A 1ULYA 3L00A 3LA2A 2ADUA 2XAQA 2K7LA 1TTYA 2CQKA 4HX7A 4XSXF 2COMA 3RDIA 2CO5A 4UVBA 2P5KA 3ECOA 5FGMA 1ZG3A 2M1BA 1IUYA 3ELKA 2KIFA 3C3WA 2D1VA 1L0OC 2CGPA 4KIBA 1SFXA 4RGRA 1SD6A 4LLNA 3MFKA 5DV5A 3GWZA 2VBYA 4M71A 2OQGA 5HS8A 1IXSB 3CUOA 4AIKA 3B73A 3CUQA 5ICGA 3JTHA 5JR3A 3BJAA 1Z7UA 1B4AA 1WRJA 3F72A 3GW2A 3IWZA 4ETSA 1RZ4A 1BI1A 2OZUA 2Z99A 4S04A 3DF8A 4P9FA 2OQRA 1IF1A 4RB1A 4ZYHA 4LLGF 3C18A 1QZYA 1R1TA 1TQIA 3RJPA 2XGXA 2ESHA 2C6YA 1NHAA 3HSFA 3JSPA 4KMUX 2B0LA 1FBSA 4ESFA 1UCRA 4MTDA 3P9KA 4P5OA 1LJ9A 1BJAA 1ON1A 2O03A 4ZYEA 3K9TA 4OIPF 2OU2A 1IN5A 3VOEA 5KVRA 2MD5A 2KJCA 2HKOA 1T39A 5HS9A 1R36A 3FMQA 3MWMA 1CF7B 1SD4A 2VBZA 3WTWC 3WGHA 3JW4A 3ABUA 3COAC 4CHUA 1HKQA 2YSRA 1OYIA 3WTYC 5LEJA 2JRTA 2ZBKA 2XKPA 4KYWA 1IN7A 1MJAA 1RIOH 4CZZA 1F9NA 4A6DA 2VT2A 2L54A 3KEQA 3FMRA 2RDPA 4B09A 4S05A 4RB2C 3HRTA 1B6AA 1I1GA 3HOSA 2R3SA 2MLKA 4NHJA 4XSZF 5E20A 5D5WB 3RKXA 1J2XA 3RPQA 3HRUA 1B9NA 1MJBA 3GZ6A 2EK5A 3WG9A 2QWWA 2ZMEA 3V7RA 3FX3A 2JT1A 3O3KA 4XRFA 1I5ZA 5DCFA 5E1ZB 3QAHA 3CLOA 2Y75A 4U0YA 3V7SA 3J81K 4RB0A 1Z91A 3N4MA 2A07F 1A04A 2FNPA 1MGTA 1MDMB 1FZPB 4TV7A 4M9XA 3MQ0A 3QP5A 2WV0A 4UVAA 3R0JA 1HKTA 4I09A 5D8LB 3E5QA 2IT0A 4HYEA 4MGRA 5A2QK 2FOKA 3EDPA 3L2CA 4Q47A 2HOEA 4BHBA 3U2RA 3F8BA 3KE2A 2P5LC 4U88A 1S3JA 2O6GE 4L9JA 3R6SA 2ZO4A 3I58A 2QBYA 4RAZA 2F5EA 5FD5A 3IC7A 2HWVA 3V8LA 4R8HA 3R61A 1ONVA 2KJBA 3I59A 4A0YA 1ZRFA 3ZQ7A 2EFWA 2Z5UA 4HBLA 1KU2A 2CW0F 5L3GA 2EFNA 1O3QA 1YS7A 2DPUA 3WU1B 3KP5A 2IA2A 4YFNF 1F1ZA 1YO5C 2K4JA 3I5UA 2YU3A 3IRRA 2VE8A 1B1BA 2LDUA 4WXDA 1FSHA 4IPAA 2RGVA 3EQLF 4PCQA 5TJJA 3BZ6A 1ZGJA 1WI9A 2P6SA 1LEAA 4EGZA 2V9VA 5TRDA 4ZZLA 2GA2A 4Y17A 3RIRA 3ZMDA 2E7WA 1MD0A 1RNLA 3LWFA 4NQWA 5K5RA 2O61A 4A5MA 3J81Z 1LDDA 1QGPA 1ZHFA 4Z2YA 4I0BA 3TOAA 1IRGA 3H3ZA 3K0LA
chains in the Genus database with same CATH superfamily
1MMAA 3U9GA 1XCVA 4N9IA 1FOKA 2R5ZB 1S29A 2Y9YA 3T0YA 3WG7H 4XONA 2LR8A 5BPIA 2HOAA 5JLWA 5IOYA 3I56I 5IY5H 4V2GA 1RESA 2FEZA 2WV1A 1R49A 4I01A 3HBLA 4XICA 2VPLA 4KN7X 5CYVA 2CV0A 2H1KA 3A03A 4RLQA 2OF7A 3FISA 5LHHA 1OCZH 2MC3A 4RS8A 4LB6B 3A01A 3Q5FA 2DXIA 1ETQA 1X1AA 5EGOA 4F55A 3KYLA 3ZMUA 1BN5A 3EYYA 3EETA 2XSDC 2PJRA 5DCMA 2DFHA 3BTCA 4HEA2 5F08A 4CUGA 3HOZJ 3OV8A 3M3YJ 3WGIA 5ILVA 3CF5F 2HYFA 1TQPA 4DYCA 2FBKA 1OFCX 1HDPA 1OMIA 3LSJA 2R5YB 4RDUA 3BLYA 5HDKA 4GXOA 2M5WA 4I99C 5KAIC 1QPIA 1OKRA 2OCCH 3JRGA 4J00A 3KLOA 1RR7A 1IN6A 4HQEA 1E0EA 1ZAOA 3BG3A 4IJAA 1KU9A 2FQ4A 5D5VB 3LFKA 2DQRA 1OCRH 4F93B 3K4JA 5FLXZ 2DJNA 3LSGA 2BV6A 4ZDPA 2EIJH 3F9KA 3E5XA 4WF2A 2OAZA 4QLCU 3ONQA 3S17J 4U0VA 4HZFA 4BY7J 2R0QC 1KQ8A 1OQYA 1YE9A 2QQBA 1ETKA 1QO0D 1ZR2A 4UNOA 3AKZA 2UZKA 3I9V2 4RM2A 2DOEA 3OYJA 2EB7A 5JHFA 2JPBA 2R7ZJ 1J5YA 3HG9A 5K1YA 3LL7A 1ZGWA 1Y0NA 1PUFA 4ITVA 2FSWA 4XLPF 1N75A 1XGOA 2OUMA 4MQVA 1YLFA 4IL6C 3ZMTA 1X1CA 3DP7A 2NS8A 2ZKZA 1G4DA 2J5OA 1J59A 2IS2A 2W24A 2O7OA 2CUJA 2EIMH 3BR3A 5IP7J 1YI2I 4IRIA 3R4KA 1IRFA 2BY1A 3K10A 3JTGA 2UWMA 2VBWA 1XTAA 4AVZA 4IZZA 3AG2H 3DU5A 3F21A 3RZDJ 2E36A 2VI6A 5KCMA 3WU2C 2FA5A 2JSCA 1IV8A 2VQCA 5FKOA 3IV5A 1Z1DA 1SD7A 5HOOA 5E18F 1REPC 4B47A 2XASA 1GV2A 2QVOA 3E0JB 3HRMA 1SD5A 5M5XJ 1R4NB 1S8NA 1GT0C 3VWBA 4HLXA 1IJWC 2PLYA 4ESJA 2CUEA 3GYHX 1BI3A 1D0YA 3F3XA 2DI3A 4IXAA 4BY1J 3C1DA 2ID3A 4BEHB 3WE2A 2O8KA 2VQHA 3ZQLA 1T0FC 3WU0A 2FNAA 1W7PB 5KNLA 5E8GA 2ZSHB 4F92B 5LBQA 4AIJA 3CJNA 1GXPA 1Z6RA 1JTYA 4OAYA 4KISA 3ERMA 1JGSA 3HKZA 2ZXJA 4B1RA 3VYTB 2MW8A 1KU3A 2ZCWA 2Q0OA 3MEXA 3N97A 2W1OA 2LF8A 2F5DA 4II3A 3W2AA 3PQJA 3TKYA 4HSRA 1X3ZB 5KK1A 2Z16A 1IXCA 2R7FA 2YUSA 3RKYA 2XGDA 2VJ5A 1N77A 2K9SA 3OYEA 4FHTA 1MH4A 5J6XA 1BIBA 2EA4A 4QWQA 5JVGF 2XHKA 3CMEI 2G0EA 2V6EA 3CCUI 4OMYA 3O8HA 2H6BA 1UHWA 4XM3A 1FC3A 1OLTA 4ANJA 3K70C 4KDPA 3T5XA 3ZMZA 2HPMA 2NVYJ 3LOCA 1JUMA 4AUXA 3MCZA 1F36A 2GA1A 5F64A 1YJWI 4LG0B 3H5RA 1I27A 1YFHA 3G2BA 1AHDP 2V1DA 4M3DA 2BE5F 5DEQA 5K7HA 2XAJA 2JWTA 4QPQA 5BPDA 4UUVA 1MIJA 3OIOA 3HTUA 4AVPA 1FY7A 2NAZA 2MA3A 4AC0A 4D5FA 1R23A 2GIVA 3Q0WA 5LRSA 3CD6I 5FD6A 3GF2A 5L3EA 1B59A 2HZDA 3L1PA 4X0GA 1P7IA 3FF5A 2F5FA 1X3UA 5J4VA 2F2EA 3ZQIA 3IWFA 5FRNA 3S2DJ 2XAHA 4GO1A 2W85A 3IKTA 1H88C 3K7AJ 1XPXA 3C2GA 2KDOA 3D1NI 1YS6A 4HSTA 5HNFA 1TT5B 1MMDA 4HF0A 2P6TA 4CZCA 4BBRJ 5F0CA 1IRZA 4RBOA 1UHSA 3BPXA 1ZN2A 2ELJA 3DPTA 3GMEA 5CVIA 3ZN1A 4LOCA 3ZQCA 1M1EB 4EJTA 2CW7A 5GP9A 2JUGA 3H5NA 2HYJA 2LYCA 3OS0A 1TWAJ 2H1LA 3KEOA 2QGUA 1PUEE 1R1UA 4DBRA 4A3IJ 5LRRA 3VODA 3KLNA 3HGYA 4OOIA 1LE8B 4CYCA 3HZJA 1LQ1A 5M5WJ 2VOPA 4A3DJ 3GUDA 2QLZA 2W7NA 2Q2EB 1VI0A 4GYGA 1VQ9I 3CUQB 1I1SA 4DQ2A 3DCFA 1FYLA 3VYRB 2VKDA 3GLXA 4BL0B 1QA6A 2XSJC 2H8RA 5E3OA 1R71A 3S1RJ 3K1MA 5TGTA 4IHVA 4XR6A 2L7MP 2LRDA 5DM7F 2XGCA 3DXJF 2FD5A 2M30A 4Y13A 2G7HA 2EFPA 2OV7A 2KIUA 2W00A 3M7GA 1FP2A 3PM1A 2M8EA 4N0BA 4IHXA 1H8AC 5D4SA 3QPTA 2E7XA 5LHGA 9ANTA 2COBA 3TBIA 1ZRDA 4CICA 2A69F 3OYFA 1ZELA 1OYWA 2P81A 5BNGA 2BY2A 3T8TA 3NEUA 4J19A 1T6SA 2Y48A 4FT8A 1VNDA 3ABLH 2DA3A 2VBXA 3MKWB 4B44A 2L02A 1T0FA 1ITYA 2DYSH 4A0XA 5DYMA 3FIWA 2DPDA 1XB4A 2LBFB 4Q4ZF 4PSXA 1WGXA 2XRLA 3G3ZA 3DBRB 2NXNB 1XD7A 2LKSA 4EGYA 4I2OA 1UG2A 3B6AA 2M8GX 1SVMA 3CMYA 3K69A 2WAQN 3FDYA 3H35A 2E5ZA 3HTSB 2WTEA 3TO9A 3EUAA 2EV6A 2L0KA 2P7CB 5IT9K 3LFUA 2EZLA 3KETA 2E60A 3WTTC 1KU7A 1XGSA 4KIFA 2PQ8A 2R7QA 4IKFA 1OYYA 3LSKA 3IL2A 1Y1VJ 5ILUA 3AG4H 4KITB 3OYHA 1EF4A 5DD8A 4PJJA 4AYBA 2R93J 2KRFA 4HV6A 1KQ0A 3GZ5A 4LG3A 5ICFA 3BQZA 2P5VA 3MZYA 4XKWA 2KDZA 2XAUA 5E1WA 2CQNA 2IPQX 1OPCA 1MBEA 2V26A 5EEHA 1U9NA 2DOAA 2NYXA 1BI0A 3G71I 1U5TB 1G3TA 3QP6A 3FM3A 2K02A 1W36C 4E7SA 2OTJI 2JUCA 3P5JA 3W3CA 3M07A 3A02A 5LFAA 3S3OA 1WKMA 4KT5C 2BYVE 2IGNA 1HQCA 3ZR8X 2KQRA 4M9ZA 3FXLA 2A5YB 4D0PA 4WK8F 3FZVA 2DK8A 3QPLA 3WTUC 5J8CA 3CO6C 1MBJA 2OCEA 2K5CA 1O3SA 2R7TA 1R5HA 2Z33A 3H0DA 2WB1N 4B3XA 2F4MB 2OTLI 2E71A 1XDUA 2F5VA 5HVQC 2E34A 5C3EJ 2J5PA 3PIPF 4EJOA 2KL4A 4KMFA 2Q1ZB 1CF7A 1A5JA 1Z67A 1RPWA 1FT9A 3OOPA 1YIOA 2FMLA 4NC7A 4P96A 3OYKA 1K61A 3TW7A 3F8NA 5HS7A 3UNGC 5C4XJ 1BW5A 2P8TA 3OWTA 3P7NA 4BQNA 4DYRA 2ISZA 4H0EA 2PI0A 3DPUA 5AIQA 4CGZA 4PFPA 1QQIA 1YIJI 6PAXA 4BKXA 3GFLA 4OIRF 2DT5A 4KT6A 2WADA 3BROA 3L2QA 3LA3A 1GXQA 3HM5A 1B72A 4UY8I 1BR2A 5CKTA 3HL2A 1U3EM 1PDNC 1EH6A 4EJVA 3E3VA 3JRFA 5FKKA 4ZDLA 2LVSA 3A0HC 5AONA 4D1QA 2JMWA 2M7AA 3WHCA 5M5YJ 2Z2SB 3FHNA 5CVRA 3GCMA 3KP3A 1SC7A 1K78B 4C3HJ 3N05A 1SFEA 1PP8F 1FIAA 1JUPA 1U9OA 4F7ZA 4ABZA 3FKIJ 3BY6A 2RVCA 1U2WA 3QU3A 4A12A 2EV0A 4F3QA 1E3PA 1LNWA 1ZARA 3LQQA 5J1UA 2AXTC 2FBHA 1JE8A 2JJ7A 4JBAA 1D0ZA 4HX4A 3A4CA 1VQLI 2VONA 2MYSA 3R60A 4FE7A 4YIFA 1UMQA 5IT9Z 5JFRA 3OL4A 1NG7A 1JKOC 1WZ2A 4RAGA 4FX4A 1R6RA 3NWSA 1STZA 2DU9A 2KIQA 4F91B 3C2BA 1SMYF 4X6AJ 2GXGA 2O3FA 3DKYA 1J09A 4A5NA 1W0TA 1F5TA 1QNTA 1UB9A 4EMSA 2CG4A 2QM3A 2RN7A 1WJ5A 2EINH 1WJAA 1GVJA 3E5UA 2K9NA 2RQPA 2VN2A 3OMYA 1QZZA 3RZOJ 3S14J 2CH0A 2DAOA 3PSFA 1YX3A 3E7LA 4YRVA 2HQNA 2OBPA 3IAM2 2FU4A 5D5UB 1O3RA 1TZLA 2K4BA 2G7UA 2VC0A 2R7VA 4KUMA 1MDMA 1ZK8A 3JAMK 2DN0A 4MEYF 3EUHC 1BR4A 2HVRA 5GAHJ 2JPCA 1UG0A 4HDVA 2R7DA 2NVXJ 2EQRA 4EEFG 4ZH4F 2MC4A 3M4OJ 1QZEA 1ZKGA 1AKHA 2ZJ2A 4P55A 4XNFA 2WAQA 3KCCA 3HIFA 2CV2A 4M72A 3ZQGA 1YW7A 5KAFC 5LGNA 2EIKH 2HQ5A 5BOXA 1MJ9A 2HU9A 4CA0A 4BYYA 1G3YA 2FOWA 1YRNA 2VQLA 3NRVA 4XBFA 2UXNA 3BQYA 1APLC 1Z05A 5FLXK 2DTZA 1K79A 1XX5A 2Y0SN 3AL0B 1J75A 3OOUA 1FBUA 4M3EA 3TO7A 4O3MA 1J7KA 4R79A 3SZTA 3OR2C 2DMTA 4IHYA 3OYBA 3LSMA 3J7AO 4IEJA 4LLLA 5EZGA 1ZGAA 3A2KA 2HTJA 2Y2ZA 1Q1HA 5F6FA 5GAEJ 3J7ZI 4Q5SF 4M6XA 4CO8A 1OR7C 3ZPLA 4UV9A 4KJZA 2WAEA 4P9UA 4JX6A 1EH7A 1YW9A 1MZBA 3M8FA 2F48A 5D6EA 3RQ4A 3E1SA 3DWLE 5F1JA 3KZYA 1T95A 1DPUA 2FRHA 2HQRA 1MKMA 3CTAA 3SJMA 4XKBA 1AOYA 2M7BA 5L3BA 4CCLA 3HYIA 4FISA 2KISA 1WWXA 3X2QH 2VB6A 1BM9A 2M9HA 1BI2A 3F8CA 4LK1F 3S2WA 4CCNA 1DP7P 1IGNA 3I4PA 1HA8A 2L4AA 2WY8Q 3F8MA 3B02A 5TISC 3MAJA 3C7JA 3KEYA 4E6KG 1WCMJ 3ZMSA 2XKOA 1FPQA 2A68F 4BNCA 2X1EA 4L0ZB 1X19A 1N78A 4AD9A 4EVIA 2XC7A 4A3GJ 3CF2A 5FFXA 3IRQA 3LSIA 3ABTA 4QPOA 4CCMA 3CCMI 2X0LA 2A6TA 2DCEA 4DGWB 3KP2A 1JHHA 4OAZA 2ESNA 2X4HA 4BHCA 3J7AY 2KHMA 2LK2A 3P9IA 5D4RA 1T8IA 2DMPA 2K9LA 1E3OC 5ICEA 4PZJA 1QPMA 1ENHA 3GFIA 2AXLA 4I7HA 1S5LC 1J0RA 1FIPA 3FBNB 1DUXC 2WWYA 1G2HA 2VJIA 2B9SA 1EH8A 3LAPA 4GYIA 3OYAA 1IN8A 1MNDA 1CGPA 2JA2A 1XSXA 3KFWX 2P4WA 3KP7A 2LSOA 1MBFA 3K70D 2DTRA 2ZNYA 1WHUA 5D6FA 5D5XB 2HYGD 3IH3A 3SEQA 5IOZA 1XMXA 2BW3B 3SFIA 3WTVC 5B3SH 5DM6F 3S15J 3SFZA 1BL0A 1JT0A 1H0MA 4WXHA 3JAMZ 2X6XA 1XG1A 2PN6A 3VB2A 4J01A 3V42A 1XC5A 2IA0A 1VQKI 2K86A 1ETOA 2PG4A 2R5ZA 3H3VK 3BR5A 4BE2A 4D7MA 3RPUA 4HAMA 1FSEA 2HI3A 4FCYA 2JN6A 4XK4A 3L2RA 1EV7A 1R1VA 1Z3YA 1YYVA 4BU2A 2EV5A 1YJNI 3UKGA 2HDCA 4A3CJ 4L18B 1SVLA 3DV8A 2CUZA 4NC6A 2KRCA 1JUSA 2ISYA 1GHCA 1FNNA 4FQGA 3K1PA 2ECCA 4IF4A 1WVRA 2XF6A 2GXAA 2W25A 3I4NJ 2F6CA 2GXBA 1P2FA 3J80K 4MQ9F 2XDVA 3ISPA 5J8FA 2IRFG 4JX5A 3EUHA 5DUKA 3WE3A 2RV8A 3JSOA 2HXOA 3BWGA 4E7HA 4C2UA 1A6QA 4AIHA 2QUFA 3JR9A 1X2MA 2PMUA 1ORKA 4IHTA 4XLCA 3G4SI 1ZREA 3DBHB 2R5YA 4OIOF 2VODA 4NNJA 4HF1A 2CQ7A 1LKXA 4MFDA 3OR1C 1MH3A 5E8IA 5H6RA 2E35A 4E7JA 5BQTA 1V4RA 4ENNA 4XN0A 3PNYA 3JRCA 1ZQ3P 4NB5A 3KP6A 2XUBA 4I0AA 4M3GA 4A69C 4EM2A 5DS9A 3HOXJ 3CDHA 2YX4A 3S1MJ 2EZHA 1R5GA 3IUOA 1P4XA 1ZRCA 3F0CA 2X6WA 2RNJA 3L2VA 2PJPA 1WJCA 1JKRC 3F23A 3DTIA 5CLSA 3CCSI 1OR7A 1R58A 2Y0SA 1R9TJ 1UHMA 3ZQFA 2AQEA 5J40A 1D1BA 5BS6A 3HDDA 2V9PA 1BJZA 4PK4A 3KIOA 4HNUA 2Y69H 3HRSA 1TL8A 4OMZA 4D7NA 3A0BC 3W2WA 4NBQA 1LPQA 2L4MA 4UUSB 3HUGB 1TNTA 1EKEA 4I76A 3QU6A 3I54A 1SAXA 2PMZN 3FHZA 3W6KB 4AIDA 3ECHA 3GFMA 5IT3A 3PNTA 3G73A 3L9FA 2JQ7A 2TCTA 1TT0A 2ZJRF 1R00A 2ZFWA 3WHBA 2QA4I 2WA0A 5F0FA 3HB9A 2XRNA 1I3QJ 1YTYA 1ETYA 1X58A 3S16J 1USSA 1P92A 3V7CA 3CC7I 4LD5A 3IH2A 1S7AA 4OU0A 2HS5A 4LIVA 1PP7U 1P6RA 3E6BA 2LP0A 3E97A 3IAS2 3SDBA 2BVMA 1EJ9A 4MO7A 3BG9A 2Z3YA 2AO9A 3AG1H 1T33A 3KP4A 2FQ3A 1U78A 4HNTA 1F4KA 2AS5F 4AYBN 3FXUA 3KZZA 5EF6A 3S2HJ 3OL3A 2OA4A 1HW2A 3HPHA 2MH2A 4HPQA 4Z6YA 3EYIA 1JI8A 2EJRA 1FP1D 1IDZA 2VT3A 3V8JA 2IJLA 2QENA 4G12A 3PFYA 4HLYA 3V8KA 1YG2A 4N4OB 1TQMA 2IVMA 3ZQQA 4BEHA 3HSEA 2W82A 2X1CA 3H3UA 3K6GA 5F27A 5EG0B 1KYZA 1D5YA 1W7PA 2E5NA 3M8JA 1QRYA 2W57A 1ZH5A 3J80Z 2KPMA 5FO5A 2JZYA 5B1AH 3M9AA 1T2KA 2W48A 2YX7A 3OSGA 4L9NA 3S32A 3I71A 1QVTA 4G94A 1P4WA 5CVVA 1MSEC 3JRHA 2O5RA 2LKXA 5HLHA 1X2NA 4YIRX 1OCOH 1TWHJ 3BR1A 3RCOA 5DD4A 3LAJA 2LNBA 1RR8C 3CC2I 3TDUC 4YIIA 1W36D 2D1HA 2E1NA 1WJDA 1YITI 4U87A 3OYDA 3DU6A 4G7HF 1IZ1A 2LG4A 1AU7A 2ZB9A 2VXDA 4XLAA 4LB5A 1WJFA 2VKVA 3PSIA 4IQJA 2HZTA 2QKLB 3GTMJ 2K3FA 1H9GA 2E1CA 2E19A 1YX5A 1HCRA 2OJED 2ME0A 3B6CA 4FE4A 1KGSA 