3MFKA

Ets1 complex with stromelysin-1 promoter dna
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
138
structure length
138
Chain Sequence
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA.
pubmed rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Protein C-ets-1
total genus 39
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3mfkA00
3ECOA 5K5QA 4HX7A 3ERED 5CYVA 5LHHA 2R3SA 2Z9OA 4O5VA 3MQ0A 2HYFA 1PP8F 3F3XA 1R5GA 1TLHB 3FMRA 1FOKA 2PFBA 4A5MA 4CXFA 2P4WA 4MQ9F 2NYXA 1HSJA 3FM5A 2ESHA 2IA0A 2IRFG 1ODDA 4G6DA 3LQQA 5FB2A 5AONA 5CVVA 1SAXA 1BI0A 2H09A 3GZ6A 3CUOA 3CO7C 2L4MA 2ETHA 4Y17A 4YIFA 2IJLA 2Y0MA 2JPBA 1T98A 2ELHA 3DF8A 2ZKZA 4WXHA 4Z2YA 4EVIA 1P92A 1IXCA 3FWEA 4A6DA 1SMTA 3JW4A 3B73A 5KK1A 1KU2A 5LEKA 4ESFA 1TNSA 2W84A 5HVQC 4HX8A 4HF2A 3E97A 4R1HA 2XKOA 4ASNA 1B59A 2LNBA 2MLKA 1O3SA 3LA3A 4A0ZA 3R6SA 5E1XA 4HLXA 4IRGA 2DLLA 1TQPA 3C18A 3K1MA 5FLXZ 5H20A 5CVRA 1F1ZA 3WTXC 2V1UA 1GXPA 1L0OC 5ICFA 4MGRA 4ZYGA 1LB2A 5FFXA 3IKVA 2ISZA 5ICCA 1I1SA 4LB6B 3HSFA 3V7CA 1RI7A 1Z7UA 1SD7A 2GXBA 2DU9A 1Z1DA 4MEYF 2NRAC 4I7HA 1I27A 3LA2A 1IUYA 4ENNA 4M6YA 2V1XA 2O03A 5HDGA 3IL2A 4B8XA 2FEZA 2FF4A 5HDKA 3WGGA 1LJ9A 4RB0A 4RGRA 2YPRA 3KEOA 3Q9VA 3WGIA 3P9CA 2FU4A 4L9TA 1MGTA 3HHGA 5K5OA 4G7ZF 2F5EA 4XLPF 2NAZA 2HKXA 3RKXA 3RYPA 3LAJA 3VEPA 3COAC 1LDDA 3CTAA 4CICA 2QQAA 1FWZA 2L4AA 1IN7A 3IHUA 1GXQA 1I6XA 1G6NA 1G4DA 2M30A 5ERIA 5E8GA 2CQKA 5AIPA 4ENMA 3F6OA 4CYDA 3MZHA 4EM1A 2XAHA 4HLYA 3GFMA 4FHTA 3I59B 1P4WA 4F7ZA 1LDJA 3ZMDA 2HDCA 2A6EF 2IPQX 3FXQA 2STWA 1Q1HA 3J80K 3T8RA 2MC3A 1K79A 1DPRA 1G3TA 4EJWA 1NHAA 5D4RA 3H3ZA 1YO5C 2QYOA 1FYKA 1MZBA 2KIUA 2OQRA 3U9GA 2A3SA 5DCMB 4HV6A 2VBXA 3RI4A 3HYIA 4N0BA 5E20A 2E7WA 2EA2A 3PQKA 1OKRA 2CGPA 1RZ4A 3F6VA 1TTYA 1HBXG 1MD0A 5HS9A 3F8FA 1XSDA 4P96A 1HXDA 4IHTA 3GWZA 5JFRA 5LBQA 3HOTA 1ZRFA 3LFKA 2CFXA 1Z9CA 1T38A 3TGNA 4A2UA 1S8NA 2ZXJA 2MLGA 2V6CA 1IN6A 4U88A 3R4KA 3OOPA 1FY7A 2FE3A 2RQPA 1P4AA 2Z99A 2UXXA 1QZYA 2PMUA 1OYYA 4HV5A 4YFXF 2D1VA 4A12A 3E5XA 2QM3A 4AIHA 2M5WA 5JHUA 4JBAA 3GXOA 1MKMA 4R8HA 2LF8A 3NRVA 3TKYA 3K2ZA 1IN5A 3K69A 2A69F 2Z5UA 5D5VB 4ZYDA 3WE2A 3BZ6A 2IT0A 3GUDA 3KP7A 1B9NA 1FC3A 2HZTA 3TO6A 1QGPA 2COMA 3CDHA 3K0LA 2L54A 2V9VA 3V8KA 4OIPF 2FQ3A 2HTJA 3WTUC 2PLYA 3I5UA 2P7CB 4PZJA 1W7PB 4WK8F 4G7OF 1U78A 2EV5A 2KRFA 2BYVE 2P8TA 4L0ZB 3FMSA 1EH8A 3HRSA 4HDVA 1USSA 2VODA 4IVNA 3E6BA 3T0YA 4BHBA 4UVBA 2L02A 3TO9A 1TBXA 4A6EA 3C7JA 5L3FA 3BJOA 3RIRA 4L9VA 1J7KA 2RNJA 3R60A 2BGCA 2FBKA 3KP2A 4NHJA 4XBFA 4EGZA 1RUOA 1BI2A 3HSRA 3L00A 4L5IA 3BY6A 4P5OA 2Q2EA 3L09A 4G8XA 1AOYA 2ZBKA 4NQWA 4KT5C 3JTGA 1IZ1A 3E5QA 1WRJA 4LB5A 3KLOA 2WC2A 2W57A 4IPAA 5H6RA 2XASA 3HUGA 2O0YA 2XGXA 4RB1A 1H0MA 2XV4S 4HYEA 4L9NA 1X3UA 3GFIA 1LEAA 2QWWA 5ILSA 2VT3A 4PDKA 2ZNYA 5DV5A 3TOAA 1EH7A 1ON1A 3TDZC 4FT8A 2W24A 1G3YA 1IXRC 3V8JA 1I5ZA 3ZN0A 3J81Z 2EV0A 2D45A 5J6XA 1ONVA 5HS7A 1BIAA 3EYIA 3I0TA 4YFNF 2D1HA 3M8FA 3SHFA 5EEGA 3M1EA 3J81K 2JZYA 4G94A 3M8EA 5AIQA 3QU6A 5D8LB 4FX4A 2PG4A 3DXJF 3ZMSA 2XUBA 1IAWA 4YIIA 5D8KB 1ZN2A 2J5OA 1PDNC 1RUNA 3SXYA 4EMSA 1B4AA 1XSVA 1KA8A 5DD8A 1FZPB 5ILVA 3GYHX 4G7HF 3P9IA 4Q4ZF 2GIVA 4LD5A 3CO6C 1D5VA 4Q5SF 6PAXA 1PP7U 4P55A 1GVJA 5E17F 3ZMZA 3LWFA 1HW2A 1LEBA 4KDPA 4I2OA 1YYVA 2BBYA 3DEUA 4S05A 1WKMA 1YFHA 1YW8A 2O3FA 3WTWC 2BEOA 2DI3A 2D2WA 1H9GA 3WTTC 1B9MA 1FSHA 2DW4A 2K4JA 4RGXA 3T5XA 2O8XA 3RYRA 2HFHA 4RGSA 3SQNA 1YS7A 2VN2A 2F2EA 3ZMTA 2AXLA 4LJZF 3BP8A 4KYWA 4G9YA 1QBJA 1D8JA 4CHUA 1ZRDA 3RKWA 2FOKA 2ZCWA 2FXAA 1J75A 3O3KA 1JE8A 4MTDA 2PEXA 3WU1B 2O61A 2YX7A 2W85A 1O7LA 3D0SA 4ZZLA 2H6BA 3LSTA 3QU3A 1U3EM 3TDUC 1WWXA 1WSUA 4CDGA 2FSWA 4LLGF 4EJTA 1UFMA 1W7PD 3MZYA 1DUXC 4BYYA 1P4XA 3GFLA 4BH9A 1R7JA 2EA4A 1O3RA 1BI1A 1QZZA 3QP5A 3GX4X 3BPVA 3JTHA 4O3MA 3RTRA 4QWQA 3PQJA 2HS5A 4U7BA 2GAUA 5LEJA 5LRRA 5TJJA 1REPC 4LFUA 4XSZF 3K1NA 5DCMA 4A0XA 1BC7C 5A2QZ 3BWGA 1R58A 2M87A 1YIOA 3R0AA 1MJBA 2EWNA 4AIKA 1JHFA 4KIBA 2ZNZA 3W6JB 1R36A 3L9FA 3LQRA 4RB3C 2XHKA 2ZMEA 1XGMA 4AVPA 1FLIA 2E1CA 1HSTA 4P9UA 4L5JA 2LSOA 3QP6A 3N97A 1BI3A 3BJ6A 3KEQA 3I53A 1OYIA 3IWFA 3BOQA 3FXUA 4WX9A 4WF2A 4A0YA 1KQ9A 2UZKA 1LVAA 3F8MA 4PGGA 3ULQB 3I4PA 4NB5A 3RPUA 1S29A 1OPCA 3FM3A 4HF1A 4ENJA 2A68F 2K27A 1Z6TA 3V8LA 1J59A 4FX0A 5EEHA 2ZFWA 5DUIA 5J8CA 3Q9SA 4L9JA 5BMZA 1ZHFA 2LDUA 2E1NA 4EJVA 1ZYRF 3KLNA 1EH6A 3NEUA 4UV9A 1MDMA 1P2FA 3DKWA 1ZRCA 3O6BB 2EFPA 3K9TA 1J0RA 1S7OA 5L3GA 4ZYEA 1QPMA 2VOPA 3F8BA 3CLOA 3IC7A 2QBYB 1S6LA 1BIBA 2QUFA 1W5TA 4WXDA 1ZLKA 1TNTA 2DT5A 3IRQA 1H9TA 1KU7A 3V7RA 4KIGA 4IF4A 5CLSA 1HKSA 4I98B 2GQQA 1KU3A 2IW5A 3E6DA 3IKTA 3QRFF 2DK8A 2CYYA 1ZG3A 2CWEA 2IP2A 2XKPA 1BOAA 2DQRA 3IWZA 5BQTA 4Q47A 3F23A 2FNPA 1XGSA 2QQBA 2YSRA 5FFZA 1Y0UA 4P9FA 3PFIA 1CGPA 2ZJ2A 2UWMA 2WWYA 1IN8A 5TRDA 4BHCA 1SFUA 2GA1A 4MEXF 4OMYA 2V79A 4H0EA 2OBPA 3V4GA 4HQMA 2DO7A 2JTVA 3J80Z 1IF1A 1YTYA 1T6SA 2XROA 2F5DA 2PI0A 1PUEE 5LRSA 2KJBA 1TQIA 2PN6A 2Q0OA 2GWRA 1KYWA 4M9ZA 1ZREA 4Y15A 1JGSA 4I0AA 4IHSA 2ISYA 1TQMA 1F5TA 3KCCA 1R22A 5FO5A 5CVUA 2QENA 5LGNA 2CG4A 3RPQA 1D8KA 4HX4A 1XDUA 4EQQA 2DTRA 2R7FA 2K7LA 5ILUA 1S3JA 2DK5A 4QLCU 1HW5A 4I0BA 1YS6A 3ISPA 5F1RA 1LNWA 1U6GA 4D0PA 3EETA 5HLIA 1Z6RA 3H92A 2H6CA 2A5YB 3ZPLA 3LA7A 4PGHA 5LHGA 1DPUA 3MEXA 5LLQA 5H6QA 4KUMA 5D4SA 4OU0A 4ZYHA 1ULYA 4KMFA 1UCRA 3GW2A 3C1DA 2XAGA 1T2KA 5D6EA 1U5TB 3LAPA 2HTSA 2P6TA 1MDMB 1OR7A 5D5XB 4AWXB 2JT1A 1F4KA 4ZZDA 2E7XA 3JSOA 2JPCA 3O2PE 4U0YA 2KKOA 4N9HA 1BBYA 5CJ9A 1R1TA 1CF7A 4BXUA 1W4MA 3EQLF 2H27A 1SFEA 1ZLJA 5HDNA 3NQOA 1ON2A 2OU2A 1ZGJA 3GO5A 2M8EA 4XSXF 1USTA 3BROA 3HRTA 1HW1A 1MJ9A 4LLLA 5BPIA 4I02A 2HOEA 3I64A 2IVMA 2K86A 2TDXA 5E18F 4UNOA 2RC4A 3KP6A 5K1YA 2GZWA 4L0YB 1KQ8A 1U2WA 3GVAA 2HWVA 5IT9K 3K1PA 1U8RA 4BHPA 3ROUA 2XAFA 2Y48A 4HBLA 1IW7F 4EJOA 2P5KA 3G73A 5J8FA 3ZMUA 5JVTA 2P6SA 1BJAA 3WTYC 1QNTA 4KFCA 4MNUA 1UB9A 1T39A 2YR2A 2K4BA 1J9IA 4M9XA 4ESJA 4RS8A 4HDUA 1BM9A 3FX3A 4CO8A 4EV0A 5DDGA 4PCQA 3HTSB 1XSXA 3KZYA 3F8CA 3KP3A 2KIMA 3SZTA 2OQGA 3T1BA 1KYZA 2FNAA 2P5LC 5IT3A 3VODA 3F72A 5E1ZB 3V7SA 1FBQA 4U7DA 1OMIA 2G7HA 4UUVA 3F21A 2HEOA 3BJAA 2Y75A 4R79A 2C6YA 5F64A 1A04A 2G9WA 2DBBA 1YW7A 2PMHA 4UVAA 4L18B 4Y13A 1XDSA 2XVCA 4JQFA 4KA4A 5JI6A 4GCVA 2OA4A 1ZG1A 2VOOA 1K78B 2ESNA 1FX7A 4LG0B 1XCVA 1O57A 1SD6A 2MBFA 3DFGA 2ZMEB 3W6KB 1W5SA 2RGVA 1V4RA 4DNCA 1QQIA 2QLZA 4DQ2A 3HSEA 4UHTA 1C0WA 1ZAOA 3E5UA 4YG2F 1R23A 2CO5A 3M7GA 2UXNA 4AD9A 4MQVA 2VC1A 2YU3A 2M45A 2Z3YA 5E1WA 5CVJA 5BOXA 1XGNA 1FNNA 3L2CA 4EGYA 1XCBA 2ZO4A 3QOPA 3GLXA 2XAJA 1JXSA 3KETA 1ZG5A 4M6XA 1DP7P 1P6RA 1FBUA 4M71A 2KJCA 2OZUA 4M9SA 2O6GE 4HW0A 1E2XA 2JRTA 1IRFA 1B6AA 1DDNA 2JSCA 4OIOF 1IRGA 4RGUA 5DYMA 3CUQA 5D6FA 4K2EA 2LKPA 2BE5F 2NNNA 1I1GA 4ON0A 1HKQA 3H3UA 1T0FA 2OD5A 1XD7A 4LG0A 3HIFA 3F8NA 2STTA 3OV8A 2RVCA 4LLNA 2FBIA 2IA2A 1ZARA 2F5FA 5DEQA 2L3DA 4HZFA 3R61A 2FRHA 3HTUA 2MH2A 1LDKB 2CSOA 2HQNA 2Q8KA 2QBYA 3VFZA 4GXOA 5LHIA 1SMYF 3DP7A 2QZ8A 2MD5A 1GHCA 4S04A 1O7FA 1ZGAA 4Q48A 3RDIA 3TOBA 3DPLC 4ENKA 3KZZA 1MJAA 1O3QA 4M74A 4YFKF 3CUQB 1HQCA 2A07F 1BC8C 1J2XA 1UHWA 4WWCA 5BS6A 1U5TA 3MCZA 5A2QK 4HQEA 3BDDA 1TW2A 4E70A 4KNYA 3EUHA 2QVOA 3P9KA 4M73A 5L3BA 3GF2A 4UVCA 1FBSA 5D5UB 5L3CA 3JAMZ 3MAJA 2NNYA 3DV8A 1KU9A 1FP1D 3WODF 3DQVC 3ELKA 2DQLA 5L3DA 4KN4X 2ADUA 1XN7A 4A5NA 4WCGA 1RIOH 1J5YA 3JAMK 5ICEA 1D3YA 4XRFA 2G7UA 4KICA 2EFQA 3MWMA 3WTZA 1STZA 4IXAA 1OYWA 5L3EA 2XRNA 2FA5A 3ECHA 4UV8A 2VT2A 3FF5A 3DPTA 1R00A 3GEZA 2PQ8A 2M1BA 3WG9A 4EJUA 1Z05A 3QPHA 1K7AA 4N9IA 1K6OA 1W7PA 2GA2A 3M9AA 5HS8A 4KN7X 1UHMA 2VXZA 3N4MA 3JSPA 3VOEA 1R1UA 5DUKA 4HAMA 5HLGA 3E6CC 2AS5F 1G3WA 2X0LA 2WV0A 2EFWA 2W25A 2VBWA 1G3SA 3ML6A 3ZN1A 1SFXA 1S7AA 2FMYA 1Z91A 4ESBA 4OIQF 3U2RA 3HOSA 4O6JA 2R7DA 3SZPA 2MA3A 3VB2A 3FXRA 2HYGD 3ZP5A 4B09A 2EFNA 1R5HA 1L3LA 5JR3A 4GYIA 2B0LA 1KGSA 2PJPA 2HR3A 2EB7A 2DPUA 3ZQ7A 4IJAA 1KQ0A 2VBYA 5K5RA 4I01A 4OMZA 1TW3A 4ZH4F 1WQ2A 2EJRA 5E8IA 5F6FA 2HQRA 1FSEA 3MFKA 1U5TC 5D5WB 3CJNA 2XIGA 1FT9A 2X4HA 3RKYA 3ABUA 1WI9A 3I58A 3HRMA 4BAYA 2L01A 3KE2A 1FYMA 3P7NA 3L7WA 1BN5A 5FD5A 5KVRA 2K02A 5LGTA 5CVIA 4LGWA 1EV7A 4RAYA 3T8TA 3QAHA 1V3FA 1IN4A 2J5PA 2DAOA 3GZ5A 5FD6A 3E3VA 1FPQA 1YG2A 1F9NA 2PBIA 3S2WA 2OZ6A 2WTEA 5ED4A 1LQ1A 2P5VA 3HHHA 4WXCA 4MTEA 1VTNC 3HRUA 5DCFA 3D5LA 3J7AO 3I59A 4HA8A 2BV6A 5FGMA 4OOIA 4ETSA 3CUQC 3FMQA 1AWCA 3REOA 4LMYA 2GXGA 2NS0A 1ZH5A 2HGCA 5HLHA 5HOOA 3EYYA 4U0VA 5BPDA 5FLXK 1YQAA 4EM2A 5LGUA 4CGZA 1XGOA 2DFIA 1IXSB 4MHGA 3AAFA 4RAZA 2RDPA 2EK5A 2VE9A 1E17A 2Z33A 2F5CA 3TO7A 1XMAA 2IA1A 1HKTA 4G6QA 4LK0F 4OINF 1K78A 2EFOA 3KP4A 4U0WA 1QO0D 2V1DA 3RJPA 3WE3A 4GO1A 3FZVA 2OAZA 4XLNF 3U1DA 3BPXA 2CW0F 2YX4A 3KP5A 4GYGA 3Q5FA 4TV7A 4AIJA 1SD5A 4OIRF 1CF7B 1XB4A 4EM0B 3EDPA 3GFJA 3ZMVA 2RKHA 4KIFA 5IT9Z 4GGGA 4I09A 3G3ZA 1JHHA 2VE8A 4HOBA 2XAQA 4KMUX 3WTSC 1B1BA 3E6MA 3FHZA 3F22A 2VBZA 3I54A 3QPTA 4UXNA 3IRRA 1SD4A 2LF7A 4HF0A 2RV8A 2QQ9A 3KFWX 3I71A 4BQAA 1RNLA 3R0JA 4LK1F 3WGHA 2EV6A 2VC0A 2KIFA 3ABTA 3C3WA 1R1VA 4CZZA 3SFZA 3TQNA 1FP2A 4JK1X 3WTVC 2DPDA 2FMLA 2H94A 2FBHA 4M72A 3B02A 2VONA 5DD4A 2ACJA 2P7VB 2MH9A 2RN7A 2A61A 4BNCA 1O3TA 1YW9A 2A6HF 1YLFA 4IRIA 3WU0A 4IRHA 1FYLA 5ICGA 1XMKA 2HKOA 4RB2C
chains in the Genus database with same CATH superfamily
3ECOA 4FISA 2F6CA 4MLOA 3OY9A 5K5QA 2NVYJ 4HX7A 3HOYJ 1D1CA 2QKLB 1FTTA 3ERED 4F91B 3RQ4A 3OOUA 1HLVA 1X1DA 5CYVA 1P7IA 3KYLA 2IS6A 3GTLJ 5LHHA 2R3SA 2Z9OA 4O5VA 3MQ0A 2LY1A 2HYFA 3JR9A 1PP8F 1HC8A 1W1WE 3F3XA 1R5GA 1TLHB 3FMRA 3HL2A 1ETWA 3OYEA 1FOKA 2PFBA 4A5MA 4A3MJ 4CXFA 2LBFB 2P4WA 4Z6YA 4MQ9F 2NYXA 1HSJA 3FM5A 5GTHC 5BOXA 2ESHA 4LITA 3GMEA 5B66C 2IA0A 1WJCA 3FBIB 2IRFG 5IPAA 1ODDA 4G6DA 3LQQA 4D7MA 5FB2A 5AONA 5CVVA 2BY3A 1SAXA 1BI0A 1OR7C 2H09A 4OAZA 3GZ6A 4RBOA 3CF5F 3CUOA 3CO7C 2L4MA 2ETHA 3E1SA 2PMZN 4Y17A 3BZKA 3I9V2 4YIFA 2IJLA 5HNHA 2Y0MA 1Y8QB 2JPBA 1T98A 4BY7J 2KDZA 5C44J 1NG7A 1RESA 4ZDOA 2ELHA 3DF8A 2ZKZA 4WXHA 4Z2YA 2Y2ZA 4AC0A 2HVSA 3OYIA 2MFZA 4KT6A 4X0GA 2V9PA 2OCCH 3OYFA 4EVIA 1P92A 1IXCA 1RKWA 3FWEA 1W36D 4A6DA 3CDLA 1AHDP 1A5JA 1SMTA 3L1PA 1M1EB 1MW7A 2ZJPF 3JW4A 3B73A 5KK1A 1KU2A 5LEKA 4ESFA 3A2KA 2CUEA 1TNSA 3S1MJ 5E3LA 1JKPC 2W84A 3A0HC 4CCMA 5EGOB 5HVQC 4HX8A 4HF2A 3E97A 4R1HA 1FTZA 2XKOA 4ASNA 1HCRA 1OCTC 1B59A 2HVQA 2LNBA 2MLKA 4A3IJ 1MBFA 1O3SA 3LA3A 2LG4A 1MIJA 2TCTA 4ZC3A 3X2QH 4W97A 4A0ZA 1A6IA 4RM3A 3R6SA 5E1XA 2WV1A 1GT0C 4HLXA 4IRGA 3CF2A 2DLLA 1TQPA 3C18A 3K1MA 3S3OA 5FLXZ 1VQKI 3JRBA 2EILH 1LKXA 4LIUA 5H20A 5CVRA 1F1ZA 2IGNA 3WTXC 2E1MB 3OIQA 2V1UA 5EYRA 1GXPA 1L0OC 5E79C 3OYCA 3O8HA 4KJZA 3PNVA 5F0FA 1T95A 5ICFA 1ZK8A 1Z3XA 2BVLA 4MGRA 2W4SA 4ZYGA 3ABLH 1Z67A 2L5QA 3BCBA 2I10A 3VWBA 1LB2A 1WH5A 3K2AA 5FRMA 5FFXA 2CMPA 3H35A 5JHFA 3IKVA 3FXOA 2ISZA 5ICCA 1X2NA 2NVXJ 1I1SA 2QSFX 1MBEA 2MABA 2XB5A 3TL4X 4LB6B 3UKGA 3HSFA 3IAS2 5M5XJ 3V7CA 1Z21A 3SEQA 1G8XA 4C2UA 1MMSA 3G71I 1RI7A 4UB6C 3MD2A 3CCLI 1Z7UA 5CKTA 1SD7A 2MGQA 3BR3A 2GXBA 1TL8A 2DU9A 1MMGA 1Z1DA 4MEYF 2NRAC 4I7HA 3H3VK 2VQHA 1I27A 1GLNA 3LA2A 4ANJA 1IUYA 1FMVA 4ENNA 4BXXJ 1BA5A 4M6YA 4B3XA 1EJ9A 2V1XA 1I50J 2O03A 5HDGA 2QA4I 3IL2A 3N05A 2DYRH 4B8XA 1TWCJ 5FKMA 2FEZA 2FF4A 5HDKA 1Y56A 2DYSH 2EZKA 1W0UA 2NVQJ 2VQCA 2M0MA 1APLC 3WGGA 1LJ9A 3HC7A 4RB0A 3S93A 4RGRA 2YPRA 3S16J 3KEOA 3Q9VA 4PJMA 3P9CA 2X1DA 3WGIA 2FU4A 4L9TA 1MGTA 2DDBA 3FKIJ 3HHGA 5K5OA 1X1BA 4G7ZF 4G6TB 2ZB9A 1JKQC 2F5EA 5EJCA 3K4NA 2FUG2 1IDZA 2MW8A 3ZQIA 4XLPF 3H0DA 5GTIC 2NAZA 2HKXA 3RKXA 