4LG0A 1DGWY 4CDGA 5FLVA 1D3YA 1ODDA 1IN4A 2ETHA 2QKMB 3FXQA 1HKSA 5JVTA 3GBGA 2JA8J 1JT6A 3WGGA 1FYKA 2DW4A 3GFJA 3BR2A 1D8JA 3SQNA 4ZJZA 3AG3H 1XN7A 2CYYA 3IP4B 3M8EA 3ERED 4UVCA 3OS2A 2DQLA 1U5TC 3MZHA 5IP6A 4EQQA 1JKQC 2L3DA 2CWEA 5C4JJ 2BXZA 4PGHA 1H9TA 1GV5A 1TWCJ 4XMYA 4RM3A 5JI6A 1FOYA 1LVAA 1T38A 5CQEA 1S72I 3K4KA 2H6CA 5L3CA 2UUZA 2DLLA 3HPGA 3I0TA 4NC8A 5CVUA 1R22A 3PL8A 2DMUA 2DYRH 2ELHA 5EEAA 4LIUA 4QIWN 3K2ZA 1D5VA 1SVOA 1YQAA 2ELKA 4XRSG 1F43A 1V5EA 4XQFA 5JHUA 1ZR4A 1I6HJ 1AA7A 2EFQA 2G9WA 4Y33A 2UV1A 2DK5A 2NS0A 4XOTA 3RQIA 2XROA 2VC1A 4IRGA 2RREA 1G6NA 2DMQA 3DBLB 3DKWA 1LE8A 1V55H 4LMYA 1K6OA 2RAEA 3O6BB 3RYPA 1WI3A 1TW3A 4BS9A 2GWRA 2EH3A 2D5VA 5E17F 1TBXA 4Y3OA 2Q2EA 2L9SA 3CLQA 1VTNC 1RKWA 3OYGA 4RA2A 2VE9A 3LSHA 3JCUC 4LITA 1QHHD 2V1UA 2XPWA 2BBYA 2H8WA 3BJ6A 2VKEA 3GO5A 4A3EJ 3HSRA 1PJRA 2GLOA 1T08B 2L9RA 3ULQB 1FBQA 3HOVJ 1R7JA 3VDXA 2BEOA 3CZ6A 1XCBA 4DOZA 4W97A 2HPIA 2X85A 3OSFA 4L5JA 4XOPA 3LA7A 1Y39A 3GVAA 2JTVA 4G8XA 1SAUA 2PMZA 2QSFX 3GTLJ 4RB3C 2KMUA 2L7FP 3GTJJ 1HOMA 2I8DA 4G9YA 2IXSA 1KYWA 2L9VA 1DP3A 4O5VA 1Z0XA 4YG2F 3AFHA 2DA6A 5K7ZA 3HOUJ 4YFXF 2Y30A 5ILSA 4PJNA 2JA7J 5D8KB 1HSTA 3QRFF 4JP0A 3BTLA 3RTRA 4GCVA 3I64A 4MFEA 3QPHA 1G3SA 2HDDA 3S1NJ 3M1CA 3QYFA 2LTPA 1OCPA 4V2FA 2DBBA 3ABKH 5IYDJ 1QU3A 3DEEA 1JTXA 3BCAA 3PUBA 2DO7A 3W6JB 4GGGA 3TMOA 2NNNA 5J3LA 1WJBA 2A6EF 2TRTA 2HEOA 2HQAA 4DBQA 5F0HA 4ZC3A 2DA7A 4LJZF 2LBFA 5LGUA 1W1WE 4HA8A 1RUOA 3D5LA 2LKPA 2CSOA 3R0AA 5GAGJ 5GTHC 2CFOA 1HW1A 1Z9CA 1GDTA 1JGGA 3BDDA 2BGCA 5GTIC 2MG4A 4A6EA 3FWEA 4BHPA 3ZGKA 5FROA 2QSGX 3M1EA 2F5CA 2I5UA 4HNVA 2XIGA 3G1OA 1D1AA 2K9QA 5J1RA 4YFKF 5LEKA 2CU7A 3PQKA 4DW6A 2V1XA 4CSWA 1Q1VA 4BXFA 4FX0A 1B8IB 2FE3A 2KZVA 2LH9A 3CO7C 1POGA 2ACJA 3VEPA 2V79A 2ZC2A 2QEXI 3ZXSA 2Y9ZA 1X1DA 5FFZA 4MHGA 3E6CC 3H92A 4BXUA 3K1NA 1BOAA 4BJTA 4XRMA 1DGRM 3REOA 5FB2A 2Z9OA 1MMSA 2HOTA 3CDLA 2VIXA 4ENJA 2E2JJ 3SXYA 3TP3A 5HDGA 1RI7A 5HDNA 2ZMEB 4I98B 4XRSA 4N9HA 4M74A 1IV6A 4ENMA 4M9SA 3NQOA 1O57A 5EZHA 1U5TA 4CH7A 1MMGA 5LLQA 2ECBA 2LMDA 3BTJA 3TDZC 2DODA 1XGMA 1IW7F 1YW8A 4MNUA 5F04A 4RAFA 2ZXWH 2FF4A 4OINF 1OCTC 1VQ7I 1FTTA 3PNVA 5K5OA 1K4TA 3DLLF 1BC7C 2NVUB 4BE1A 3ML6A 1K6YA 4ASNA 2L7ZA 1FX7A 1FLIA 3BG6A 1G3WA 3OIQA 5AIPA 3ZN0A 5HLTA 3Q9VA 2V4JC 4YELA 5L3DA 5GADJ 2PEXA 3F6VA 2NRAC 1VQ6I 1BBYA 4AM3A 2YR2A 3SDGA 1TP4A 3JRDA 2V9KA 2XAFA 2NNYA 2DDAA 2VASA 1UJ8A 2M0MA 2BVLA 2EWNA 1KQ9A 4C30A 2GQQA 4PDKA 3NAUA 3K4MA 2FMYA 4IVNA 1JHFA 1W7PD 3NWTA 3T1BA 4WX9A 3HOYJ 1ZTRA 2XAGA 4Y52J 1FYMA 4WWCA 2YPRA 2STTA 4BJ5C 1S6LA 3CCQI 4CXFA 2BOLA 2XF7A 3S3MA 1MNMC 4MTEA 4U7DA 2HFHA 2EBIA 1V3FA 2QBYB 2FBIA 3FK7A 4PGGA 3BZKA 2Q8KA 5HODA 2A61A 1R5ID 3W6VA 3Q9SA 3S1QJ 5F1RA 2IBDA 4WCGA 1K78A 5E1XA 5ERIA 3BC8A 3KPHA 4BGDA 4U7BA 3ROUA 2X6YA 3CCLI 3GEZA 2OC6A 3I59B 3TQNA 2HKXA 3FBIB 2VJ4A 3MN2A 4C2TA 3G1LA 1D8KA 4Y15A 1K7AA 4D9JA 4BQQA 5K5QA 1A6IA 5FLMJ 1HC8A 3IHUA 1IG7A 1UAAA 4RGUA 1SANA 4E7IA 5CJ9A 4PUSA 1VQOI 2DA2A 4DYQA 1XSDA 2UXXA 1VQMI 1X1PA 3O8GA 3H9QA 3E6MA 1RKTA 2QQ8A 3Q0UA 1XGNA 1X4PA 2X48A 1CQTA 1TNSA 2LREA 5LD2C 1BW6A 4M3FA 4A2UA 1FOWA 5ICCA 3DPLC 2XB0X 4HF2A 4LFUA 2ZFUA 3CC4I 4JQFA 5EEGA 2L01A 4E70A 5M3MJ 1ZG5A 4IRHA 4XL9A 4MIMA 1NK3P 2MBFA 2O0YA 2QQ9A 2XPVA 1IXRC 4KIGA 2Z1DA 3D5SC 1P9QC 2MABA 4ZYDA 4G6DA 5E3NA 2VOOA 3O2PE 3A1YA 2FXAA 3RI4A 2PFBA 3BJOA 2STWA 3MKLA 2A05A 3PUFA 1HW5A 2HNHA 4XLEA 3VPRA 1ON2A 2BY3A 2PMHA 3ZMVA 4HDUA 2H27A 4NQWB 2OZ6A 2XV4S 4UV8A 1XSVA 3FXOA 3TOBA 4GRIA 5LGTA 3MKZA 1VQ5I 3WODF 3FXRA 3K4CA 1XS9A 2CFXA 2B7EA 1I39A 2L5QA 3H9GA 4H4KC 1FOXA 1WQ2A 2ZNZA 3OYLA 4RAYA 2MLGA 3MVPA 1HBXG 4ENKA 4K2EA 3U1DA 1W5TA 2HGCA 4KFCA 3F6OA 1X4OA 4BQOA 1W5SA 2JA6J 1OCCH 2RQQA 3CJRB 3OYCA 2O9LA 2DOFA 2K27A 4B43A 3DKXA 3A01B 2JVGA 1FJLA 3MKYB 4G6QA 5EGOB 3QOPA 4ZTFA 3BTIA 1WH5A 4A3JJ 2RC4A 4LK0F 1WH7A 5DCMB 2R7WA 3U21A 2PJRB 2EILH 1XMAA 4XIDA 1FMWA 4R1HA 4KA4A 4BDZA 4DNCA 1LFBA 1Z77A 2A6HF 1HLVA 3VFZA 1LDJA 3DLAA 1W5CC 1H89C 1SFUA 2LF7A 1W4MA 1V54H 2JVHA 2CRGA 4UB6C 3RSNA 1BC8C 1LFPA 2WAFA 5J1YA 2KRHA 1J9IA 2BZTA 2KIMA 2QYOA 2FUG2 2WY7Q 1AWCA 1SMTA 3BR0A 5A2QZ 2ZJQF 2HTSA 2E1MB 4L9VA 2EA2A 5L3FA 4RGXA 1O3TA 3JRIA 4PJLA 2X1DA 3SZPA 4G6TB 1GUUA 4EM1A 3U1KA 1LEBA 3E6DA 2IW5A 3GX4X 1B9MA 2OPTA 4BAYA 2VLAA 4HQMA 2VXZA 2ID6A 4S0HB 2HOSA 3LSRA 5M3FJ 2GIZA 2KKOA 4LGWA 4XORA 1LB2A 1NTCA 4DZPA 1Y8RB 2VQGA 1SFOJ 4X1EA 2XVCA 4HX8A 4O6JA 4ESBA 3WTZA 3HHGA 2PX9A 4EV0A 3L09A 1IDYA 2DA4A 3HOTA 4WXCA 5BMZA 3CJTB 1PUFB 2XB5A 4BJ6C 3DTEA 5B1BH 2KLOA 4A3MJ 2RKHA 4BUPA 3IH4A 2DDBA 1KONA 2BW3A 3KYDB 2VJJA 3DFGA 2M45A 5ED4A 4NUBA 1PYVA 2QZ8A 1Z6TA 4ZYGA 3G6EI 4GDFA 3HHHA 4FETA 4MEXF 3TGNA 3T8RA 5DUIA 1RUNA 2IS6A 1XDSA 2H94A 3TO6A 4IHSA 1OISA 1U8BA 4CCJA 1E17A 4C9YA 3HC7A 1HSJA 4ZZDA 4EATA 3WTSC 4E7ZA 5J4YA 2NS7A 4V19K 2A3SA 3LQRA 5HLGA 4PFOA 3KZIC 2V6CA 1DDNA 1T98A 4Q48A 1Y0UA 2VL8A 3FMSA 4C2MJ 4EM0B 1ZG1A 4G7ZF 1Y56A 1TWFJ 5H6QA 4B48A 3H5AA 3V4GA 1RRJA 1FEXA 4HV5A 1O7FA 1P7JA 2KP6A 4EJUA 2D45A 3P9CA 4L0YB 1IAWA 4P1WA 3ESWB 2MGQA 1ZYRF 3AAFA 3IKVA 1DQUA 4DJAA 1LDKB 3OYIA 4HG2A 5EYRA 3PO2J 1ETWA 5B66C 4HW0A 2YU9J 2IP2A 4G7OF 4B8XA 3GZNB 1L3LA 1USTA 3CUQC 3HXLA 1TLHB 3GXOA 3CP8A 1LFUP 2DT7B 1JXSA 4UHTA 3LSTA 3I53A 3OYMA 3I55I 2O8XA 1ZLJA 1QBJA 2XPUA 5JLXA 3L7WA 4HRIA 1VQ8I 3CDIA 1KA8A 2HDWA 2DA5A 3SHFA 4RMNA 1C0WA 2R7RA 4L5IA 4A0ZA 1VQ4I 1ACIA 1QVUA 1HDDC 2QQAA 1JJ8C 1DU6A 4JX4A 3HJEA 3QWLA 3I4MJ 5HLIA 2PBIA 2A5WA 4HOBA 2Y0MA 2FX0A 1A31A 4E7KA 3BG7A 2IAIA 4CCKA 1VFCA 4DIQA 2OD5A 1K4SA 1FTZA 1BOBA 1N25A 1TW2A 2BHZA 2CS3A 2DFIA 2LC2A 3PFIA 3F22A 1I50J 2ZJPF 1DU0A 2IA1A 2KFDA 2CV1A 2M87A 3RYRA 2R7SA 3SYTA 2GAUA 5E79C 4M6YA 4OIQF 3GTQJ 3D0SA 1TC3C 1G8XA 2JRMA 4DZJA 4UUSA 3HUGA 1WSUA 2EFOA 3BOQA 3FXJA 2LOOA 3I3LA 4XLNF 4EJWA 2HR3A 3LSPA 4ZYAA 5DTDA 4I02A 3S8PA 3ZP5A 1BIAA 2IGOA 4BBSJ 2R7XA 1A36A 1E2XA 3QPSA 3VYSB 3BPVA 4KICA 3H36A 3FM5A 4RGSA 3CQZJ 4L5EA 2WC2A 3DEUA 4U0WA 4BQAA 4ZDOA 2GZWA 2K85A 2ZXHA 1HXDA 3FXKA 3F8FA 5LHIA 5DDGA 5GPCA 2P0WA 4BH9A 3SZGA 2EPFA 1P4AA 4JK1X 5CVJA 4AWXB 2ICWG 1S7EA 1ZLKA 3BP8A 4KNYA 3K4LA 2JSPA 2R4GA 3BZCA 4QTRA 1DPRA 3DQVC 1S7OA 3WTXC 2GOMA 1RETA 1G59A 2H09A 2LFBA 1I6XA 1U6GA 1XMKA 4UXNA 1VQNI 2E2HJ 2K3PA 4CYCB 4ON0A 2Y31A 2GOXB 2P7VB 1NK2P 1VF9A 1UFMA 1VQPI 2TDXA 4BE0A 2LD5A 5FJ8J 3LMMA 4CYDA 2DFEA 1JKPC 4KN4X 3CCYA 5EG0A 4IOAF 2D2WA 3RKWA 1PVEA 1MBKA 2W84A 3CMMA 5FKLA 3CP2A 5H20A 4L9TA 4A3LJ 4M73A 1O7LA 1U8RA 2CJJA 1Z7LA 1FWZA 2M4GA 2MH9A 3K4NA 4II2A 2K40A 3G1MA 1S9HA 1ULYA 3L00A 3LA2A 1T56A 2ADUA 1TWGJ 2XAQA 4JYKA 2K7LA 1TTYA 2CQKA 1WPKA 5HNHA 4HX7A 2L2OA 4XSXF 1QHGA 1Z21A 2COMA 5FKMA 3TL4X 3RDIA 3ZCOA 2CO5A 2R7OA 4UVBA 2B63J 2P5KA 3ECOA 5FGMA 3GTPJ 1ZG3A 2M1BA 1IUYA 3ELKA 2KIFA 3C3WA 2D1VA 4A3FJ 2VPRA 2F4IA 1MBHA 1L0OC 5EJCA 2CGPA 4KIBA 2WBMA 2X9DA 5FRMA 1EA3A 4AU7A 4XN3A 2ZSIB 1BA5A 3FK6A 1SFXA 5CPRB 1IO2A 2V7FA 2VKHA 1LVKA 4RGRA 1SD6A 4LLNA 3MFKA 2IGMA 3MZ8A 4M3BA 5DV5A 3GWZA 4B4CA 2VBYA 4M71A 1OJLA 2OQGA 2ZMEC 5FKNA 1Y6IA 4XKVA 5HS8A 4E4HA 1FMVA 1IXSB 3CUOA 4AIKA 4IHWA 3B73A 3CUQA 4OWRB 3JTHA 5ICGA 5JR3A 3BJAA 2R7UA 2F4OB 1YHQI 3BR6A 1O4XA 3S93A 1ERDA 1Z7UA 1B4AA 2NVQJ 1GLNA 1WRJA 4C3JJ 1MW7A 4PJ0C 4BDYA 3F72A 3GW2A 3IWZA 4ETSA 1RZ4A 1BI1A 2OZUA 2Z99A 4S04A 3DF8A 3RPUD 5IP9J 2ZXIA 3GLLA 1Z3XA 2OQRA 4JOMA 4P9FA 1IF1A 1KZHA 2CQXA 1BR1A 5EDNA 4RB1A 3UR3C 1UELB 3DTKA 4ZYHA 4LLGF 5C44J 2BHYA 3C18A 1QZYA 1R1TA 2NVTJ 3K2AA 4FASD 1ETXA 1TQIA 3KYCB 3RJPA 2XGXA 2ESHA 4BXXJ 2C6YA 1MMNA 1NHAA 3MMYB 3HGGA 3QYBA 2HXIA 3HSFA 4D5CA 3JSPA 3TEDA 4KMUX 2B0LA 5K7FA 3GTKJ 1FBSA 1D0XA 2XF5A 3GTOJ 4ESFA 1UCRA 2X51A 3QOEA 4MTDA 3P9KA 4P5OA 3OS1A 1LJ9A 1BJAA 2CW8A 1ON1A 2O03A 4ZYEA 3K9TA 4OIPF 2L7KA 2LY2A 2OU2A 1IN5A 4IX7A 1Y8QB 5E3MA 4FTHA 1HF0A 3VOEA 5KVRA 3K4BA 3SEZA 2MD5A 3TP0A 2DMNA 2KJCA 3KX2A 2HKOA 1T39A 5HS9A 1MBGA 3FKJA 1R36A 2XGEA 2AQFA 3FMQA 3MWMA 1CF7B 2BY0A 1SD4A 2VBZA 4IO9F 2FJ1A 3WTWC 3LNQA 3WGHA 3JW4A 4MLOA 2NOJB 3ABUA 1MSFC 3COAC 1A35A 2VUMJ 1X3WB 4CHUA 1HKQA 2YSRA 1OYIA 2M34A 3WTYC 2EZIA 5LEJA 2JRTA 2ZBKA 2XKPA 4KYWA 3FXMA 1B72B 3VSLA 2DA1A 4A3BJ 3AL0C 1YOVB 5J47A 3ZOBA 1IN7A 1MJAA 1RIOH 4CZZA 3D5RC 1F9NA 4A6DA 2VT2A 2L54A 3KEQA 4BACA 1WJEA 3FMRA 2RDPA 4B09A 3H1CA 2LLKA 4S05A 2CUFA 3BG5A 4RB2C 3RKQA 3HRTA 1B6AA 2KZGA 3Q0VA 1I1GA 3HOSA 2R3SA 3JRBA 2MLKA 1B8IA 4NHJA 4XSZF 2M0CA 1Y1WJ 4QSHA 2MD0A 5E20A 1ETVA 1VZ0A 1RC9A 3W2VA 5D5WB 3RKXA 1J2XA 2DJIA 1NG6A 3RPQA 3HRUA 1B9NA 4A3KJ 2E2IJ 2X6OA 3ZQHA 1W0UA 1MJBA 1X1BA 2HVQA 1U0JA 2IEKA 3GZ6A 2EK5A 4XLHA 1R4MB 3WG9A 1LUJB 2QWWA 2ZMEA 3V7RA 5IYCJ 3FX3A 2JT1A 3O3KA 3CMAI 2LY9A 4XRFA 3QODA 1I5ZA 5DCFA 5E1ZB 2DT6A 3QAHA 3CLOA 2YS9A 2QSHX 3BT9A 4M6VA 1E3HA 2Y75A 4U0YA 3V7SA 3J81K 4RB0A 2L9NA 2DFFA 1Z91A 2ME6A 4YEJA 1A04A 2FNPA 3JRAA 3N4MA 4XLFA 2A07F 2IS4A 3PO3J 1MGTA 3NARA 1MDMB 1I3AA 2LY1A 1FZPB 4RLFA 4Y7NJ 4TV7A 4M9XA 3MQ0A 3QYEA 4A93J 3QP5A 4B3AA 2CQQA 2WV0A 4UVAA 1WFXA 5IYBJ 3R0JA 1HKTA 1AKHB 4I09A 5D8LB 3E5QA 3HEFA 5B5EC 2KT0A 4HYEA 4MGRA 5A2QK 4E7LA 2IT0A 2FOKA 3EDPA 4GFBA 5KHDA 3ASNH 2CMPA 2M3AA 2QF7A 3H0GJ 3L2CA 4Q47A 2M4KA 3BCBA 2HOEA 1YRNB 3S3NA 4BHBA 3U2RA 2E1MC 3F8BA 3KE2A 3CCVI 2I10A 4U88A 4CCOA 3L2WA 2P5LC 1S3JA 2O6GE 4N4NB 4IOCF 4L9JA 4W1UA 5GPAA 3R6SA 3OY9A 2EZKA 2ZO4A 3I58A 3PIOF 3Q3SA 2HVSA 1MNEA 4PSWA 2QBYA 3ZRGA 2RNGA 4RAZA 1SFKA 4XKCA 3JREA 2IS1A 2F5EA 5FD5A 4UB8C 3IC7A 2HWVA 1V5GA 2JK3A 3V8LA 4R8HA 2AHQA 3R61A 1ONVA 2KJBA 3I59A 3QQAA 3VSKA 4A0YA 3HOWJ 3ASOH 1ZRFA 3ZQ7A 3CCEI 2EFWA 2Z5UA 4HBLA 2W4SA 1KU2A 2CW0F 5L3GA 1IC8A 1K83J 4IQ4A 5E3LA 2EFNA 3CCRI 3CCJI 1O3QA 2V1NA 1YS7A 2DPUA 3ABMH 3MD2A 3J7YJ 3OYNA 2NOGA 2BXYA 3WU1B 4C3IJ 3EPZA 3C2HA 3KP5A 4F52A 4PJMA 3VYUB 2IA2A 2JA5J 2M2EA 4YFNF 1F1ZA 1YJ9I 1YO5C 5IPAA 2QCOA 2K4JA 3I5UA 4UUTA 4NDLA 2R92J 1UZCA 4Y4RA 3GTGJ 2YU3A 3IRRA 1IUFA 2N8GA 2E1OA 2VE8A 3CJQB 5CQGA 1V5FA 1B1BA 3DEWA 1SEUA 2LDUA 4WXDA 1JJ6C 1FSHA 2K9MA 4IPAA 2RGVA 3EQLF 4PCQA 5TJJA 1D1CA 2MFZA 3BZ6A 2IGKA 1ZGJA 1WI9A 3EUKL 2P6SA 3L2UA 3CESA 5H2FC 1LEAA 1NH3A 4EGZA 2V9VA 3PJRA 3H9JA 5TRDA 4ZTJA 2MSYA 4ZZLA 2GA2A 4Y17A 3RIRA 3HKZN 3ZMDA 2GBYA 2E7WA 1MD0A 3TW6A 1IRXA 2GM4A 1RNLA 3LWFA 4NQWA 5K5RA 2O61A 4A5MA 3J81Z 1LDDA 1QGPA 1ZHFA 1GVDA 4Z2YA 4I0BA 3OIPA 2WB1A 3TOAA 4I6ZA 1IRGA 3H3ZA 3K0LA
chains in the Genus database with same CATH topology