1B8IB 1OCZH 2XRLA 3RYPA 3QYEA 2PJRA 3LAJA 3VEPA 5JVGF 3COAC 1LDDA 3CTAA 2W7NA 4JX6A 2MYSA 1B72A 1W5CC 4CICA 2QQAA 1FWZA 2RNGA 1WI3A 1WJDA 2L4AA 1IN7A 3IHUA 1GXQA 1I6XA 1G6NA 1G4DA 2M30A 5ERIA 1X2MA 3HPHA 5E8GA 5EZGA 2CQKA 3A02A 4IX7A 5AIPA 5IYDJ 1MMAA 2ECBA 4ENMA 3F6OA 2ZSIB 5GP9A 4CYDA 3MZHA 1VQPI 4EM1A 2XAHA 4XOTA 2B9SA 3BR1A 1K6YA 4HLYA 4DZJA 3GFMA 3S3NA 4FHTA 2P0WA 3I59B 1P4WA 4X1EA 1LDJA 4F7ZA 3ASNH 3ZMDA 2IXSA 2HDCA 2A6EF 2IPQX 3FXQA 3PIPF 2STWA 1Q1HA 3J80K 3T8RA 3GTMJ 1MH3A 3OL4A 2IEKA 2MC3A 2LREA 1K79A 2IS2A 5GAEJ 2N8GA 1DPRA 3K70C 2CUJA 1G3TA 4EJWA 1NHAA 5D4RA 4ZDLA 1B8IA 3PUFA 2GOMA 3H3ZA 1YO5C 5DS9A 2V26A 2QYOA 4F93B 1FYKA 2HPMA 1MZBA 2DA6A 2KIUA 1S9HA 1X1CA 1D1BA 2A3SA 2OQRA 3BR2A 3U9GA 3UNGC 2JN6A 5DCMB 5CQGA 4HV6A 2VBXA 3RI4A 2OTJI 1D0YA 4C3JJ 3HYIA 2ECCA 3LSJA 4N0BA 4XM3A 2NOGA 4HG2A 2E7WA 5E20A 3QWLA 2EA2A 1FJLA 1PJRA 3PQKA 3JRGA 1OKRA 2CGPA 1RZ4A 5EZHA 3CCEI 3F6VA 2OPTA 1TTYA 1HBXG 4XN0A 1MD0A 3VPRA 2KFDA 2VPRA 5HS9A 3HJEA 4E7KA 3HDDA 2H1LA 3F8FA 1XSDA 2LKSA 4P96A 1HXDA 4IHTA 2W48A 3GWZA 5JFRA 5LBQA 3BR6A 3HOTA 1ZRFA 3LFKA 2RAEA 1Y39A 5F04A 2CFXA 1Z9CA 1ENHA 2A5WA 1YJNI 2Y31A 3ASOH 1T38A 2L7MP 3TGNA 4A2UA 1S8NA 2Y0SA 2ZXJA 3KZIC 3D1NI 2OCEA 2MLGA 3BTJA 2X6XA 2V6CA 4RA2A 1IN6A 4U88A 4P1WA 3BG3A 3R4KA 3J7AY 3C2GA 3OOPA 4IZZA 2HI3A 1FY7A 2FE3A 2RQPA 1MNDA 1P4AA 2LVSA 3CQZJ 2Z99A 2UXXA 1QZYA 2PMUA 1OYYA 4HV5A 3I55I 4YFXF 2D1VA 4A12A 3E5XA 3OIOA 2E5ZA 2QM3A 4AIHA 2M5WA 1IC8A 5JHUA 1SVOA 3HOVJ 4JBAA 2LYCA 3GXOA 1U9OA 1MKMA 4R8HA 2LF8A 3SFIA 3NRVA 1I39A 4BDZA 3TKYA 5E3OA 3K2ZA 3PNTA 4Y52J 2CUFA 2NVUB 3DTEA 4FQGA 1IN5A 3ZOBA 3K69A 2A69F 5IP7J 2Z5UA 4XIDA 5D5VB 4ZYDA 4UB8C 3WE2A 3BZ6A 2IT0A 3GUDA 3KP7A 1B9NA 2RREA 1U8BA 1FC3A 3QOEA 2HZTA 4HNTA 3DU5A 1FOYA 1H8AC 3TO6A 1MNMC 2LC2A 1QGPA 3A01A 2COMA 3CDHA 3K0LA 2L54A 1RC9A 2V9VA 4BY1J 3CMYA 2Z2SB 3V8KA 3BTLA 4OIPF 2FQ3A 2HTJA 2JA6J 1WFXA 3WTUC 3MKLA 2PJRB 3U21A 5F0CA 3CCJI 2PLYA 1GUUA 3C2BA 3O8GA 3I5UA 2K9NA 4E7IA 5F27A 4B47A 5EG0A 2P7CB 4PZJA 1IV8A 1W7PB 4WK8F 3DLLF 4G7OF 2CJJA 1U78A 2EV5A 2KRFA 2ZJQF 2BYVE 2P8TA 4L0ZB 3B6AA 1F36A 2JVHA 1AU7A 3GTQJ 3FMSA 1EH8A 3HRSA 2ME0A 1FOWA 4HDVA 1USSA 2VODA 3L2UA 4IVNA 3OWTA 3E6BA 3T0YA 4BHBA 1UAAA 4UVBA 2L02A 2V9KA 3TO9A 1NH3A 1TBXA 3IH2A 4A6EA 1SFOJ 5F1JA 2BXZA 1MSFC 1WGXA 3C7JA 5L3FA 3BJOA 3H5AA 3VYTB 4BUPA 4W1UA 3RIRA 4BEHB 1SFKA 4L9VA 3ZCOA 2RQQA 1J7KA 2W82A 5GADJ 4F55A 2RNJA 2DJIA 3R60A 2PMZA 2KISA 2BGCA 2FBKA 3CJQB 3PNYA 4RLFA 4XLCA 3ONQA 3KP2A 4NHJA 5FKNA 4XBFA 2KQRA 3CP2A 4EGZA 1RUOA 1X58A 1V5GA 2DMUA 2R5ZA 1BI2A 2HU9A 2KZGA 3HSRA 3L00A 4L5IA 3BY6A 4P5OA 1WZ2A 2Q2EA 3S17J 1I3QJ 2XSDC 3L09A 4G8XA 1AOYA 2W00A 2ZBKA 3ZQFA 1ETVA 3GBGA 3DPUA 2HZDA 4KT5C 4NQWA 3JTGA 4A3JJ 4IOAF 1IZ1A 5FKOA 1VFCA 3E5QA 3NWTA 3AG4H 2VPLA 1WRJA 4LB5A 3KLOA 9ANTA 4FETA 1IRZA 2DDAA 2WC2A 2W57A 4BBSJ 1X3WB 4IPAA 5H6RA 2XASA 3H1CA 5KHDA 1BR4A 2NXNB 3HUGA 2O0YA 2XGXA 5K7HA 4RB1A 1H0MA 3CC7I 2L7ZA 2XV4S 3DKXA 4HYEA 3K4CA 4L9NA 1X3UA 3GFIA 1LEAA 2QWWA 2R7RA 1A36A 1YRNA 5ILSA 2VT3A 1ZR2A 3S2HJ 4AYBN 2FD5A 2WAQN 4PDKA 2AQFA 3C2HA 2ZNYA 2K85A 5DV5A 5EDNA 3TOAA 3CCYA 1EH7A 1ON1A 3JRIA 3TDZC 4FT8A 1HF0A 2W24A 1WCMJ 1G3YA 1IXRC 2YU9J 3V8JA 1I5ZA 2HDDA 1DGWY 3M1CA 3ZN0A 1TZLA 3J81Z 3HOXJ 2EV0A 2D45A 5J6XA 3S2DJ 2CQXA 2M8GX 1ONVA 1QZEA 4CCOA 4J01A 5HS7A 3CMAI 1BIAA 2QCOA 2Z1DA 3EYIA 3I0TA 2LY9A 3K4BA 4YFNF 2D1HA 4DOZA 2OC6A 3M8FA 3SHFA 4XLAA 4G12A 5EEGA 3OYHA 3M1EA 3S8PA 3J81K 2XB0X 3PL8A 1ERDA 4ZTJA 2DFHA 2JZYA 2V7FA 3M8EA 4G94A 5AIQA 3DEEA 3QU6A 1S72I 1TP4A 5D8LB 3FBNB 2L7KA 4FX4A 2PG4A 1XG1A 3U1KA 3DXJF 5KCMA 2XUBA 3ZMSA 4A3EJ 1P7JA 2BW3B 1IAWA 1BL0A 2X51A 1Z3YA 3LSIA 4YIIA 5FJ8J 3K10A 3I3LA 1YIJI 5D8KB 3QYFA 4BJ5C 1ZN2A 3W2AA 2J5OA 1PDNC 1RUNA 3M07A 3SXYA 4EMSA 1B4AA 3Q0VA 1XSVA 3MZ8A 3Q0UA 1KA8A 5DD8A 1FZPB 5ILVA 3GYHX 4G7HF 3P9IA 2DOFA 4Q4ZF 2GIVA 2HOAA 4LD5A 4AIDA 4C2TA 3CJTB 1YITI 3CO6C 1D5VA 4Q5SF 1IO2A 4D9JA 1MMDA 1K61A 6PAXA 1PP7U 4P55A 4HSRA 2ID6A 1GVJA 1RRJA 1YJWI 5E17F 2VL8A 3G4SI 2GM4A 3ZMZA 3LWFA 1HW2A 1LEBA 4F3QA 4XL9A 4KDPA 4I2OA 2JA2A 4PFOA 1YYVA 1GV2A 2BBYA 3HXLA 3DCFA 2ZXWH 1AA7A 4YRVA 3B6CA 3DEUA 4S05A 3S1NJ 1WKMA 5K7FA 4GDFA 5KAIC 5E3NA 1YFHA 2DXIA 3FKJA 2HOTA 1YW8A 2O3FA 2X9DA 2JMWA 3WTWC 2BEOA 2R7OA 2DI3A 2F4IA 1WH7A 5FKKA 2LR8A 2D2WA 3BC8A 4A69C 1H9GA 1AKHA 3WTTC 1B9MA 4RAFA 3GTKJ 1SANA 2DW4A 2K4JA 2X85A 4RGXA 5EEAA 5GAHJ 3CCUI 1FSHA 2EIJH 3T5XA 1YX3A 1EKEA 2K3PA 2O8XA 3RYRA 2HFHA 4RGSA 3SQNA 3ZQQA 5EG0B 1YS7A 5LFAA 2WAQA 5DM6F 3QPSA 2VN2A 4BACA 2F2EA 3ZMTA 3GLLA 2AXLA 4LJZF 4FE7A 2WBMA 2QSHX 1ORKA 2ME6A 4XN3A 3BP8A 1Z77A 1HDDC 4E7LA 2Q2EB 3SYTA 3JRCA 3SDBA 4KYWA 1DU6A 4G9YA 4DIQA 1QBJA 3PIOF 2XSJC 2HXIA 1D8JA 3BR0A 4CHUA 1ZRDA 2KZVA 3VDXA 2W1OA 4CH7A 5H2FC 4N4OB 3RKWA 2FOKA 3OS1A 3BTIA 2ZCWA 1LE8B 2GIZA 3G1MA 3OR2C 2FXAA 1J75A 3O3KA 1JE8A 4MTDA 4PJ0C 3KIOA 2VQLA 1R71A 4DBQA 4B3AA 2PEXA 4QPOA 3WU1B 2HOSA 5DM7F 2O61A 2YX7A 2Y69H 1Z7LA 3TW6A 2W85A 1O7LA 1N77A 1X19A 3D0SA 4ZZLA 4C30A 2H6BA 2VKDA 3LSTA 3QU3A 3Q3SA 5J4YA 2EPFA 1U3EM 3TDUC 1WWXA 2XC7A 1WSUA 4CDGA 2FOWA 2FSWA 4LLGF 2E19A 2IBDA 4EJTA 1UFMA 1W7PD 3MZYA 3OSGA 1DUXC 5B1BH 4BYYA 1P4XA 1WJAA 2LK2A 3GFLA 2JSPA 1G59A 4BH9A 3FHNA 1R7JA 2EA4A 1O3RA 1BI1A 1QZZA 3QP5A 3GX4X 3BPVA 3JTHA 4O3MA 1E0EA 3RTRA 3D5RC 4QWQA 3PQJA 2HS5A 4BQOA 4U7BA 2GAUA 3JCUC 3KX2A 5LEJA 5LRRA 5TJJA 2Y9ZA 1REPC 4LFUA 1FIPA 4XSZF 3K1NA 5DCMA 4A0XA 1HA8A 1BC7C 5A2QZ 3BWGA 3LSRA 1H89C 2NVTJ 1R58A 2BZTA 2M87A 1YIOA 3CCMI 3R0AA 1MJBA 2EWNA 3CDIA 4AIKA 5IOZA 1JHFA 2X1CA 2F5VA 4KIBA 2ZNZA 3HKZA 2KHMA 1Y0NA 3W6JB 3FK7A 1R36A 3L9FA 3LQRA 4HEA2 3SZGA 4BQQA 4RB3C 4E7JA 2XHKA 2ZMEA 1XGMA 4AVPA 3S3MA 1FLIA 4HSTA 2E1CA 1HSTA 1ZKGA 4P9UA 4L5JA 2LSOA 3QP6A 3N97A 1BI3A 3BJ6A 2ZMEC 3KEQA 3OIPA 4II2A 3ZRGA 3G1LA 3I53A 1OYIA 1QVUA 2OUMA 3BOQA 3FXUA 3IWFA 4WX9A 4WF2A 3OS0A 4A0YA 1KQ9A 2JUGA 2UZKA 2XGDA 2GBYA 3BCAA 1VF9A 1A35A 1LVAA 3LL7A 2O5RA 1OISA 3F8MA 4PGGA 3ULQB 1FEXA 3I4PA 3W2WA 3G2BA 4NB5A 2XF6A 1LE8A 2IS4A 2LBFA 3RPUA 2FX0A 1S29A 4C3HJ 3H36A 3DTIA 1OPCA 3FM3A 4HF1A 2CFOA 2HPIA 4M3BA 4ENJA 1HDPA 1YX5A 2A68F 2K27A 4PFPA 1Z6TA 3K4MA 1WJFA 3V8LA 3K7AJ 2DMTA 5GPAA 1J59A 4FX0A 3OSFA 4X6AJ 4RAGA 5EEHA 2HXOA 2ZFWA 4IHWA 5DUIA 1UG0A 4A3FJ 3P5JA 4XKVA 2YS9A 3Q9SA 5J8CA 4L9JA 3NAUA 4XLFA 5BMZA 1ZHFA 3BG9A 4MO7A 3PSIA 1RETA 2LDUA 2E1NA 2CV0A 2ELJA 4M3FA 4ABZA 4EJVA 2FQ4A 1ZYRF 2KDOA 3KLNA 3OYAA 4C2MJ 1EH6A 3NEUA 4UV9A 1X1PA 1Y1VJ 1MDMA 3DBHB 4NNJA 1P2FA 3H5NA 3DKWA 3GTPJ 1ZRCA 3O6BB 2EFPA 3K9TA 1J0RA 4Y33A 1TWAJ 2CRGA 3CJRB 2CV2A 1S7OA 4IL6C 5L3GA 4ZYEA 2LD5A 1R6RA 1QPMA 2LTPA 1S7EA 2AO9A 2VOPA 4M3GA 3DLAA 1LVKA 3F8BA 4HNUA 3BR5A 1IV6A 3CLOA 3IC7A 5EGOA 2QBYB 5LD2C 1S6LA 1BIBA 2QUFA 4A3GJ 1W5TA 4ITVA 2MD0A 4JOMA 1ZELA 4WXDA 3CCVI 2CUZA 3LSPA 1ZLKA 2R7UA 2X6OA 1TNTA 2EZIA 3EUKL 1XMXA 2DT5A 3IRQA 1DP3A 2O7OA 1H9TA 1KU7A 3V7RA 3CC4I 3PM1A 4KIGA 4IF4A 4ZJZA 5CLSA 1Y8RB 2IGOA 4XKWA 3AL0B 3EUHC 1HKSA 4I98B 2GQQA 1KU3A 2IW5A 3E6DA 3IKTA 3MKWB 2DFFA 2MG4A 3BZCA 2M0CA 3A01B 3QRFF 1ZTRA 2DK8A 3KYDB 2CYYA 1BJZA 1ZG3A 2V1NA 3VSLA 2F48A 2CWEA 2VB6A 2IP2A 2XPUA 1DQUA 3UR3C 3I56I 2H8RA 4PJNA 5J1YA 4A3KJ 5F0HA 2XKPA 2Y0SN 1BOAA 3BQYA 1T8IA 2E60A 2BW3A 4J00A 2M3AA 2DQRA 4MFDA 3IWZA 4PK4A 5BQTA 2K5CA 3HZJA 2A05A 4Q47A 3F23A 4XQFA 1MMNA 4Y7NJ 2FNPA 1K4SA 1XGSA 2QQBA 1A6QA 2YSRA 5FFZA 2R4GA 2NS7A 1Y0UA 1XS9A 1V55H 4DYQA 2NS8A 4P9FA 3PFIA 1CGPA 2ZJ2A 2UWMA 4A3CJ 3WHBA 4BJ6C 2WWYA 1IN8A 5TRDA 2DA5A 1JGGA 4BHCA 3FISA 1ZQ3P 1SFUA 4RDUA 3MN2A 2GA1A 4MEXF 4AYBA 4OMYA 2V79A 1D1AA 4H0EA 2OBPA 3V4GA 1FOXA 3S15J 4HQMA 2WB1A 2B63J 2DODA 2LRDA 2DO7A 2JTVA 3J80Z 1IF1A 1YTYA 1T6SA 2ZSHB 2XROA 2F5DA 2PI0A 2BY1A 2JQ7A 4XICA 1PUEE 3CC2I 5LRSA 3OYMA 2KJBA 2ZJRF 4V2GA 1TQIA 2PN6A 3VYSB 4CZCA 2Q0OA 4XLEA 1UHSA 2GWRA 1KYWA 4M9ZA 1GDTA 2X48A 1ZREA 1BR2A 4Y15A 1JGSA 4I0AA 2L9VA 4IHSA 1F43A 2ISYA 3SEZA 4CA0A 1TQMA 1F5TA 3E0JB 3I4MJ 3KCCA 3VSKA 1IJWC 3LSKA 2LY2A 1FIAA 1R22A 5FO5A 1EA3A 3TEDA 4EEFG 1NG6A 2QENA 5CVUA 5LGNA 2CG4A 3RPQA 1UELB 2DA1A 1V54H 1IDYA 1D8KA 2KRHA 3H5RA 2XGCA 4HX4A 3RZDJ 1XDUA 4EQQA 5JLWA 2DTRA 4CUGA 2R7FA 2K7LA 3IV5A 5ILUA 1S3JA 2DK5A 4QLCU 1I3AA 3HUGB 1HW5A 4KITB 2X6YA 2E2JJ 4I0BA 1YS6A 5IYCJ 2EQRA 1LPQA 3L2WA 2BOLA 4ZTFA 4HPQA 3ISPA 5F1RA 4XRMA 1LNWA 1U6GA 4D0PA 2YUSA 3EETA 4I99C 3MMYB 5HLIA 5GPCA 1Z6RA 2E36A 4XRSA 3H92A 2L9NA 3S32A 5CQEA 2CU7A 2A5YB 2H6CA 3ZPLA 2DJNA 3LA7A 4PGHA 5B5EC 5LHGA 1DPUA 1LFPA 3MEXA 1ETOA 5LLQA 1NTCA 5H6QA 3TW7A 4BE1A 3DU6A 4KUMA 5D4SA 4OU0A 4ZYHA 3K4JA 1ULYA 3BG5A 3K6GA 4KMFA 1UCRA 3OR1C 3GW2A 3TMOA 3C1DA 2XAGA 1T2KA 2BHYA 5D6EA 1U5TB 4F92B 1R4MB 1VZ0A 3LAPA 4MFEA 2HTSA 4U87A 2XAUA 2P6TA 3RSNA 1MDMB 2DOEA 1MBJA 1YHQI 1OR7A 5D5XB 4AWXB 1MNEA 2OV7A 3CCRI 2E71A 4UUTA 2JT1A 1F4KA 3HOWJ 4ZZDA 2IGKA 4DJAA 2F4OB 2E7XA 3GTGJ 4MIMA 2DMQA 1OQYA 3JSOA 2JPCA 3O2PE 1JJ8C 4U0YA 5J1RA 1VNDA 2KKOA 2M4GA 4N9HA 1BBYA 5CJ9A 1R1TA 3SDGA 2R93J 3ABKH 1CF7A 4BXUA 1YOVB 4M6VA 2HDWA 1W4MA 1SAUA 3EQLF 2H27A 3HPGA 1SFEA 4B43A 1RPWA 2R7VA 4D7NA 1QU3A 1ZLJA 5HDNA 2M4KA 3NQOA 1ON2A 2OU2A 4I76A 4IEJA 2R0QC 3DEWA 5M5YJ 1ZGJA 3GO5A 3PSFA 1UMQA 1BR1A 1D0ZA 2M8EA 4XSXF 1USTA 3BROA 1PUFA 3HRTA 1HW1A 1MJ9A 4LLLA 5BPIA 4I02A 2MC4A 2HOEA 3FXJA 3I64A 2IVMA 2K86A 2HYJA 4BS9A 1BOBA 2DMNA 2TDXA 5E18F 1VQOI 2RC4A 4UNOA 1Y6IA 3KP6A 5K1YA 2LKXA 2GZWA 2ZFUA 3CMEI 1VQ7I 4L0YB 2ID3A 5B3SH 1KQ8A 1U2WA 3GVAA 3PO2J 3FK6A 4B44A 2DMPA 1DU0A 2HWVA 5IT9K 3K1PA 3M3YJ 1U8RA 4BHPA 3ROUA 4ZDPA 3H0GJ 2X1EA 2IGMA 2XAFA 2R7WA 3AG2H 2Y48A 2DA4A 4HBLA 1JT0A 1MSEC 3S1RJ 1IW7F 4EJOA 2P5KA 3CESA 3G73A 2CS3A 5F08A 1D5YA 1SVMA 3KEYA 5J8FA 3HOZJ 3ZMUA 4BE2A 1HOMA 5IYBJ 5JVTA 2P6SA 4BKXA 4FE4A 1BJAA 3JRAA 3WTYC 3AL0C 1QNTA 1TWHJ 4KFCA 1PYVA 3IP4B 1N78A 4MNUA 1UB9A 2KMUA 2YR2A 3E7LA 2K4BA 1T39A 1R49A 1WVRA 1U0JA 1G2HA 1J9IA 1A31A 1JI8A 1YE9A 4M9XA 4XK4A 2L2OA 1SC7A 4I6ZA 3PFYA 4ESJA 1QHHD 4RS8A 4HDUA 1W36C 1BM9A 3LMMA 3FX3A 4CO8A 3OMYA 2JJ7A 4EV0A 5DDGA 4PCQA 3HTSB 1XSXA 3KZYA 5IP6A 3F8CA 4BGDA 3TP0A 1V5FA 5J47A 2VKEA 3KP3A 2KIMA 3SZTA 1CQTA 2OQGA 3T1BA 1KYZA 4B4CA 2VKHA 3V42A 4LG3A 2FNAA 3EPZA 1PUFB 3BT9A 3RCOA 3PJRA 2P5LC 1WJBA 5IT3A 3VODA 5CPRB 3F72A 5E1ZB 1ZGWA 2DT7B 1T33A 3V7SA 1FBQA 3TBIA 4U7DA 2AXTC 1IGNA 2G0EA 1OMIA 2G7HA 4UUVA 3F21A 2L0KA 4DBRA 2HEOA 2A6TA 2Y75A 3BJAA 4XLHA 3TP3A 4R79A 2KPMA 2C6YA 2KP6A 5F64A 4BL0B 1QRYA 1A04A 2ZC2A 2G9WA 3CMMA 3RZOJ 2DBBA 1JUPA 1YW7A 2PMHA 2IAIA 4UVAA 4BBRJ 4H4KC 4L18B 2EH3A 1XDSA 4Y13A 2XVCA 4JQFA 2R7XA 4KA4A 5JI6A 2EZHA 4GCVA 2OA4A 1ZG1A 4PSWA 1ETKA 2VOOA 1K78B 1SEUA 2E35A 2ESNA 4C9YA 1FX7A 3CCSI 4LG0B 2K3FA 4B48A 1VI0A 1XCVA 1O57A 3DFGA 1SD6A 2MBFA 2ZMEB 4E6KG 3W6KB 1W5SA 3S14J 1XX5A 2RGVA 5M3MJ 1V4RA 4DNCA 3GTOJ 1X1AA 4E7HA 1QQIA 2VQGA 2QLZA 4DQ2A 4LIVA 2MSYA 1ZR4A 3HSEA 4UHTA 4RMNA 2HQ5A 1ZAOA 3E5UA 4QSHA 1C0WA 4YG2F 1LUJB 1NK3P 1P9QC 1R23A 2CO5A 3M7GA 4CYCB 1BW5A 2UXNA 3IH3A 4AD9A 1U9NA 4XMYA 2PX9A 4MQVA 3GTJJ 1B72B 3OYKA 2VC1A 5B1AH 2YU3A 1H88C 3J7ZI 2M45A 2Z3YA 5E1WA 1OCCH 2BY2A 3HEFA 5CVJA 3A1YA 4XKCA 4DZPA 1XGNA 1FNNA 3K4LA 3FIWA 3L2CA 1ITYA 4EGYA 1XCBA 2ZO4A 3QOPA 2DA3A 2VKVA 3GLXA 1VQNI 2XAJA 4E7ZA 1JXSA 5J3LA 2QEXI 3KETA 3ZGKA 1ZG5A 2KT0A 2HVRA 4GRIA 2LMDA 4M6XA 2R5ZB 1DP7P 1P6RA 1FBUA 4M71A 2KJCA 2OZUA 2WA0A 4M9SA 2O6GE 4NC8A 4D1QA 4IKFA 4HW0A 1E2XA 2JK3A 2JRTA 1IRFA 2WY8Q 1B6AA 3QQAA 4FCYA 1DDNA 2JSCA 1IRXA 2DFEA 4OIOF 1VQMI 5J40A 1IRGA 4RGUA 5DYMA 3CUQA 5D6FA 2BVMA 4JYKA 4K2EA 3IUOA 4CCLA 2LKPA 2BE5F 2NNNA 