3U9GA 1XCVA 4N9IA 1FOKA 1S29A 3T0YA 5BPIA 2FEZA 4I01A 4KN7X 5CYVA 5LHHA 2MC3A 4RS8A 4LB6B 3Q5FA 3ZMUA 1BN5A 3EYYA 3EETA 5DCMA 3OV8A 3WGIA 5ILVA 2HYFA 1TQPA 2FBKA 1OMIA 5HDKA 4GXOA 2M5WA 1OKRA 3KLOA 1IN6A 4HQEA 1ZAOA 4IJAA 1KU9A 5D5VB 3LFKA 2DQRA 5FLXZ 2BV6A 3E5XA 4WF2A 2OAZA 4QLCU 4U0VA 4HZFA 1KQ8A 2QQBA 4UNOA 1QO0D 2UZKA 2EB7A 2JPBA 1J5YA 5K1YA 2FSWA 4XLPF 1XGOA 4MQVA 1YLFA 3ZMTA 3DP7A 2ZKZA 1G4DA 2J5OA 1J59A 2W24A 4IRIA 3R4KA 1IRFA 3JTGA 2UWMA 2VBWA 3F21A 2FA5A 2JSCA 1Z1DA 1SD7A 5HOOA 5E18F 1REPC 2XASA 2QVOA 3HRMA 1SD5A 1S8NA 4HLXA 2PLYA 4ESJA 3GYHX 1BI3A 3F3XA 2DI3A 4IXAA 3C1DA 3WE2A 3WU0A 2FNAA 1W7PB 5E8GA 5LBQA 4AIJA 3CJNA 1GXPA 1Z6RA 1JGSA 2ZXJA 1KU3A 2ZCWA 2Q0OA 3MEXA 3N97A 2LF8A 2F5DA 3PQJA 3TKYA 5KK1A 1IXCA 2R7FA 3RKYA 4FHTA 5J6XA 1BIBA 2EA4A 4QWQA 2XHKA 4OMYA 2H6BA 1UHWA 1FC3A 4KDPA 3T5XA 3ZMZA 3MCZA 2GA1A 5F64A 4LG0B 1I27A 1YFHA 2V1DA 2BE5F 5DEQA 2XAJA 5BPDA 4UUVA 3HTUA 4AVPA 1FY7A 2NAZA 2MA3A 1R23A 2GIVA 5LRSA 5FD6A 3GF2A 5L3EA 1B59A 3FF5A 2F5FA 1X3UA 2F2EA 3IWFA 2XAHA 4GO1A 2W85A 3IKTA 1YS6A 4HF0A 2P6TA 3BPXA 1ZN2A 3DPTA 5CVIA 3ZN1A 4EJTA 3KEOA 1PUEE 1R1UA 5LRRA 3VODA 3KLNA 4OOIA 1LQ1A 2VOPA 3GUDA 2QLZA 4GYGA 3CUQB 1I1SA 4DQ2A 1FYLA 3GLXA 3K1MA 3DXJF 2M30A 4Y13A 2G7HA 2EFPA 2KIUA 3M7GA 1FP2A 2M8EA 4N0BA 5D4SA 3QPTA 2E7XA 5LHGA 1ZRDA 4CICA 2A69F 1OYWA 3T8TA 3NEUA 1T6SA 2Y48A 4FT8A 2VBXA 2L02A 1T0FA 4A0XA 5DYMA 2DPDA 1XB4A 4Q4ZF 3G3ZA 1XD7A 4EGYA 4I2OA 3K69A 3HTSB 2WTEA 3TO9A 2EV6A 2P7CB 5IT9K 3KETA 3WTTC 1KU7A 1XGSA 4KIFA 2PQ8A 1OYYA 3IL2A 5ILUA 5DD8A 2KRFA 4HV6A 1KQ0A 3GZ5A 5ICFA 2P5VA 3MZYA 5E1WA 2IPQX 1OPCA 5EEHA 2NYXA 1BI0A 1U5TB 1G3TA 3QP6A 3FM3A 2K02A 1WKMA 4KT5C 2BYVE 1HQCA 4M9ZA 2A5YB 4D0PA 4WK8F 3FZVA 2DK8A 3WTUC 5J8CA 3CO6C 1O3SA 1R5HA 2Z33A 1XDUA 5HVQC 2J5PA 4EJOA 4KMFA 1CF7A 1FT9A 3OOPA 1YIOA 2FMLA 4P96A 3F8NA 5HS7A 2P8TA 3P7NA 2ISZA 4H0EA 2PI0A 5AIQA 4CGZA 1QQIA 6PAXA 3GFLA 4OIRF 2DT5A 3BROA 3LA3A 1GXQA 1U3EM 1PDNC 1EH6A 4EJVA 3E3VA 5AONA 5CVRA 3KP3A 1K78B 1SFEA 1PP8F 4F7ZA 3BY6A 2RVCA 1U2WA 3QU3A 4A12A 2EV0A 1LNWA 1ZARA 3LQQA 2FBHA 1JE8A 4JBAA 4HX4A 2VONA 3R60A 4YIFA 5IT9Z 5JFRA 4FX4A 1STZA 2DU9A 1SMYF 2GXGA 2O3FA 4A5NA 1F5TA 1QNTA 1UB9A 4EMSA 2CG4A 2QM3A 2RN7A 1GVJA 3E5UA 2RQPA 2VN2A 1QZZA 2DAOA 2HQNA 2OBPA 2FU4A 5D5UB 1O3RA 2K4BA 2G7UA 2VC0A 4KUMA 1MDMA 3JAMK 4MEYF 2JPCA 4HDVA 2R7DA 4ZH4F 2ZJ2A 4P55A 3KCCA 3HIFA 4M72A 1YW7A 5LGNA 5BOXA 1MJ9A 4BYYA 1G3YA 3NRVA 4XBFA 2UXNA 1Z05A 5FLXK 1K79A 1J75A 1FBUA 3TO7A 4O3MA 1J7KA 4R79A 3SZTA 3J7AO 4LLLA 1ZGAA 2HTJA 1Q1HA 5F6FA 4Q5SF 4M6XA 4CO8A 3ZPLA 4UV9A 4P9UA 1EH7A 1YW9A 1MZBA 3M8FA 5D6EA 3KZYA 1DPUA 2FRHA 2HQRA 1MKMA 3CTAA 1AOYA 5L3BA 3HYIA 1WWXA 3F8CA 1BM9A 4LK1F 1BI2A 3S2WA 1DP7P 3I4PA 2L4AA 3F8MA 3B02A 3MAJA 3C7JA 3ZMSA 2XKOA 1FPQA 2A68F 4BNCA 4L0ZB 4AD9A 4EVIA 5FFXA 3IRQA 3ABTA 2X0LA 3KP2A 1JHHA 2ESNA 2X4HA 4BHCA 3P9IA 5D4RA 5ICEA 4PZJA 1QPMA 3GFIA 2AXLA 4I7HA 1J0RA 1DUXC 2WWYA 1EH8A 3LAPA 4GYIA 1IN8A 1CGPA 1XSXA 3KFWX 2P4WA 3KP7A 2LSOA 2DTRA 2ZNYA 5D6FA 5D5XB 2HYGD 3WTVC 3SFZA 1H0MA 4WXHA 3JAMZ 2PN6A 3VB2A 2IA0A 2K86A 2PG4A 3RPUA 4HAMA 1FSEA 1EV7A 1R1VA 1YYVA 2EV5A 2HDCA 4L18B 3DV8A 2ISYA 1GHCA 1FNNA 3K1PA 4IF4A 2W25A 2GXBA 1P2FA 3J80K 4MQ9F 3ISPA 5J8FA 2IRFG 3EUHA 5DUKA 3WE3A 2RV8A 3JSOA 3BWGA 4AIHA 2QUFA 2PMUA 4IHTA 1ZREA 4OIOF 2VODA 4HF1A 5E8IA 5H6RA 5BQTA 1V4RA 4ENNA 4NB5A 3KP6A 2XUBA 4I0AA 4EM2A 3CDHA 2YX4A 1R5GA 1P4XA 1ZRCA 2RNJA 2PJPA 3F23A 5CLSA 1OR7A 1R58A 1UHMA 5BS6A 3HRSA 4OMZA 2L4MA 1TNTA 3QU6A 3I54A 1SAXA 3FHZA 3W6KB 3ECHA 3GFMA 5IT3A 3G73A 3L9FA 1R00A 2ZFWA 2XRNA 1YTYA 1USSA 1P92A 3V7CA 4LD5A 1PP7U 1S7AA 4OU0A 2HS5A 1P6RA 3E6BA 3E97A 2Z3YA 1F4KA 1U78A 3KP4A 2FQ3A 2AS5F 3FXUA 3KZZA 2OA4A 1HW2A 2MH2A 3EYIA 2EJRA 1FP1D 2VT3A 3V8JA 2IJLA 2QENA 4HLYA 3V8KA 1YG2A 1TQMA 2IVMA 3HSEA 3H3UA 1KYZA 1W7PA 2W57A 1ZH5A 3J80Z 5FO5A 2JZYA 3M9AA 1T2KA 2YX7A 4L9NA 3I71A 4G94A 1P4WA 5CVVA 5HLHA 3LAJA 5DD4A 2LNBA 3TDUC 4YIIA 2D1HA 2E1NA 4G7HF 1IZ1A 4LB5A 2HZTA 1H9GA 2E1CA 1KGSA 4LG0A 4CDGA 1D3YA 1ODDA 1IN4A 2ETHA 3FXQA 1HKSA 5JVTA 3WGGA 1FYKA 2DW4A 3GFJA 1D8JA 3SQNA 1XN7A 2CYYA 3M8EA 3ERED 4UVCA 2DQLA 1U5TC 3MZHA 4EQQA 2L3DA 2CWEA 4PGHA 1H9TA 5JI6A 1LVAA 1T38A 2H6CA 5L3CA 2DLLA 3I0TA 5CVUA 1R22A 2ELHA 3K2ZA 1D5VA 1YQAA 5JHUA 2EFQA 2G9WA 2DK5A 2NS0A 2XROA 2VC1A 4IRGA 1G6NA 3DKWA 4LMYA 1K6OA 3O6BB 3RYPA 1TW3A 5E17F 2GWRA 1TBXA 2Q2EA 1VTNC 2VE9A 2V1UA 3BJ6A 2BBYA 3GO5A 3HSRA 3ULQB 1FBQA 1R7JA 2BEOA 1XCBA 4L5JA 3LA7A 3GVAA 2JTVA 4G8XA 4RB3C 4G9YA 1KYWA 4O5VA 4YG2F 4YFXF 5ILSA 5D8KB 1HSTA 3QRFF 3RTRA 4GCVA 3I64A 3QPHA 1G3SA 2DBBA 3W6JB 2DO7A 4GGGA 2NNNA 2HEOA 2A6EF 4LJZF 5LGUA 1RUOA 4HA8A 3D5LA 2LKPA 2CSOA 3R0AA 1HW1A 1Z9CA 3BDDA 2BGCA 4A6EA 3FWEA 4BHPA 3M1EA 2F5CA 2XIGA 4YFKF 5LEKA 3PQKA 2V1XA 4FX0A 2FE3A 3CO7C 2ACJA 3VEPA 2V79A 5FFZA 4MHGA 3E6CC 3H92A 4BXUA 3K1NA 1BOAA 3REOA 5FB2A 2Z9OA 4ENJA 3SXYA 5HDGA 1RI7A 5HDNA 2ZMEB 4I98B 4N9HA 4M74A 4ENMA 4M9SA 3NQOA 1O57A 1U5TA 5LLQA 3TDZC 1XGMA 1IW7F 1YW8A 4MNUA 2FF4A 4OINF 5K5OA 1BC7C 3ML6A 4ASNA 1FX7A 1FLIA 1G3WA 5AIPA 3ZN0A 3Q9VA 5L3DA 2PEXA 3F6VA 2NRAC 1BBYA 2YR2A 2XAFA 2NNYA 2EWNA 1KQ9A 2GQQA 4PDKA 4IVNA 2FMYA 1JHFA 1W7PD 3T1BA 4WX9A 2XAGA 1FYMA 4WWCA 2YPRA 2STTA 1S6LA 4CXFA 4MTEA 4U7DA 2HFHA 1V3FA 2QBYB 2FBIA 4PGGA 2Q8KA 2A61A 3Q9SA 5F1RA 4WCGA 1K78A 5E1XA 5ERIA 4U7BA 3ROUA 3GEZA 3I59B 3TQNA 2HKXA 1K7AA 1D8KA 4Y15A 5K5QA 3IHUA 4RGUA 5CJ9A 1XSDA 2UXXA 3E6MA 1XGNA 1TNSA 4A2UA 5ICCA 3DPLC 4HF2A 4LFUA 4JQFA 5EEGA 2L01A 4E70A 1ZG5A 4IRHA 2MBFA 2O0YA 2QQ9A 1IXRC 4KIGA 4ZYDA 4G6DA 2VOOA 3O2PE 2FXAA 3RI4A 2PFBA 3BJOA 2STWA 1HW5A 3ZMVA 4HDUA 1ON2A 2PMHA 2H27A 2OZ6A 2XV4S 4UV8A 1XSVA 3TOBA 5LGTA 3WODF 3FXRA 2CFXA 1WQ2A 2ZNZA 4RAYA 2MLGA 1HBXG 4ENKA 4K2EA 3U1DA 1W5TA 2HGCA 4KFCA 3F6OA 1W5SA 2K27A 4G6QA 3QOPA 2RC4A 4LK0F 5DCMB 1XMAA 4R1HA 4KA4A 4DNCA 2A6HF 3VFZA 1LDJA 1SFUA 2LF7A 1W4MA 1BC8C 1J9IA 2KIMA 2QYOA 1AWCA 1SMTA 5A2QZ 2HTSA 4L9VA 2EA2A 5L3FA 4RGXA 1O3TA 3SZPA 4EM1A 1LEBA 3E6DA 2IW5A 3GX4X 1B9MA 4BAYA 4HQMA 2VXZA 2KKOA 4LGWA 1LB2A 2XVCA 4HX8A 4O6JA 4ESBA 3WTZA 3HHGA 4EV0A 3L09A 3HOTA 4WXCA 5BMZA 2RKHA 3DFGA 2M45A 5ED4A 2QZ8A 1Z6TA 4ZYGA 3HHHA 4MEXF 3TGNA 3T8RA 5DUIA 1RUNA 1XDSA 2H94A 3TO6A 4IHSA 1E17A 1HSJA 4ZZDA 3WTSC 2A3SA 3LQRA 5HLGA 2V6CA 1DDNA 1T98A 4Q48A 1Y0UA 3FMSA 4EM0B 1ZG1A 4G7ZF 5H6QA 3V4GA 4HV5A 1O7FA 4EJUA 2D45A 3P9CA 4L0YB 1IAWA 1ZYRF 3AAFA 3IKVA 1LDKB 4HW0A 2IP2A 4G7OF 4B8XA 1L3LA 1USTA 3CUQC 1TLHB 3GXOA 1JXSA 4UHTA 3LSTA 3I53A 2O8XA 1ZLJA 1QBJA 3L7WA 1KA8A 3SHFA 1C0WA 4L5IA 4A0ZA 2QQAA 5HLIA 2PBIA 4HOBA 2Y0MA 2OD5A 2DFIA 1TW2A 3PFIA 3F22A 2IA1A 2M87A 3RYRA 2GAUA 4M6YA 4OIQF 3D0SA 3HUGA 1WSUA 2EFOA 3BOQA 4XLNF 4EJWA 2HR3A 4I02A 3ZP5A 1BIAA 1E2XA 3BPVA 4KICA 3FM5A 4RGSA 4BQAA 2WC2A 3DEUA 4U0WA 2GZWA 1HXDA 3F8FA 5LHIA 5DDGA 4BH9A 4JK1X 1P4AA 5CVJA 4AWXB 1ZLKA 3BP8A 4KNYA 1DPRA 3DQVC 1S7OA 3WTXC 2H09A 1I6XA 1U6GA 1XMKA 4UXNA 4ON0A 2P7VB 1UFMA 2TDXA 4CYDA 4KN4X 2D2WA 3RKWA 2W84A 5H20A 4L9TA 4M73A 1O7LA 1U8RA 1FWZA 2MH9A 1ULYA 3L00A 3LA2A 2ADUA 2XAQA 2K7LA 1TTYA 2CQKA 4HX7A 4XSXF 2COMA 3RDIA 2CO5A 4UVBA 2P5KA 3ECOA 5FGMA 1ZG3A 2M1BA 1IUYA 3ELKA 2KIFA 3C3WA 2D1VA 1L0OC 2CGPA 4KIBA 1SFXA 4RGRA 1SD6A 4LLNA 3MFKA 5DV5A 3GWZA 2VBYA 4M71A 2OQGA 5HS8A 1IXSB 3CUOA 4AIKA 3B73A 3CUQA 5ICGA 3JTHA 5JR3A 3BJAA 1Z7UA 1B4AA 1WRJA 3F72A 3GW2A 3IWZA 4ETSA 1RZ4A 1BI1A 2OZUA 2Z99A 4S04A 3DF8A 4P9FA 2OQRA 1IF1A 4RB1A 4ZYHA 4LLGF 3C18A 1QZYA 1R1TA 1TQIA 3RJPA 2XGXA 2ESHA 2C6YA 1NHAA 3HSFA 3JSPA 4KMUX 2B0LA 1FBSA 4ESFA 1UCRA 4MTDA 3P9KA 4P5OA 1LJ9A 1BJAA 1ON1A 2O03A 4ZYEA 3K9TA 4OIPF 2OU2A 1IN5A 3VOEA 5KVRA 2MD5A 2KJCA 2HKOA 1T39A 5HS9A 1R36A 3FMQA 3MWMA 1CF7B 1SD4A 2VBZA 3WTWC 3WGHA 3JW4A 3ABUA 3COAC 4CHUA 1HKQA 2YSRA 1OYIA 3WTYC 5LEJA 2JRTA 2ZBKA 2XKPA 4KYWA 1IN7A 1MJAA 1RIOH 4CZZA 1F9NA 4A6DA 2VT2A 2L54A 3KEQA 3FMRA 2RDPA 4B09A 4S05A 4RB2C 3HRTA 1B6AA 1I1GA 3HOSA 2R3SA 2MLKA 4NHJA 4XSZF 5E20A 5D5WB 3RKXA 1J2XA 3RPQA 3HRUA 1B9NA 1MJBA 3GZ6A 2EK5A 3WG9A 2QWWA 2ZMEA 3V7RA 3FX3A 2JT1A 3O3KA 4XRFA 1I5ZA 5DCFA 5E1ZB 3QAHA 3CLOA 2Y75A 4U0YA 3V7SA 3J81K 4RB0A 1Z91A 3N4MA 2A07F 1A04A 2FNPA 1MGTA 1MDMB 1FZPB 4TV7A 4M9XA 3MQ0A 3QP5A 2WV0A 4UVAA 3R0JA 1HKTA 4I09A 5D8LB 3E5QA 2IT0A 4HYEA 4MGRA 5A2QK 2FOKA 3EDPA 3L2CA 4Q47A 2HOEA 4BHBA 3U2RA 3F8BA 3KE2A 2P5LC 4U88A 1S3JA 2O6GE 4L9JA 3R6SA 2ZO4A 3I58A 2QBYA 4RAZA 2F5EA 5FD5A 3IC7A 2HWVA 3V8LA 4R8HA 3R61A 1ONVA 2KJBA 3I59A 4A0YA 1ZRFA 3ZQ7A 2EFWA 2Z5UA 4HBLA 1KU2A 2CW0F 5L3GA 2EFNA 1O3QA 1YS7A 2DPUA 3WU1B 3KP5A 2IA2A 4YFNF 1F1ZA 1YO5C 2K4JA 3I5UA 2YU3A 3IRRA 2VE8A 1B1BA 2LDUA 4WXDA 1FSHA 4IPAA 2RGVA 3EQLF 4PCQA 5TJJA 3BZ6A 1ZGJA 1WI9A 2P6SA 1LEAA 4EGZA 2V9VA 5TRDA 4ZZLA 2GA2A 4Y17A 3RIRA 3ZMDA 2E7WA 1MD0A 1RNLA 3LWFA 4NQWA 5K5RA 2O61A 4A5MA 3J81Z 1LDDA 1QGPA 1ZHFA 4Z2YA 4I0BA 3TOAA 1IRGA 3H3ZA 3K0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9G A;  1XCV A;  4N9I A;  1FOK A;  1S29 A;  3T0Y A;  5BPI A;  2FEZ A;  4I01 A;  4KN7 X;  5CYV A;  5LHH A;  2MC3 A;  4RS8 A;  4LB6 B;  3Q5F A;  3ZMU A;  1BN5 A;  3EYY A;  3EET A;  5DCM A;  3OV8 A;  3WGI A;  5ILV A;  2HYF A;  1TQP A;  2FBK A;  1OMI A;  5HDK A;  4GXO A;  2M5W A;  1OKR A;  3KLO A;  1IN6 A;  4HQE A;  1ZAO A;  4IJA A;  1KU9 A;  5D5V B;  3LFK A;  2DQR A;  5FLX Z;  2BV6 A;  3E5X A;  4WF2 A;  2OAZ A;  4QLC U;  4U0V A;  4HZF A;  1KQ8 A;  2QQB A;  4UNO A;  1QO0 D;  2UZK A;  2EB7 A;  2JPB A;  1J5Y A;  5K1Y A;  2FSW A;  4XLP F;  1XGO A;  4MQV A;  1YLF A;  3ZMT A;  3DP7 A;  2ZKZ A;  1G4D A;  2J5O A;  1J59 A;  2W24 A;  4IRI A;  3R4K A;  1IRF A;  3JTG A;  2UWM A;  2VBW A;  3F21 A;  2FA5 A;  2JSC A;  1Z1D A;  1SD7 A;  5HOO A;  5E18 F;  1REP C;  2XAS A;  2QVO A;  3HRM A;  1SD5 A;  1S8N A;  4HLX A;  2PLY A;  4ESJ A;  3GYH X;  1BI3 A;  3F3X A;  2DI3 A;  4IXA A;  3C1D A;  3WE2 A;  3WU0 A;  2FNA A;  1W7P B;  5E8G A;  5LBQ A;  4AIJ A;  3CJN A;  1GXP A;  1Z6R A;  1JGS A;  2ZXJ A;  1KU3 A;  2ZCW A;  2Q0O A;  3MEX A;  3N97 A;  2LF8 A;  2F5D A;  3PQJ A;  3TKY A;  5KK1 A;  1IXC A;  2R7F A;  3RKY A;  4FHT A;  5J6X A;  1BIB A;  2EA4 A;  4QWQ A;  2XHK A;  4OMY A;  2H6B A;  1UHW A;  1FC3 A;  4KDP A;  3T5X A;  3ZMZ A;  3MCZ A;  2GA1 A;  5F64 A;  4LG0 B;  1I27 A;  1YFH A;  2V1D A;  2BE5 F;  5DEQ A;  2XAJ A;  5BPD A;  4UUV A;  3HTU A;  4AVP A;  1FY7 A;  2NAZ A;  2MA3 A;  1R23 A;  2GIV A;  5LRS A;  5FD6 A;  3GF2 A;  5L3E A;  1B59 A;  3FF5 A;  2F5F A;  1X3U A;  2F2E A;  3IWF A;  2XAH A;  4GO1 A;  2W85 A;  3IKT A;  1YS6 A;  4HF0 A;  2P6T A;  3BPX A;  1ZN2 A;  3DPT A;  5CVI A;  3ZN1 A;  4EJT A;  3KEO A;  1PUE E;  1R1U A;  5LRR A;  3VOD A;  3KLN A;  4OOI A;  1LQ1 A;  2VOP A;  3GUD A;  2QLZ A;  4GYG A;  3CUQ B;  1I1S A;  4DQ2 A;  1FYL A;  3GLX A;  3K1M A;  3DXJ F;  2M30 A;  4Y13 A;  2G7H A;  2EFP A;  2KIU A;  3M7G A;  1FP2 A;  2M8E A;  4N0B A;  5D4S A;  3QPT A;  2E7X A;  5LHG A;  1ZRD A;  4CIC A;  2A69 F;  1OYW A;  3T8T A;  3NEU A;  1T6S A;  2Y48 A;  4FT8 A;  2VBX A;  2L02 A;  1T0F A;  4A0X A;  5DYM A;  2DPD A;  1XB4 A;  4Q4Z F;  3G3Z A;  1XD7 A;  4EGY A;  4I2O A;  3K69 A;  3HTS B;  2WTE A;  3TO9 A;  2EV6 A;  2P7C B;  5IT9 K;  3KET A;  3WTT C;  1KU7 A;  1XGS A;  4KIF A;  2PQ8 A;  1OYY A;  3IL2 A;  5ILU A;  5DD8 A;  2KRF A;  4HV6 A;  1KQ0 A;  3GZ5 A;  5ICF A;  2P5V A;  3MZY A;  5E1W A;  2IPQ X;  1OPC A;  5EEH A;  2NYX A;  1BI0 A;  1U5T B;  1G3T A;  3QP6 A;  3FM3 A;  2K02 A;  1WKM A;  4KT5 C;  2BYV E;  1HQC A;  4M9Z A;  2A5Y B;  4D0P A;  4WK8 F;  3FZV A;  2DK8 A;  3WTU C;  5J8C A;  3CO6 C;  1O3S A;  1R5H A;  2Z33 A;  1XDU A;  5HVQ C;  2J5P A;  4EJO A;  4KMF A;  1CF7 A;  1FT9 A;  3OOP A;  1YIO A;  2FML A;  4P96 A;  3F8N A;  5HS7 A;  2P8T A;  3P7N A;  2ISZ A;  4H0E A;  2PI0 A;  5AIQ A;  4CGZ A;  1QQI A;  6PAX A;  3GFL A;  4OIR F;  2DT5 A;  3BRO A;  3LA3 A;  1GXQ A;  1U3E M;  1PDN C;  1EH6 A;  4EJV A;  3E3V A;  5AON A;  5CVR A;  3KP3 A;  1K78 B;  1SFE A;  1PP8 F;  4F7Z A;  3BY6 A;  2RVC A;  1U2W A;  3QU3 A;  4A12 A;  2EV0 A;  1LNW A;  1ZAR A;  3LQQ A;  2FBH A;  1JE8 A;  4JBA A;  4HX4 A;  2VON A;  3R60 A;  4YIF A;  5IT9 Z;  5JFR A;  4FX4 A;  1STZ A;  2DU9 A;  1SMY F;  2GXG A;  2O3F A;  4A5N A;  1F5T A;  1QNT A;  1UB9 A;  4EMS A;  2CG4 A;  2QM3 A;  2RN7 A;  1GVJ A;  3E5U A;  2RQP A;  2VN2 A;  1QZZ A;  2DAO A;  2HQN A;  2OBP A;  2FU4 A;  5D5U B;  1O3R A;  2K4B A;  2G7U A;  2VC0 A;  4KUM A;  1MDM A;  3JAM K;  4MEY F;  2JPC A;  4HDV A;  2R7D A;  4ZH4 F;  2ZJ2 A;  4P55 A;  3KCC A;  3HIF A;  4M72 A;  1YW7 A;  5LGN A;  5BOX A;  1MJ9 A;  4BYY A;  1G3Y A;  3NRV A;  4XBF A;  2UXN A;  1Z05 A;  5FLX K;  1K79 A;  1J75 A;  1FBU A;  3TO7 A;  4O3M A;  1J7K A;  4R79 A;  3SZT A;  3J7A O;  4LLL A;  1ZGA A;  2HTJ A;  1Q1H A;  5F6F A;  4Q5S F;  4M6X A;  4CO8 A;  3ZPL A;  4UV9 A;  4P9U A;  1EH7 A;  1YW9 A;  1MZB A;  3M8F A;  5D6E A;  3KZY A;  1DPU A;  2FRH A;  2HQR A;  1MKM A;  3CTA A;  1AOY A;  5L3B A;  3HYI A;  1WWX A;  3F8C A;  1BM9 A;  4LK1 F;  1BI2 A;  3S2W A;  1DP7 P;  3I4P A;  2L4A A;  3F8M A;  3B02 A;  3MAJ A;  3C7J A;  3ZMS A;  2XKO A;  1FPQ A;  2A68 F;  4BNC A;  4L0Z B;  4AD9 A;  4EVI A;  5FFX A;  3IRQ A;  3ABT A;  2X0L A;  3KP2 A;  1JHH A;  2ESN A;  2X4H A;  4BHC A;  3P9I A;  5D4R A;  5ICE A;  4PZJ A;  1QPM A;  3GFI A;  2AXL A;  4I7H A;  1J0R A;  1DUX C;  2WWY A;  1EH8 A;  3LAP A;  4GYI A;  1IN8 A;  1CGP A;  1XSX A;  3KFW X;  2P4W A;  3KP7 A;  2LSO A;  2DTR A;  2ZNY A;  5D6F A;  5D5X B;  2HYG D;  3WTV C;  3SFZ A;  1H0M A;  4WXH A;  3JAM Z;  2PN6 A;  3VB2 A;  2IA0 A;  2K86 A;  2PG4 A;  3RPU A;  4HAM A;  1FSE A;  1EV7 A;  1R1V A;  1YYV A;  2EV5 A;  2HDC A;  4L18 B;  3DV8 A;  2ISY A;  1GHC A;  1FNN A;  3K1P A;  4IF4 A;  2W25 A;  2GXB A;  1P2F A;  3J80 K;  4MQ9 F;  3ISP A;  5J8F A;  2IRF G;  3EUH A;  5DUK A;  3WE3 A;  2RV8 A;  3JSO A;  3BWG A;  4AIH A;  2QUF A;  2PMU A;  4IHT A;  1ZRE A;  4OIO F;  2VOD A;  4HF1 A;  5E8I A;  5H6R A;  5BQT A;  1V4R A;  4ENN A;  4NB5 A;  3KP6 A;  2XUB A;  4I0A A;  4EM2 A;  3CDH A;  2YX4 A;  1R5G A;  1P4X A;  1ZRC A;  2RNJ A;  2PJP A;  3F23 A;  5CLS A;  1OR7 A;  1R58 A;  1UHM A;  5BS6 A;  3HRS A;  4OMZ A;  2L4M A;  1TNT A;  3QU6 A;  3I54 A;  1SAX A;  3FHZ A;  3W6K B;  3ECH A;  3GFM A;  5IT3 A;  3G73 A;  3L9F A;  1R00 A;  2ZFW A;  2XRN A;  1YTY A;  1USS A;  1P92 A;  3V7C A;  4LD5 A;  1PP7 U;  1S7A A;  4OU0 A;  2HS5 A;  1P6R A;  3E6B A;  3E97 A;  2Z3Y A;  1F4K A;  1U78 A;  3KP4 A;  2FQ3 A;  2AS5 F;  3FXU A;  3KZZ A;  2OA4 A;  1HW2 A;  2MH2 A;  3EYI A;  2EJR A;  1FP1 D;  2VT3 A;  3V8J A;  2IJL A;  2QEN A;  4HLY A;  3V8K A;  1YG2 A;  1TQM A;  2IVM A;  3HSE A;  3H3U A;  1KYZ A;  1W7P A;  2W57 A;  1ZH5 A;  3J80 Z;  5FO5 A;  2JZY A;  3M9A A;  1T2K A;  2YX7 A;  4L9N A;  3I71 A;  4G94 A;  1P4W A;  5CVV A;  5HLH A;  3LAJ A;  5DD4 A;  2LNB A;  3TDU C;  4YII A;  2D1H A;  2E1N A;  4G7H F;  1IZ1 A;  4LB5 A;  2HZT A;  1H9G A;  2E1C A;  1KGS A;  4LG0 A;  4CDG A;  1D3Y A;  1ODD A;  1IN4 A;  2ETH A;  3FXQ A;  1HKS A;  5JVT A;  3WGG A;  1FYK A;  2DW4 A;  3GFJ A;  1D8J A;  3SQN A;  1XN7 A;  2CYY A;  3M8E A;  3ERE D;  4UVC A;  2DQL A;  1U5T C;  3MZH A;  4EQQ A;  2L3D A;  2CWE A;  4PGH A;  1H9T A;  5JI6 A;  1LVA A;  1T38 A;  2H6C A;  5L3C A;  2DLL A;  3I0T A;  5CVU A;  1R22 A;  2ELH A;  3K2Z A;  1D5V A;  1YQA A;  5JHU A;  2EFQ A;  2G9W A;  2DK5 A;  2NS0 A;  2XRO A;  2VC1 A;  4IRG A;  1G6N A;  3DKW A;  4LMY A;  1K6O A;  3O6B B;  3RYP A;  1TW3 A;  5E17 F;  2GWR A;  1TBX A;  2Q2E A;  1VTN C;  2VE9 A;  2V1U A;  3BJ6 A;  2BBY A;  3GO5 A;  3HSR A;  3ULQ B;  1FBQ A;  1R7J A;  2BEO A;  1XCB A;  4L5J A;  3LA7 A;  3GVA A;  2JTV A;  4G8X A;  4RB3 C;  4G9Y A;  1KYW A;  4O5V A;  4YG2 F;  4YFX F;  5ILS A;  5D8K B;  1HST A;  3QRF F;  3RTR A;  4GCV A;  3I64 A;  3QPH A;  1G3S A;  2DBB A;  3W6J B;  2DO7 A;  4GGG A;  2NNN A;  2HEO A;  2A6E F;  4LJZ F;  5LGU A;  1RUO A;  4HA8 A;  3D5L A;  2LKP A;  2CSO A;  3R0A A;  1HW1 A;  1Z9C A;  3BDD A;  2BGC A;  4A6E A;  3FWE A;  4BHP A;  3M1E A;  2F5C A;  2XIG A;  4YFK F;  5LEK A;  3PQK A;  2V1X A;  4FX0 A;  2FE3 A;  3CO7 C;  2ACJ A;  3VEP A;  2V79 A;  5FFZ A;  4MHG A;  3E6C C;  3H92 A;  4BXU A;  3K1N A;  1BOA A;  3REO A;  5FB2 A;  2Z9O A;  4ENJ A;  3SXY A;  5HDG A;  1RI7 A;  5HDN A;  2ZME B;  4I98 B;  4N9H A;  4M74 A;  4ENM A;  4M9S A;  3NQO A;  1O57 A;  1U5T A;  5LLQ A;  3TDZ C;  1XGM A;  1IW7 F;  1YW8 A;  4MNU A;  2FF4 A;  4OIN F;  5K5O A;  1BC7 C;  3ML6 A;  4ASN A;  1FX7 A;  1FLI A;  1G3W A;  5AIP A;  3ZN0 A;  3Q9V A;  5L3D A;  2PEX A;  3F6V A;  2NRA C;  1BBY A;  2YR2 A;  2XAF A;  2NNY A;  2EWN A;  1KQ9 A;  2GQQ A;  4PDK A;  4IVN A;  2FMY A;  1JHF A;  1W7P D;  3T1B A;  4WX9 A;  2XAG A;  1FYM A;  4WWC A;  2YPR A;  2STT A;  1S6L A;  4CXF A;  4MTE A;  4U7D A;  2HFH A;  1V3F A;  2QBY B;  2FBI A;  4PGG A;  2Q8K A;  2A61 A;  3Q9S A;  5F1R A;  4WCG A;  1K78 A;  5E1X A;  5ERI A;  4U7B A;  3ROU A;  3GEZ A;  3I59 B;  3TQN A;  2HKX A;  1K7A A;  1D8K A;  4Y15 A;  5K5Q A;  3IHU A;  4RGU A;  5CJ9 A;  1XSD A;  2UXX A;  3E6M A;  1XGN A;  1TNS A;  4A2U A;  5ICC A;  3DPL C;  4HF2 A;  4LFU A;  4JQF A;  5EEG A;  2L01 A;  4E70 A;  1ZG5 A;  4IRH A;  2MBF A;  2O0Y A;  2QQ9 A;  1IXR C;  4KIG A;  4ZYD A;  4G6D A;  2VOO A;  3O2P E;  2FXA A;  3RI4 A;  2PFB A;  3BJO A;  2STW A;  1HW5 A;  3ZMV A;  4HDU A;  1ON2 A;  2PMH A;  2H27 A;  2OZ6 A;  2XV4 S;  4UV8 A;  1XSV A;  3TOB A;  5LGT A;  3WOD F;  3FXR A;  2CFX A;  1WQ2 A;  2ZNZ A;  4RAY A;  2MLG A;  1HBX G;  4ENK A;  4K2E A;  3U1D A;  1W5T A;  2HGC A;  4KFC A;  3F6O A;  1W5S A;  2K27 A;  4G6Q A;  3QOP A;  2RC4 A;  4LK0 F;  5DCM B;  1XMA A;  4R1H A;  4KA4 A;  4DNC A;  2A6H F;  3VFZ A;  1LDJ A;  1SFU A;  2LF7 A;  1W4M A;  1BC8 C;  1J9I A;  2KIM A;  2QYO A;  1AWC A;  1SMT A;  5A2Q Z;  2HTS A;  4L9V A;  2EA2 A;  5L3F A;  4RGX A;  1O3T A;  3SZP A;  4EM1 A;  1LEB A;  3E6D A;  2IW5 A;  3GX4 X;  1B9M A;  4BAY A;  4HQM A;  2VXZ A;  2KKO A;  4LGW A;  1LB2 A;  2XVC A;  4HX8 A;  4O6J A;  4ESB A;  3WTZ A;  3HHG A;  4EV0 A;  3L09 A;  3HOT A;  4WXC A;  5BMZ A;  2RKH A;  3DFG A;  2M45 A;  5ED4 A;  2QZ8 A;  1Z6T A;  4ZYG A;  3HHH A;  4MEX F;  3TGN A;  3T8R A;  5DUI A;  1RUN A;  1XDS A;  2H94 A;  3TO6 A;  4IHS A;  1E17 A;  1HSJ A;  4ZZD A;  3WTS C;  2A3S A;  3LQR A;  5HLG A;  2V6C A;  1DDN A;  1T98 A;  4Q48 A;  1Y0U A;  3FMS A;  4EM0 B;  1ZG1 A;  4G7Z F;  5H6Q A;  3V4G A;  4HV5 A;  1O7F A;  4EJU A;  2D45 A;  3P9C A;  4L0Y B;  1IAW A;  1ZYR F;  3AAF A;  3IKV A;  1LDK B;  4HW0 A;  2IP2 A;  4G7O F;  4B8X A;  1L3L A;  1UST A;  3CUQ C;  1TLH B;  3GXO A;  1JXS A;  4UHT A;  3LST A;  3I53 A;  2O8X A;  1ZLJ A;  1QBJ A;  3L7W A;  1KA8 A;  3SHF A;  1C0W A;  4L5I A;  4A0Z A;  2QQA A;  5HLI A;  2PBI A;  4HOB A;  2Y0M A;  2OD5 A;  2DFI A;  1TW2 A;  3PFI A;  3F22 A;  2IA1 A;  2M87 A;  3RYR A;  2GAU A;  4M6Y A;  4OIQ F;  3D0S A;  3HUG A;  1WSU A;  2EFO A;  3BOQ A;  4XLN F;  4EJW A;  2HR3 A;  4I02 A;  3ZP5 A;  1BIA A;  1E2X A;  3BPV A;  4KIC A;  3FM5 A;  4RGS A;  4BQA A;  2WC2 A;  3DEU A;  4U0W A;  2GZW A;  1HXD A;  3F8F A;  5LHI A;  5DDG A;  4BH9 A;  4JK1 X;  1P4A A;  5CVJ A;  4AWX B;  1ZLK A;  3BP8 A;  4KNY A;  1DPR A;  3DQV C;  1S7O A;  3WTX C;  2H09 A;  1I6X A;  1U6G A;  1XMK A;  4UXN A;  4ON0 A;  2P7V B;  1UFM A;  2TDX A;  4CYD A;  4KN4 X;  2D2W A;  3RKW A;  2W84 A;  5H20 A;  4L9T A;  4M73 A;  1O7L A;  1U8R A;  1FWZ A;  2MH9 A;  1ULY A;  3L00 A;  3LA2 A;  2ADU A;  2XAQ A;  2K7L A;  1TTY A;  2CQK A;  4HX7 A;  4XSX F;  2COM A;  3RDI A;  2CO5 A;  4UVB A;  2P5K A;  3ECO A;  5FGM A;  1ZG3 A;  2M1B A;  1IUY A;  3ELK A;  2KIF A;  3C3W A;  2D1V A;  1L0O C;  2CGP A;  4KIB A;  1SFX A;  4RGR A;  1SD6 A;  4LLN A;  3MFK A;  5DV5 A;  3GWZ A;  2VBY A;  4M71 A;  2OQG A;  5HS8 A;  1IXS B;  3CUO A;  4AIK A;  3B73 A;  3CUQ A;  5ICG A;  3JTH A;  5JR3 A;  3BJA A;  1Z7U A;  1B4A A;  1WRJ A;  3F72 A;  3GW2 A;  3IWZ A;  4ETS A;  1RZ4 A;  1BI1 A;  2OZU A;  2Z99 A;  4S04 A;  3DF8 A;  4P9F A;  2OQR A;  1IF1 A;  4RB1 A;  4ZYH A;  4LLG F;  3C18 A;  1QZY A;  1R1T A;  1TQI A;  3RJP A;  2XGX A;  2ESH A;  2C6Y A;  1NHA A;  3HSF A;  3JSP A;  4KMU X;  2B0L A;  1FBS A;  4ESF A;  1UCR A;  4MTD A;  3P9K A;  4P5O A;  1LJ9 A;  1BJA A;  1ON1 A;  2O03 A;  4ZYE A;  3K9T A;  4OIP F;  2OU2 A;  1IN5 A;  3VOE A;  5KVR A;  2MD5 A;  2KJC A;  2HKO A;  1T39 A;  5HS9 A;  1R36 A;  3FMQ A;  3MWM A;  1CF7 B;  1SD4 A;  2VBZ A;  3WTW C;  3WGH A;  3JW4 A;  3ABU A;  3COA C;  4CHU A;  1HKQ A;  2YSR A;  1OYI A;  3WTY C;  5LEJ A;  2JRT A;  2ZBK A;  2XKP A;  4KYW A;  1IN7 A;  1MJA A;  1RIO H;  4CZZ A;  1F9N A;  4A6D A;  2VT2 A;  2L54 A;  3KEQ A;  3FMR A;  2RDP A;  4B09 A;  4S05 A;  4RB2 C;  3HRT A;  1B6A A;  1I1G A;  3HOS A;  2R3S A;  2MLK A;  4NHJ A;  4XSZ F;  5E20 A;  5D5W B;  3RKX A;  1J2X A;  3RPQ A;  3HRU A;  1B9N A;  1MJB A;  3GZ6 A;  2EK5 A;  3WG9 A;  2QWW A;  2ZME A;  3V7R A;  3FX3 A;  2JT1 A;  3O3K A;  4XRF A;  1I5Z A;  5DCF A;  5E1Z B;  3QAH A;  3CLO A;  2Y75 A;  4U0Y A;  3V7S A;  3J81 K;  4RB0 A;  1Z91 A;  3N4M A;  2A07 F;  1A04 A;  2FNP A;  1MGT A;  1MDM B;  1FZP B;  4TV7 A;  4M9X A;  3MQ0 A;  3QP5 A;  2WV0 A;  4UVA A;  3R0J A;  1HKT A;  4I09 A;  5D8L B;  3E5Q A;  2IT0 A;  4HYE A;  4MGR A;  5A2Q K;  2FOK A;  3EDP A;  3L2C A;  4Q47 A;  2HOE A;  4BHB A;  3U2R A;  3F8B A;  3KE2 A;  2P5L C;  4U88 A;  1S3J A;  2O6G E;  4L9J A;  3R6S A;  2ZO4 A;  3I58 A;  2QBY A;  4RAZ A;  2F5E A;  5FD5 A;  3IC7 A;  2HWV A;  3V8L A;  4R8H A;  3R61 A;  1ONV A;  2KJB A;  3I59 A;  4A0Y A;  1ZRF A;  3ZQ7 A;  2EFW A;  2Z5U A;  4HBL A;  1KU2 A;  2CW0 F;  5L3G A;  2EFN A;  1O3Q A;  1YS7 A;  2DPU A;  3WU1 B;  3KP5 A;  2IA2 A;  4YFN F;  1F1Z A;  1YO5 C;  2K4J A;  3I5U A;  2YU3 A;  3IRR A;  2VE8 A;  1B1B A;  2LDU A;  4WXD A;  1FSH A;  4IPA A;  2RGV A;  3EQL F;  4PCQ A;  5TJJ A;  3BZ6 A;  1ZGJ A;  1WI9 A;  2P6S A;  1LEA A;  4EGZ A;  2V9V A;  5TRD A;  4ZZL A;  2GA2 A;  4Y17 A;  3RIR A;  3ZMD A;  2E7W A;  1MD0 A;  1RNL A;  3LWF A;  4NQW A;  5K5R A;  2O61 A;  4A5M A;  3J81 Z;  1LDD A;  1QGP A;  1ZHF A;  4Z2Y A;  4I0B A;  3TOA A;  1IRG A;  3H3Z A;  3K0L A; 