3HBLA 3Q0WA 4UUSB 1VQ8I 1I1GA 2P81A 4ON0A 1HKQA 3WU2C 3H3UA 2NOJB 1T0FA 3AG1H 2OD5A 1XD7A 4LG0A 3W2VA 2XPWA 3HIFA 2R7QA 1ETQA 3F8NA 2STTA 3OV8A 2RVCA 5IP9J 4YEJA 4LLNA 3BTCA 2GXAA 2EINH 3H9GA 2FBIA 1JKRC 3F9KA 2JA5J 2IA2A 2B7EA 3F0CA 1ZARA 1SVLA 2OF7A 3FXMA 3KPHA 3PUBA 1Q1VA 2AQEA 2CQ7A 2F5FA 5DEQA 2L3DA 4HZFA 3BG6A 1VQ4I 3R61A 2FRHA 3W3CA 3HTUA 2MH2A 4AU7A 3MKZA 1LDKB 4NUBA 1TT5B 2CSOA 1YI2I 2I8DA 2M34A 2HQNA 2R7SA 3LSGA 4XONA 2Q8KA 2QBYA 1WJ5A 4Y4RA 3VFZA 4GXOA 5LHIA 1SMYF 3DBLB 4V19K 2BY0A 3I4NJ 2HQAA 3DP7A 2QZ8A 2K40A 2MD5A 3MVPA 1GHCA 4S04A 1O7FA 1ZGAA 4Q48A 3RDIA 3TOBA 3DPLC 2E2HJ 2AHQA 4ENKA 3KZZA 1MJAA 1O3QA 4M74A 2R5YA 4YFKF 3CUQB 1HQCA 4IOCF 2A07F 2JRMA 1BC8C 1J2XA 1UHWA 4WWCA 4FTHA 4NQWB 5FKLA 5BS6A 1U5TA 3MCZA 5A2QK 2DTZA 3S1QJ 4HQEA 2JA8J 1T08B 4A93J 3BDDA 1TW2A 4E70A 3VYUB 1OJLA 4KNYA 4A3LJ 1K83J 3CZ6A 3EUHA 2QVOA 3P9KA 4BXFA 3ERMA 4M73A 2QGUA 1X4OA 4CSWA 5L3BA 2ICWG 3GF2A 4UVCA 3FXKA 2CQNA 1FBSA 1WPKA 4F52A 2ELKA 1JT6A 3ZQGA 3ABMH 4PJLA 3OYJA 5FRNA 2E1OA 5D5UB 5L3CA 2EIMH 3JAMZ 3G6EI 1TWGJ 3MAJA 2NNYA 3M4OJ 1RKTA 1OCPA 3DV8A 2V6EA 2CV1A 5M5WJ 1KU9A 1FP1D 3WODF 1POGA 3DQVC 3ELKA 4CCKA 2DQLA 1JUSA 5L3DA 2BHZA 4KN4X 2XPVA 2ADUA 1XN7A 5C4JJ 1T0FC 2KIQA 4XOPA 4A5NA 4WCGA 4YIRX 4IHVA 1J5YA 1RIOH 1R4NB 3JAMK 5ICEA 1TC3C 1D3YA 4JX5A 4XRFA 2G7UA 4KICA 4D5FA 2EFQA 2VASA 3MWMA 2ZXHA 2R5YB 1Z0XA 2CQQA 3WTZA 1STZA 4IXAA 1RR7A 1OYWA 2CW7A 5L3EA 2XRNA 2FA5A 5J1UA 3CD6I 3ECHA 4UV8A 2VT2A 2WAFA 3FF5A 3HM5A 3DPTA 1R00A 3GEZA 4N4NB 5E3MA 1N75A 1TT0A 2PQ8A 2M1BA 3WG9A 2UUZA 4EJUA 4BU2A 4DGWB 4OWRB 5C4XJ 1Z05A 3QPHA 4AVZA 1K7AA 1QA6A 1QPIA 1RR8C 4N9IA 1K6OA 1W7PA 1BW6A 2GA2A 3M9AA 2DN0A 2QSGX 2GLOA 5HS8A 4KN7X 4HNVA 4QTRA 1UHMA 2VXZA 2VJIA 3N4MA 2LH9A 3VYRB 3JSPA 3WHCA 3VOEA 1R1UA 3JRDA 5FLVA 5DUKA 2OJED 3K4KA 4HAMA 1VQ9I 1VQLI 4D5CA 1UG2A 5HLGA 2VJ5A 3E6CC 2AS5F 1G3WA 2VXDA 3DWLE 2X0LA 2WV0A 2EFWA 2W25A 2VBWA 1G3SA 3ML6A 2XF5A 3ZN1A 4J19A 1SFXA 1S7AA 4A3DJ 1GV5A 1X3ZB 3H9QA 3FXLA 5HLTA 2LLKA 2FMYA 4NDLA 1Z91A 3DTKA 1J09A 4ESBA 1KZHA 2F4MB 1MBKA 4OIQF 3U2RA 4JP0A 3HOSA 4O6JA 2R7DA 3SZPA 2MA3A 1KONA 3VB2A 3JREA 4BEHA 2DOAA 5BNGA 2LP0A 3NARA 3FXRA 3AKZA 2HYGD 2E1MC 3H9JA 3ZP5A 2BXYA 3PO3J 3QYBA 4B09A 2XGEA 2EFNA 3JRFA 2R92J 1R5HA 1L3LA 5JR3A 3M8JA 4GYIA 2B0LA 3L2VA 2VI6A 3CCQI 4AUXA 3LNQA 1KGSA 4BQNA 2PJPA 2HR3A 2EB7A 2DPUA 3LFUA 1VQ5I 3ZQ7A 4XR6A 4IJAA 1KQ0A 2VBYA 3HKZN 5K5RA 4I01A 4OMZA 1JKOC 4FASD 1TW3A 4ZH4F 1WQ2A 2EJRA 5TGTA 1UZCA 2R7ZJ 1XTAA 2KRCA 2E34A 1JTYA 5E8IA 1LFUP 1QHGA 3HB9A 4PJJA 4L5EA 2L7FP 5F6FA 1TWFJ 3HG9A 5IOYA 2HQRA 1FSEA 3MFKA 1X4PA 2CH0A 1U5TC 2LOOA 5D5WB 3CJNA 2XIGA 1JJ6C 1FT9A 2FJ1A 3KYCB 4XNFA 2X4HA 3RKYA 3ABUA 1WI9A 2IS1A 3I58A 3OYDA 3HRMA 4BAYA 3MKYB 2K9SA 4XORA 3BG7A 2L01A 3L2QA 3OS2A 3ZQCA 5EF6A 4B1RA 3A0BC 2UV1A 3BLYA 3KE2A 3A4CA 1FYMA 3RPUD 3P7NA 3L7WA 4C3IJ 4IHYA 3OYGA 3ZQHA 1PVEA 4M3EA 4XRSG 1BN5A 3K70D 5FD5A 1XPXA 4PSXA 5KVRA 2K02A 2Y9YA 5LGTA 2QQ8A 2WB1N 4QIWN 2JVGA 1K4TA 5CVIA 4IO9F 4IHXA 1MBGA 2DA7A 4LGWA 2X6WA 3GZNB 1EV7A 4RAYA 3T8TA 3G1OA 3QAHA 2QKMB 3NWSA 4M3DA 2H8WA 1V3FA 2K9LA 5DTDA 3JRHA 1IN4A 2JWTA 2J5PA 2DAOA 4YELA 1IUFA 3GZ5A 3OL3A 4LOCA 5FD6A 3E3VA 1WJEA 1QVTA 1E3HA 1XC5A 1FPQA 1YG2A 1F9NA 2KL4A 2M7AA 2PBIA 3S2WA 2OZ6A 2WTEA 5ED4A 1LQ1A 2P5VA 2KLOA 1WHUA 3EUAA 3IAM2 1EF4A 3HHHA 4UUSA 4WXCA 4MTEA 4RLQA 3HRUA 1VTNC 2XF7A 5DCFA 2WY7Q 3D5LA 3J7AO 4ZYAA 3I59A 4HA8A 4RM2A 2WAEA 1R5ID 4E4HA 4XKBA 2BV6A 5FGMA 1GVDA 2OTLI 4OOIA 4ETSA 5HNFA 3CUQC 2EBIA 1ETYA 3HGGA 3FMQA 1AWCA 3REOA 1ETXA 3ZR8X 1UJ8A 4LMYA 2GXGA 2NS0A 3OYLA 4CCJA 3HGYA 4DW6A 1ZH5A 2HGCA 3FDYA 4NC6A 5HLHA 5HOOA 4BJTA 3EYYA 1IG7A 2Q1ZB 4U0VA 1E3PA 5BPDA 2VJ4A 5FLXK 1Y1WJ 1YQAA 4EM2A 5LGUA 5FLMJ 4CGZA 2M7BA 1JTXA 1XGOA 1JUMA 2L9SA 2DFIA 4II3A 5C3EJ 2K9MA 1IXSB 2DCEA 4MHGA 5J4VA 5KNLA 3AAFA 4RAZA 2DA2A 2RDPA 4E7SA 4DYCA 3LSHA 2EK5A 2VE9A 1W0TA 1E17A 2Z33A 2F5CA 3TO7A 1S5LC 2M9HA 4IQ4A 4HRIA 2O9LA 3QODA 1XMAA 4V2FA 2IA1A 3DBRB 3SJMA 3OYBA 1HKTA 4G6QA 1YRNB 4LK0F 4OINF 2H1KA 5GAGJ 1K78A 1NK2P 2EFOA 3KP4A 4U0WA 1QO0D 4CCNA 1ACIA 2V1DA 3RJPA 3WE3A 1MBHA 3CP8A 3ZXSA 1AKHB 1DGRM 2TRTA 4KISA 4IQJA 2M2EA 4GO1A 3FZVA 2Y30A 2OAZA 4NC7A 4XLNF 2ZXIA 3U1DA 2EIKH 3BPXA 2CW0F 2YX4A 3KP5A 2VJJA 3GCMA 3ESWB 3QPLA 4GYGA 2O8KA 3Q5FA 4TV7A 3RKQA 3J7YJ 3LSMA 4AIJA 1SD5A 1N25A 2GOXB 1T56A 4DYRA 2JA7J 2JUCA 3OYNA 2L9RA 3BQZA 4OIRF 3RQIA 4A3BJ 5M3FJ 1CF7B 1XB4A 4EM0B 5FROA 2COBA 2LFBA 1OLTA 3EDPA 3A03A 3GFJA 3ZMVA 1OCOH 2RKHA 1MH4A 1OCRH 4KIFA 5IT9Z 2K9QA 4GGGA 4I09A 4NBQA 4CYCA 3G3ZA 2E2IJ 1JHHA 2VUMJ 2VE8A 2Z16A 4HOBA 2XAQA 4KMUX 2E5NA 3WTSC 1B1BA 3E6MA 3W6VA 3FHZA 2DT6A 4BE0A 3F22A 2VBZA 3CLQA 1FMWA 2HNHA 1V5EA 3HOUJ 3I54A 3QPTA 2XDVA 4UXNA 3IRRA 1SD4A 3LOCA 2LF7A 4JX4A 5TISC 4HF0A 2RV8A 3IH4A 2QQ9A 4EATA 1E3OC 3KFWX 3I71A 1LFBA 4BQAA 1RNLA 3R0JA 4LK1F 3AG3H 4Y3OA 1R9TJ 1O4XA 3WGHA 3DKYA 5KAFC 2EV6A 2VC0A 4OAYA 2KIFA 1YJ9I 2I5UA 3ABTA 4AM3A 3C3WA 1R1VA 4PUSA 3AFHA 5K7ZA 4QPQA 4BDYA 4CZZA 3SFZA 3D5SC 3TQNA 2VIXA 5HODA 4GFBA 1FP2A 4JK1X 2D5VA 3ZQLA 3WTVC 2DPDA 2FMLA 2H94A 2FBHA 2EZLA 2QF7A 4M72A 3WG7H 3B02A 5IY5H 2VONA 5DD4A 2ACJA 1D0XA 2P7VB 1OFCX 2MH9A 2RN7A 2A61A 2CW8A 2WADA 2VLAA 4BNCA 1O3TA 1YW9A 2A6HF 1YLFA 4S0HB 4IRIA 3WU0A 5JLXA 4IRHA 1FYLA 4UY8I 1I6HJ 5ICGA 3L2RA 1VQ6I 2R7TA 1XMKA 2V4JC 2HKOA 4RB2C
chains in the Genus database with same CATH topology
3ECOA 5K5QA 4HX7A 3ERED 5CYVA 5LHHA 2R3SA 2Z9OA 4O5VA 3MQ0A 2HYFA 1PP8F 3F3XA 1R5GA 1TLHB 3FMRA 1FOKA 2PFBA 4A5MA 4CXFA 2P4WA 4MQ9F 2NYXA 1HSJA 3FM5A 2ESHA 2IA0A 2IRFG 1ODDA 4G6DA 3LQQA 5FB2A 5AONA 5CVVA 1SAXA 1BI0A 2H09A 3GZ6A 3CUOA 3CO7C 2L4MA 2ETHA 4Y17A 4YIFA 2IJLA 2Y0MA 2JPBA 1T98A 2ELHA 3DF8A 2ZKZA 4WXHA 4Z2YA 4EVIA 1P92A 1IXCA 3FWEA 4A6DA 1SMTA 3JW4A 3B73A 5KK1A 1KU2A 5LEKA 4ESFA 1TNSA 2W84A 5HVQC 4HX8A 4HF2A 3E97A 4R1HA 2XKOA 4ASNA 1B59A 2LNBA 2MLKA 1O3SA 3LA3A 4A0ZA 3R6SA 5E1XA 4HLXA 4IRGA 2DLLA 1TQPA 3C18A 3K1MA 5FLXZ 5H20A 5CVRA 1F1ZA 3WTXC 2V1UA 1GXPA 1L0OC 5ICFA 4MGRA 4ZYGA 1LB2A 5FFXA 3IKVA 2ISZA 5ICCA 1I1SA 4LB6B 3HSFA 3V7CA 1RI7A 1Z7UA 1SD7A 2GXBA 2DU9A 1Z1DA 4MEYF 2NRAC 4I7HA 1I27A 3LA2A 1IUYA 4ENNA 4M6YA 2V1XA 2O03A 5HDGA 3IL2A 4B8XA 2FEZA 2FF4A 5HDKA 3WGGA 1LJ9A 4RB0A 4RGRA 2YPRA 3KEOA 3Q9VA 3WGIA 3P9CA 2FU4A 4L9TA 1MGTA 3HHGA 5K5OA 4G7ZF 2F5EA 4XLPF 2NAZA 2HKXA 3RKXA 3RYPA 3LAJA 3VEPA 3COAC 1LDDA 3CTAA 4CICA 2QQAA 1FWZA 2L4AA 1IN7A 3IHUA 1GXQA 1I6XA 1G6NA 1G4DA 2M30A 5ERIA 5E8GA 2CQKA 5AIPA 4ENMA 3F6OA 4CYDA 3MZHA 4EM1A 2XAHA 4HLYA 3GFMA 4FHTA 3I59B 1P4WA 4F7ZA 1LDJA 3ZMDA 2HDCA 2A6EF 2IPQX 3FXQA 2STWA 1Q1HA 3J80K 3T8RA 2MC3A 1K79A 1DPRA 1G3TA 4EJWA 1NHAA 5D4RA 3H3ZA 1YO5C 2QYOA 1FYKA 1MZBA 2KIUA 2OQRA 3U9GA 2A3SA 5DCMB 4HV6A 2VBXA 3RI4A 3HYIA 4N0BA 5E20A 2E7WA 2EA2A 3PQKA 1OKRA 2CGPA 1RZ4A 3F6VA 1TTYA 1HBXG 1MD0A 5HS9A 3F8FA 1XSDA 4P96A 1HXDA 4IHTA 3GWZA 5JFRA 5LBQA 3HOTA 1ZRFA 3LFKA 2CFXA 1Z9CA 1T38A 3TGNA 4A2UA 1S8NA 2ZXJA 2MLGA 2V6CA 1IN6A 4U88A 3R4KA 3OOPA 1FY7A 2FE3A 2RQPA 1P4AA 2Z99A 2UXXA 1QZYA 2PMUA 1OYYA 4HV5A 4YFXF 2D1VA 4A12A 3E5XA 2QM3A 4AIHA 2M5WA 5JHUA 4JBAA 3GXOA 1MKMA 4R8HA 2LF8A 3NRVA 3TKYA 3K2ZA 1IN5A 3K69A 2A69F 2Z5UA 5D5VB 4ZYDA 3WE2A 3BZ6A 2IT0A 3GUDA 3KP7A 1B9NA 1FC3A 2HZTA 3TO6A 1QGPA 2COMA 3CDHA 3K0LA 2L54A 2V9VA 3V8KA 4OIPF 2FQ3A 2HTJA 3WTUC 2PLYA 3I5UA 2P7CB 4PZJA 1W7PB 4WK8F 4G7OF 1U78A 2EV5A 2KRFA 2BYVE 2P8TA 4L0ZB 3FMSA 1EH8A 3HRSA 4HDVA 1USSA 2VODA 4IVNA 3E6BA 3T0YA 4BHBA 4UVBA 2L02A 3TO9A 1TBXA 4A6EA 3C7JA 5L3FA 3BJOA 3RIRA 4L9VA 1J7KA 2RNJA 3R60A 2BGCA 2FBKA 3KP2A 4NHJA 4XBFA 4EGZA 1RUOA 1BI2A 3HSRA 3L00A 4L5IA 3BY6A 4P5OA 2Q2EA 3L09A 4G8XA 1AOYA 2ZBKA 4NQWA 4KT5C 3JTGA 1IZ1A 3E5QA 1WRJA 4LB5A 3KLOA 2WC2A 2W57A 4IPAA 5H6RA 2XASA 3HUGA 2O0YA 2XGXA 4RB1A 1H0MA 2XV4S 4HYEA 4L9NA 1X3UA 3GFIA 1LEAA 2QWWA 5ILSA 2VT3A 4PDKA 2ZNYA 5DV5A 3TOAA 1EH7A 1ON1A 3TDZC 4FT8A 2W24A 1G3YA 1IXRC 3V8JA 1I5ZA 3ZN0A 3J81Z 2EV0A 2D45A 5J6XA 1ONVA 5HS7A 1BIAA 3EYIA 3I0TA 4YFNF 2D1HA 3M8FA 3SHFA 5EEGA 3M1EA 3J81K 2JZYA 4G94A 3M8EA 5AIQA 3QU6A 5D8LB 4FX4A 2PG4A 3DXJF 3ZMSA 2XUBA 1IAWA 4YIIA 5D8KB 1ZN2A 2J5OA 1PDNC 1RUNA 3SXYA 4EMSA 1B4AA 1XSVA 1KA8A 5DD8A 1FZPB 5ILVA 3GYHX 4G7HF 3P9IA 4Q4ZF 2GIVA 4LD5A 3CO6C 1D5VA 4Q5SF 6PAXA 1PP7U 4P55A 1GVJA 5E17F 3ZMZA 3LWFA 1HW2A 1LEBA 4KDPA 4I2OA 1YYVA 2BBYA 3DEUA 4S05A 1WKMA 1YFHA 1YW8A 2O3FA 3WTWC 2BEOA 2DI3A 2D2WA 1H9GA 3WTTC 1B9MA 1FSHA 2DW4A 2K4JA 4RGXA 3T5XA 2O8XA 3RYRA 2HFHA 4RGSA 3SQNA 1YS7A 2VN2A 2F2EA 3ZMTA 2AXLA 4LJZF 3BP8A 4KYWA 4G9YA 1QBJA 1D8JA 4CHUA 1ZRDA 3RKWA 2FOKA 2ZCWA 2FXAA 1J75A 3O3KA 1JE8A 4MTDA 2PEXA 3WU1B 2O61A 2YX7A 2W85A 1O7LA 3D0SA 4ZZLA 2H6BA 3LSTA 3QU3A 1U3EM 3TDUC 1WWXA 1WSUA 4CDGA 2FSWA 4LLGF 4EJTA 1UFMA 1W7PD 3MZYA 1DUXC 4BYYA 1P4XA 3GFLA 4BH9A 1R7JA 2EA4A 1O3RA 1BI1A 1QZZA 3QP5A 3GX4X 3BPVA 3JTHA 4O3MA 3RTRA 4QWQA 3PQJA 2HS5A 4U7BA 2GAUA 5LEJA 5LRRA 5TJJA 1REPC 4LFUA 4XSZF 3K1NA 5DCMA 4A0XA 1BC7C 5A2QZ 3BWGA 1R58A 2M87A 1YIOA 3R0AA 1MJBA 2EWNA 4AIKA 1JHFA 4KIBA 2ZNZA 3W6JB 1R36A 3L9FA 3LQRA 4RB3C 2XHKA 2ZMEA 1XGMA 4AVPA 1FLIA 2E1CA 1HSTA 4P9UA 4L5JA 2LSOA 3QP6A 3N97A 1BI3A 3BJ6A 3KEQA 3I53A 1OYIA 3IWFA 3BOQA 3FXUA 4WX9A 4WF2A 4A0YA 1KQ9A 2UZKA 1LVAA 3F8MA 4PGGA 3ULQB 3I4PA 4NB5A 3RPUA 1S29A 1OPCA 3FM3A 4HF1A 4ENJA 2A68F 2K27A 1Z6TA 3V8LA 1J59A 4FX0A 5EEHA 2ZFWA 5DUIA 5J8CA 3Q9SA 4L9JA 5BMZA 1ZHFA 2LDUA 2E1NA 4EJVA 1ZYRF 3KLNA 1EH6A 3NEUA 4UV9A 1MDMA 1P2FA 3DKWA 1ZRCA 3O6BB 2EFPA 3K9TA 1J0RA 1S7OA 5L3GA 4ZYEA 1QPMA 2VOPA 3F8BA 3CLOA 3IC7A 2QBYB 1S6LA 1BIBA 2QUFA 1W5TA 4WXDA 1ZLKA 1TNTA 2DT5A 3IRQA 1H9TA 1KU7A 3V7RA 4KIGA 4IF4A 5CLSA 1HKSA 4I98B 2GQQA 1KU3A 2IW5A 3E6DA 3IKTA 3QRFF 2DK8A 2CYYA 1ZG3A 2CWEA 2IP2A 2XKPA 1BOAA 2DQRA 3IWZA 5BQTA 4Q47A 3F23A 2FNPA 1XGSA 2QQBA 2YSRA 5FFZA 1Y0UA 4P9FA 3PFIA 1CGPA 2ZJ2A 2UWMA 2WWYA 1IN8A 5TRDA 4BHCA 1SFUA 2GA1A 4MEXF 4OMYA 2V79A 4H0EA 2OBPA 3V4GA 4HQMA 2DO7A 2JTVA 3J80Z 1IF1A 1YTYA 1T6SA 2XROA 2F5DA 2PI0A 1PUEE 5LRSA 2KJBA 1TQIA 2PN6A 2Q0OA 2GWRA 1KYWA 4M9ZA 1ZREA 4Y15A 1JGSA 4I0AA 4IHSA 2ISYA 1TQMA 1F5TA 3KCCA 1R22A 5FO5A 5CVUA 2QENA 5LGNA 2CG4A 3RPQA 1D8KA 4HX4A 1XDUA 4EQQA 2DTRA 2R7FA 2K7LA 5ILUA 1S3JA 2DK5A 4QLCU 1HW5A 4I0BA 1YS6A 3ISPA 5F1RA 1LNWA 1U6GA 4D0PA 3EETA 5HLIA 1Z6RA 3H92A 2H6CA 2A5YB 3ZPLA 3LA7A 4PGHA 5LHGA 1DPUA 3MEXA 5LLQA 5H6QA 4KUMA 5D4SA 4OU0A 4ZYHA 1ULYA 4KMFA 1UCRA 3GW2A 3C1DA 2XAGA 1T2KA 5D6EA 1U5TB 3LAPA 2HTSA 2P6TA 1MDMB 1OR7A 5D5XB 4AWXB 2JT1A 1F4KA 4ZZDA 2E7XA 3JSOA 2JPCA 3O2PE 4U0YA 2KKOA 4N9HA 1BBYA 5CJ9A 1R1TA 1CF7A 4BXUA 1W4MA 3EQLF 2H27A 1SFEA 1ZLJA 5HDNA 3NQOA 1ON2A 2OU2A 1ZGJA 3GO5A 2M8EA 4XSXF 1USTA 3BROA 3HRTA 1HW1A 1MJ9A 4LLLA 5BPIA 4I02A 2HOEA 3I64A 2IVMA 2K86A 2TDXA 5E18F 4UNOA 2RC4A 3KP6A 5K1YA 2GZWA 4L0YB 1KQ8A 1U2WA 3GVAA 2HWVA 5IT9K 3K1PA 1U8RA 4BHPA 3ROUA 2XAFA 2Y48A 4HBLA 1IW7F 4EJOA 2P5KA 3G73A 5J8FA 3ZMUA 5JVTA 2P6SA 1BJAA 3WTYC 1QNTA 4KFCA 4MNUA 1UB9A 1T39A 2YR2A 2K4BA 1J9IA 4M9XA 4ESJA 4RS8A 4HDUA 1BM9A 3FX3A 4CO8A 4EV0A 5DDGA 4PCQA 3HTSB 1XSXA 3KZYA 3F8CA 3KP3A 2KIMA 3SZTA 2OQGA 3T1BA 1KYZA 2FNAA 2P5LC 5IT3A 3VODA 3F72A 5E1ZB 3V7SA 1FBQA 4U7DA 1OMIA 2G7HA 4UUVA 3F21A 2HEOA 3BJAA 2Y75A 4R79A 2C6YA 5F64A 1A04A 2G9WA 2DBBA 1YW7A 2PMHA 4UVAA 4L18B 4Y13A 1XDSA 2XVCA 4JQFA 4KA4A 5JI6A 4GCVA 2OA4A 1ZG1A 2VOOA 1K78B 2ESNA 1FX7A 4LG0B 1XCVA 1O57A 1SD6A 2MBFA 3DFGA 2ZMEB 3W6KB 1W5SA 2RGVA 1V4RA 4DNCA 1QQIA 2QLZA 4DQ2A 3HSEA 4UHTA 1C0WA 1ZAOA 3E5UA 4YG2F 1R23A 2CO5A 3M7GA 2UXNA 4AD9A 4MQVA 2VC1A 2YU3A 2M45A 2Z3YA 5E1WA 5CVJA 5BOXA 1XGNA 1FNNA 3L2CA 4EGYA 1XCBA 2ZO4A 3QOPA 3GLXA 2XAJA 1JXSA 3KETA 1ZG5A 4M6XA 1DP7P 1P6RA 1FBUA 4M71A 2KJCA 2OZUA 4M9SA 2O6GE 4HW0A 1E2XA 2JRTA 1IRFA 1B6AA 1DDNA 2JSCA 4OIOF 1IRGA 4RGUA 5DYMA 3CUQA 5D6FA 4K2EA 2LKPA 2BE5F 2NNNA 1I1GA 4ON0A 1HKQA 3H3UA 1T0FA 2OD5A 1XD7A 4LG0A 3HIFA 3F8NA 2STTA 3OV8A 2RVCA 4LLNA 2FBIA 2IA2A 1ZARA 2F5FA 5DEQA 2L3DA 4HZFA 3R61A 2FRHA 3HTUA 2MH2A 1LDKB 2CSOA 2HQNA 2Q8KA 2QBYA 3VFZA 4GXOA 5LHIA 1SMYF 3DP7A 2QZ8A 2MD5A 1GHCA 4S04A 1O7FA 1ZGAA 4Q48A 3RDIA 3TOBA 3DPLC 4ENKA 3KZZA 1MJAA 1O3QA 4M74A 4YFKF 3CUQB 1HQCA 2A07F 1BC8C 1J2XA 1UHWA 4WWCA 5BS6A 1U5TA 3MCZA 5A2QK 4HQEA 3BDDA 1TW2A 4E70A 4KNYA 3EUHA 2QVOA 3P9KA 4M73A 5L3BA 3GF2A 4UVCA 1FBSA 5D5UB 5L3CA 3JAMZ 3MAJA 2NNYA 3DV8A 1KU9A 1FP1D 3WODF 3DQVC 3ELKA 2DQLA 5L3DA 4KN4X 2ADUA 1XN7A 4A5NA 4WCGA 1RIOH 1J5YA 3JAMK 5ICEA 1D3YA 4XRFA 2G7UA 4KICA 2EFQA 3MWMA 3WTZA 1STZA 4IXAA 1OYWA 5L3EA 2XRNA 2FA5A 3ECHA 4UV8A 2VT2A 3FF5A 3DPTA 1R00A 3GEZA 2PQ8A 2M1BA 3WG9A 4EJUA 1Z05A 3QPHA 1K7AA 4N9IA 1K6OA 1W7PA 2GA2A 3M9AA 5HS8A 4KN7X 1UHMA 2VXZA 3N4MA 3JSPA 3VOEA 1R1UA 5DUKA 4HAMA 5HLGA 3E6CC 2AS5F 1G3WA 2X0LA 2WV0A 2EFWA 2W25A 2VBWA 1G3SA 3ML6A 3ZN1A 1SFXA 1S7AA 2FMYA 1Z91A 4ESBA 4OIQF 3U2RA 3HOSA 4O6JA 2R7DA 3SZPA 2MA3A 3VB2A 3FXRA 2HYGD 3ZP5A 4B09A 2EFNA 1R5HA 1L3LA 5JR3A 4GYIA 2B0LA 1KGSA 2PJPA 2HR3A 2EB7A 2DPUA 3ZQ7A 4IJAA 1KQ0A 2VBYA 5K5RA 4I01A 4OMZA 1TW3A 4ZH4F 1WQ2A 2EJRA 5E8IA 5F6FA 2HQRA 1FSEA 3MFKA 1U5TC 5D5WB 3CJNA 2XIGA 1FT9A 2X4HA 3RKYA 3ABUA 1WI9A 3I58A 3HRMA 4BAYA 2L01A 3KE2A 1FYMA 3P7NA 3L7WA 1BN5A 5FD5A 5KVRA 2K02A 5LGTA 5CVIA 4LGWA 1EV7A 4RAYA 3T8TA 3QAHA 1V3FA 1IN4A 2J5PA 2DAOA 3GZ5A 5FD6A 3E3VA 1FPQA 1YG2A 1F9NA 2PBIA 3S2WA 2OZ6A 2WTEA 5ED4A 1LQ1A 2P5VA 3HHHA 4WXCA 4MTEA 1VTNC 3HRUA 5DCFA 3D5LA 3J7AO 3I59A 4HA8A 2BV6A 5FGMA 4OOIA 4ETSA 3CUQC 3FMQA 1AWCA 3REOA 4LMYA 2GXGA 2NS0A 1ZH5A 2HGCA 5HLHA 5HOOA 3EYYA 4U0VA 5BPDA 5FLXK 1YQAA 4EM2A 5LGUA 4CGZA 1XGOA 2DFIA 1IXSB 4MHGA 3AAFA 4RAZA 2RDPA 2EK5A 2VE9A 1E17A 2Z33A 2F5CA 3TO7A 1XMAA 2IA1A 1HKTA 4G6QA 4LK0F 4OINF 1K78A 2EFOA 3KP4A 4U0WA 1QO0D 2V1DA 3RJPA 3WE3A 4GO1A 3FZVA 2OAZA 4XLNF 3U1DA 3BPXA 2CW0F 2YX4A 3KP5A 4GYGA 3Q5FA 4TV7A 4AIJA 1SD5A 4OIRF 1CF7B 1XB4A 4EM0B 3EDPA 3GFJA 3ZMVA 2RKHA 4KIFA 5IT9Z 4GGGA 4I09A 3G3ZA 1JHHA 2VE8A 4HOBA 2XAQA 4KMUX 3WTSC 1B1BA 3E6MA 3FHZA 3F22A 2VBZA 3I54A 3QPTA 4UXNA 3IRRA 1SD4A 2LF7A 4HF0A 2RV8A 2QQ9A 3KFWX 3I71A 4BQAA 1RNLA 3R0JA 4LK1F 3WGHA 2EV6A 2VC0A 2KIFA 3ABTA 3C3WA 1R1VA 4CZZA 3SFZA 3TQNA 1FP2A 4JK1X 3WTVC 2DPDA 2FMLA 2H94A 2FBHA 4M72A 3B02A 2VONA 5DD4A 2ACJA 2P7VB 2MH9A 2RN7A 2A61A 4BNCA 1O3TA 1YW9A 2A6HF 1YLFA 4IRIA 3WU0A 4IRHA 1FYLA 5ICGA 1XMKA 2HKOA 4RB2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ECO A;  5K5Q A;  4HX7 A;  3ERE D;  5CYV A;  5LHH A;  2R3S A;  2Z9O A;  4O5V A;  3MQ0 A;  2HYF A;  1PP8 F;  3F3X A;  1R5G A;  1TLH B;  3FMR A;  1FOK A;  2PFB A;  4A5M A;  4CXF A;  2P4W A;  4MQ9 F;  2NYX A;  1HSJ A;  3FM5 A;  2ESH A;  2IA0 A;  2IRF G;  1ODD A;  4G6D A;  3LQQ A;  5FB2 A;  5AON A;  5CVV A;  1SAX A;  1BI0 A;  2H09 A;  3GZ6 A;  3CUO A;  3CO7 C;  2L4M A;  2ETH A;  4Y17 A;  4YIF A;  2IJL A;  2Y0M A;  2JPB A;  1T98 A;  2ELH A;  3DF8 A;  2ZKZ A;  4WXH A;  4Z2Y A;  4EVI A;  1P92 A;  1IXC A;  3FWE A;  4A6D A;  1SMT A;  3JW4 A;  3B73 A;  5KK1 A;  1KU2 A;  5LEK A;  4ESF A;  1TNS A;  2W84 A;  5HVQ C;  4HX8 A;  4HF2 A;  3E97 A;  4R1H A;  2XKO A;  4ASN A;  1B59 A;  2LNB A;  2MLK A;  1O3S A;  3LA3 A;  4A0Z A;  3R6S A;  5E1X A;  4HLX A;  4IRG A;  2DLL A;  1TQP A;  3C18 A;  3K1M A;  5FLX Z;  5H20 A;  5CVR A;  1F1Z A;  3WTX C;  2V1U A;  1GXP A;  1L0O C;  5ICF A;  4MGR A;  4ZYG A;  1LB2 A;  5FFX A;  3IKV A;  2ISZ A;  5ICC A;  1I1S A;  4LB6 B;  3HSF A;  3V7C A;  1RI7 A;  1Z7U A;  1SD7 A;  2GXB A;  2DU9 A;  1Z1D A;  4MEY F;  2NRA C;  4I7H A;  1I27 A;  3LA2 A;  1IUY A;  4ENN A;  4M6Y A;  2V1X A;  2O03 A;  5HDG A;  3IL2 A;  4B8X A;  2FEZ A;  2FF4 A;  5HDK A;  3WGG A;  1LJ9 A;  4RB0 A;  4RGR A;  2YPR A;  3KEO A;  3Q9V A;  3WGI A;  3P9C A;  2FU4 A;  4L9T A;  1MGT A;  3HHG A;  5K5O A;  4G7Z F;  2F5E A;  4XLP F;  2NAZ A;  2HKX A;  3RKX A;  3RYP A;  3LAJ A;  3VEP A;  3COA C;  1LDD A;  3CTA A;  4CIC A;  2QQA A;  1FWZ A;  2L4A A;  1IN7 A;  3IHU A;  1GXQ A;  1I6X A;  1G6N A;  1G4D A;  2M30 A;  5ERI A;  5E8G A;  2CQK A;  5AIP A;  4ENM A;  3F6O A;  4CYD A;  3MZH A;  4EM1 A;  2XAH A;  4HLY A;  3GFM A;  4FHT A;  3I59 B;  1P4W A;  4F7Z A;  1LDJ A;  3ZMD A;  2HDC A;  2A6E F;  2IPQ X;  3FXQ A;  2STW A;  1Q1H A;  3J80 K;  3T8R A;  2MC3 A;  1K79 A;  1DPR A;  1G3T A;  4EJW A;  1NHA A;  5D4R A;  3H3Z A;  1YO5 C;  2QYO A;  1FYK A;  1MZB A;  2KIU A;  2OQR A;  3U9G A;  2A3S A;  5DCM B;  4HV6 A;  2VBX A;  3RI4 A;  3HYI A;  4N0B A;  5E20 A;  2E7W A;  2EA2 A;  3PQK A;  1OKR A;  2CGP A;  1RZ4 A;  3F6V A;  1TTY A;  1HBX G;  1MD0 A;  5HS9 A;  3F8F A;  1XSD A;  4P96 A;  1HXD A;  4IHT A;  3GWZ A;  5JFR A;  5LBQ A;  3HOT A;  1ZRF A;  3LFK A;  2CFX A;  1Z9C A;  1T38 A;  3TGN A;  4A2U A;  1S8N A;  2ZXJ A;  2MLG A;  2V6C A;  1IN6 A;  4U88 A;  3R4K A;  3OOP A;  1FY7 A;  2FE3 A;  2RQP A;  1P4A A;  2Z99 A;  2UXX A;  1QZY A;  2PMU A;  1OYY A;  4HV5 A;  4YFX F;  2D1V A;  4A12 A;  3E5X A;  2QM3 A;  4AIH A;  2M5W A;  5JHU A;  4JBA A;  3GXO A;  1MKM A;  4R8H A;  2LF8 A;  3NRV A;  3TKY A;  3K2Z A;  1IN5 A;  3K69 A;  2A69 F;  2Z5U A;  5D5V B;  4ZYD A;  3WE2 A;  3BZ6 A;  2IT0 A;  3GUD A;  3KP7 A;  1B9N A;  1FC3 A;  2HZT A;  3TO6 A;  1QGP A;  2COM A;  3CDH A;  3K0L A;  2L54 A;  2V9V A;  3V8K A;  4OIP F;  2FQ3 A;  2HTJ A;  3WTU C;  2PLY A;  3I5U A;  2P7C B;  4PZJ A;  1W7P B;  4WK8 F;  4G7O F;  1U78 A;  2EV5 A;  2KRF A;  2BYV E;  2P8T A;  4L0Z B;  3FMS A;  1EH8 A;  3HRS A;  4HDV A;  1USS A;  2VOD A;  4IVN A;  3E6B A;  3T0Y A;  4BHB A;  4UVB A;  2L02 A;  3TO9 A;  1TBX A;  4A6E A;  3C7J A;  5L3F A;  3BJO A;  3RIR A;  4L9V A;  1J7K A;  2RNJ A;  3R60 A;  2BGC A;  2FBK A;  3KP2 A;  4NHJ A;  4XBF A;  4EGZ A;  1RUO A;  1BI2 A;  3HSR A;  3L00 A;  4L5I A;  3BY6 A;  4P5O A;  2Q2E A;  3L09 A;  4G8X A;  1AOY A;  2ZBK A;  4NQW A;  4KT5 C;  3JTG A;  1IZ1 A;  3E5Q A;  1WRJ A;  4LB5 A;  3KLO A;  2WC2 A;  2W57 A;  4IPA A;  5H6R A;  2XAS A;  3HUG A;  2O0Y A;  2XGX A;  4RB1 A;  1H0M A;  2XV4 S;  4HYE A;  4L9N A;  1X3U A;  3GFI A;  1LEA A;  2QWW A;  5ILS A;  2VT3 A;  4PDK A;  2ZNY A;  5DV5 A;  3TOA A;  1EH7 A;  1ON1 A;  3TDZ C;  4FT8 A;  2W24 A;  1G3Y A;  1IXR C;  3V8J A;  1I5Z A;  3ZN0 A;  3J81 Z;  2EV0 A;  2D45 A;  5J6X A;  1ONV A;  5HS7 A;  1BIA A;  3EYI A;  3I0T A;  4YFN F;  2D1H A;  3M8F A;  3SHF A;  5EEG A;  3M1E A;  3J81 K;  2JZY A;  4G94 A;  3M8E A;  5AIQ A;  3QU6 A;  5D8L B;  4FX4 A;  2PG4 A;  3DXJ F;  3ZMS A;  2XUB A;  1IAW A;  4YII A;  5D8K B;  1ZN2 A;  2J5O A;  1PDN C;  1RUN A;  3SXY A;  4EMS A;  1B4A A;  1XSV A;  1KA8 A;  5DD8 A;  1FZP B;  5ILV A;  3GYH X;  4G7H F;  3P9I A;  4Q4Z F;  2GIV A;  4LD5 A;  3CO6 C;  1D5V A;  4Q5S F;  6PAX A;  1PP7 U;  4P55 A;  1GVJ A;  5E17 F;  3ZMZ A;  3LWF A;  1HW2 A;  1LEB A;  4KDP A;  4I2O A;  1YYV A;  2BBY A;  3DEU A;  4S05 A;  1WKM A;  1YFH A;  1YW8 A;  2O3F A;  3WTW C;  2BEO A;  2DI3 A;  2D2W A;  1H9G A;  3WTT C;  1B9M A;  1FSH A;  2DW4 A;  2K4J A;  4RGX A;  3T5X A;  2O8X A;  3RYR A;  2HFH A;  4RGS A;  3SQN A;  1YS7 A;  2VN2 A;  2F2E A;  3ZMT A;  2AXL A;  4LJZ F;  3BP8 A;  4KYW A;  4G9Y A;  1QBJ A;  1D8J A;  4CHU A;  1ZRD A;  3RKW A;  2FOK A;  2ZCW A;  2FXA A;  1J75 A;  3O3K A;  1JE8 A;  4MTD A;  2PEX A;  3WU1 B;  2O61 A;  2YX7 A;  2W85 A;  1O7L A;  3D0S A;  4ZZL A;  2H6B A;  3LST A;  3QU3 A;  1U3E M;  3TDU C;  1WWX A;  1WSU A;  4CDG A;  2FSW A;  4LLG F;  4EJT A;  1UFM A;  1W7P D;  3MZY A;  1DUX C;  4BYY A;  1P4X A;  3GFL A;  4BH9 A;  1R7J A;  2EA4 A;  1O3R A;  1BI1 A;  1QZZ A;  3QP5 A;  3GX4 X;  3BPV A;  3JTH A;  4O3M A;  3RTR A;  4QWQ A;  3PQJ A;  2HS5 A;  4U7B A;  2GAU A;  5LEJ A;  5LRR A;  5TJJ A;  1REP C;  4LFU A;  4XSZ F;  3K1N A;  5DCM A;  4A0X A;  1BC7 C;  5A2Q Z;  3BWG A;  1R58 A;  2M87 A;  1YIO A;  3R0A A;  1MJB A;  2EWN A;  4AIK A;  1JHF A;  4KIB A;  2ZNZ A;  3W6J B;  1R36 A;  3L9F A;  3LQR A;  4RB3 C;  2XHK A;  2ZME A;  1XGM A;  4AVP A;  1FLI A;  2E1C A;  1HST A;  4P9U A;  4L5J A;  2LSO A;  3QP6 A;  3N97 A;  1BI3 A;  3BJ6 A;  3KEQ A;  3I53 A;  1OYI A;  3IWF A;  3BOQ A;  3FXU A;  4WX9 A;  4WF2 A;  4A0Y A;  1KQ9 A;  2UZK A;  1LVA A;  3F8M A;  4PGG A;  3ULQ B;  3I4P A;  4NB5 A;  3RPU A;  1S29 A;  1OPC A;  3FM3 A;  4HF1 A;  4ENJ A;  2A68 F;  2K27 A;  1Z6T A;  3V8L A;  1J59 A;  4FX0 A;  5EEH A;  2ZFW A;  5DUI A;  5J8C A;  3Q9S A;  4L9J A;  5BMZ A;  1ZHF A;  2LDU A;  2E1N A;  4EJV A;  1ZYR F;  3KLN A;  1EH6 A;  3NEU A;  4UV9 A;  1MDM A;  1P2F A;  3DKW A;  1ZRC A;  3O6B B;  2EFP A;  3K9T A;  1J0R A;  1S7O A;  5L3G A;  4ZYE A;  1QPM A;  2VOP A;  3F8B A;  3CLO A;  3IC7 A;  2QBY B;  1S6L A;  1BIB A;  2QUF A;  1W5T A;  4WXD A;  1ZLK A;  1TNT A;  2DT5 A;  3IRQ A;  1H9T A;  1KU7 A;  3V7R A;  4KIG A;  4IF4 A;  5CLS A;  1HKS A;  4I98 B;  2GQQ A;  1KU3 A;  2IW5 A;  3E6D A;  3IKT A;  3QRF F;  2DK8 A;  2CYY A;  1ZG3 A;  2CWE A;  2IP2 A;  2XKP A;  1BOA A;  2DQR A;  3IWZ A;  5BQT A;  4Q47 A;  3F23 A;  2FNP A;  1XGS A;  2QQB A;  2YSR A;  5FFZ A;  1Y0U A;  4P9F A;  3PFI A;  1CGP A;  2ZJ2 A;  2UWM A;  2WWY A;  1IN8 A;  5TRD A;  4BHC A;  1SFU A;  2GA1 A;  4MEX F;  4OMY A;  2V79 A;  4H0E A;  2OBP A;  3V4G A;  4HQM A;  2DO7 A;  2JTV A;  3J80 Z;  1IF1 A;  1YTY A;  1T6S A;  2XRO A;  2F5D A;  2PI0 A;  1PUE E;  5LRS A;  2KJB A;  1TQI A;  2PN6 A;  2Q0O A;  2GWR A;  1KYW A;  4M9Z A;  1ZRE A;  4Y15 A;  1JGS A;  4I0A A;  4IHS A;  2ISY A;  1TQM A;  1F5T A;  3KCC A;  1R22 A;  5FO5 A;  5CVU A;  2QEN A;  5LGN A;  2CG4 A;  3RPQ A;  1D8K A;  4HX4 A;  1XDU A;  4EQQ A;  2DTR A;  2R7F A;  2K7L A;  5ILU A;  1S3J A;  2DK5 A;  4QLC U;  1HW5 A;  4I0B A;  1YS6 A;  3ISP A;  5F1R A;  1LNW A;  1U6G A;  4D0P A;  3EET A;  5HLI A;  1Z6R A;  3H92 A;  2H6C A;  2A5Y B;  3ZPL A;  3LA7 A;  4PGH A;  5LHG A;  1DPU A;  3MEX A;  5LLQ A;  5H6Q A;  4KUM A;  5D4S A;  4OU0 A;  4ZYH A;  1ULY A;  4KMF A;  1UCR A;  3GW2 A;  3C1D A;  2XAG A;  1T2K A;  5D6E A;  1U5T B;  3LAP A;  2HTS A;  2P6T A;  1MDM B;  1OR7 A;  5D5X B;  4AWX B;  2JT1 A;  1F4K A;  4ZZD A;  2E7X A;  3JSO A;  2JPC A;  3O2P E;  4U0Y A;  2KKO A;  4N9H A;  1BBY A;  5CJ9 A;  1R1T A;  1CF7 A;  4BXU A;  1W4M A;  3EQL F;  2H27 A;  1SFE A;  1ZLJ A;  5HDN A;  3NQO A;  1ON2 A;  2OU2 A;  1ZGJ A;  3GO5 A;  2M8E A;  4XSX F;  1UST A;  3BRO A;  3HRT A;  1HW1 A;  1MJ9 A;  4LLL A;  5BPI A;  4I02 A;  2HOE A;  3I64 A;  2IVM A;  2K86 A;  2TDX A;  5E18 F;  4UNO A;  2RC4 A;  3KP6 A;  5K1Y A;  2GZW A;  4L0Y B;  1KQ8 A;  1U2W A;  3GVA A;  2HWV A;  5IT9 K;  3K1P A;  1U8R A;  4BHP A;  3ROU A;  2XAF A;  2Y48 A;  4HBL A;  1IW7 F;  4EJO A;  2P5K A;  3G73 A;  5J8F A;  3ZMU A;  5JVT A;  2P6S A;  1BJA A;  3WTY C;  1QNT A;  4KFC A;  4MNU A;  1UB9 A;  1T39 A;  2YR2 A;  2K4B A;  1J9I A;  4M9X A;  4ESJ A;  4RS8 A;  4HDU A;  1BM9 A;  3FX3 A;  4CO8 A;  4EV0 A;  5DDG A;  4PCQ A;  3HTS B;  1XSX A;  3KZY A;  3F8C A;  3KP3 A;  2KIM A;  3SZT A;  2OQG A;  3T1B A;  1KYZ A;  2FNA A;  2P5L C;  5IT3 A;  3VOD A;  3F72 A;  5E1Z B;  3V7S A;  1FBQ A;  4U7D A;  1OMI A;  2G7H A;  4UUV A;  3F21 A;  2HEO A;  3BJA A;  2Y75 A;  4R79 A;  2C6Y