#chains in the Genus database with same CATH topology
 1MMA A;  3U9G A;  1XCV A;  4N9I A;  1FOK A;  2R5Z B;  1S29 A;  2Y9Y A;  3T0Y A;  3WG7 H;  4XON A;  2LR8 A;  5BPI A;  2HOA A;  5JLW A;  5IOY A;  3I56 I;  5IY5 H;  4V2G A;  1RES A;  2FEZ A;  2WV1 A;  1R49 A;  4I01 A;  3HBL A;  4XIC A;  2VPL A;  4KN7 X;  5CYV A;  2CV0 A;  2H1K A;  3A03 A;  4RLQ A;  2OF7 A;  3FIS A;  5LHH A;  1OCZ H;  2MC3 A;  4RS8 A;  4LB6 B;  3A01 A;  3Q5F A;  2DXI A;  1ETQ A;  1X1A A;  5EGO A;  4F55 A;  3KYL A;  3ZMU A;  1BN5 A;  3EYY A;  3EET A;  2XSD C;  2PJR A;  5DCM A;  2DFH A;  3BTC A;  4HEA 2;  5F08 A;  4CUG A;  3HOZ J;  3OV8 A;  3M3Y J;  3WGI A;  5ILV A;  3CF5 F;  2HYF A;  1TQP A;  4DYC A;  2FBK A;  1OFC X;  1HDP A;  1OMI A;  3LSJ A;  2R5Y B;  4RDU A;  3BLY A;  5HDK A;  4GXO A;  2M5W A;  4I99 C;  5KAI C;  1QPI A;  1OKR A;  2OCC H;  3JRG A;  4J00 A;  3KLO A;  1RR7 A;  1IN6 A;  4HQE A;  1E0E A;  1ZAO A;  3BG3 A;  4IJA A;  1KU9 A;  2FQ4 A;  5D5V B;  3LFK A;  2DQR A;  1OCR H;  4F93 B;  3K4J A;  5FLX Z;  2DJN A;  3LSG A;  2BV6 A;  4ZDP A;  2EIJ H;  3F9K A;  3E5X A;  4WF2 A;  2OAZ A;  4QLC U;  3ONQ A;  3S17 J;  4U0V A;  4HZF A;  4BY7 J;  2R0Q C;  1KQ8 A;  1OQY A;  1YE9 A;  2QQB A;  1ETK A;  1QO0 D;  1ZR2 A;  4UNO A;  3AKZ A;  2UZK A;  3I9V 2;  4RM2 A;  2DOE A;  3OYJ A;  2EB7 A;  5JHF A;  2JPB A;  2R7Z J;  1J5Y A;  3HG9 A;  5K1Y A;  3LL7 A;  1ZGW A;  1Y0N A;  1PUF A;  4ITV A;  2FSW A;  4XLP F;  1N75 A;  1XGO A;  2OUM A;  4MQV A;  1YLF A;  4IL6 C;  3ZMT A;  1X1C A;  3DP7 A;  2NS8 A;  2ZKZ A;  1G4D A;  2J5O A;  1J59 A;  2IS2 A;  2W24 A;  2O7O A;  2CUJ A;  2EIM H;  3BR3 A;  5IP7 J;  1YI2 I;  4IRI A;  3R4K A;  1IRF A;  2BY1 A;  3K10 A;  3JTG A;  2UWM A;  2VBW A;  1XTA A;  4AVZ A;  4IZZ A;  3AG2 H;  3DU5 A;  3F21 A;  3RZD J;  2E36 A;  2VI6 A;  5KCM A;  3WU2 C;  2FA5 A;  2JSC A;  1IV8 A;  2VQC A;  5FKO A;  3IV5 A;  1Z1D A;  1SD7 A;  5HOO A;  5E18 F;  1REP C;  4B47 A;  2XAS A;  1GV2 A;  2QVO A;  3E0J B;  3HRM A;  1SD5 A;  5M5X J;  1R4N B;  1S8N A;  1GT0 C;  3VWB A;  4HLX A;  1IJW C;  2PLY A;  4ESJ A;  2CUE A;  3GYH X;  1BI3 A;  1D0Y A;  3F3X A;  2DI3 A;  4IXA A;  4BY1 J;  3C1D A;  2ID3 A;  4BEH B;  3WE2 A;  2O8K A;  2VQH A;  3ZQL A;  1T0F C;  3WU0 A;  2FNA A;  1W7P B;  5KNL A;  5E8G A;  2ZSH B;  4F92 B;  5LBQ A;  4AIJ A;  3CJN A;  1GXP A;  1Z6R A;  1JTY A;  4OAY A;  4KIS A;  3ERM A;  1JGS A;  3HKZ A;  2ZXJ A;  4B1R A;  3VYT B;  2MW8 A;  1KU3 A;  2ZCW A;  2Q0O A;  3MEX A;  3N97 A;  2W1O A;  2LF8 A;  2F5D A;  4II3 A;  3W2A A;  3PQJ A;  3TKY A;  4HSR A;  1X3Z B;  5KK1 A;  2Z16 A;  1IXC A;  2R7F A;  2YUS A;  3RKY A;  2XGD A;  2VJ5 A;  1N77 A;  2K9S A;  3OYE A;  4FHT A;  1MH4 A;  5J6X A;  1BIB A;  2EA4 A;  4QWQ A;  5JVG F;  2XHK A;  3CME I;  2G0E A;  2V6E A;  3CCU I;  4OMY A;  3O8H A;  2H6B A;  1UHW A;  4XM3 A;  1FC3 A;  1OLT A;  4ANJ A;  3K70 C;  4KDP A;  3T5X A;  3ZMZ A;  2HPM A;  2NVY J;  3LOC A;  1JUM A;  4AUX A;  3MCZ A;  1F36 A;  2GA1 A;  5F64 A;  1YJW I;  4LG0 B;  3H5R A;  1I27 A;  1YFH A;  3G2B A;  1AHD P;  2V1D A;  4M3D A;  2BE5 F;  5DEQ A;  5K7H A;  2XAJ A;  2JWT A;  4QPQ A;  5BPD A;  4UUV A;  1MIJ A;  3OIO A;  3HTU A;  4AVP A;  1FY7 A;  2NAZ A;  2MA3 A;  4AC0 A;  4D5F A;  1R23 A;  2GIV A;  3Q0W A;  5LRS A;  3CD6 I;  5FD6 A;  3GF2 A;  5L3E A;  1B59 A;  2HZD A;  3L1P A;  4X0G A;  1P7I A;  3FF5 A;  2F5F A;  1X3U A;  5J4V A;  2F2E A;  3ZQI A;  3IWF A;  5FRN A;  3S2D J;  2XAH A;  4GO1 A;  2W85 A;  3IKT A;  1H88 C;  3K7A J;  1XPX A;  3C2G A;  2KDO A;  3D1N I;  1YS6 A;  4HST A;  5HNF A;  1TT5 B;  1MMD A;  4HF0 A;  2P6T A;  4CZC A;  4BBR J;  5F0C A;  1IRZ A;  4RBO A;  1UHS A;  3BPX A;  1ZN2 A;  2ELJ A;  3DPT A;  3GME A;  5CVI A;  3ZN1 A;  4LOC A;  3ZQC A;  1M1E B;  4EJT A;  2CW7 A;  5GP9 A;  2JUG A;  3H5N A;  2HYJ A;  2LYC A;  3OS0 A;  1TWA J;  2H1L A;  3KEO A;  2QGU A;  1PUE E;  1R1U A;  4DBR A;  4A3I J;  5LRR A;  3VOD A;  3KLN A;  3HGY A;  4OOI A;  1LE8 B;  4CYC A;  3HZJ A;  1LQ1 A;  5M5W J;  2VOP A;  4A3D J;  3GUD A;  2QLZ A;  2W7N A;  2Q2E B;  1VI0 A;  4GYG A;  1VQ9 I;  3CUQ B;  1I1S A;  4DQ2 A;  3DCF A;  1FYL A;  3VYR B;  2VKD A;  3GLX A;  4BL0 B;  1QA6 A;  2XSJ C;  2H8R A;  5E3O A;  1R71 A;  3S1R J;  3K1M A;  5TGT A;  4IHV A;  4XR6 A;  2L7M P;  2LRD A;  5DM7 F;  2XGC A;  3DXJ F;  2FD5 A;  2M30 A;  4Y13 A;  2G7H A;  2EFP A;  2OV7 A;  2KIU A;  2W00 A;  3M7G A;  1FP2 A;  3PM1 A;  2M8E A;  4N0B A;  4IHX A;  1H8A C;  5D4S A;  3QPT A;  2E7X A;  5LHG A;  9ANT A;  2COB A;  3TBI A;  1ZRD A;  4CIC A;  2A69 F;  3OYF A;  1ZEL A;  1OYW A;  2P81 A;  5BNG A;  2BY2 A;  3T8T A;  3NEU A;  4J19 A;  1T6S A;  2Y48 A;  4FT8 A;  1VND A;  3ABL H;  2DA3 A;  2VBX A;  3MKW B;  4B44 A;  2L02 A;  1T0F A;  1ITY A;  2DYS H;  4A0X A;  5DYM A;  3FIW A;  2DPD A;  1XB4 A;  2LBF B;  4Q4Z F;  4PSX A;  1WGX A;  2XRL A;  3G3Z A;  3DBR B;  2NXN B;  1XD7 A;  2LKS A;  4EGY A;  4I2O A;  1UG2 A;  3B6A A;  2M8G X;  1SVM A;  3CMY A;  3K69 A;  2WAQ N;  3FDY A;  3H35 A;  2E5Z A;  3HTS B;  2WTE A;  3TO9 A;  3EUA A;  2EV6 A;  2L0K A;  2P7C B;  5IT9 K;  3LFU A;  2EZL A;  3KET A;  2E60 A;  3WTT C;  1KU7 A;  1XGS A;  4KIF A;  2PQ8 A;  2R7Q A;  4IKF A;  1OYY A;  3LSK A;  3IL2 A;  1Y1V J;  5ILU A;  3AG4 H;  4KIT B;  3OYH A;  1EF4 A;  5DD8 A;  4PJJ A;  4AYB A;  2R93 J;  2KRF A;  4HV6 A;  1KQ0 A;  3GZ5 A;  4LG3 A;  5ICF A;  3BQZ A;  2P5V A;  3MZY A;  4XKW A;  2KDZ A;  2XAU A;  5E1W A;  2CQN A;  2IPQ X;  1OPC A;  1MBE A;  2V26 A;  5EEH A;  1U9N A;  2DOA A;  2NYX A;  1BI0 A;  3G71 I;  1U5T B;  1G3T A;  3QP6 A;  3FM3 A;  2K02 A;  1W36 C;  4E7S A;  2OTJ I;  2JUC A;  3P5J A;  3W3C A;  3M07 A;  3A02 A;  5LFA A;  3S3O A;  1WKM A;  4KT5 C;  2BYV E;  2IGN A;  1HQC A;  3ZR8 X;  2KQR A;  4M9Z A;  3FXL A;  2A5Y B;  4D0P A;  4WK8 F;  3FZV A;  2DK8 A;  3QPL A;  3WTU C;  5J8C A;  3CO6 C;  1MBJ A;  2OCE A;  2K5C A;  1O3S A;  2R7T A;  1R5H A;  2Z33 A;  3H0D A;  2WB1 N;  4B3X A;  2F4M B;  2OTL I;  2E71 A;  1XDU A;  2F5V A;  5HVQ C;  2E34 A;  5C3E J;  2J5P A;  3PIP F;  4EJO A;  2KL4 A;  4KMF A;  2Q1Z B;  1CF7 A;  1A5J A;  1Z67 A;  1RPW A;  1FT9 A;  3OOP A;  1YIO A;  2FML A;  4NC7 A;  4P96 A;  3OYK A;  1K61 A;  3TW7 A;  3F8N A;  5HS7 A;  3UNG C;  5C4X J;  1BW5 A;  2P8T A;  3OWT A;  3P7N A;  4BQN A;  4DYR A;  2ISZ A;  4H0E A;  2PI0 A;  3DPU A;  5AIQ A;  4CGZ A;  4PFP A;  1QQI A;  1YIJ I;  6PAX A;  4BKX A;  3GFL A;  4OIR F;  2DT5 A;  4KT6 A;  2WAD A;  3BRO A;  3L2Q A;  3LA3 A;  1GXQ A;  3HM5 A;  1B72 A;  4UY8 I;  1BR2 A;  5CKT A;  3HL2 A;  1U3E M;  1PDN C;  1EH6 A;  4EJV A;  3E3V A;  3JRF A;  5FKK A;  4ZDL A;  2LVS A;  3A0H C;  5AON A;  4D1Q A;  2JMW A;  2M7A A;  3WHC A;  5M5Y J;  2Z2S B;  3FHN A;  5CVR A;  3GCM A;  3KP3 A;  1SC7 A;  1K78 B;  4C3H J;  3N05 A;  1SFE A;  1PP8 F;  1FIA A;  1JUP A;  1U9O A;  4F7Z A;  4ABZ A;  3FKI J;  3BY6 A;  2RVC A;  1U2W A;  3QU3 A;  4A12 A;  2EV0 A;  4F3Q A;  1E3P A;  1LNW A;  1ZAR A;  3LQQ A;  5J1U A;  2AXT C;  2FBH A;  1JE8 A;  2JJ7 A;  4JBA A;  1D0Z A;  4HX4 A;  3A4C A;  1VQL I;  2VON A;  2MYS A;  3R60 A;  4FE7 A;  4YIF A;  1UMQ A;  5IT9 Z;  5JFR A;  3OL4 A;  1NG7 A;  1JKO C;  1WZ2 A;  4RAG A;  4FX4 A;  1R6R A;  3NWS A;  1STZ A;  2DU9 A;  2KIQ A;  4F91 B;  3C2B A;  1SMY F;  4X6A J;  2GXG A;  2O3F A;  3DKY A;  1J09 A;  4A5N A;  1W0T A;  1F5T A;  1QNT A;  1UB9 A;  4EMS A;  2CG4 A;  2QM3 A;  2RN7 A;  1WJ5 A;  2EIN H;  1WJA A;  1GVJ A;  3E5U A;  2K9N A;  2RQP A;  2VN2 A;  3OMY A;  1QZZ A;  3RZO J;  3S14 J;  2CH0 A;  2DAO A;  3PSF A;  1YX3 A;  3E7L A;  4YRV A;  2HQN A;  2OBP A;  3IAM 2;  2FU4 A;  5D5U B;  1O3R A;  1TZL A;  2K4B A;  2G7U A;  2VC0 A;  2R7V A;  4KUM A;  1MDM A;  1ZK8 A;  3JAM K;  2DN0 A;  4MEY F;  3EUH C;  1BR4 A;  2HVR A;  5GAH J;  2JPC A;  1UG0 A;  4HDV A;  2R7D A;  2NVX J;  2EQR A;  4EEF G;  4ZH4 F;  2MC4 A;  3M4O J;  1QZE A;  1ZKG A;  1AKH A;  2ZJ2 A;  4P55 A;  4XNF A;  2WAQ A;  3KCC A;  3HIF A;  2CV2 A;  4M72 A;  3ZQG A;  1YW7 A;  5KAF C;  5LGN A;  2EIK H;  2HQ5 A;  5BOX A;  1MJ9 A;  2HU9 A;  4CA0 A;  4BYY A;  1G3Y A;  2FOW A;  1YRN A;  2VQL A;  3NRV A;  4XBF A;  2UXN A;  3BQY A;  1APL C;  1Z05 A;  5FLX K;  2DTZ A;  1K79 A;  1XX5 A;  2Y0S N;  3AL0 B;  1J75 A;  3OOU A;  1FBU A;  4M3E A;  3TO7 A;  4O3M A;  1J7K A;  4R79 A;  3SZT A;  3OR2 C;  2DMT A;  4IHY A;  3OYB A;  3LSM A;  3J7A O;  4IEJ A;  4LLL A;  5EZG A;  1ZGA A;  3A2K A;  2HTJ A;  2Y2Z A;  1Q1H A;  5F6F A;  5GAE J;  3J7Z I;  4Q5S F;  4M6X A;  4CO8 A;  1OR7 C;  3ZPL A;  4UV9 A;  4KJZ A;  2WAE A;  4P9U A;  4JX6 A;  1EH7 A;  1YW9 A;  1MZB A;  3M8F A;  2F48 A;  5D6E A;  3RQ4 A;  3E1S A;  3DWL E;  5F1J A;  3KZY A;  1T95 A;  1DPU A;  2FRH A;  2HQR A;  1MKM A;  3CTA A;  3SJM A;  4XKB A;  1AOY A;  2M7B A;  5L3B A;  4CCL A;  3HYI A;  4FIS A;  2KIS A;  1WWX A;  3X2Q H;  2VB6 A;  1BM9 A;  2M9H A;  1BI2 A;  3F8C A;  4LK1 F;  3S2W A;  4CCN A;  1DP7 P;  1IGN A;  3I4P A;  1HA8 A;  2L4A A;  2WY8 Q;  3F8M A;  3B02 A;  5TIS C;  3MAJ A;  3C7J A;  3KEY A;  4E6K G;  1WCM J;  3ZMS A;  2XKO A;  1FPQ A;  2A68 F;  4BNC A;  2X1E A;  4L0Z B;  1X19 A;  1N78 A;  4AD9 A;  4EVI A;  2XC7 A;  4A3G J;  3CF2 A;  5FFX A;  3IRQ A;  3LSI A;  3ABT A;  4QPO A;  4CCM A;  3CCM I;  2X0L A;  2A6T A;  2DCE A;  4DGW B;  3KP2 A;  1JHH A;  4OAZ A;  2ESN A;  2X4H A;  4BHC A;  3J7A Y;  2KHM A;  2LK2 A;  3P9I A;  5D4R A;  1T8I A;  2DMP A;  2K9L A;  1E3O C;  5ICE A;  4PZJ A;  1QPM A;  1ENH A;  3GFI A;  2AXL A;  4I7H A;  1S5L C;  1J0R A;  1FIP A;  3FBN B;  1DUX C;  2WWY A;  1G2H A;  2VJI A;  2B9S A;  1EH8 A;  3LAP A;  4GYI A;  3OYA A;  1IN8 A;  1MND A;  1CGP A;  2JA2 A;  1XSX A;  3KFW X;  2P4W A;  3KP7 A;  2LSO A;  1MBF A;  3K70 D;  2DTR A;  2ZNY A;  1WHU A;  5D6F A;  5D5X B;  2HYG D;  3IH3 A;  3SEQ A;  5IOZ A;  1XMX A;  2BW3 B;  3SFI A;  3WTV C;  5B3S H;  5DM6 F;  3S15 J;  3SFZ A;  1BL0 A;  1JT0 A;  1H0M A;  4WXH A;  3JAM Z;  2X6X A;  1XG1 A;  2PN6 A;  3VB2 A;  4J01 A;  3V42 A;  1XC5 A;  2IA0 A;  1VQK I;  2K86 A;  1ETO A;  2PG4 A;  2R5Z A;  3H3V K;  3BR5 A;  4BE2 A;  4D7M A;  3RPU A;  4HAM A;  1FSE A;  2HI3 A;  4FCY A;  2JN6 A;  4XK4 A;  3L2R A;  1EV7 A;  1R1V A;  1Z3Y A;  1YYV A;  4BU2 A;  2EV5 A;  1YJN I;  3UKG A;  2HDC A;  4A3C J;  4L18 B;  1SVL A;  3DV8 A;  2CUZ A;  4NC6 A;  2KRC A;  1JUS A;  2ISY A;  1GHC A;  1FNN A;  4FQG A;  3K1P A;  2ECC A;  4IF4 A;  1WVR A;  2XF6 A;  2GXA A;  2W25 A;  3I4N J;  2F6C A;  2GXB A;  1P2F A;  3J80 K;  4MQ9 F;  2XDV A;  3ISP A;  5J8F A;  2IRF G;  4JX5 A;  3EUH A;  5DUK A;  3WE3 A;  2RV8 A;  3JSO A;  2HXO A;  3BWG A;  4E7H A;  4C2U A;  1A6Q A;  4AIH A;  2QUF A;  3JR9 A;  1X2M A;  2PMU A;  1ORK A;  4IHT A;  4XLC A;  3G4S I;  1ZRE A;  3DBH B;  2R5Y A;  4OIO F;  2VOD A;  4NNJ A;  4HF1 A;  2CQ7 A;  1LKX A;  4MFD A;  3OR1 C;  1MH3 A;  5E8I A;  5H6R A;  2E35 A;  4E7J A;  5BQT A;  1V4R A;  4ENN A;  4XN0 A;  3PNY A;  3JRC A;  1ZQ3 P;  4NB5 A;  3KP6 A;  2XUB A;  4I0A A;  4M3G A;  4A69 C;  4EM2 A;  5DS9 A;  3HOX J;  3CDH A;  2YX4 A;  3S1M J;  2EZH A;  1R5G A;  3IUO A;  1P4X A;  1ZRC A;  3F0C A;  2X6W A;  2RNJ A;  3L2V A;  2PJP A;  1WJC A;  1JKR C;  3F23 A;  3DTI A;  5CLS A;  3CCS I;  1OR7 A;  1R58 A;  2Y0S A;  1R9T J;  1UHM A;  3ZQF A;  2AQE A;  5J40 A;  1D1B A;  5BS6 A;  3HDD A;  2V9P A;  1BJZ A;  4PK4 A;  3KIO A;  4HNU A;  2Y69 H;  3HRS A;  1TL8 A;  4OMZ A;  4D7N A;  3A0B C;  3W2W A;  4NBQ A;  1LPQ A;  2L4M A;  4UUS B;  3HUG B;  1TNT A;  1EKE A;  4I76 A;  3QU6 A;  3I54 A;  1SAX A;  2PMZ N;  3FHZ A;  3W6K B;  4AID A;  3ECH A;  3GFM A;  5IT3 A;  3PNT A;  3G73 A;  3L9F A;  2JQ7 A;  2TCT A;  1TT0 A;  2ZJR F;  1R00 A;  2ZFW A;  3WHB A;  2QA4 I;  2WA0 A;  5F0F A;  3HB9 A;  2XRN A;  1I3Q J;  1YTY A;  1ETY A;  1X58 A;  3S16 J;  1USS A;  1P92 A;  3V7C A;  3CC7 I;  4LD5 A;  3IH2 A;  1S7A A;  4OU0 A;  2HS5 A;  4LIV A;  1PP7 U;  1P6R A;  3E6B A;  2LP0 A;  3E97 A;  3IAS 2;  3SDB A;  2BVM A;  1EJ9 A;  4MO7 A;  3BG9 A;  2Z3Y A;  2AO9 A;  3AG1 H;  1T33 A;  3KP4 A;  2FQ3 A;  1U78 A;  4HNT A;  1F4K A;  2AS5 F;  4AYB N;  3FXU A;  3KZZ A;  5EF6 A;  3S2H J;  3OL3 A;  2OA4 A;  1HW2 A;  3HPH A;  2MH2 A;  4HPQ A;  4Z6Y A;  3EYI A;  1JI8 A;  2EJR A;  1FP1 D;  1IDZ A;  2VT3 A;  3V8J A;  2IJL A;  2QEN A;  4G12 A;  3PFY A;  4HLY A;  3V8K A;  1YG2 A;  4N4O B;  1TQM A;  2IVM A;  3ZQQ A;  4BEH A;  3HSE A;  2W82 A;  2X1C A;  3H3U A;  3K6G A;  5F27 A;  5EG0 B;  1KYZ A;  1D5Y A;  1W7P A;  2E5N A;  3M8J A;  1QRY A;  2W57 A;  1ZH5 A;  3J80 Z;  2KPM A;  5FO5 A;  2JZY A;  5B1A H;  3M9A A;  1T2K A;  2W48 A;  2YX7 A;  3OSG A;  4L9N A;  3S32 A;  3I71 A;  1QVT A;  4G94 A;  1P4W A;  5CVV A;  1MSE C;  3JRH A;  2O5R A;  2LKX A;  5HLH A;  1X2N A;  4YIR X;  1OCO H;  1TWH J;  3BR1 A;  3RCO A;  5DD4 A;  3LAJ A;  2LNB A;  1RR8 C;  3CC2 I;  3TDU C;  4YII A;  1W36 D;  2D1H A;  2E1N A;  1WJD A;  1YIT I;  4U87 A;  3OYD A;  3DU6 A;  4G7H F;  1IZ1 A;  2LG4 A;  1AU7 A;  2ZB9 A;  2VXD A;  4XLA A;  4LB5 A;  1WJF A;  2VKV A;  3PSI A;  4IQJ A;  2HZT A;  2QKL B;  3GTM J;  2K3F A;  1H9G A;  2E1C A;  2E19 A;  1YX5 A;  1HCR A;  2OJE D;  2ME0 A;  3B6C A;  4FE4 A;  1KGS A;  4LG0 A;  1DGW Y;  4CDG A;  5FLV A;  1D3Y A;  1ODD A;  1IN4 A;  2ETH A;  2QKM B;  3FXQ A;  1HKS A;  5JVT A;  3GBG A;  2JA8 J;  1JT6 A;  3WGG A;  1FYK A;  2DW4 A;  3GFJ A;  3BR2 A;  1D8J A;  3SQN A;  4ZJZ A;  3AG3 H;  1XN7 A;  2CYY A;  3IP4 B;  3M8E A;  3ERE D;  4UVC A;  3OS2 A;  2DQL A;  1U5T C;  3MZH A;  5IP6 A;  4EQQ A;  1JKQ C;  2L3D A;  2CWE A;  5C4J J;  2BXZ A;  4PGH A;  1H9T A;  1GV5 A;  1TWC J;  4XMY A;  4RM3 A;  5JI6 A;  1FOY A;  1LVA A;  1T38 A;  5CQE A;  1S72 I;  3K4K A;  2H6C A;  5L3C A;  2UUZ A;  2DLL A;  3HPG A;  3I0T A;  4NC8 A;  5CVU A;  1R22 A;  3PL8 A;  2DMU A;  2DYR H;  2ELH A;  5EEA A;  4LIU A;  4QIW N;  3K2Z A;  1D5V A;  1SVO A;  1YQA A;  2ELK A;  4XRS G;  1F43 A;  1V5E A;  4XQF A;  5JHU A;  1ZR4 A;  1I6H J;  1AA7 A;  2EFQ A;  2G9W A;  4Y33 A;  2UV1 A;  2DK5 A;  2NS0 A;  4XOT A;  3RQI A;  2XRO A;  2VC1 A;  4IRG A;  2RRE A;  1G6N A;  2DMQ A;  3DBL B;  3DKW A;  1LE8 A;  1V55 H;  4LMY A;  1K6O A;  2RAE A;  3O6B B;  3RYP A;  1WI3 A;  1TW3 A;  4BS9 A;  2GWR A;  2EH3 A;  2D5V A;  5E17 F;  1TBX A;  4Y3O A;  2Q2E A;  2L9S A;  3CLQ A;  1VTN C;  1RKW A;  3OYG A;  4RA2 A;  2VE9 A;  3LSH A;  3JCU C;  4LIT A;  1QHH D;  2V1U A;  2XPW A;  2BBY A;  2H8W A;  3BJ6 A;  2VKE A;  3GO5 A;  4A3E J;  3HSR A;  1PJR A;  2GLO A;  1T08 B;  2L9R A;  3ULQ B;  1FBQ A;  3HOV J;  1R7J A;  3VDX A;  2BEO A;  3CZ6 A;  1XCB A;  4DOZ A;  4W97 A;  2HPI A;  2X85 A;  3OSF A;  4L5J A;  4XOP A;  3LA7 A;  1Y39 A;  3GVA A;  2JTV A;  4G8X A;  1SAU A;  2PMZ A;  2QSF X;  3GTL J;  4RB3 C;  2KMU A;  2L7F P;  3GTJ J;  1HOM A;  2I8D A;  4G9Y A;  2IXS A;  1KYW A;  2L9V A;  1DP3 A;  4O5V A;  1Z0X A;  4YG2 F;  3AFH A;  2DA6 A;  5K7Z A;  3HOU J;  4YFX F;  2Y30 A;  5ILS A;  4PJN A;  2JA7 J;  5D8K B;  1HST A;  3QRF F;  4JP0 A;  3BTL A;  3RTR A;  4GCV A;  3I64 A;  4MFE A;  3QPH A;  1G3S A;  2HDD A;  3S1N J;  3M1C A;  3QYF A;  2LTP A;  1OCP A;  4V2F A;  2DBB A;  3ABK H;  5IYD J;  1QU3 A;  3DEE A;  1JTX A;  3BCA A;  3PUB A;  2DO7 A;  3W6J B;  4GGG A;  3TMO A;  2NNN A;  5J3L A;  1WJB A;  2A6E F;  2TRT A;  2HEO A;  2HQA A;  4DBQ A;  5F0H A;  4ZC3 A;  2DA7 A;  4LJZ F;  2LBF A;  5LGU A;  1W1W E;  4HA8 A;  1RUO A;  3D5L A;  2LKP A;  2CSO A;  3R0A A;  5GAG J;  5GTH C;  2CFO A;  1HW1 A;  1Z9C A;  1GDT A;  1JGG A;  3BDD A;  2BGC A;  5GTI C;  2MG4 A;  4A6E A;  3FWE A;  4BHP A;  3ZGK A;  5FRO A;  2QSG X;  3M1E A;  2F5C A;  2I5U A;  4HNV A;  2XIG A;  3G1O A;  1D1A A;  2K9Q A;  5J1R A;  4YFK F;  5LEK A;  2CU7 A;  3PQK A;  4DW6 A;  2V1X A;  4CSW A;  1Q1V A;  4BXF A;  4FX0 A;  1B8I B;  2FE3 A;  2KZV A;  2LH9 A;  3CO7 C;  1POG A;  2ACJ A;  3VEP A;  2V79 A;  2ZC2 A;  2QEX I;  3ZXS A;  2Y9Z A;  1X1D A;  5FFZ A;  4MHG A;  3E6C C;  3H92 A;  4BXU A;  3K1N A;  1BOA A;  4BJT A;  4XRM A;  1DGR M;  3REO A;  5FB2 A;  2Z9O A;  1MMS A;  2HOT A;  3CDL A;  2VIX A;  4ENJ A;  2E2J J;  3SXY A;  3TP3 A;  5HDG A;  1RI7 A;  5HDN A;  2ZME B;  4I98 B;  4XRS A;  4N9H A;  4M74 A;  1IV6 A;  4ENM A;  4M9S A;  3NQO A;  1O57 A;  5EZH A;  1U5T A;  4CH7 A;  1MMG A;  5LLQ A;  2ECB A;  2LMD A;  3BTJ A;  3TDZ C;  2DOD A;  1XGM A;  1IW7 F;  1YW8 A;  4MNU A;  5F04 A;  4RAF A;  2ZXW H;  2FF4 A;  4OIN F;  1OCT C;  1VQ7 I;  1FTT A;  3PNV A;  5K5O A;  1K4T A;  3DLL F;  1BC7 C;  2NVU B;  4BE1 A;  3ML6 A;  1K6Y A;  4ASN A;  2L7Z A;  1FX7 A;  1FLI A;  3BG6 A;  1G3W A;  3OIQ A;  5AIP A;  3ZN0 A;  5HLT A;  3Q9V A;  2V4J C;  4YEL A;  5L3D A;  5GAD J;  2PEX A;  3F6V A;  2NRA C;  1VQ6 I;  1BBY A;  4AM3 A;  2YR2 A;  3SDG A;  1TP4 A;  3JRD A;  2V9K A;  2XAF A;  2NNY A;  2DDA A;  2VAS A;  1UJ8 A;  2M0M A;  2BVL A;  2EWN A;  1KQ9 A;  4C30 A;  2GQQ A;  4PDK A;  3NAU A;  3K4M A;  2FMY A;  4IVN A;  1JHF A;  1W7P D;  3NWT A;  3T1B A;  4WX9 A;  3HOY J;  1ZTR A;  2XAG A;  4Y52 J;  1FYM A;  4WWC A;  2YPR A;  2STT A;  4BJ5 C;  1S6L A;  3CCQ I;  4CXF A;  2BOL A;  2XF7 A;  3S3M A;  1MNM C;  4MTE A;  4U7D A;  2HFH A;  2EBI A;  1V3F A;  2QBY B;  2FBI A;  3FK7 A;  4PGG A;  3BZK A;  2Q8K A;  5HOD A;  2A61 A;  1R5I D;  3W6V A;  3Q9S A;  3S1Q J;  5F1R A;  2IBD A;  4WCG A;  1K78 A;  5E1X A;  5ERI A;  3BC8 A;  3KPH A;  4BGD A;  4U7B A;  3ROU A;  2X6Y A;  3CCL I;  3GEZ A;  2OC6 A;  3I59 B;  3TQN A;  2HKX A;  3FBI B;  2VJ4 A;  3MN2 A;  4C2T A;  3G1L A;  1D8K A;  4Y15 A;  1K7A A;  4D9J A;  4BQQ A;  5K5Q A;  1A6I A;  5FLM J;  1HC8 A;  3IHU A;  1IG7 A;  1UAA A;  4RGU A;  1SAN A;  4E7I A;  5CJ9 A;  4PUS A;  1VQO I;  2DA2 A;  4DYQ A;  1XSD A;  2UXX A;  1VQM I;  1X1P A;  3O8G A;  3H9Q A;  3E6M A;  1RKT A;  2QQ8 A;  3Q0U A;  1XGN A;  1X4P A;  2X48 A;  1CQT A;  1TNS A;  2LRE A;  5LD2 C;  1BW6 A;  4M3F A;  4A2U A;  1FOW A;  5ICC A;  3DPL C;  2XB0 X;  4HF2 A;  4LFU A;  2ZFU A;  3CC4 I;  4JQF A;  5EEG A;  2L01 A;  4E70 A;  5M3M J;  1ZG5 A;  4IRH A;  4XL9 A;  4MIM A;  1NK3 P;  2MBF A;  2O0Y A;  2QQ9 A;  2XPV A;  1IXR C;  4KIG A;  2Z1D A;  3D5S C;  1P9Q C;  2MAB A;  4ZYD A;  4G6D A;  5E3N A;  2VOO A;  3O2P E;  3A1Y A;  2FXA A;  3RI4 A;  2PFB A;  3BJO A;  2STW A;  3MKL A;  2A05 A;  3PUF A;  1HW5 A;  2HNH A;  4XLE A;  3VPR A;  1ON2 A;  2BY3 A;  2PMH A;  3ZMV A;  4HDU A;  2H27 A;  4NQW B;  2OZ6 A;  2XV4 S;  4UV8 A;  1XSV A;  3FXO A;  3TOB A;  4GRI A;  5LGT A;  3MKZ A;  1VQ5 I;  3WOD F;  3FXR A;  3K4C A;  1XS9 A;  2CFX A;  2B7E A;  1I39 A;  2L5Q A;  3H9G A;  4H4K C;  1FOX A;  1WQ2 A;  2ZNZ A;  3OYL A;  4RAY A;  2MLG A;  3MVP A;  1HBX G;  4ENK A;  4K2E A;  3U1D A;  1W5T A;  2HGC A;  4KFC A;  3F6O A;  1X4O A;  4BQO A;  1W5S A;  2JA6 J;  1OCC H;  2RQQ A;  3CJR B;  3OYC A;  2O9L A;  2DOF A;  2K27 A;  4B43 A;  3DKX A;  3A01 B;  2JVG A;  1FJL A;  3MKY B;  4G6Q A;  5EGO B;  3QOP A;  4ZTF A;  3BTI A;  1WH5 A;  4A3J J;  2RC4 A;  4LK0 F;  1WH7 A;  5DCM B;  2R7W A;  3U21 A;  2PJR B;  2EIL H;  1XMA A;  4XID A;  1FMW A;  4R1H A;  4KA4 A;  4BDZ A;  4DNC A;  1LFB A;  1Z77 A;  2A6H F;  1HLV A;  3VFZ A;  1LDJ A;  3DLA A;  1W5C C;  1H89 C;  1SFU A;  2LF7 A;  1W4M A;  1V54 H;  2JVH A;  2CRG A;  4UB6 C;  3RSN A;  1BC8 C;  1LFP A;  2WAF A;  5J1Y A;  2KRH A;  1J9I A;  2BZT A;  2KIM A;  2QYO A;  2FUG 2;  2WY7 Q;  1AWC A;  1SMT A;  3BR0 A;  5A2Q Z;  2ZJQ F;  2HTS A;  2E1M B;  4L9V A;  2EA2 A;  5L3F A;  4RGX A;  1O3T A;  3JRI A;  4PJL A;  2X1D A;  3SZP A;  4G6T B;  1GUU A;  4EM1 A;  3U1K A;  1LEB A;  3E6D A;  2IW5 A;  3GX4 X;  1B9M A;  2OPT A;  4BAY A;  2VLA A;  4HQM A;  2VXZ A;  2ID6 A;  4S0H B;  2HOS A;  3LSR A;  5M3F J;  2GIZ A;  2KKO A;  4LGW A;  4XOR A;  1LB2 A;  1NTC A;  4DZP A;  1Y8R B;  2VQG A;  1SFO J;  4X1E A;  2XVC A;  4HX8 A;  4O6J A;  4ESB A;  3WTZ A;  3HHG A;  2PX9 A;  4EV0 A;  3L09 A;  1IDY A;  2DA4 A;  3HOT A;  4WXC A;  5BMZ A;  3CJT B;  1PUF B;  2XB5 A;  4BJ6 C;  3DTE A;  5B1B H;  2KLO A;  4A3M J;  2RKH A;  4BUP A;  3IH4 A;  2DDB A;  1KON A;  2BW3 A;  3KYD B;  2VJJ A;  3DFG A;  2M45 A;  5ED4 A;  4NUB A;  1PYV A;  2QZ8 A;  1Z6T A;  4ZYG A;  3G6E I;  4GDF A;  3HHH A;  4FET A;  4MEX F;  3TGN A;  3T8R A;  5DUI A;  1RUN A;  2IS6 A;  1XDS A;  2H94 A;  3TO6 A;  4IHS A;  1OIS A;  1U8B A;  4CCJ A;  1E17 A;  4C9Y A;  3HC7 A;  1HSJ A;  4ZZD A;  4EAT A;  3WTS C;  4E7Z A;  5J4Y A;  2NS7 A;  4V19 K;  2A3S A;  3LQR A;  5HLG A;  4PFO A;  3KZI C;  2V6C A;  1DDN A;  1T98 A;  4Q48 A;  1Y0U A;  2VL8 A;  3FMS A;  4C2M J;  4EM0 B;  1ZG1 A;  4G7Z F;  1Y56 A;  1TWF J;  5H6Q A;  4B48 A;  3H5A A;  3V4G A;  1RRJ A;  1FEX A;  4HV5 A;  1O7F A;  1P7J A;  2KP6 A;  4EJU