A;  5F64 A;  1A04 A;  2G9W A;  2DBB A;  1YW7 A;  2PMH A;  4UVA A;  4L18 B;  4Y13 A;  1XDS A;  2XVC A;  4JQF A;  4KA4 A;  5JI6 A;  4GCV A;  2OA4 A;  1ZG1 A;  2VOO A;  1K78 B;  2ESN A;  1FX7 A;  4LG0 B;  1XCV A;  1O57 A;  1SD6 A;  2MBF A;  3DFG A;  2ZME B;  3W6K B;  1W5S A;  2RGV A;  1V4R A;  4DNC A;  1QQI A;  2QLZ A;  4DQ2 A;  3HSE A;  4UHT A;  1C0W A;  1ZAO A;  3E5U A;  4YG2 F;  1R23 A;  2CO5 A;  3M7G A;  2UXN A;  4AD9 A;  4MQV A;  2VC1 A;  2YU3 A;  2M45 A;  2Z3Y A;  5E1W A;  5CVJ A;  5BOX A;  1XGN A;  1FNN A;  3L2C A;  4EGY A;  1XCB A;  2ZO4 A;  3QOP A;  3GLX A;  2XAJ A;  1JXS A;  3KET A;  1ZG5 A;  4M6X A;  1DP7 P;  1P6R A;  1FBU A;  4M71 A;  2KJC A;  2OZU A;  4M9S A;  2O6G E;  4HW0 A;  1E2X A;  2JRT A;  1IRF A;  1B6A A;  1DDN A;  2JSC A;  4OIO F;  1IRG A;  4RGU A;  5DYM A;  3CUQ A;  5D6F A;  4K2E A;  2LKP A;  2BE5 F;  2NNN A;  1I1G A;  4ON0 A;  1HKQ A;  3H3U A;  1T0F A;  2OD5 A;  1XD7 A;  4LG0 A;  3HIF A;  3F8N A;  2STT A;  3OV8 A;  2RVC A;  4LLN A;  2FBI A;  2IA2 A;  1ZAR A;  2F5F A;  5DEQ A;  2L3D A;  4HZF A;  3R61 A;  2FRH A;  3HTU A;  2MH2 A;  1LDK B;  2CSO A;  2HQN A;  2Q8K A;  2QBY A;  3VFZ A;  4GXO A;  5LHI A;  1SMY F;  3DP7 A;  2QZ8 A;  2MD5 A;  1GHC A;  4S04 A;  1O7F A;  1ZGA A;  4Q48 A;  3RDI A;  3TOB A;  3DPL C;  4ENK A;  3KZZ A;  1MJA A;  1O3Q A;  4M74 A;  4YFK F;  3CUQ B;  1HQC A;  2A07 F;  1BC8 C;  1J2X A;  1UHW A;  4WWC A;  5BS6 A;  1U5T A;  3MCZ A;  5A2Q K;  4HQE A;  3BDD A;  1TW2 A;  4E70 A;  4KNY A;  3EUH A;  2QVO A;  3P9K A;  4M73 A;  5L3B A;  3GF2 A;  4UVC A;  1FBS A;  5D5U B;  5L3C A;  3JAM Z;  3MAJ A;  2NNY A;  3DV8 A;  1KU9 A;  1FP1 D;  3WOD F;  3DQV C;  3ELK A;  2DQL A;  5L3D A;  4KN4 X;  2ADU A;  1XN7 A;  4A5N A;  4WCG A;  1RIO H;  1J5Y A;  3JAM K;  5ICE A;  1D3Y A;  4XRF A;  2G7U A;  4KIC A;  2EFQ A;  3MWM A;  3WTZ A;  1STZ A;  4IXA A;  1OYW A;  5L3E A;  2XRN A;  2FA5 A;  3ECH A;  4UV8 A;  2VT2 A;  3FF5 A;  3DPT A;  1R00 A;  3GEZ A;  2PQ8 A;  2M1B A;  3WG9 A;  4EJU A;  1Z05 A;  3QPH A;  1K7A A;  4N9I A;  1K6O A;  1W7P A;  2GA2 A;  3M9A A;  5HS8 A;  4KN7 X;  1UHM A;  2VXZ A;  3N4M A;  3JSP A;  3VOE A;  1R1U A;  5DUK A;  4HAM A;  5HLG A;  3E6C C;  2AS5 F;  1G3W A;  2X0L A;  2WV0 A;  2EFW A;  2W25 A;  2VBW A;  1G3S A;  3ML6 A;  3ZN1 A;  1SFX A;  1S7A A;  2FMY A;  1Z91 A;  4ESB A;  4OIQ F;  3U2R A;  3HOS A;  4O6J A;  2R7D A;  3SZP A;  2MA3 A;  3VB2 A;  3FXR A;  2HYG D;  3ZP5 A;  4B09 A;  2EFN A;  1R5H A;  1L3L A;  5JR3 A;  4GYI A;  2B0L A;  1KGS A;  2PJP A;  2HR3 A;  2EB7 A;  2DPU A;  3ZQ7 A;  4IJA A;  1KQ0 A;  2VBY A;  5K5R A;  4I01 A;  4OMZ A;  1TW3 A;  4ZH4 F;  1WQ2 A;  2EJR A;  5E8I A;  5F6F A;  2HQR A;  1FSE A;  3MFK A;  1U5T C;  5D5W B;  3CJN A;  2XIG A;  1FT9 A;  2X4H A;  3RKY A;  3ABU A;  1WI9 A;  3I58 A;  3HRM A;  4BAY A;  2L01 A;  3KE2 A;  1FYM A;  3P7N A;  3L7W A;  1BN5 A;  5FD5 A;  5KVR A;  2K02 A;  5LGT A;  5CVI A;  4LGW A;  1EV7 A;  4RAY A;  3T8T A;  3QAH A;  1V3F A;  1IN4 A;  2J5P A;  2DAO A;  3GZ5 A;  5FD6 A;  3E3V A;  1FPQ A;  1YG2 A;  1F9N A;  2PBI A;  3S2W A;  2OZ6 A;  2WTE A;  5ED4 A;  1LQ1 A;  2P5V A;  3HHH A;  4WXC A;  4MTE A;  1VTN C;  3HRU A;  5DCF A;  3D5L A;  3J7A O;  3I59 A;  4HA8 A;  2BV6 A;  5FGM A;  4OOI A;  4ETS A;  3CUQ C;  3FMQ A;  1AWC A;  3REO A;  4LMY A;  2GXG A;  2NS0 A;  1ZH5 A;  2HGC A;  5HLH A;  5HOO A;  3EYY A;  4U0V A;  5BPD A;  5FLX K;  1YQA A;  4EM2 A;  5LGU A;  4CGZ A;  1XGO A;  2DFI A;  1IXS B;  4MHG A;  3AAF A;  4RAZ A;  2RDP A;  2EK5 A;  2VE9 A;  1E17 A;  2Z33 A;  2F5C A;  3TO7 A;  1XMA A;  2IA1 A;  1HKT A;  4G6Q A;  4LK0 F;  4OIN F;  1K78 A;  2EFO A;  3KP4 A;  4U0W A;  1QO0 D;  2V1D A;  3RJP A;  3WE3 A;  4GO1 A;  3FZV A;  2OAZ A;  4XLN F;  3U1D A;  3BPX A;  2CW0 F;  2YX4 A;  3KP5 A;  4GYG A;  3Q5F A;  4TV7 A;  4AIJ A;  1SD5 A;  4OIR F;  1CF7 B;  1XB4 A;  4EM0 B;  3EDP A;  3GFJ A;  3ZMV A;  2RKH A;  4KIF A;  5IT9 Z;  4GGG A;  4I09 A;  3G3Z A;  1JHH A;  2VE8 A;  4HOB A;  2XAQ A;  4KMU X;  3WTS C;  1B1B A;  3E6M A;  3FHZ A;  3F22 A;  2VBZ A;  3I54 A;  3QPT A;  4UXN A;  3IRR A;  1SD4 A;  2LF7 A;  4HF0 A;  2RV8 A;  2QQ9 A;  3KFW X;  3I71 A;  4BQA A;  1RNL A;  3R0J A;  4LK1 F;  3WGH A;  2EV6 A;  2VC0 A;  2KIF A;  3ABT A;  3C3W A;  1R1V A;  4CZZ A;  3SFZ A;  3TQN A;  1FP2 A;  4JK1 X;  3WTV C;  2DPD A;  2FML A;  2H94 A;  2FBH A;  4M72 A;  3B02 A;  2VON A;  5DD4 A;  2ACJ A;  2P7V B;  2MH9 A;  2RN7 A;  2A61 A;  4BNC A;  1O3T A;  1YW9 A;  2A6H F;  1YLF A;  4IRI A;  3WU0 A;  4IRH A;  1FYL A;  5ICG A;  1XMK A;  2HKO A;  4RB2 C; 
#chains in the Genus database with same CATH topology
 3ECO A;  4FIS A;  2F6C A;  4MLO A;  3OY9 A;  5K5Q A;  2NVY J;  4HX7 A;  3HOY J;  1D1C A;  2QKL B;  1FTT A;  3ERE D;  4F91 B;  3RQ4 A;  3OOU A;  1HLV A;  1X1D A;  5CYV A;  1P7I A;  3KYL A;  2IS6 A;  3GTL J;  5LHH A;  2R3S A;  2Z9O A;  4O5V A;  3MQ0 A;  2LY1 A;  2HYF A;  3JR9 A;  1PP8 F;  1HC8 A;  1W1W E;  3F3X A;  1R5G A;  1TLH B;  3FMR A;  3HL2 A;  1ETW A;  3OYE A;  1FOK A;  2PFB A;  4A5M A;  4A3M J;  4CXF A;  2LBF B;  2P4W A;  4Z6Y A;  4MQ9 F;  2NYX A;  1HSJ A;  3FM5 A;  5GTH C;  5BOX A;  2ESH A;  4LIT A;  3GME A;  5B66 C;  2IA0 A;  1WJC A;  3FBI B;  2IRF G;  5IPA A;  1ODD A;  4G6D A;  3LQQ A;  4D7M A;  5FB2 A;  5AON A;  5CVV A;  2BY3 A;  1SAX A;  1BI0 A;  1OR7 C;  2H09 A;  4OAZ A;  3GZ6 A;  4RBO A;  3CF5 F;  3CUO A;  3CO7 C;  2L4M A;  2ETH A;  3E1S A;  2PMZ N;  4Y17 A;  3BZK A;  3I9V 2;  4YIF A;  2IJL A;  5HNH A;  2Y0M A;  1Y8Q B;  2JPB A;  1T98 A;  4BY7 J;  2KDZ A;  5C44 J;  1NG7 A;  1RES A;  4ZDO A;  2ELH A;  3DF8 A;  2ZKZ A;  4WXH A;  4Z2Y A;  2Y2Z A;  4AC0 A;  2HVS A;  3OYI A;  2MFZ A;  4KT6 A;  4X0G A;  2V9P A;  2OCC H;  3OYF A;  4EVI A;  1P92 A;  1IXC A;  1RKW A;  3FWE A;  1W36 D;  4A6D A;  3CDL A;  1AHD P;  1A5J A;  1SMT A;  3L1P A;  1M1E B;  1MW7 A;  2ZJP F;  3JW4 A;  3B73 A;  5KK1 A;  1KU2 A;  5LEK A;  4ESF A;  3A2K A;  2CUE A;  1TNS A;  3S1M J;  5E3L A;  1JKP C;  2W84 A;  3A0H C;  4CCM A;  5EGO B;  5HVQ C;  4HX8 A;  4HF2 A;  3E97 A;  4R1H A;  1FTZ A;  2XKO A;  4ASN A;  1HCR A;  1OCT C;  1B59 A;  2HVQ A;  2LNB A;  2MLK A;  4A3I J;  1MBF A;  1O3S A;  3LA3 A;  2LG4 A;  1MIJ A;  2TCT A;  4ZC3 A;  3X2Q H;  4W97 A;  4A0Z A;  1A6I A;  4RM3 A;  3R6S A;  5E1X A;  2WV1 A;  1GT0 C;  4HLX A;  4IRG A;  3CF2 A;  2DLL A;  1TQP A;  3C18 A;  3K1M A;  3S3O A;  5FLX Z;  1VQK I;  3JRB A;  2EIL H;  1LKX A;  4LIU A;  5H20 A;  5CVR A;  1F1Z A;  2IGN A;  3WTX C;  2E1M B;  3OIQ A;  2V1U A;  5EYR A;  1GXP A;  1L0O C;  5E79 C;  3OYC A;  3O8H A;  4KJZ A;  3PNV A;  5F0F A;  1T95 A;  5ICF A;  1ZK8 A;  1Z3X A;  2BVL A;  4MGR A;  2W4S A;  4ZYG A;  3ABL H;  1Z67 A;  2L5Q A;  3BCB A;  2I10 A;  3VWB A;  1LB2 A;  1WH5 A;  3K2A A;  5FRM A;  5FFX A;  2CMP A;  3H35 A;  5JHF A;  3IKV A;  3FXO A;  2ISZ A;  5ICC A;  1X2N A;  2NVX J;  1I1S A;  2QSF X;  1MBE A;  2MAB A;  2XB5 A;  3TL4 X;  4LB6 B;  3UKG A;  3HSF A;  3IAS 2;  5M5X J;  3V7C A;  1Z21 A;  3SEQ A;  1G8X A;  4C2U A;  1MMS A;  3G71 I;  1RI7 A;  4UB6 C;  3MD2 A;  3CCL I;  1Z7U A;  5CKT A;  1SD7 A;  2MGQ A;  3BR3 A;  2GXB A;  1TL8 A;  2DU9 A;  1MMG A;  1Z1D A;  4MEY F;  2NRA C;  4I7H A;  3H3V K;  2VQH A;  1I27 A;  1GLN A;  3LA2 A;  4ANJ A;  1IUY A;  1FMV A;  4ENN A;  4BXX J;  1BA5 A;  4M6Y A;  4B3X A;  1EJ9 A;  2V1X A;  1I50 J;  2O03 A;  5HDG A;  2QA4 I;  3IL2 A;  3N05 A;  2DYR H;  4B8X A;  1TWC J;  5FKM A;  2FEZ A;  2FF4 A;  5HDK A;  1Y56 A;  2DYS H;  2EZK A;  1W0U A;  2NVQ J;  2VQC A;  2M0M A;  1APL C;  3WGG A;  1LJ9 A;  3HC7 A;  4RB0 A;  3S93 A;  4RGR A;  2YPR A;  3S16 J;  3KEO A;  3Q9V A;  4PJM A;  3P9C A;  2X1D A;  3WGI A;  2FU4 A;  4L9T A;  1MGT A;  2DDB A;  3FKI J;  3HHG A;  5K5O A;  1X1B A;  4G7Z F;  4G6T B;  2ZB9 A;  1JKQ C;  2F5E A;  5EJC A;  3K4N A;  2FUG 2;  1IDZ A;  2MW8 A;  3ZQI A;  4XLP F;  3H0D A;  5GTI C;  2NAZ A;  2HKX A;  3RKX A;  1B8I B;  1OCZ H;  2XRL A;  3RYP A;  3QYE A;  2PJR A;  3LAJ A;  3VEP A;  5JVG F;  3COA C;  1LDD A;  3CTA A;  2W7N A;  4JX6 A;  2MYS A;  1B72 A;  1W5C C;  4CIC A;  2QQA A;  1FWZ A;  2RNG A;  1WI3 A;  1WJD A;  2L4A A;  1IN7 A;  3IHU A;  1GXQ A;  1I6X A;  1G6N A;  1G4D A;  2M30 A;  5ERI A;  1X2M A;  3HPH A;  5E8G A;  5EZG A;  2CQK A;  3A02 A;  4IX7 A;  5AIP A;  5IYD J;  1MMA A;  2ECB A;  4ENM A;  3F6O A;  2ZSI B;  5GP9 A;  4CYD A;  3MZH A;  1VQP I;  4EM1 A;  2XAH A;  4XOT A;  2B9S A;  3BR1 A;  1K6Y A;  4HLY A;  4DZJ A;  3GFM A;  3S3N A;  4FHT A;  2P0W A;  3I59 B;  1P4W A;  4X1E A;  1LDJ A;  4F7Z A;  3ASN H;  3ZMD A;  2IXS A;  2HDC A;  2A6E F;  2IPQ X;  3FXQ A;  3PIP F;  2STW A;  1Q1H A;  3J80 K;  3T8R A;  3GTM J;  1MH3 A;  3OL4 A;  2IEK A;  2MC3 A;  2LRE A;  1K79 A;  2IS2 A;  5GAE J;  2N8G A;  1DPR A;  3K70 C;  2CUJ A;  1G3T A;  4EJW A;  1NHA A;  5D4R A;  4ZDL A;  1B8I A;  3PUF A;  2GOM A;  3H3Z A;  1YO5 C;  5DS9 A;  2V26 A;  2QYO A;  4F93 B;  1FYK A;  2HPM A;  1MZB A;  2DA6 A;  2KIU A;  1S9H A;  1X1C A;  1D1B A;  2A3S A;  2OQR A;  3BR2 A;  3U9G A;  3UNG C;  2JN6 A;  5DCM B;  5CQG A;  4HV6 A;  2VBX A;  3RI4 A;  2OTJ I;  1D0Y A;  4C3J J;  3HYI A;  2ECC A;  3LSJ A;  4N0B A;  4XM3 A;  2NOG A;  4HG2 A;  2E7W A;  5E20 A;  3QWL A;  2EA2 A;  1FJL A;  1PJR A;  3PQK A;  3JRG A;  1OKR A;  2CGP A;  1RZ4 A;  5EZH A;  3CCE I;  3F6V A;  2OPT A;  1TTY A;  1HBX G;  4XN0 A;  1MD0 A;  3VPR A;  2KFD A;  2VPR A;  5HS9 A;  3HJE A;  4E7K A;  3HDD A;  2H1L A;  3F8F A;  1XSD A;  2LKS A;  4P96 A;  1HXD A;  4IHT A;  2W48 A;  3GWZ A;  5JFR A;  5LBQ A;  3BR6 A;  3HOT A;  1ZRF A;  3LFK A;  2RAE A;  1Y39 A;  5F04 A;  2CFX A;  1Z9C A;  1ENH A;  2A5W A;  1YJN I;  2Y31 A;  3ASO H;  1T38 A;  2L7M P;  3TGN A;  4A2U A;  1S8N A;  2Y0S A;  2ZXJ A;  3KZI C;  3D1N I;  2OCE A;  2MLG A;  3BTJ A;  2X6X A;  2V6C A;  4RA2 A;  1IN6 A;  4U88 A;  4P1W A;  3BG3 A;  3R4K A;  3J7A Y;  3C2G A;  3OOP A;  4IZZ A;  2HI3 A;  1FY7 A;  2FE3 A;  2RQP A;  1MND A;  1P4A A;  2LVS A;  3CQZ J;  2Z99 A;  2UXX A;  1QZY A;  2PMU A;  1OYY A;  4HV5 A;  3I55 I;  4YFX F;  2D1V A;  4A12 A;  3E5X A;  3OIO A;  2E5Z A;  2QM3 A;  4AIH A;  2M5W A;  1IC8 A;  5JHU A;  1SVO A;  3HOV J;  4JBA A;  2LYC A;  3GXO A;  1U9O A;  1MKM A;  4R8H A;  2LF8 A;  3SFI A;  3NRV A;  1I39 A;  4BDZ A;  3TKY A;  5E3O A;  3K2Z A;  3PNT A;  4Y52 J;  2CUF A;  2NVU B;  3DTE A;  4FQG A;  1IN5 A;  3ZOB A;  3K69 A;  2A69 F;  5IP7 J;  2Z5U A;  4XID A;  5D5V B;  4ZYD A;  4UB8 C;  3WE2 A;  3BZ6 A;  2IT0 A;  3GUD A;  3KP7 A;  1B9N A;  2RRE A;  1U8B A;  1FC3 A;  3QOE A;  2HZT A;  4HNT A;  3DU5 A;  1FOY A;  1H8A C;  3TO6 A;  1MNM C;  2LC2 A;  1QGP A;  3A01 A;  2COM A;  3CDH A;  3K0L A;  2L54 A;  1RC9 A;  2V9V A;  4BY1 J;  3CMY A;  2Z2S B;  3V8K A;  3BTL A;  4OIP F;  2FQ3 A;  2HTJ A;  2JA6 J;  1WFX A;  3WTU C;  3MKL A;  2PJR B;  3U21 A;  5F0C A;  3CCJ I;  2PLY A;  1GUU A;  3C2B A;  3O8G A;  3I5U A;  2K9N A;  4E7I A;  5F27 A;  4B47 A;  5EG0 A;  2P7C B;  4PZJ A;  1IV8 A;  1W7P B;  4WK8 F;  3DLL F;  4G7O F;  2CJJ A;  1U78 A;  2EV5 A;  2KRF A;  2ZJQ F;  2BYV E;  2P8T A;  4L0Z B;  3B6A A;  1F36 A;  2JVH A;  1AU7 A;  3GTQ J;  3FMS A;  1EH8 A;  3HRS A;  2ME0 A;  1FOW A;  4HDV A;  1USS A;  2VOD A;  3L2U A;  4IVN A;  3OWT A;  3E6B A;  3T0Y A;  4BHB A;  1UAA A;  4UVB A;  2L02 A;  2V9K A;  3TO9 A;  1NH3 A;  1TBX A;  3IH2 A;  4A6E A;  1SFO J;  5F1J A;  2BXZ A;  1MSF C;  1WGX A;  3C7J A;  5L3F A;  3BJO A;  3H5A A;  3VYT B;  4BUP A;  4W1U A;  3RIR A;  4BEH B;  1SFK A;  4L9V A;  3ZCO A;  2RQQ A;  1J7K A;  2W82 A;  5GAD J;  4F55 A;  2RNJ A;  2DJI A;  3R60 A;  2PMZ A;  2KIS A;  2BGC A;  2FBK A;  3CJQ B;  3PNY A;  4RLF A;  4XLC A;  3ONQ A;  3KP2 A;  4NHJ A;  5FKN A;  4XBF A;  2KQR A;  3CP2 A;  4EGZ A;  1RUO A;  1X58 A;  1V5G A;  2DMU A;  2R5Z A;  1BI2 A;  2HU9 A;  2KZG A;  3HSR A;  3L00 A;  4L5I A;  3BY6 A;  4P5O A;  1WZ2 A;  2Q2E A;  3S17 J;  1I3Q J;  2XSD C;  3L09 A;  4G8X A;  1AOY A;  2W00 A;  2ZBK A;  3ZQF A;  1ETV A;  3GBG A;  3DPU A;  2HZD A;  4KT5 C;  4NQW A;  3JTG A;  4A3J J;  4IOA F;  1IZ1 A;  5FKO A;  1VFC A;  3E5Q A;  3NWT A;  3AG4 H;  2VPL A;  1WRJ A;  4LB5 A;  3KLO A;  9ANT A;  4FET A;  1IRZ A;  2DDA A;  2WC2 A;  2W57 A;  4BBS J;  1X3W B;  4IPA A;  5H6R A;  2XAS A;  3H1C A;  5KHD A;  1BR4 A;  2NXN B;  3HUG A;  2O0Y A;  2XGX A;  5K7H A;  4RB1 A;  1H0M A;  3CC7 I;  2L7Z A;  2XV4 S;  3DKX A;  4HYE A;  3K4C A;  4L9N A;  1X3U A;  3GFI A;  1LEA A;  2QWW A;  2R7R A;  1A36 A;  1YRN A;  5ILS A;  2VT3 A;  1ZR2 A;  3S2H J;  4AYB N;  2FD5 A;  2WAQ N;  4PDK A;  2AQF A;  3C2H A;  2ZNY A;  2K85 A;  5DV5 A;  5EDN A;  3TOA A;  3CCY A;  1EH7 A;  1ON1 A;  3JRI A;  3TDZ C;  4FT8 A;  1HF0 A;  2W24 A;  1WCM J;  1G3Y A;  1IXR C;  2YU9 J;  3V8J A;  1I5Z A;  2HDD A;  1DGW Y;  3M1C A;  3ZN0 A;  1TZL A;  3J81 Z;  3HOX J;  2EV0 A;  2D45 A;  5J6X A;  3S2D J;  2CQX A;  2M8G X;  1ONV A;  1QZE A;  4CCO A;  4J01 A;  5HS7 A;  3CMA I;  1BIA A;  2QCO A;  2Z1D A;  3EYI A;  3I0T A;  2LY9 A;  3K4B A;  4YFN F;  2D1H A;  4DOZ A;  2OC6 A;  3M8F A;  3SHF A;  4XLA A;  4G12 A;  5EEG A;  3OYH A;  3M1E A;  3S8P A;  3J81 K;  2XB0 X;  3PL8 A;  1ERD A;  4ZTJ A;  2DFH A;  2JZY A;  2V7F A;  3M8E A;  4G94 A;  5AIQ A;  3DEE A;  3QU6 A;  1S72 I;  1TP4 A;  5D8L B;  3FBN B;  2L7K A;  4FX4 A;  2PG4 A;  1XG1 A;  3U1K A;  3DXJ F;  5KCM A;  2XUB A;  3ZMS A;  4A3E J;  1P7J A;  2BW3 B;  1IAW A;  1BL0 A;  2X51 A;  1Z3Y A;  3LSI A;  4YII A;  5FJ8 J;  3K10 A;  3I3L A;  1YIJ I;  5D8K B;  3QYF A;  4BJ5 C;  1ZN2 A;  3W2A A;  2J5O A;  1PDN C;  1RUN A;  3M07 A;  3SXY A;  4EMS A;  1B4A A;  3Q0V A;  1XSV A;  3MZ8 A;  3Q0U A;  1KA8 A;  5DD8 A;  1FZP B;  5ILV A;  3GYH X;  4G7H F;  3P9I A;  2DOF A;  4Q4Z F;  2GIV A;  2HOA A;  4LD5 A;  4AID A;  4C2T A;  3CJT B;  1YIT I;  3CO6 C;  1D5V A;  4Q5S F;  1IO2 A;  4D9J A;  1MMD A;  1K61 A;  6PAX A;  1PP7 U;  4P55 A;  4HSR A;  2ID6 A;  1GVJ A;  1RRJ A;  1YJW I;  5E17 F;  2VL8 A;  3G4S I;  2GM4 A;  3ZMZ A;  3LWF A;  1HW2 A;  1LEB A;  4F3Q A;  4XL9 A;  4KDP A;  4I2O A;  2JA2 A;  4PFO A;  1YYV A;  1GV2 A;  2BBY A;  3HXL A;  3DCF A;  2ZXW H;  1AA7 A;  4YRV A;  3B6C A;  3DEU A;  4S05 A;  3S1N J;  1WKM A;  5K7F A;  4GDF A;  5KAI C;  5E3N A;  1YFH A;  2DXI A;  3FKJ A;  2HOT A;  1YW8 A;  2O3F A;  2X9D A;  2JMW A;  3WTW C;  2BEO A;  2R7O A;  2DI3 A;  2F4I A;  1WH7 A;  5FKK A;  2LR8 A;  2D2W A;  3BC8 A;  4A69 C;  1H9G A;  1AKH A;  3WTT C;  1B9M A;  4RAF A;  3GTK J;  1SAN A;  2DW4 A;  2K4J A;  2X85 A;  4RGX A;  5EEA A;  5GAH J;  3CCU I;  1FSH A;  2EIJ H;  3T5X A;  1YX3 A;  1EKE A;  2K3P A;  2O8X A;  3RYR A;  2HFH A;  4RGS A;  3SQN A;  3ZQQ A;  5EG0 B;  1YS7 A;  5LFA A;  2WAQ A;  5DM6 F;  3QPS A;  2VN2 A;  4BAC A;  2F2E A;  3ZMT A;  3GLL A;  2AXL A;  4LJZ F;  4FE7 A;  2WBM A;  2QSH X;  1ORK A;  2ME6 A;  4XN3 A;  3BP8 A;  1Z77 A;  1HDD C;  4E7L A;  2Q2E B;  3SYT A;  3JRC A;  3SDB A;  4KYW A;  1DU6 A;  4G9Y A;  4DIQ A;  1QBJ A;  3PIO F;  2XSJ C;  2HXI A;  1D8J A;  3BR0 A;  4CHU A;  1ZRD A;  2KZV A;  3VDX A;  2W1O A;  4CH7 A;  5H2F C;  4N4O B;  3RKW A;  2FOK A;  3OS1 A;  3BTI A;  2ZCW A;  1LE8 B;  2GIZ A;  3G1M A;  3OR2 C;  2FXA A;  1J75 A;  3O3K A;  1JE8 A;  4MTD A;  4PJ0 C;  3KIO A;  2VQL A;  1R71 A;  4DBQ A;  4B3A A;  2PEX A;  4QPO A;  3WU1 B;  2HOS A;  5DM7 F;  2O61 A;  2YX7 A;  2Y69 H;  1Z7L A;  3TW6 A;  2W85 A;  1O7L A;  1N77 A;  1X19 A;  3D0S A;  4ZZL A;  4C30 A;  2H6B A;  2VKD A;  3LST A;  3QU3 A;  3Q3S A;  5J4Y A;  2EPF A;  1U3E M;  3TDU C;  1WWX A;  2XC7 A;  1WSU A;  4CDG A;  2FOW A;  2FSW A;  4LLG F;  2E19 A;  2IBD A;  4EJT A;  1UFM A;  1W7P D;  3MZY A;  3OSG A;  1DUX C;  5B1B H;  4BYY A;  1P4X A;  1WJA A;  2LK2 A;  3GFL A;  2JSP A;  1G59 A;  4BH9 A;  3FHN A;  1R7J A;  2EA4 A;  1O3R A;  1BI1 A;  1QZZ A;  3QP5 A;  3GX4 X;  3BPV A;  3JTH A;  4O3M A;  1E0E A;  3RTR A;  3D5R C;  4QWQ A;  3PQJ A;  2HS5 A;  4BQO A;  4U7B A;  2GAU A;  3JCU C;  3KX2 A;  5LEJ A;  5LRR A;  5TJJ A;  2Y9Z A;  1REP C;  4LFU A;  1FIP A;  4XSZ F;  3K1N A;  5DCM A;  4A0X A;  1HA8 A;  1BC7 C;  5A2Q Z;  3BWG A;  3LSR A;  1H89 C;  2NVT J;  1R58 A;  2BZT A;  2M87 A;  1YIO A;  3CCM I;  3R0A A;  1MJB A;  2EWN A;  3CDI A;  4AIK A;  5IOZ A;  1JHF A;  2X1C A;  2F5V A;  4KIB A;  2ZNZ A;  3HKZ A;  2KHM A;  1Y0N A;  3W6J B;  3FK7 A;  1R36 A;  3L9F A;  3LQR A;  4HEA 2;  3SZG A;  4BQQ A;  4RB3 C;  4E7J A;  2XHK A;  2ZME A;  1XGM A;  4AVP A;  3S3M A;  1FLI A;  4HST A;  2E1C A;  1HST A;  1ZKG A;  4P9U A;  4L5J A;  2LSO A;  3QP6 A;  3N97 A;  1BI3 A;  3BJ6 A;  2ZME C;  3KEQ A;  3OIP A;  4II2 A;  3ZRG A;  3G1L A;  3I53 A;  1OYI A;  1QVU A;  2OUM A;  3BOQ A;  3FXU A;  3IWF A;  4WX9 A;  4WF2 A;  3OS0 A;  4A0Y A;  1KQ9 A;  2JUG A;  2UZK A;  2XGD A;  2GBY A;  3BCA A;  1VF9 A;  1A35 A;  1LVA A;  3LL7 A;  2O5R A;  1OIS A;  3F8M A;  4PGG A;  3ULQ B;  1FEX A;  3I4P A;  3W2W A;  3G2B A;  4NB5 A;  2XF6 A;  1LE8 A;  2IS4 A;  2LBF A;  3RPU A;  2FX0 A;  1S29 A;  4C3H J;  3H36 A;  3DTI A;  1OPC A;  3FM3 A;  4HF1 A;  2CFO A;  2HPI A;  4M3B A;  4ENJ A;  1HDP A;  1YX5 A;  2A68 F;  2K27 A;  4PFP A;  1Z6T A;  3K4M A;  1WJF A;  3V8L A;  3K7A J;  2DMT A;  5GPA A;  1J59 A;  4FX0 A;  3OSF A;  4X6A J;  4RAG A;  5EEH A;  2HXO A;  2ZFW A;  4IHW A;  5DUI A;  1UG0 A;  4A3F J;  3P5J A;  4XKV A;  2YS9 A;  3Q9S A;  5J8C A;  4L9J A;  3NAU A;  4XLF A;  5BMZ A;  1ZHF A;  3BG9 A;  4MO7 A;  3PSI A;  1RET A;  2LDU A;  2E1N A;  2CV0 A;  2ELJ A;  4M3F A;  4ABZ A;  4EJV A;  2FQ4 A;  1ZYR F;  2KDO A;  3KLN A;  3OYA A;  4C2M J;  1EH6 A;  3NEU A;  4UV9 A;  1X1P A;  1Y1V J;  1MDM A;  3DBH B;  4NNJ A;  1P2F A;  3H5N A;  3DKW A;  3GTP J;  1ZRC A;  3O6B B;  2EFP A;  3K9T A;  1J0R A;  4Y33 A;  1TWA J;  2CRG A;  3CJR B;  2CV2 A;  1S7O A;  4IL6 C;  5L3G A;  4ZYE A;  2LD5 A;  1R6R A;  1QPM A;  2LTP A;  1S7E A;  2AO9 A;  2VOP A;  4M3G A;  3DLA A;  1LVK A;  3F8B A;  4HNU A;  3BR5 A;  1IV6 A;  3CLO A;  3IC7 A;  5EGO A;  2QBY B;  5LD2 C;  1S6L A;  1BIB A;  2QUF A;  4A3G J;  1W5T A;  4ITV A;  2MD0 A;  4JOM A;  1ZEL A;  4WXD A;  3CCV I;  2CUZ A;  3LSP A;  1ZLK A;  2R7U A;  2X6O A;  1TNT A;  2EZI A;  3EUK L;  1XMX A;  2DT5 A;  3IRQ A;  1DP3 A;  2O7O A;  1H9T A;  1KU7 A;  3V7R A;  3CC4 I;  3PM1 A;  4KIG A;  4IF4 A;  4ZJZ A;  5CLS A;  1Y8R B;  2IGO A;  4XKW A;  3AL0 B;  3EUH C;  1HKS A;  4I98 B;  2GQQ A;  1KU3 A;  2IW5 A;  3E6D A;  3IKT A;  3MKW B;  2DFF A;  2MG4 A;  3BZC A;  2M0C A;  3A01 B;  3QRF F;  1ZTR A;  2DK8 A;  3KYD B;  2CYY A;  1BJZ A;  1ZG3 A;  2V1N A;  3VSL A;  2F48 A;  2CWE A;  2VB6 A;  2IP2 A;  2XPU A;  1DQU A;  3UR3 C;  3I56 I;  2H8R A;  4PJN A;  5J1Y A;  4A3K J;  5F0H A;  2XKP A;  2Y0S N;  1BOA A;  3BQY A;  1T8I A;  2E60 A;  2BW3 A;  4J00 A;  2M3A A;  2DQR A;  4MFD A;  3IWZ A;  4PK4 A;  5BQT A;  2K5C A;  3HZJ A;  2A05 A;  4Q47 A;  3F23 A;  4XQF A;  1MMN A;  4Y7N J;  2FNP A;  1K4S A;  1XGS A;  2QQB A;  1A6Q A;  2YSR A;  5FFZ A;  2R4G A;  2NS7 A;  1Y0U A;  1XS9 A;  1V55 H;  4DYQ A;  2NS8 A;  4P9F A;  3PFI A;  1CGP A;  2ZJ2 A;  2UWM A;  4A3C J;  3WHB A;  4BJ6 C;  2WWY A;  1IN8 A;  5TRD A;  2DA5 A;  1JGG A;  4BHC A;  3FIS A;  1ZQ3 P;  1SFU A;  4RDU A;  3MN2 A;  2GA1 A;  4MEX F;  4AYB A;  4OMY A;  2V79 A;  1D1A A;  4H0E A;  2OBP A;  3V4G A;  1FOX A;  3S15 J;  4HQM A;  2WB1 A;  2B63 J;  2DOD A;  2LRD A;  2DO7 A;  2JTV A;  3J80 Z;  1IF1 A;  1YTY A;  1T6S A;  2ZSH B;  2XRO A;  2F5D A;  2PI0 A;  2BY1 A;  2JQ7 A;  4XIC A;  1PUE E;  3CC2 I;  5LRS A;  3OYM A;  2KJB A;  2ZJR F;  4V2G A;  1TQI A;  2PN6 A;  3VYS B;  4CZC A;  2Q0O A;  4XLE A;  1UHS A;  2GWR A;  1KYW A;  4M9Z A;  1GDT A;  2X48 A;  1ZRE A;  1BR2 A;  4Y15 A;  1JGS A;  4I0A A;  2L9V A;  4IHS A;  1F43 A;  2ISY A;  3SEZ A;  4CA0 A;  1TQM A;  1F5T A;  3E0J B;  3I4M J;  3KCC A;  3VSK A;  1IJW C;  3LSK A;  2LY2 A;  1FIA A;  1R22 A;  5FO5 A;  1EA3 A;  3TED A;  4EEF G;  1NG6 A;  2QEN A;  5CVU A;  5LGN A;  2CG4 A;  3RPQ A;  1UEL B;  2DA1 A;  1V54 H;  1IDY A;  1D8K A;  2KRH A;  3H5R A;  2XGC A;  4HX4 A;  3RZD J;  1XDU A;  4EQQ A;  5JLW A;  2DTR A;  4CUG A;  2R7F A;  2K7L A;  3IV5 A;  5ILU A;  1S3J A;  2DK5 A;  4QLC U;  1I3A A;  3HUG B;  1HW5 A;  4KIT B;  2X6Y A;  2E2J J;  4I0B A;  1YS6 A;  5IYC J;  2EQR A;  1LPQ A;  3L2W A;  2BOL A;  4ZTF A;  4HPQ A;  3ISP A;  5F1R A;  4XRM A;  1LNW A;  1U6G A;  4D0P A;  2YUS A;  3EET A;  4I99 C;  3MMY B;  5HLI A;  5GPC A;  1Z6R A;  2E36 A;  4XRS A;  3H92 A;  2L9N A;  3S32 A;  5CQE A;  2CU7 A;  2A5Y B;  2H6C A;  3ZPL A;  2DJN A;  3LA7 A;  4PGH A;  5B5E C;  5LHG A;  1DPU A;  1LFP A;  3MEX A;  1ETO A;  5LLQ A;  1NTC A;  5H6Q A;  3TW7 A;  4BE1 A;  3DU6 A;  4KUM A;  5D4S A;  4OU0 A;  4ZYH A;  3K4J A;  1ULY A;  3BG5 A;  3K6G A;  4KMF A;  1UCR A;  3OR1 C;  3GW2 A;  3TMO A;  3C1D A;  2XAG A;  1T2K A;  2BHY A;  5D6E A;  1U5T B;  4F92 B;  1R4M B;  1VZ0 A;  3LAP A;  4MFE A;  2HTS A;  4U87 A;  2XAU A;  2P6T A;  3RSN A;  1MDM B;  2DOE A;  1MBJ A;  1YHQ I;  1OR7 A;  5D5X B;  4AWX B;  1MNE A;  2OV7 A;  3CCR I;  2E71 A;  4UUT A;  2JT1 A;  1F4K A;  3HOW J;  4ZZD A;  2IGK A;  4DJA A;  2F4O B;  2E7X A;  3GTG J;  4MIM A;  2DMQ A;  1OQY A;  3JSO A;  2JPC A;  3O2P E;  1JJ8 C;  4U0Y A;  5J1R A;  1VND A;  2KKO A;  2M4G A;  4N9H A;  1BBY A;  5CJ9 A;  1R1T A;  3SDG A;  2R93 J;  3ABK H;  1CF7 A;  4BXU A;  1YOV B;  4M6V A;  2HDW A;  1W4M A;  1SAU A;  3EQL F;  2H27 A;  3HPG A;  1SFE A;  4B43 A;  1RPW A;  2R7V A;  4D7N A;  1QU3 A;  1ZLJ A;  5HDN A;  2M4K A;  3NQO A;  1ON2 A;  2OU2 A;  4I76 A;  4IEJ A;  2R0Q C;  3DEW A;  5M5Y J;  1ZGJ A;  3GO5 A;  3PSF A;  1UMQ A;  1BR1 A;  1D0Z A;  2M8E A;  4XSX F;  1UST A;  3BRO A;  1PUF A;  3HRT A;  1HW1 A;  1MJ9 A;  4LLL A;  5BPI A;  4I02 A;  2MC4 A;  2HOE A;  3FXJ A;  3I64 A;  2IVM A;  2K86 A;  2HYJ A;  4BS9 A;  1BOB A;  2DMN A;  2TDX A;  5E18 F;  1VQO I;  2RC4 A;  4UNO A;  1Y6I A;  3KP6 A;  5K1Y A;  2LKX A;  2GZW A;  2ZFU A;  3CME I;  1VQ7 I;  4L0Y B;  2ID3 A;  5B3S H;  1KQ8 A;  1U2W A;  3GVA A;  3PO2 J;  3FK6 A;  4B44 A;  2DMP A;  1DU0 A;  2HWV A;  5IT9 K;  3K1P A;  3M3Y J;  1U8R A;  4BHP A;  3ROU A;  4ZDP A;  3H0G J;  2X1E A;  2IGM A;  2XAF A;  2R7W A;  3AG2 H;  2Y48 A;  2DA4 A;  4HBL A;  1JT0 A;  1MSE C;  3S1R J;  1IW7 F;  4EJO A;  2P5K A;  3CES A;  3G73 A;  2CS3 A;  5F08 A;  1D5Y A;  1SVM A;  3KEY A;  5J8F A;  3HOZ J;  3ZMU A;  4BE2 A;  1HOM A;  5IYB J;  5JVT A;  2P6S A;  4BKX A;  4FE4 A;  1BJA A;  3JRA A;  3WTY C;  3AL0 C;  1QNT A;  1TWH J;  4KFC A;  1PYV A;  3IP4 B;  1N78 A;  4MNU A;  1UB9 A;  2KMU A;  2YR2 A;  3E7L A;  2K4B A;  1T39 A;  1R49 A;  1WVR A;  1U0J A;  1G2H A;  1J9I A;  1A31 A;  1JI8 A;  1YE9 A;  4M9X A;  4XK4 A;  2L2O A;  1SC7 A;  4I6Z A;  3PFY A;  4ESJ A;  1QHH D;  4RS8 A;  4HDU A;  1W36 C;  1BM9 A;  3LMM A;  3FX3 A;  4CO8 A;  3OMY A;  2JJ7 A;  4EV0 A;  5DDG A;  4PCQ A;  3HTS B;  1XSX A;  3KZY A;  5IP6 A;  3F8C