A;  2D45 A;  3P9C A;  4L0Y B;  1IAW A;  4P1W A;  3ESW B;  2MGQ A;  1ZYR F;  3AAF A;  3IKV A;  1DQU A;  4DJA A;  1LDK B;  3OYI A;  4HG2 A;  5EYR A;  3PO2 J;  1ETW A;  5B66 C;  4HW0 A;  2YU9 J;  2IP2 A;  4G7O F;  4B8X A;  3GZN B;  1L3L A;  1UST A;  3CUQ C;  3HXL A;  1TLH B;  3GXO A;  3CP8 A;  1LFU P;  2DT7 B;  1JXS A;  4UHT A;  3LST A;  3I53 A;  3OYM A;  3I55 I;  2O8X A;  1ZLJ A;  1QBJ A;  2XPU A;  5JLX A;  3L7W A;  4HRI A;  1VQ8 I;  3CDI A;  1KA8 A;  2HDW A;  2DA5 A;  3SHF A;  4RMN A;  1C0W A;  2R7R A;  4L5I A;  4A0Z A;  1VQ4 I;  1ACI A;  1QVU A;  1HDD C;  2QQA A;  1JJ8 C;  1DU6 A;  4JX4 A;  3HJE A;  3QWL A;  3I4M J;  5HLI A;  2PBI A;  2A5W A;  4HOB A;  2Y0M A;  2FX0 A;  1A31 A;  4E7K A;  3BG7 A;  2IAI A;  4CCK A;  1VFC A;  4DIQ A;  2OD5 A;  1K4S A;  1FTZ A;  1BOB A;  1N25 A;  1TW2 A;  2BHZ A;  2CS3 A;  2DFI A;  2LC2 A;  3PFI A;  3F22 A;  1I50 J;  2ZJP F;  1DU0 A;  2IA1 A;  2KFD A;  2CV1 A;  2M87 A;  3RYR A;  2R7S A;  3SYT A;  2GAU A;  5E79 C;  4M6Y A;  4OIQ F;  3GTQ J;  3D0S A;  1TC3 C;  1G8X A;  2JRM A;  4DZJ A;  4UUS A;  3HUG A;  1WSU A;  2EFO A;  3BOQ A;  3FXJ A;  2LOO A;  3I3L A;  4XLN F;  4EJW A;  2HR3 A;  3LSP A;  4ZYA A;  5DTD A;  4I02 A;  3S8P A;  3ZP5 A;  1BIA A;  2IGO A;  4BBS J;  2R7X A;  1A36 A;  1E2X A;  3QPS A;  3VYS B;  3BPV A;  4KIC A;  3H36 A;  3FM5 A;  4RGS A;  3CQZ J;  4L5E A;  2WC2 A;  3DEU A;  4U0W A;  4BQA A;  4ZDO A;  2GZW A;  2K85 A;  2ZXH A;  1HXD A;  3FXK A;  3F8F A;  5LHI A;  5DDG A;  5GPC A;  2P0W A;  4BH9 A;  3SZG A;  2EPF A;  1P4A A;  4JK1 X;  5CVJ A;  4AWX B;  2ICW G;  1S7E A;  1ZLK A;  3BP8 A;  4KNY A;  3K4L A;  2JSP A;  2R4G A;  3BZC A;  4QTR A;  1DPR A;  3DQV C;  1S7O A;  3WTX C;  2GOM A;  1RET A;  1G59 A;  2H09 A;  2LFB A;  1I6X A;  1U6G A;  1XMK A;  4UXN A;  1VQN I;  2E2H J;  2K3P A;  4CYC B;  4ON0 A;  2Y31 A;  2GOX B;  2P7V B;  1NK2 P;  1VF9 A;  1UFM A;  1VQP I;  2TDX A;  4BE0 A;  2LD5 A;  5FJ8 J;  3LMM A;  4CYD A;  2DFE A;  1JKP C;  4KN4 X;  3CCY A;  5EG0 A;  4IOA F;  2D2W A;  3RKW A;  1PVE A;  1MBK A;  2W84 A;  3CMM A;  5FKL A;  3CP2 A;  5H20 A;  4L9T A;  4A3L J;  4M73 A;  1O7L A;  1U8R A;  2CJJ A;  1Z7L A;  1FWZ A;  2M4G A;  2MH9 A;  3K4N A;  4II2 A;  2K40 A;  3G1M A;  1S9H A;  1ULY A;  3L00 A;  3LA2 A;  1T56 A;  2ADU A;  1TWG J;  2XAQ A;  4JYK A;  2K7L A;  1TTY A;  2CQK A;  1WPK A;  5HNH A;  4HX7 A;  2L2O A;  4XSX F;  1QHG A;  1Z21 A;  2COM A;  5FKM A;  3TL4 X;  3RDI A;  3ZCO A;  2CO5 A;  2R7O A;  4UVB A;  2B63 J;  2P5K A;  3ECO A;  5FGM A;  3GTP J;  1ZG3 A;  2M1B A;  1IUY A;  3ELK A;  2KIF A;  3C3W A;  2D1V A;  4A3F J;  2VPR A;  2F4I A;  1MBH A;  1L0O C;  5EJC A;  2CGP A;  4KIB A;  2WBM A;  2X9D A;  5FRM A;  1EA3 A;  4AU7 A;  4XN3 A;  2ZSI B;  1BA5 A;  3FK6 A;  1SFX A;  5CPR B;  1IO2 A;  2V7F A;  2VKH A;  1LVK A;  4RGR A;  1SD6 A;  4LLN A;  3MFK A;  2IGM A;  3MZ8 A;  4M3B A;  5DV5 A;  3GWZ A;  4B4C A;  2VBY A;  4M71 A;  1OJL A;  2OQG A;  2ZME C;  5FKN A;  1Y6I A;  4XKV A;  5HS8 A;  4E4H A;  1FMV A;  1IXS B;  3CUO A;  4AIK A;  4IHW A;  3B73 A;  3CUQ A;  4OWR B;  3JTH A;  5ICG A;  5JR3 A;  3BJA A;  2R7U A;  2F4O B;  1YHQ I;  3BR6 A;  1O4X A;  3S93 A;  1ERD A;  1Z7U A;  1B4A A;  2NVQ J;  1GLN A;  1WRJ A;  4C3J J;  1MW7 A;  4PJ0 C;  4BDY A;  3F72 A;  3GW2 A;  3IWZ A;  4ETS A;  1RZ4 A;  1BI1 A;  2OZU A;  2Z99 A;  4S04 A;  3DF8 A;  3RPU D;  5IP9 J;  2ZXI A;  3GLL A;  1Z3X A;  2OQR A;  4JOM A;  4P9F A;  1IF1 A;  1KZH A;  2CQX A;  1BR1 A;  5EDN A;  4RB1 A;  3UR3 C;  1UEL B;  3DTK A;  4ZYH A;  4LLG F;  5C44 J;  2BHY A;  3C18 A;  1QZY A;  1R1T A;  2NVT J;  3K2A A;  4FAS D;  1ETX A;  1TQI A;  3KYC B;  3RJP A;  2XGX A;  2ESH A;  4BXX J;  2C6Y A;  1MMN A;  1NHA A;  3MMY B;  3HGG A;  3QYB A;  2HXI A;  3HSF A;  4D5C A;  3JSP A;  3TED A;  4KMU X;  2B0L A;  5K7F A;  3GTK J;  1FBS A;  1D0X A;  2XF5 A;  3GTO J;  4ESF A;  1UCR A;  2X51 A;  3QOE A;  4MTD A;  3P9K A;  4P5O A;  3OS1 A;  1LJ9 A;  1BJA A;  2CW8 A;  1ON1 A;  2O03 A;  4ZYE A;  3K9T A;  4OIP F;  2L7K A;  2LY2 A;  2OU2 A;  1IN5 A;  4IX7 A;  1Y8Q B;  5E3M A;  4FTH A;  1HF0 A;  3VOE A;  5KVR A;  3K4B A;  3SEZ A;  2MD5 A;  3TP0 A;  2DMN A;  2KJC A;  3KX2 A;  2HKO A;  1T39 A;  5HS9 A;  1MBG A;  3FKJ A;  1R36 A;  2XGE A;  2AQF A;  3FMQ A;  3MWM A;  1CF7 B;  2BY0 A;  1SD4 A;  2VBZ A;  4IO9 F;  2FJ1 A;  3WTW C;  3LNQ A;  3WGH A;  3JW4 A;  4MLO A;  2NOJ B;  3ABU A;  1MSF C;  3COA C;  1A35 A;  2VUM J;  1X3W B;  4CHU A;  1HKQ A;  2YSR A;  1OYI A;  2M34 A;  3WTY C;  2EZI A;  5LEJ A;  2JRT A;  2ZBK A;  2XKP A;  4KYW A;  3FXM A;  1B72 B;  3VSL A;  2DA1 A;  4A3B J;  3AL0 C;  1YOV B;  5J47 A;  3ZOB A;  1IN7 A;  1MJA A;  1RIO H;  4CZZ A;  3D5R C;  1F9N A;  4A6D A;  2VT2 A;  2L54 A;  3KEQ A;  4BAC A;  1WJE A;  3FMR A;  2RDP A;  4B09 A;  3H1C A;  2LLK A;  4S05 A;  2CUF A;  3BG5 A;  4RB2 C;  3RKQ A;  3HRT A;  1B6A A;  2KZG A;  3Q0V A;  1I1G A;  3HOS A;  2R3S A;  3JRB A;  2MLK A;  1B8I A;  4NHJ A;  4XSZ F;  2M0C A;  1Y1W J;  4QSH A;  2MD0 A;  5E20 A;  1ETV A;  1VZ0 A;  1RC9 A;  3W2V A;  5D5W B;  3RKX A;  1J2X A;  2DJI A;  1NG6 A;  3RPQ A;  3HRU A;  1B9N A;  4A3K J;  2E2I J;  2X6O A;  3ZQH A;  1W0U A;  1MJB A;  1X1B A;  2HVQ A;  1U0J A;  2IEK A;  3GZ6 A;  2EK5 A;  4XLH A;  1R4M B;  3WG9 A;  1LUJ B;  2QWW A;  2ZME A;  3V7R A;  5IYC J;  3FX3 A;  2JT1 A;  3O3K A;  3CMA I;  2LY9 A;  4XRF A;  3QOD A;  1I5Z A;  5DCF A;  5E1Z B;  2DT6 A;  3QAH A;  3CLO A;  2YS9 A;  2QSH X;  3BT9 A;  4M6V A;  1E3H A;  2Y75 A;  4U0Y A;  3V7S A;  3J81 K;  4RB0 A;  2L9N A;  2DFF A;  1Z91 A;  2ME6 A;  4YEJ A;  1A04 A;  2FNP A;  3JRA A;  3N4M A;  4XLF A;  2A07 F;  2IS4 A;  3PO3 J;  1MGT A;  3NAR A;  1MDM B;  1I3A A;  2LY1 A;  1FZP B;  4RLF A;  4Y7N J;  4TV7 A;  4M9X A;  3MQ0 A;  3QYE A;  4A93 J;  3QP5 A;  4B3A A;  2CQQ A;  2WV0 A;  4UVA A;  1WFX A;  5IYB J;  3R0J A;  1HKT A;  1AKH B;  4I09 A;  5D8L B;  3E5Q A;  3HEF A;  5B5E C;  2KT0 A;  4HYE A;  4MGR A;  5A2Q K;  4E7L A;  2IT0 A;  2FOK A;  3EDP A;  4GFB A;  5KHD A;  3ASN H;  2CMP A;  2M3A A;  2QF7 A;  3H0G J;  3L2C A;  4Q47 A;  2M4K A;  3BCB A;  2HOE A;  1YRN B;  3S3N A;  4BHB A;  3U2R A;  2E1M C;  3F8B A;  3KE2 A;  3CCV I;  2I10 A;  4U88 A;  4CCO A;  3L2W A;  2P5L C;  1S3J A;  2O6G E;  4N4N B;  4IOC F;  4L9J A;  4W1U A;  5GPA A;  3R6S A;  3OY9 A;  2EZK A;  2ZO4 A;  3I58 A;  3PIO F;  3Q3S A;  2HVS A;  1MNE A;  4PSW A;  2QBY A;  3ZRG A;  2RNG A;  4RAZ A;  1SFK A;  4XKC A;  3JRE A;  2IS1 A;  2F5E A;  5FD5 A;  4UB8 C;  3IC7 A;  2HWV A;  1V5G A;  2JK3 A;  3V8L A;  4R8H A;  2AHQ A;  3R61 A;  1ONV A;  2KJB A;  3I59 A;  3QQA A;  3VSK A;  4A0Y A;  3HOW J;  3ASO H;  1ZRF A;  3ZQ7 A;  3CCE I;  2EFW A;  2Z5U A;  4HBL A;  2W4S A;  1KU2 A;  2CW0 F;  5L3G A;  1IC8 A;  1K83 J;  4IQ4 A;  5E3L A;  2EFN A;  3CCR I;  3CCJ I;  1O3Q A;  2V1N A;  1YS7 A;  2DPU A;  3ABM H;  3MD2 A;  3J7Y J;  3OYN A;  2NOG A;  2BXY A;  3WU1 B;  4C3I J;  3EPZ A;  3C2H A;  3KP5 A;  4F52 A;  4PJM A;  3VYU B;  2IA2 A;  2JA5 J;  2M2E A;  4YFN F;  1F1Z A;  1YJ9 I;  1YO5 C;  5IPA A;  2QCO A;  2K4J A;  3I5U A;  4UUT A;  4NDL A;  2R92 J;  1UZC A;  4Y4R A;  3GTG J;  2YU3 A;  3IRR A;  1IUF A;  2N8G A;  2E1O A;  2VE8 A;  3CJQ B;  5CQG A;  1V5F A;  1B1B A;  3DEW A;  1SEU A;  2LDU A;  4WXD A;  1JJ6 C;  1FSH A;  2K9M A;  4IPA A;  2RGV A;  3EQL F;  4PCQ A;  5TJJ A;  1D1C A;  2MFZ A;  3BZ6 A;  2IGK A;  1ZGJ A;  1WI9 A;  3EUK L;  2P6S A;  3L2U A;  3CES A;  5H2F C;  1LEA A;  1NH3 A;  4EGZ A;  2V9V A;  3PJR A;  3H9J A;  5TRD A;  4ZTJ A;  2MSY A;  4ZZL A;  2GA2 A;  4Y17 A;  3RIR A;  3HKZ N;  3ZMD A;  2GBY A;  2E7W A;  1MD0 A;  3TW6 A;  1IRX A;  2GM4 A;  1RNL A;  3LWF A;  4NQW A;  5K5R A;  2O61 A;  4A5M A;  3J81 Z;  1LDD A;  1QGP A;  1ZHF A;  1GVD A;  4Z2Y A;  4I0B A;  3OIP A;  2WB1 A;  3TOA A;  4I6Z A;  1IRG A;  3H3Z A;  3K0L A; 
#chains in the Genus database with same CATH homology
 3U9G A;  1XCV A;  4N9I A;  1FOK A;  1S29 A;  3T0Y A;  5BPI A;  2FEZ A;  4I01 A;  4KN7 X;  5CYV A;  5LHH A;  2MC3 A;  4RS8 A;  4LB6 B;  3Q5F A;  3ZMU A;  1BN5 A;  3EYY A;  3EET A;  5DCM A;  3OV8 A;  3WGI A;  5ILV A;  2HYF A;  1TQP A;  2FBK A;  1OMI A;  5HDK A;  4GXO A;  2M5W A;  1OKR A;  3KLO A;  1IN6 A;  4HQE A;  1ZAO A;  4IJA A;  1KU9 A;  5D5V B;  3LFK A;  2DQR A;  5FLX Z;  2BV6 A;  3E5X A;  4WF2 A;  2OAZ A;  4QLC U;  4U0V A;  4HZF A;  1KQ8 A;  2QQB A;  4UNO A;  1QO0 D;  2UZK A;  2EB7 A;  2JPB A;  1J5Y A;  5K1Y A;  2FSW A;  4XLP F;  1XGO A;  4MQV A;  1YLF A;  3ZMT A;  3DP7 A;  2ZKZ A;  1G4D A;  2J5O A;  1J59 A;  2W24 A;  4IRI A;  3R4K A;  1IRF A;  3JTG A;  2UWM A;  2VBW A;  3F21 A;  2FA5 A;  2JSC A;  1Z1D A;  1SD7 A;  5HOO A;  5E18 F;  1REP C;  2XAS A;  2QVO A;  3HRM A;  1SD5 A;  1S8N A;  4HLX A;  2PLY A;  4ESJ A;  3GYH X;  1BI3 A;  3F3X A;  2DI3 A;  4IXA A;  3C1D A;  3WE2 A;  3WU0 A;  2FNA A;  1W7P B;  5E8G A;  5LBQ A;  4AIJ A;  3CJN A;  1GXP A;  1Z6R A;  1JGS A;  2ZXJ A;  1KU3 A;  2ZCW A;  2Q0O A;  3MEX A;  3N97 A;  2LF8 A;  2F5D A;  3PQJ A;  3TKY A;  5KK1 A;  1IXC A;  2R7F A;  3RKY A;  4FHT A;  5J6X A;  1BIB A;  2EA4 A;  4QWQ A;  2XHK A;  4OMY A;  2H6B A;  1UHW A;  1FC3 A;  4KDP A;  3T5X A;  3ZMZ A;  3MCZ A;  2GA1 A;  5F64 A;  4LG0 B;  1I27 A;  1YFH A;  2V1D A;  2BE5 F;  5DEQ A;  2XAJ A;  5BPD A;  4UUV A;  3HTU A;  4AVP A;  1FY7 A;  2NAZ A;  2MA3 A;  1R23 A;  2GIV A;  5LRS A;  5FD6 A;  3GF2 A;  5L3E A;  1B59 A;  3FF5 A;  2F5F A;  1X3U A;  2F2E A;  3IWF A;  2XAH A;  4GO1 A;  2W85 A;  3IKT A;  1YS6 A;  4HF0 A;  2P6T A;  3BPX A;  1ZN2 A;  3DPT A;  5CVI A;  3ZN1 A;  4EJT A;  3KEO A;  1PUE E;  1R1U A;  5LRR A;  3VOD A;  3KLN A;  4OOI A;  1LQ1 A;  2VOP A;  3GUD A;  2QLZ A;  4GYG A;  3CUQ B;  1I1S A;  4DQ2 A;  1FYL A;  3GLX A;  3K1M A;  3DXJ F;  2M30 A;  4Y13 A;  2G7H A;  2EFP A;  2KIU A;  3M7G A;  1FP2 A;  2M8E A;  4N0B A;  5D4S A;  3QPT A;  2E7X A;  5LHG A;  1ZRD A;  4CIC A;  2A69 F;  1OYW A;  3T8T A;  3NEU A;  1T6S A;  2Y48 A;  4FT8 A;  2VBX A;  2L02 A;  1T0F A;  4A0X A;  5DYM A;  2DPD A;  1XB4 A;  4Q4Z F;  3G3Z A;  1XD7 A;  4EGY A;  4I2O A;  3K69 A;  3HTS B;  2WTE A;  3TO9 A;  2EV6 A;  2P7C B;  5IT9 K;  3KET A;  3WTT C;  1KU7 A;  1XGS A;  4KIF A;  2PQ8 A;  1OYY A;  3IL2 A;  5ILU A;  5DD8 A;  2KRF A;  4HV6 A;  1KQ0 A;  3GZ5 A;  5ICF A;  2P5V A;  3MZY A;  5E1W A;  2IPQ X;  1OPC A;  5EEH A;  2NYX A;  1BI0 A;  1U5T B;  1G3T A;  3QP6 A;  3FM3 A;  2K02 A;  1WKM A;  4KT5 C;  2BYV E;  1HQC A;  4M9Z A;  2A5Y B;  4D0P A;  4WK8 F;  3FZV A;  2DK8 A;  3WTU C;  5J8C A;  3CO6 C;  1O3S A;  1R5H A;  2Z33 A;  1XDU A;  