A;  4BGD A;  3TP0 A;  1V5F A;  5J47 A;  2VKE A;  3KP3 A;  2KIM A;  3SZT A;  1CQT A;  2OQG A;  3T1B A;  1KYZ A;  4B4C A;  2VKH A;  3V42 A;  4LG3 A;  2FNA A;  3EPZ A;  1PUF B;  3BT9 A;  3RCO A;  3PJR A;  2P5L C;  1WJB A;  5IT3 A;  3VOD A;  5CPR B;  3F72 A;  5E1Z B;  1ZGW A;  2DT7 B;  1T33 A;  3V7S A;  1FBQ A;  3TBI A;  4U7D A;  2AXT C;  1IGN A;  2G0E A;  1OMI A;  2G7H A;  4UUV A;  3F21 A;  2L0K A;  4DBR A;  2HEO A;  2A6T A;  2Y75 A;  3BJA A;  4XLH A;  3TP3 A;  4R79 A;  2KPM A;  2C6Y A;  2KP6 A;  5F64 A;  4BL0 B;  1QRY A;  1A04 A;  2ZC2 A;  2G9W A;  3CMM A;  3RZO J;  2DBB A;  1JUP A;  1YW7 A;  2PMH A;  2IAI A;  4UVA A;  4BBR J;  4H4K C;  4L18 B;  2EH3 A;  1XDS A;  4Y13 A;  2XVC A;  4JQF A;  2R7X A;  4KA4 A;  5JI6 A;  2EZH A;  4GCV A;  2OA4 A;  1ZG1 A;  4PSW A;  1ETK A;  2VOO A;  1K78 B;  1SEU A;  2E35 A;  2ESN A;  4C9Y A;  1FX7 A;  3CCS I;  4LG0 B;  2K3F A;  4B48 A;  1VI0 A;  1XCV A;  1O57 A;  3DFG A;  1SD6 A;  2MBF A;  2ZME B;  4E6K G;  3W6K B;  1W5S A;  3S14 J;  1XX5 A;  2RGV A;  5M3M J;  1V4R A;  4DNC A;  3GTO J;  1X1A A;  4E7H A;  1QQI A;  2VQG A;  2QLZ A;  4DQ2 A;  4LIV A;  2MSY A;  1ZR4 A;  3HSE A;  4UHT A;  4RMN A;  2HQ5 A;  1ZAO A;  3E5U A;  4QSH A;  1C0W A;  4YG2 F;  1LUJ B;  1NK3 P;  1P9Q C;  1R23 A;  2CO5 A;  3M7G A;  4CYC B;  1BW5 A;  2UXN A;  3IH3 A;  4AD9 A;  1U9N A;  4XMY A;  2PX9 A;  4MQV A;  3GTJ J;  1B72 B;  3OYK A;  2VC1 A;  5B1A H;  2YU3 A;  1H88 C;  3J7Z I;  2M45 A;  2Z3Y A;  5E1W A;  1OCC H;  2BY2 A;  3HEF A;  5CVJ A;  3A1Y A;  4XKC A;  4DZP A;  1XGN A;  1FNN A;  3K4L A;  3FIW A;  3L2C A;  1ITY A;  4EGY A;  1XCB A;  2ZO4 A;  3QOP A;  2DA3 A;  2VKV A;  3GLX A;  1VQN I;  2XAJ A;  4E7Z A;  1JXS A;  5J3L A;  2QEX I;  3KET A;  3ZGK A;  1ZG5 A;  2KT0 A;  2HVR A;  4GRI A;  2LMD A;  4M6X A;  2R5Z B;  1DP7 P;  1P6R A;  1FBU A;  4M71 A;  2KJC A;  2OZU A;  2WA0 A;  4M9S A;  2O6G E;  4NC8 A;  4D1Q A;  4IKF A;  4HW0 A;  1E2X A;  2JK3 A;  2JRT A;  1IRF A;  2WY8 Q;  1B6A A;  3QQA A;  4FCY A;  1DDN A;  2JSC A;  1IRX A;  2DFE A;  4OIO F;  1VQM I;  5J40 A;  1IRG A;  4RGU A;  5DYM A;  3CUQ A;  5D6F A;  2BVM A;  4JYK A;  4K2E A;  3IUO A;  4CCL A;  2LKP A;  2BE5 F;  2NNN A;  3HBL A;  3Q0W A;  4UUS B;  1VQ8 I;  1I1G A;  2P81 A;  4ON0 A;  1HKQ A;  3WU2 C;  3H3U A;  2NOJ B;  1T0F A;  3AG1 H;  2OD5 A;  1XD7 A;  4LG0 A;  3W2V A;  2XPW A;  3HIF A;  2R7Q A;  1ETQ A;  3F8N A;  2STT A;  3OV8 A;  2RVC A;  5IP9 J;  4YEJ A;  4LLN A;  3BTC A;  2GXA A;  2EIN H;  3H9G A;  2FBI A;  1JKR C;  3F9K A;  2JA5 J;  2IA2 A;  2B7E A;  3F0C A;  1ZAR A;  1SVL A;  2OF7 A;  3FXM A;  3KPH A;  3PUB A;  1Q1V A;  2AQE A;  2CQ7 A;  2F5F A;  5DEQ A;  2L3D A;  4HZF A;  3BG6 A;  1VQ4 I;  3R61 A;  2FRH A;  3W3C A;  3HTU A;  2MH2 A;  4AU7 A;  3MKZ A;  1LDK B;  4NUB A;  1TT5 B;  2CSO A;  1YI2 I;  2I8D A;  2M34 A;  2HQN A;  2R7S A;  3LSG A;  4XON A;  2Q8K A;  2QBY A;  1WJ5 A;  4Y4R A;  3VFZ A;  4GXO A;  5LHI A;  1SMY F;  3DBL B;  4V19 K;  2BY0 A;  3I4N J;  2HQA A;  3DP7 A;  2QZ8 A;  2K40 A;  2MD5 A;  3MVP A;  1GHC A;  4S04 A;  1O7F A;  1ZGA A;  4Q48 A;  3RDI A;  3TOB A;  3DPL C;  2E2H J;  2AHQ A;  4ENK A;  3KZZ A;  1MJA A;  1O3Q A;  4M74 A;  2R5Y A;  4YFK F;  3CUQ B;  1HQC A;  4IOC F;  2A07 F;  2JRM A;  1BC8 C;  1J2X A;  1UHW A;  4WWC A;  4FTH A;  4NQW B;  5FKL A;  5BS6 A;  1U5T A;  3MCZ A;  5A2Q K;  2DTZ A;  3S1Q J;  4HQE A;  2JA8 J;  1T08 B;  4A93 J;  3BDD A;  1TW2 A;  4E70 A;  3VYU B;  1OJL A;  4KNY A;  4A3L J;  1K83 J;  3CZ6 A;  3EUH A;  2QVO A;  3P9K A;  4BXF A;  3ERM A;  4M73 A;  2QGU A;  1X4O A;  4CSW A;  5L3B A;  2ICW G;  3GF2 A;  4UVC A;  3FXK A;  2CQN A;  1FBS A;  1WPK A;  4F52 A;  2ELK A;  1JT6 A;  3ZQG A;  3ABM H;  4PJL A;  3OYJ A;  5FRN A;  2E1O A;  5D5U B;  5L3C A;  2EIM H;  3JAM Z;  3G6E I;  1TWG J;  3MAJ A;  2NNY A;  3M4O J;  1RKT A;  1OCP A;  3DV8 A;  2V6E A;  2CV1 A;  5M5W J;  1KU9 A;  1FP1 D;  3WOD F;  1POG A;  3DQV C;  3ELK A;  4CCK A;  2DQL A;  1JUS A;  5L3D A;  2BHZ A;  4KN4 X;  2XPV A;  2ADU A;  1XN7 A;  5C4J J;  1T0F C;  2KIQ A;  4XOP A;  4A5N A;  4WCG A;  4YIR X;  4IHV A;  1J5Y A;  1RIO H;  1R4N B;  3JAM K;  5ICE A;  1TC3 C;  1D3Y A;  4JX5 A;  4XRF A;  2G7U A;  4KIC A;  4D5F A;  2EFQ A;  2VAS A;  3MWM A;  2ZXH A;  2R5Y B;  1Z0X A;  2CQQ A;  3WTZ A;  1STZ A;  4IXA A;  1RR7 A;  1OYW A;  2CW7 A;  5L3E A;  2XRN A;  2FA5 A;  5J1U A;  3CD6 I;  3ECH A;  4UV8 A;  2VT2 A;  2WAF A;  3FF5 A;  3HM5 A;  3DPT A;  1R00 A;  3GEZ A;  4N4N B;  5E3M A;  1N75 A;  1TT0 A;  2PQ8 A;  2M1B A;  3WG9 A;  2UUZ A;  4EJU A;  4BU2 A;  4DGW B;  4OWR B;  5C4X J;  1Z05 A;  3QPH A;  4AVZ A;  1K7A A;  1QA6 A;  1QPI A;  1RR8 C;  4N9I A;  1K6O A;  1W7P A;  1BW6 A;  2GA2 A;  3M9A A;  2DN0 A;  2QSG X;  2GLO A;  5HS8 A;  4KN7 X;  4HNV A;  4QTR A;  1UHM A;  2VXZ A;  2VJI A;  3N4M A;  2LH9 A;  3VYR B;  3JSP A;  3WHC A;  3VOE A;  1R1U A;  3JRD A;  5FLV A;  5DUK A;  2OJE D;  3K4K A;  4HAM A;  1VQ9 I;  1VQL I;  4D5C A;  1UG2 A;  5HLG A;  2VJ5 A;  3E6C C;  2AS5 F;  1G3W A;  2VXD A;  3DWL E;  2X0L A;  2WV0 A;  2EFW A;  2W25 A;  2VBW A;  1G3S A;  3ML6 A;  2XF5 A;  3ZN1 A;  4J19 A;  1SFX A;  1S7A A;  4A3D J;  1GV5 A;  1X3Z B;  3H9Q A;  3FXL A;  5HLT A;  2LLK A;  2FMY A;  4NDL A;  1Z91 A;  3DTK A;  1J09 A;  4ESB A;  1KZH A;  2F4M B;  1MBK A;  4OIQ F;  3U2R A;  4JP0 A;  3HOS A;  4O6J A;  2R7D A;  3SZP A;  2MA3 A;  1KON A;  3VB2 A;  3JRE A;  4BEH A;  2DOA A;  5BNG A;  2LP0 A;  3NAR A;  3FXR A;  3AKZ A;  2HYG D;  2E1M C;  3H9J A;  3ZP5 A;  2BXY A;  3PO3 J;  3QYB A;  4B09 A;  2XGE A;  2EFN A;  3JRF A;  2R92 J;  1R5H A;  1L3L A;  5JR3 A;  3M8J A;  4GYI A;  2B0L A;  3L2V A;  2VI6 A;  3CCQ I;  4AUX A;  3LNQ A;  1KGS A;  4BQN A;  2PJP A;  2HR3 A;  2EB7 A;  2DPU A;  3LFU A;  1VQ5 I;  3ZQ7 A;  4XR6 A;  4IJA A;  1KQ0 A;  2VBY A;  3HKZ N;  5K5R A;  4I01 A;  4OMZ A;  1JKO C;  4FAS D;  1TW3 A;  4ZH4 F;  1WQ2 A;  2EJR A;  5TGT A;  1UZC A;  2R7Z J;  1XTA A;  2KRC A;  2E34 A;  1JTY A;  5E8I A;  1LFU P;  1QHG A;  3HB9 A;  4PJJ A;  4L5E A;  2L7F P;  5F6F A;  1TWF J;  3HG9 A;  5IOY A;  2HQR A;  1FSE A;  3MFK A;  1X4P A;  2CH0 A;  1U5T C;  2LOO A;  5D5W B;  3CJN A;  2XIG A;  1JJ6 C;  1FT9 A;  2FJ1 A;  3KYC B;  4XNF A;  2X4H A;  3RKY A;  3ABU A;  1WI9 A;  2IS1 A;  3I58 A;  3OYD A;  3HRM A;  4BAY A;  3MKY B;  2K9S A;  4XOR A;  3BG7 A;  2L01 A;  3L2Q A;  3OS2 A;  3ZQC A;  5EF6 A;  4B1R A;  3A0B C;  2UV1 A;  3BLY A;  3KE2 A;  3A4C A;  1FYM A;  3RPU D;  3P7N A;  3L7W A;  4C3I J;  4IHY A;  3OYG A;  3ZQH A;  1PVE A;  4M3E A;  4XRS G;  1BN5 A;  3K70 D;  5FD5 A;  1XPX A;  4PSX A;  5KVR A;  2K02 A;  2Y9Y A;  5LGT A;  2QQ8 A;  2WB1 N;  4QIW N;  2JVG A;  1K4T A;  5CVI A;  4IO9 F;  4IHX A;  1MBG A;  2DA7 A;  4LGW A;  2X6W A;  3GZN B;  1EV7 A;  4RAY A;  3T8T A;  3G1O A;  3QAH A;  2QKM B;  3NWS A;  4M3D A;  2H8W A;  1V3F A;  2K9L A;  5DTD A;  3JRH A;  1IN4 A;  2JWT A;  2J5P A;  2DAO A;  4YEL A;  1IUF A;  3GZ5 A;  3OL3 A;  4LOC A;  5FD6 A;  3E3V A;  1WJE A;  1QVT A;  1E3H A;  1XC5 A;  1FPQ A;  1YG2 A;  1F9N A;  2KL4 A;  2M7A A;  2PBI A;  3S2W A;  2OZ6 A;  2WTE A;  5ED4 A;  1LQ1 A;  2P5V A;  2KLO A;  1WHU A;  3EUA A;  3IAM 2;  1EF4 A;  3HHH A;  4UUS A;  4WXC A;  4MTE A;  4RLQ A;  3HRU A;  1VTN C;  2XF7 A;  5DCF A;  2WY7 Q;  3D5L A;  3J7A O;  4ZYA A;  3I59 A;  4HA8 A;  4RM2 A;  2WAE A;  1R5I D;  4E4H A;  4XKB A;  2BV6 A;  5FGM A;  1GVD A;  2OTL I;  4OOI A;  4ETS A;  5HNF A;  3CUQ C;  2EBI A;  1ETY A;  3HGG A;  3FMQ A;  1AWC A;  3REO A;  1ETX A;  3ZR8 X;  1UJ8 A;  4LMY A;  2GXG A;  2NS0 A;  3OYL A;  4CCJ A;  3HGY A;  4DW6 A;  1ZH5 A;  2HGC A;  3FDY A;  4NC6 A;  5HLH A;  5HOO A;  4BJT A;  3EYY A;  1IG7 A;  2Q1Z B;  4U0V A;  1E3P A;  5BPD A;  2VJ4 A;  5FLX K;  1Y1W J;  1YQA A;  4EM2 A;  5LGU A;  5FLM J;  4CGZ A;  2M7B A;  1JTX A;  1XGO A;  1JUM A;  2L9S A;  2DFI A;  4II3 A;  5C3E J;  2K9M A;  1IXS B;  2DCE A;  4MHG A;  5J4V A;  5KNL A;  3AAF A;  4RAZ A;  2DA2 A;  2RDP A;  4E7S A;  4DYC A;  3LSH A;  2EK5 A;  2VE9 A;  1W0T A;  1E17 A;  2Z33 A;  2F5C A;  3TO7 A;  1S5L C;  2M9H A;  4IQ4 A;  4HRI A;  2O9L A;  3QOD A;  1XMA A;  4V2F A;  2IA1 A;  3DBR B;  3SJM A;  3OYB A;  1HKT A;  4G6Q A;  1YRN B;  4LK0 F;  4OIN F;  2H1K A;  5GAG J;  1K78 A;  1NK2 P;  2EFO A;  3KP4 A;  4U0W A;  1QO0 D;  4CCN A;  1ACI A;  2V1D A;  3RJP A;  3WE3 A;  1MBH A;  3CP8 A;  3ZXS A;  1AKH B;  1DGR M;  2TRT A;  4KIS A;  4IQJ A;  2M2E A;  4GO1 A;  3FZV A;  2Y30 A;  2OAZ A;  4NC7 A;  4XLN F;  2ZXI A;  3U1D A;  2EIK H;  3BPX A;  2CW0 F;  2YX4 A;  3KP5 A;  2VJJ A;  3GCM A;  3ESW B;  3QPL A;  4GYG A;  2O8K A;  3Q5F A;  4TV7 A;  3RKQ A;  3J7Y J;  3LSM A;  4AIJ A;  1SD5 A;  1N25 A;  2GOX B;  1T56 A;  4DYR A;  2JA7 J;  2JUC A;  3OYN A;  2L9R A;  3BQZ A;  4OIR F;  3RQI A;  4A3B J;  5M3F J;  1CF7 B;  1XB4 A;  4EM0 B;  5FRO A;  2COB A;  2LFB A;  1OLT A;  3EDP A;  3A03 A;  3GFJ A;  3ZMV A;  1OCO H;  2RKH A;  1MH4 A;  1OCR H;  4KIF A;  5IT9 Z;  2K9Q A;  4GGG A;  4I09 A;  4NBQ A;  4CYC A;  3G3Z A;  2E2I J;  1JHH A;  2VUM J;  2VE8 A;  2Z16 A;  4HOB A;  2XAQ A;  4KMU X;  2E5N A;  3WTS C;  1B1B A;  3E6M A;  3W6V A;  3FHZ A;  2DT6 A;  4BE0 A;  3F22 A;  2VBZ A;  3CLQ A;  1FMW A;  2HNH A;  1V5E A;  3HOU J;  3I54 A;  3QPT A;  2XDV A;  4UXN A;  3IRR A;  1SD4 A;  3LOC A;  2LF7 A;  4JX4 A;  5TIS C;  4HF0 A;  2RV8 A;  3IH4 A;  2QQ9 A;  4EAT A;  1E3O C;  3KFW X;  3I71 A;  1LFB A;  4BQA A;  1RNL A;  3R0J A;  4LK1 F;  3AG3 H;  4Y3O A;  1R9T J;  1O4X A;  3WGH A;  3DKY A;  5KAF C;  2EV6 A;  2VC0 A;  4OAY A;  2KIF A;  1YJ9 I;  2I5U A;  3ABT A;  4AM3 A;  3C3W A;  1R1V A;  4PUS A;  3AFH A;  5K7Z A;  4QPQ A;  4BDY A;  4CZZ A;  3SFZ A;  3D5S C;  3TQN A;  2VIX A;  5HOD A;  4GFB A;  1FP2 A;  4JK1 X;  2D5V A;  3ZQL A;  3WTV C;  2DPD A;  2FML A;  2H94 A;  2FBH A;  2EZL A;  2QF7 A;  4M72 A;  3WG7 H;  3B02 A;  5IY5 H;  2VON A;  5DD4 A;  2ACJ A;  1D0X A;  2P7V B;  1OFC X;  2MH9 A;  2RN7 A;  2A61 A;  2CW8 A;  2WAD A;  2VLA A;  4BNC A;  1O3T A;  1YW9 A;  2A6H F;  1YLF A;  4S0H B;  4IRI A;  3WU0 A;  5JLX A;  4IRH A;  1FYL A;  4UY8 I;  1I6H J;  5ICG A;  3L2R A;  1VQ6 I;  2R7T A;  1XMK A;  2V4J C;  2HKO A;  4RB2 C; 
#chains in the Genus database with same CATH homology