5HVQ C;  2J5P A;  4EJO A;  4KMF A;  1CF7 A;  1FT9 A;  3OOP A;  1YIO A;  2FML A;  4P96 A;  3F8N A;  5HS7 A;  2P8T A;  3P7N A;  2ISZ A;  4H0E A;  2PI0 A;  5AIQ A;  4CGZ A;  1QQI A;  6PAX A;  3GFL A;  4OIR F;  2DT5 A;  3BRO A;  3LA3 A;  1GXQ A;  1U3E M;  1PDN C;  1EH6 A;  4EJV A;  3E3V A;  5AON A;  5CVR A;  3KP3 A;  1K78 B;  1SFE A;  1PP8 F;  4F7Z A;  3BY6 A;  2RVC A;  1U2W A;  3QU3 A;  4A12 A;  2EV0 A;  1LNW A;  1ZAR A;  3LQQ A;  2FBH A;  1JE8 A;  4JBA A;  4HX4 A;  2VON A;  3R60 A;  4YIF A;  5IT9 Z;  5JFR A;  4FX4 A;  1STZ A;  2DU9 A;  1SMY F;  2GXG A;  2O3F A;  4A5N A;  1F5T A;  1QNT A;  1UB9 A;  4EMS A;  2CG4 A;  2QM3 A;  2RN7 A;  1GVJ A;  3E5U A;  2RQP A;  2VN2 A;  1QZZ A;  2DAO A;  2HQN A;  2OBP A;  2FU4 A;  5D5U B;  1O3R A;  2K4B A;  2G7U A;  2VC0 A;  4KUM A;  1MDM A;  3JAM K;  4MEY F;  2JPC A;  4HDV A;  2R7D A;  4ZH4 F;  2ZJ2 A;  4P55 A;  3KCC A;  3HIF A;  4M72 A;  1YW7 A;  5LGN A;  5BOX A;  1MJ9 A;  4BYY A;  1G3Y A;  3NRV A;  4XBF A;  2UXN A;  1Z05 A;  5FLX K;  1K79 A;  1J75 A;  1FBU A;  3TO7 A;  4O3M A;  1J7K A;  4R79 A;  3SZT A;  3J7A O;  4LLL A;  1ZGA A;  2HTJ A;  1Q1H A;  5F6F A;  4Q5S F;  4M6X A;  4CO8 A;  3ZPL A;  4UV9 A;  4P9U A;  1EH7 A;  1YW9 A;  1MZB A;  3M8F A;  5D6E A;  3KZY A;  1DPU A;  2FRH A;  2HQR A;  1MKM A;  3CTA A;  1AOY A;  5L3B A;  3HYI A;  1WWX A;  3F8C A;  1BM9 A;  4LK1 F;  1BI2 A;  3S2W A;  1DP7 P;  3I4P A;  2L4A A;  3F8M A;  3B02 A;  3MAJ A;  3C7J A;  3ZMS A;  2XKO A;  1FPQ A;  2A68 F;  4BNC A;  4L0Z B;  4AD9 A;  4EVI A;  5FFX A;  3IRQ A;  3ABT A;  2X0L A;  3KP2 A;  1JHH A;  2ESN A;  2X4H A;  4BHC A;  3P9I A;  5D4R A;  5ICE A;  4PZJ A;  1QPM A;  3GFI A;  2AXL A;  4I7H A;  1J0R A;  1DUX C;  2WWY A;  1EH8 A;  3LAP A;  4GYI A;  1IN8 A;  1CGP A;  1XSX A;  3KFW X;  2P4W A;  3KP7 A;  2LSO A;  2DTR A;  2ZNY A;  5D6F A;  5D5X B;  2HYG D;  3WTV C;  3SFZ A;  1H0M A;  4WXH A;  3JAM Z;  2PN6 A;  3VB2 A;  2IA0 A;  2K86 A;  2PG4 A;  3RPU A;  4HAM A;  1FSE A;  1EV7 A;  1R1V A;  1YYV A;  2EV5 A;  2HDC A;  4L18 B;  3DV8 A;  2ISY A;  1GHC A;  1FNN A;  3K1P A;  4IF4 A;  2W25 A;  2GXB A;  1P2F A;  3J80 K;  4MQ9 F;  3ISP A;  5J8F A;  2IRF G;  3EUH A;  5DUK A;  3WE3 A;  2RV8 A;  3JSO A;  3BWG A;  4AIH A;  2QUF A;  2PMU A;  4IHT A;  1ZRE A;  4OIO F;  2VOD A;  4HF1 A;  5E8I A;  5H6R A;  5BQT A;  1V4R A;  4ENN A;  4NB5 A;  3KP6 A;  2XUB A;  4I0A A;  4EM2 A;  3CDH A;  2YX4 A;  1R5G A;  1P4X A;  1ZRC A;  2RNJ A;  2PJP A;  3F23 A;  5CLS A;  1OR7 A;  1R58 A;  1UHM A;  5BS6 A;  3HRS A;  4OMZ A;  2L4M A;  1TNT A;  3QU6 A;  3I54 A;  1SAX A;  3FHZ A;  3W6K B;  3ECH A;  3GFM A;  5IT3 A;  3G73 A;  3L9F A;  1R00 A;  2ZFW A;  2XRN A;  1YTY A;  1USS A;  1P92 A;  3V7C A;  4LD5 A;  1PP7 U;  1S7A A;  4OU0 A;  2HS5 A;  1P6R A;  3E6B A;  3E97 A;  2Z3Y A;  1F4K A;  1U78 A;  3KP4 A;  2FQ3 A;  2AS5 F;  3FXU A;  3KZZ A;  2OA4 A;  1HW2 A;  2MH2 A;  3EYI A;  2EJR A;  1FP1 D;  2VT3 A;  3V8J A;  2IJL A;  2QEN A;  4HLY A;  3V8K A;  1YG2 A;  1TQM A;  2IVM A;  3HSE A;  3H3U A;  1KYZ A;  1W7P A;  2W57 A;  1ZH5 A;  3J80 Z;  5FO5 A;  2JZY A;  3M9A A;  1T2K A;  2YX7 A;  4L9N A;  3I71 A;  4G94 A;  1P4W A;  5CVV A;  5HLH A;  3LAJ A;  5DD4 A;  2LNB A;  3TDU C;  4YII A;  2D1H A;  2E1N A;  4G7H F;  1IZ1 A;  4LB5 A;  2HZT A;  1H9G A;  2E1C A;  1KGS A;  4LG0 A;  4CDG A;  1D3Y A;  1ODD A;  1IN4 A;  2ETH A;  3FXQ A;  1HKS A;  5JVT A;  3WGG A;  1FYK A;  2DW4 A;  3GFJ A;  1D8J A;  3SQN A;  1XN7 A;  2CYY A;  3M8E A;  3ERE D;  4UVC A;  2DQL A;  1U5T C;  3MZH A;  4EQQ A;  2L3D A;  2CWE A;  4PGH A;  1H9T A;  5JI6 A;  1LVA A;  1T38 A;  2H6C A;  5L3C A;  2DLL A;  3I0T A;  5CVU A;  1R22 A;  2ELH A;  3K2Z A;  1D5V A;  1YQA A;  5JHU A;  2EFQ A;  2G9W A;  2DK5 A;  2NS0 A;  2XRO A;  2VC1 A;  4IRG A;  1G6N A;  3DKW A;  4LMY A;  1K6O A;  3O6B B;  3RYP A;  1TW3 A;  5E17 F;  2GWR A;  1TBX A;  2Q2E A;  1VTN C;  2VE9 A;  2V1U A;  3BJ6 A;  2BBY A;  3GO5 A;  3HSR A;  3ULQ B;  1FBQ A;  1R7J A;  2BEO A;  1XCB A;  4L5J A;  3LA7 A;  3GVA A;  2JTV A;  4G8X A;  4RB3 C;  4G9Y A;  1KYW A;  4O5V A;  4YG2 F;  4YFX F;  5ILS A;  5D8K B;  1HST A;  3QRF F;  3RTR A;  4GCV A;  3I64 A;  3QPH A;  1G3S A;  2DBB A;  3W6J B;  2DO7 A;  4GGG A;  2NNN A;  2HEO A;  2A6E F;  4LJZ F;  5LGU A;  1RUO A;  4HA8 A;  3D5L A;  2LKP A;  2CSO A;  3R0A A;  1HW1 A;  1Z9C A;  3BDD A;  2BGC A;  4A6E A;  3FWE A;  4BHP A;  3M1E A;  2F5C A;  2XIG A;  4YFK F;  5LEK A;  3PQK A;  2V1X A;  4FX0 A;  2FE3 A;  3CO7 C;  2ACJ A;  3VEP A;  2V79 A;  5FFZ A;  4MHG A;  3E6C C;  3H92 A;  4BXU A;  3K1N A;  1BOA A;  3REO A;  5FB2 A;  2Z9O A;  4ENJ A;  3SXY A;  5HDG A;  1RI7 A;  5HDN A;  2ZME B;  4I98 B;  4N9H A;  4M74 A;  4ENM A;  4M9S A;  3NQO A;  1O57 A;  1U5T A;  5LLQ A;  3TDZ C;  1XGM A;  1IW7 F;  1YW8 A;  4MNU A;  2FF4 A;  4OIN F;  5K5O A;  1BC7 C;  3ML6 A;  4ASN A;  1FX7 A;  1FLI A;  1G3W A;  5AIP A;  3ZN0 A;  3Q9V A;  5L3D A;  2PEX A;  3F6V A;  2NRA C;  1BBY A;  2YR2 A;  2XAF A;  2NNY A;  2EWN A;  1KQ9 A;  2GQQ A;  4PDK A;  4IVN A;  2FMY A;  1JHF A;  1W7P D;  3T1B A;  4WX9 A;  2XAG A;  1FYM A;  4WWC A;  2YPR A;  2STT A;  1S6L A;  4CXF A;  4MTE A;  4U7D A;  2HFH A;  1V3F A;  2QBY B;  2FBI A;  4PGG A;  2Q8K A;  2A61 A;  3Q9S A;  5F1R A;  4WCG A;  1K78 A;  5E1X A;  5ERI A;  4U7B A;  3ROU A;  3GEZ A;  3I59 B;  3TQN A;  2HKX A;  1K7A A;  1D8K A;  4Y15 A;  5K5Q A;  3IHU A;  4RGU A;  5CJ9 A;  1XSD A;  2UXX A;  3E6M A;  1XGN A;  1TNS A;  4A2U A;  5ICC A;  3DPL C;  4HF2 A;  4LFU A;  4JQF A;  5EEG A;  2L01 A;  4E70 A;  1ZG5 A;  4IRH A;  2MBF A;  2O0Y A;  2QQ9 A;  1IXR C;  4KIG A;  4ZYD A;  4G6D A;  2VOO A;  3O2P E;  2FXA A;  3RI4 A;  2PFB A;  3BJO A;  2STW A;  1HW5 A;  3ZMV A;  4HDU A;  1ON2 A;  2PMH A;  2H27 A;  2OZ6 A;  2XV4 S;  4UV8 A;  1XSV A;  3TOB A;  5LGT A;  3WOD F;  3FXR A;  2CFX A;  1WQ2 A;  2ZNZ A;  4RAY A;  2MLG A;  1HBX G;  4ENK A;  4K2E A;  3U1D A;  1W5T A;  2HGC A;  4KFC A;  3F6O A;  1W5S A;  2K27 A;  4G6Q A;  3QOP A;  2RC4 A;  4LK0 F;  5DCM B;  1XMA A;  4R1H A;  4KA4 A;  4DNC A;  2A6H F;  3VFZ A;  1LDJ A;  1SFU A;  2LF7 A;  1W4M A;  1BC8 C;  1J9I A;  2KIM A;  2QYO A;  1AWC A;  1SMT A;  5A2Q Z;  2HTS A;  4L9V A;  2EA2 A;  5L3F A;  4RGX A;  1O3T A;  3SZP A;  4EM1 A;  1LEB A;  3E6D A;  2IW5 A;  3GX4 X;  1B9M A;  4BAY A;  4HQM A;  2VXZ A;  2KKO A;  4LGW A;  1LB2 A;  2XVC A;  4HX8 A;  4O6J A;  4ESB A;  3WTZ A;  3HHG A;  4EV0 A;  3L09 A;  3HOT A;  4WXC A;  5BMZ A;  2RKH A;  3DFG A;  2M45 A;  5ED4 A;  2QZ8 A;  1Z6T A;  4ZYG A;  3HHH A;  4MEX F;  3TGN A;  3T8R A;  5DUI A;  1RUN A;  1XDS A;  2H94 A;  3TO6 A;  4IHS A;  1E17 A;  1HSJ A;  4ZZD A;  3WTS C;  2A3S A;  3LQR A;  5HLG A;  2V6C A;  1DDN A;  1T98 A;  4Q48 A;  1Y0U A;  3FMS A;  4EM0 B;  1ZG1 A;  4G7Z F;  5H6Q A;  3V4G A;  4HV5 A;  1O7F A;  4EJU A;  2D45 A;  3P9C A;  4L0Y B;  1IAW A;  1ZYR F;  3AAF A;  3IKV A;  1LDK B;  4HW0 A;  2IP2 A;  4G7O F;  4B8X A;  1L3L A;  1UST A;  3CUQ C;  1TLH B;  3GXO A;  1JXS A;  4UHT A;  3LST A;  3I53 A;  2O8X A;  1ZLJ A;  1QBJ A;  3L7W A;  1KA8 A;  3SHF A;  1C0W A;  4L5I A;  4A0Z A;  2QQA A;  5HLI A;  2PBI A;  4HOB A;  2Y0M A;  2OD5 A;  2DFI A;  1TW2 A;  3PFI A;  3F22 A;  2IA1 A;  2M87 A;  3RYR A;  2GAU A;  4M6Y A;  4OIQ F;  3D0S A;  3HUG A;  1WSU A;  2EFO A;  3BOQ A;  4XLN F;  4EJW A;  2HR3 A;  4I02 A;  3ZP5 A;  1BIA A;  1E2X A;  3BPV A;  4KIC A;  3FM5 A;  4RGS A;  4BQA A;  2WC2 A;  3DEU A;  4U0W A;  2GZW A;  1HXD A;  3F8F A;  5LHI A;  5DDG A;  4BH9 A;  4JK1 X;  1P4A A;  5CVJ A;  4AWX B;  1ZLK A;  3BP8 A;  4KNY A;  1DPR A;  3DQV C;  1S7O A;  3WTX C;  2H09 A;  1I6X A;  1U6G A;  1XMK A;  4UXN A;  4ON0 A;  2P7V B;  1UFM A;  2TDX A;  4CYD A;  4KN4 X;  2D2W A;  3RKW A;  2W84 A;  5H20 A;  4L9T A;  4M73 A;  1O7L A;  1U8R A;  1FWZ A;  2MH9 A;  1ULY A;  3L00 A;  3LA2 A;  2ADU A;  2XAQ A;  2K7L A;  1TTY A;  2CQK A;  4HX7 A;  4XSX F;  2COM A;  3RDI A;  2CO5 A;  4UVB A;  2P5K A;  3ECO A;  5FGM A;  1ZG3 A;  2M1B A;  1IUY A;  3ELK A;  2KIF A;  3C3W A;  2D1V A;  1L0O C;  2CGP A;  4KIB A;  1SFX A;  4RGR A;  1SD6 A;  4LLN A;  3MFK A;  5DV5 A;  3GWZ A;  2VBY A;  4M71 A;  2OQG A;  5HS8 A;  1IXS B;  3CUO A;  4AIK A;  3B73 A;  3CUQ A;  5ICG A;  3JTH A;  5JR3 A;  3BJA A;  1Z7U A;  1B4A A;  1WRJ A;  3F72 A;  3GW2 A;  3IWZ A;  4ETS A;  1RZ4 A;  1BI1 A;  2OZU A;  2Z99 A;  4S04 A;  3DF8 A;  4P9F A;  2OQR A;  1IF1 A;  4RB1 A;  4ZYH A;  4LLG F;  3C18 A;  1QZY A;  1R1T A;  1TQI A;  3RJP A;  2XGX A;  2ESH A;  2C6Y A;  1NHA A;  3HSF A;  3JSP A;  4KMU X;  2B0L A;  1FBS A;  4ESF A;  1UCR A;  4MTD A;  3P9K A;  4P5O A;  1LJ9 A;  1BJA A;  1ON1 A;  2O03 A;  4ZYE A;  3K9T A;  4OIP F;  2OU2 A;  1IN5 A;  3VOE A;  5KVR A;  2MD5 A;  2KJC A;  2HKO A;  1T39 A;  5HS9 A;  1R36 A;  3FMQ A;  3MWM A;  1CF7 B;  1SD4 A;  2VBZ A;  3WTW C;  3WGH A;  3JW4 A;  3ABU A;  3COA C;  4CHU A;  1HKQ A;  2YSR A;  1OYI A;  3WTY C;  5LEJ A;  2JRT A;  2ZBK A;  2XKP A;  4KYW A;  1IN7 A;  1MJA A;  1RIO H;  4CZZ A;  1F9N A;  4A6D A;  2VT2 A;  2L54 A;  3KEQ A;  3FMR A;  2RDP A;  4B09 A;  4S05 A;  4RB2 C;  3HRT A;  1B6A A;  1I1G A;  3HOS A;  2R3S A;  2MLK A;  4NHJ A;  4XSZ F;  5E20 A;  5D5W B;  3RKX A;  1J2X A;  3RPQ A;  3HRU A;  1B9N A;  1MJB A;  3GZ6 A;  2EK5 A;  3WG9 A;  2QWW A;  2ZME A;  3V7R A;  3FX3 A;  2JT1 A;  3O3K A;  4XRF A;  1I5Z A;  5DCF A;  5E1Z B;  3QAH A;  3CLO A;  2Y75 A;  4U0Y A;  3V7S A;  3J81 K;  4RB0 A;  1Z91 A;  3N4M A;  2A07 F;  1A04 A;  2FNP A;  1MGT A;  1MDM B;  1FZP B;  4TV7 A;  4M9X A;  3MQ0 A;  3QP5 A;  2WV0 A;  4UVA A;  3R0J A;  1HKT A;  4I09 A;  5D8L B;  3E5Q A;  2IT0 A;  4HYE A;  4MGR A;  5A2Q K;  2FOK A;  3EDP A;  3L2C A;  4Q47 A;  2HOE A;  4BHB A;  3U2R A;  3F8B A;  3KE2 A;  2P5L C;  4U88 A;  1S3J A;  2O6G E;  4L9J A;  3R6S A;  2ZO4 A;  3I58 A;  2QBY A;  4RAZ A;  2F5E A;  5FD5 A;  3IC7 A;  2HWV A;  3V8L A;  4R8H A;  3R61 A;  1ONV A;  2KJB A;  3I59 A;  4A0Y A;  1ZRF A;  3ZQ7 A;  2EFW A;  2Z5U A;  4HBL A;  1KU2 A;  2CW0 F;  5L3G A;  2EFN A;  1O3Q A;  1YS7 A;  2DPU A;  3WU1 B;  3KP5 A;  2IA2 A;  4YFN F;  1F1Z A;  1YO5 C;  2K4J A;  3I5U A;  2YU3 A;  3IRR A;  2VE8 A;  1B1B A;  2LDU A;  4WXD A;  1FSH A;  4IPA A;  2RGV A;  3EQL F;  4PCQ A;  5TJJ A;  3BZ6 A;  1ZGJ A;  1WI9 A;  2P6S A;  1LEA A;  4EGZ A;  2V9V A;  5TRD A;  4ZZL A;  2GA2 A;  4Y17 A;  3RIR A;  3ZMD A;  2E7W A;  1MD0 A;  1RNL A;  3LWF A;  4NQW A;  5K5R A;  2O61 A;  4A5M A;  3J81 Z;  1LDD A;  1QGP A;  1ZHF A;  4Z2Y A;  4I0B A;  3TOA A;  1IRG A;  3H3Z A;  3K0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...