 3ECO A;  5K5Q A;  4HX7 A;  3ERE D;  5CYV A;  5LHH A;  2R3S A;  2Z9O A;  4O5V A;  3MQ0 A;  2HYF A;  1PP8 F;  3F3X A;  1R5G A;  1TLH B;  3FMR A;  1FOK A;  2PFB A;  4A5M A;  4CXF A;  2P4W A;  4MQ9 F;  2NYX A;  1HSJ A;  3FM5 A;  2ESH A;  2IA0 A;  2IRF G;  1ODD A;  4G6D A;  3LQQ A;  5FB2 A;  5AON A;  5CVV A;  1SAX A;  1BI0 A;  2H09 A;  3GZ6 A;  3CUO A;  3CO7 C;  2L4M A;  2ETH A;  4Y17 A;  4YIF A;  2IJL A;  2Y0M A;  2JPB A;  1T98 A;  2ELH A;  3DF8 A;  2ZKZ A;  4WXH A;  4Z2Y A;  4EVI A;  1P92 A;  1IXC A;  3FWE A;  4A6D A;  1SMT A;  3JW4 A;  3B73 A;  5KK1 A;  1KU2 A;  5LEK A;  4ESF A;  1TNS A;  2W84 A;  5HVQ C;  4HX8 A;  4HF2 A;  3E97 A;  4R1H A;  2XKO A;  4ASN A;  1B59 A;  2LNB A;  2MLK A;  1O3S A;  3LA3 A;  4A0Z A;  3R6S A;  5E1X A;  4HLX A;  4IRG A;  2DLL A;  1TQP A;  3C18 A;  3K1M A;  5FLX Z;  5H20 A;  5CVR A;  1F1Z A;  3WTX C;  2V1U A;  1GXP A;  1L0O C;  5ICF A;  4MGR A;  4ZYG A;  1LB2 A;  5FFX A;  3IKV A;  2ISZ A;  5ICC A;  1I1S A;  4LB6 B;  3HSF A;  3V7C A;  1RI7 A;  1Z7U A;  1SD7 A;  2GXB A;  2DU9 A;  1Z1D A;  4MEY F;  2NRA C;  4I7H A;  1I27 A;  3LA2 A;  1IUY A;  4ENN A;  4M6Y A;  2V1X A;  2O03 A;  5HDG A;  3IL2 A;  4B8X A;  2FEZ A;  2FF4 A;  5HDK A;  3WGG A;  1LJ9 A;  4RB0 A;  4RGR A;  2YPR A;  3KEO A;  3Q9V A;  3WGI A;  3P9C A;  2FU4 A;  4L9T A;  1MGT A;  3HHG A;  5K5O A;  4G7Z F;  2F5E A;  4XLP F;  2NAZ A;  2HKX A;  3RKX A;  3RYP A;  3LAJ A;  3VEP A;  3COA C;  1LDD A;  3CTA A;  4CIC A;  2QQA A;  1FWZ A;  2L4A A;  1IN7 A;  3IHU A;  1GXQ A;  1I6X A;  1G6N A;  1G4D A;  2M30 A;  5ERI A;  5E8G A;  2CQK A;  5AIP A;  4ENM A;  3F6O A;  4CYD A;  3MZH A;  4EM1 A;  2XAH A;  4HLY A;  3GFM A;  4FHT A;  3I59 B;  1P4W A;  4F7Z A;  1LDJ A;  3ZMD A;  2HDC A;  2A6E F;  2IPQ X;  3FXQ A;  2STW A;  1Q1H A;  3J80 K;  3T8R A;  2MC3 A;  1K79 A;  1DPR A;  1G3T A;  4EJW A;  1NHA A;  5D4R A;  3H3Z A;  1YO5 C;  2QYO A;  1FYK A;  1MZB A;  2KIU A;  2OQR A;  3U9G A;  2A3S A;  5DCM B;  4HV6 A;  2VBX A;  3RI4 A;  3HYI A;  4N0B A;  5E20 A;  2E7W A;  2EA2 A;  3PQK A;  1OKR A;  2CGP A;  1RZ4 A;  3F6V A;  1TTY A;  1HBX G;  1MD0 A;  5HS9 A;  3F8F A;  1XSD A;  4P96 A;  1HXD A;  4IHT A;  3GWZ A;  5JFR A;  5LBQ A;  3HOT A;  1ZRF A;  3LFK A;  2CFX A;  1Z9C A;  1T38 A;  3TGN A;  4A2U A;  1S8N A;  2ZXJ A;  2MLG A;  2V6C A;  1IN6 A;  4U88 A;  3R4K A;  3OOP A;  1FY7 A;  2FE3 A;  2RQP A;  1P4A A;  2Z99 A;  2UXX A;  1QZY A;  2PMU A;  1OYY A;  4HV5 A;  4YFX F;  2D1V A;  4A12 A;  3E5X A;  2QM3 A;  4AIH A;  2M5W A;  5JHU A;  4JBA A;  3GXO A;  1MKM A;  4R8H A;  2LF8 A;  3NRV A;  3TKY A;  3K2Z A;  1IN5 A;  3K69 A;  2A69 F;  2Z5U A;  5D5V B;  4ZYD A;  3WE2 A;  3BZ6 A;  2IT0 A;  3GUD A;  3KP7 A;  1B9N A;  1FC3 A;  2HZT A;  3TO6 A;  1QGP A;  2COM A;  3CDH A;  3K0L A;  2L54 A;  2V9V A;  3V8K A;  4OIP F;  2FQ3 A;  2HTJ A;  3WTU C;  2PLY A;  3I5U A;  2P7C B;  4PZJ A;  1W7P B;  4WK8 F;  4G7O F;  1U78 A;  2EV5 A;  2KRF A;  2BYV E;  2P8T A;  4L0Z B;  3FMS A;  1EH8 A;  3HRS A;  4HDV A;  1USS A;  2VOD A;  4IVN A;  3E6B A;  3T0Y A;  4BHB A;  4UVB A;  2L02 A;  3TO9 A;  1TBX A;  4A6E A;  3C7J A;  5L3F A;  3BJO A;  3RIR A;  4L9V A;  1J7K A;  2RNJ A;  3R60 A;  2BGC A;  2FBK A;  3KP2 A;  4NHJ A;  4XBF A;  4EGZ A;  1RUO A;  1BI2 A;  3HSR A;  3L00 A;  4L5I A;  3BY6 A;  4P5O A;  2Q2E A;  3L09 A;  4G8X A;  1AOY A;  2ZBK A;  4NQW A;  4KT5 C;  3JTG A;  1IZ1 A;  3E5Q A;  1WRJ A;  4LB5 A;  3KLO A;  2WC2 A;  2W57 A;  4IPA A;  5H6R A;  2XAS A;  3HUG A;  2O0Y A;  2XGX A;  4RB1 A;  1H0M A;  2XV4 S;  4HYE A;  4L9N A;  1X3U A;  3GFI A;  1LEA A;  2QWW A;  5ILS A;  2VT3 A;  4PDK A;  2ZNY A;  5DV5 A;  3TOA A;  1EH7 A;  1ON1 A;  3TDZ C;  4FT8 A;  2W24 A;  1G3Y A;  1IXR C;  3V8J A;  1I5Z A;  3ZN0 A;  3J81 Z;  2EV0 A;  2D45 A;  5J6X A;  1ONV A;  5HS7 A;  1BIA A;  3EYI A;  3I0T A;  4YFN F;  2D1H A;  3M8F A;  3SHF A;  5EEG A;  3M1E A;  3J81 K;  2JZY A;  4G94 A;  3M8E A;  5AIQ A;  3QU6 A;  5D8L B;  4FX4 A;  2PG4 A;  3DXJ F;  3ZMS A;  2XUB A;  1IAW A;  4YII A;  5D8K B;  1ZN2 A;  2J5O A;  1PDN C;  1RUN A;  3SXY A;  4EMS A;  1B4A A;  1XSV A;  1KA8 A;  5DD8 A;  1FZP B;  5ILV A;  3GYH X;  4G7H F;  3P9I A;  4Q4Z F;  2GIV A;  4LD5 A;  3CO6 C;  1D5V A;  4Q5S F;  6PAX A;  1PP7 U;  4P55 A;  1GVJ A;  5E17 F;  3ZMZ A;  3LWF A;  1HW2 A;  1LEB A;  4KDP A;  4I2O A;  1YYV A;  2BBY A;  3DEU A;  4S05 A;  1WKM A;  1YFH A;  1YW8 A;  2O3F A;  3WTW C;  2BEO A;  2DI3 A;  2D2W A;  1H9G A;  3WTT C;  1B9M A;  1FSH A;  2DW4 A;  2K4J A;  4RGX A;  3T5X A;  2O8X A;  3RYR A;  2HFH A;  4RGS A;  3SQN A;  1YS7 A;  2VN2 A;  2F2E A;  3ZMT A;  2AXL A;  4LJZ F;  3BP8 A;  4KYW A;  4G9Y A;  1QBJ A;  1D8J A;  4CHU A;  1ZRD A;  3RKW A;  2FOK A;  2ZCW A;  2FXA A;  1J75 A;  3O3K A;  1JE8 A;  4MTD A;  2PEX A;  3WU1 B;  2O61 A;  2YX7 A;  2W85 A;  1O7L A;  3D0S A;  4ZZL A;  2H6B A;  3LST A;  3QU3 A;  1U3E M;  3TDU C;  1WWX A;  1WSU A;  4CDG A;  2FSW A;  4LLG F;  4EJT A;  1UFM A;  1W7P D;  3MZY A;  1DUX C;  4BYY A;  1P4X A;  3GFL A;  4BH9 A;  1R7J A;  2EA4 A;  1O3R A;  1BI1 A;  1QZZ A;  3QP5 A;  3GX4 X;  3BPV A;  3JTH A;  4O3M A;  3RTR A;  4QWQ A;  3PQJ A;  2HS5 A;  4U7B A;  2GAU A;  5LEJ A;  5LRR A;  5TJJ A;  1REP C;  4LFU A;  4XSZ F;  3K1N A;  5DCM A;  4A0X A;  1BC7 C;  5A2Q Z;  3BWG A;  1R58 A;  2M87 A;  1YIO A;  3R0A A;  1MJB A;  2EWN A;  4AIK A;  1JHF A;  4KIB A;  2ZNZ A;  3W6J B;  1R36 A;  3L9F A;  3LQR A;  4RB3 C;  2XHK A;  2ZME A;  1XGM A;  4AVP A;  1FLI A;  2E1C A;  1HST A;  4P9U A;  4L5J A;  2LSO A;  3QP6 A;  3N97 A;  1BI3 A;  3BJ6 A;  3KEQ A;  3I53 A;  1OYI A;  3IWF A;  3BOQ A;  3FXU A;  4WX9 A;  4WF2 A;  4A0Y A;  1KQ9 A;  2UZK A;  1LVA A;  3F8M A;  4PGG A;  3ULQ B;  3I4P A;  4NB5 A;  3RPU A;  1S29 A;  1OPC A;  3FM3 A;  4HF1 A;  4ENJ A;  2A68 F;  2K27 A;  1Z6T A;  3V8L A;  1J59 A;  4FX0 A;  5EEH A;  2ZFW A;  5DUI A;  5J8C A;  3Q9S A;  4L9J A;  5BMZ A;  1ZHF A;  2LDU A;  2E1N A;  4EJV A;  1ZYR F;  3KLN A;  1EH6 A;  3NEU A;  4UV9 A;  1MDM A;  1P2F A;  3DKW A;  1ZRC A;  3O6B B;  2EFP A;  3K9T A;  1J0R A;  1S7O A;  5L3G A;  4ZYE A;  1QPM A;  2VOP A;  3F8B A;  3CLO A;  3IC7 A;  2QBY B;  1S6L A;  1BIB A;  2QUF A;  1W5T A;  4WXD A;  1ZLK A;  1TNT A;  2DT5 A;  3IRQ A;  1H9T A;  1KU7 A;  3V7R A;  4KIG A;  4IF4 A;  5CLS A;  1HKS A;  4I98 B;  2GQQ A;  1KU3 A;  2IW5 A;  3E6D A;  3IKT A;  3QRF F;  2DK8 A;  2CYY A;  1ZG3 A;  2CWE A;  2IP2 A;  2XKP A;  1BOA A;  2DQR A;  3IWZ A;  5BQT A;  4Q47 A;  3F23 A;  2FNP A;  1XGS A;  2QQB A;  2YSR A;  5FFZ A;  1Y0U A;  4P9F A;  3PFI A;  1CGP A;  2ZJ2 A;  2UWM A;  2WWY A;  1IN8 A;  5TRD A;  4BHC A;  1SFU A;  2GA1 A;  4MEX F;  4OMY A;  2V79 A;  4H0E A;  2OBP A;  3V4G A;  4HQM A;  2DO7 A;  2JTV A;  3J80 Z;  1IF1 A;  1YTY A;  1T6S A;  2XRO A;  2F5D A;  2PI0 A;  1PUE E;  5LRS A;  2KJB A;  1TQI A;  2PN6 A;  2Q0O A;  2GWR A;  1KYW A;  4M9Z A;  1ZRE A;  4Y15 A;  1JGS A;  4I0A A;  4IHS A;  2ISY A;  1TQM A;  1F5T A;  3KCC A;  1R22 A;  5FO5 A;  5CVU A;  2QEN A;  5LGN A;  2CG4 A;  3RPQ A;  1D8K A;  4HX4 A;  1XDU A;  4EQQ A;  2DTR A;  2R7F A;  2K7L A;  5ILU A;  1S3J A;  2DK5 A;  4QLC U;  1HW5 A;  4I0B A;  1YS6 A;  3ISP A;  5F1R A;  1LNW A;  1U6G A;  4D0P A;  3EET A;  5HLI A;  1Z6R A;  3H92 A;  2H6C A;  2A5Y B;  3ZPL A;  3LA7 A;  4PGH A;  5LHG A;  1DPU A;  3MEX A;  5LLQ A;  5H6Q A;  4KUM A;  5D4S A;  4OU0 A;  4ZYH A;  1ULY A;  4KMF A;  1UCR A;  3GW2 A;  3C1D A;  2XAG A;  1T2K A;  5D6E A;  1U5T B;  3LAP A;  2HTS A;  2P6T A;  1MDM B;  1OR7 A;  5D5X B;  4AWX B;  2JT1 A;  1F4K A;  4ZZD A;  2E7X A;  3JSO A;  2JPC A;  3O2P E;  4U0Y A;  2KKO A;  4N9H A;  1BBY A;  5CJ9 A;  1R1T A;  1CF7 A;  4BXU A;  1W4M A;  3EQL F;  2H27 A;  1SFE A;  1ZLJ A;  5HDN A;  3NQO A;  1ON2 A;  2OU2 A;  1ZGJ A;  3GO5 A;  2M8E A;  4XSX F;  1UST A;  3BRO A;  3HRT A;  1HW1 A;  1MJ9 A;  4LLL A;  5BPI A;  4I02 A;  2HOE A;  3I64 A;  2IVM A;  2K86 A;  2TDX A;  5E18 F;  4UNO A;  2RC4 A;  3KP6 A;  5K1Y A;  2GZW A;  4L0Y B;  1KQ8 A;  1U2W A;  3GVA A;  2HWV A;  5IT9 K;  3K1P A;  1U8R A;  4BHP A;  3ROU A;  2XAF A;  2Y48 A;  4HBL A;  1IW7 F;  4EJO A;  2P5K A;  3G73 A;  5J8F A;  3ZMU A;  5JVT A;  2P6S A;  1BJA A;  3WTY C;  1QNT A;  4KFC A;  4MNU A;  1UB9 A;  1T39 A;  2YR2 A;  2K4B A;  1J9I A;  4M9X A;  4ESJ A;  4RS8 A;  4HDU A;  1BM9 A;  3FX3 A;  4CO8 A;  4EV0 A;  5DDG A;  4PCQ A;  3HTS B;  1XSX A;  3KZY A;  3F8C A;  3KP3 A;  2KIM A;  3SZT A;  2OQG A;  3T1B A;  1KYZ A;  2FNA A;  2P5L C;  5IT3 A;  3VOD A;  3F72 A;  5E1Z B;  3V7S A;  1FBQ A;  4U7D A;  1OMI A;  2G7H A;  4UUV A;  3F21 A;  2HEO A;  3BJA A;  2Y75 A;  4R79 A;  2C6Y A;  5F64 A;  1A04 A;  2G9W A;  2DBB A;  1YW7 A;  2PMH A;  4UVA A;  4L18 B;  4Y13 A;  1XDS A;  2XVC A;  4JQF A;  4KA4 A;  5JI6 A;  4GCV A;  2OA4 A;  1ZG1 A;  2VOO A;  1K78 B;  2ESN A;  1FX7 A;  4LG0 B;  1XCV A;  1O57 A;  1SD6 A;  2MBF A;  3DFG A;  2ZME B;  3W6K B;  1W5S A;  2RGV A;  1V4R A;  4DNC A;  1QQI A;  2QLZ A;  4DQ2 A;  3HSE A;  4UHT A;  1C0W A;  1ZAO A;  3E5U A;  4YG2 F;  1R23 A;  2CO5 A;  3M7G A;  2UXN A;  4AD9 A;  4MQV A;  2VC1 A;  2YU3 A;  2M45 A;  2Z3Y A;  5E1W A;  5CVJ A;  5BOX A;  1XGN A;  1FNN A;  3L2C A;  4EGY A;  1XCB A;  2ZO4 A;  3QOP A;  3GLX A;  2XAJ A;  1JXS A;  3KET A;  1ZG5 A;  4M6X A;  1DP7 P;  1P6R A;  1FBU A;  4M71 A;  2KJC A;  2OZU A;  4M9S A;  2O6G E;  4HW0 A;  1E2X A;  2JRT A;  1IRF A;  1B6A A;  1DDN A;  2JSC A;  4OIO F;  1IRG A;  4RGU A;  5DYM A;  3CUQ A;  5D6F A;  4K2E A;  2LKP A;  2BE5 F;  2NNN A;  1I1G A;  4ON0 A;  1HKQ A;  3H3U A;  1T0F A;  2OD5 A;  1XD7 A;  4LG0 A;  3HIF A;  3F8N A;  2STT A;  3OV8 A;  2RVC A;  4LLN A;  2FBI A;  2IA2 A;  1ZAR A;  2F5F A;  5DEQ A;  2L3D A;  4HZF A;  3R61 A;  2FRH A;  3HTU A;  2MH2 A;  1LDK B;  2CSO A;  2HQN A;  2Q8K A;  2QBY A;  3VFZ A;  4GXO A;  5LHI A;  1SMY F;  3DP7 A;  2QZ8 A;  2MD5 A;  1GHC A;  4S04 A;  1O7F A;  1ZGA A;  4Q48 A;  3RDI A;  3TOB A;  3DPL C;  4ENK A;  3KZZ A;  1MJA A;  1O3Q A;  4M74 A;  4YFK F;  3CUQ B;  1HQC A;  2A07 F;  1BC8 C;  1J2X A;  1UHW A;  4WWC A;  5BS6 A;  1U5T A;  3MCZ A;  5A2Q K;  4HQE A;  3BDD A;  1TW2 A;  4E70 A;  4KNY A;  3EUH A;  2QVO A;  3P9K A;  4M73 A;  5L3B A;  3GF2 A;  4UVC A;  1FBS A;  5D5U B;  5L3C A;  3JAM Z;  3MAJ A;  2NNY A;  3DV8 A;  1KU9 A;  1FP1 D;  3WOD F;  3DQV C;  3ELK A;  2DQL A;  5L3D A;  4KN4 X;  2ADU A;  1XN7 A;  4A5N A;  4WCG A;  1RIO H;  1J5Y A;  3JAM K;  5ICE A;  1D3Y A;  4XRF A;  2G7U A;  4KIC A;  2EFQ A;  3MWM A;  3WTZ A;  1STZ A;  4IXA A;  1OYW A;  5L3E A;  2XRN A;  2FA5 A;  3ECH A;  4UV8 A;  2VT2 A;  3FF5 A;  3DPT A;  1R00 A;  3GEZ A;  2PQ8 A;  2M1B A;  3WG9 A;  4EJU A;  1Z05 A;  3QPH A;  1K7A A;  4N9I A;  1K6O A;  1W7P A;  2GA2 A;  3M9A A;  5HS8 A;  4KN7 X;  1UHM A;  2VXZ A;  3N4M A;  3JSP A;  3VOE A;  1R1U A;  5DUK A;  4HAM A;  5HLG A;  3E6C C;  2AS5 F;  1G3W A;  2X0L A;  2WV0 A;  2EFW A;  2W25 A;  2VBW A;  1G3S A;  3ML6 A;  3ZN1 A;  1SFX A;  1S7A A;  2FMY A;  1Z91 A;  4ESB A;  4OIQ F;  3U2R A;  3HOS A;  4O6J A;  2R7D A;  3SZP A;  2MA3 A;  3VB2 A;  3FXR A;  2HYG D;  3ZP5 A;  4B09 A;  2EFN A;  1R5H A;  1L3L A;  5JR3 A;  4GYI A;  2B0L A;  1KGS A;  2PJP A;  2HR3 A;  2EB7 A;  2DPU A;  3ZQ7 A;  4IJA A;  1KQ0 A;  2VBY A;  5K5R A;  4I01 A;  4OMZ A;  1TW3 A;  4ZH4 F;  1WQ2 A;  2EJR A;  5E8I A;  5F6F A;  2HQR A;  1FSE A;  3MFK A;  1U5T C;  5D5W B;  3CJN A;  2XIG A;  1FT9 A;  2X4H A;  3RKY A;  3ABU A;  1WI9 A;  3I58 A;  3HRM A;  4BAY A;  2L01 A;  3KE2 A;  1FYM A;  3P7N A;  3L7W A;  1BN5 A;  5FD5 A;  5KVR A;  2K02 A;  5LGT A;  5CVI A;  4LGW A;  1EV7 A;  4RAY A;  3T8T A;  3QAH A;  1V3F A;  1IN4 A;  2J5P A;  2DAO A;  3GZ5 A;  5FD6 A;  3E3V A;  1FPQ A;  1YG2 A;  1F9N A;  2PBI A;  3S2W A;  2OZ6 A;  2WTE A;  5ED4 A;  1LQ1 A;  2P5V A;  3HHH A;  4WXC A;  4MTE A;  1VTN C;  3HRU A;  5DCF A;  3D5L A;  3J7A O;  3I59 A;  4HA8 A;  2BV6 A;  5FGM A;  4OOI A;  4ETS A;  3CUQ C;  3FMQ A;  1AWC A;  3REO A;  4LMY A;  2GXG A;  2NS0 A;  1ZH5 A;  2HGC A;  5HLH A;  5HOO A;  3EYY A;  4U0V A;  5BPD A;  5FLX K;  1YQA A;  4EM2 A;  5LGU A;  4CGZ A;  1XGO A;  2DFI A;  1IXS B;  4MHG A;  3AAF A;  4RAZ A;  2RDP A;  2EK5 A;  2VE9 A;  1E17 A;  2Z33 A;  2F5C A;  3TO7 A;  1XMA A;  2IA1 A;  1HKT A;  4G6Q A;  4LK0 F;  4OIN F;  1K78 A;  2EFO A;  3KP4 A;  4U0W A;  1QO0 D;  2V1D A;  3RJP A;  3WE3 A;  4GO1 A;  3FZV A;  2OAZ A;  4XLN F;  3U1D A;  3BPX A;  2CW0 F;  2YX4 A;  3KP5 A;  4GYG A;  3Q5F A;  4TV7 A;  4AIJ A;  1SD5 A;  4OIR F;  1CF7 B;  1XB4 A;  4EM0 B;  3EDP A;  3GFJ A;  3ZMV A;  2RKH A;  4KIF A;  5IT9 Z;  4GGG A;  4I09 A;  3G3Z A;  1JHH A;  2VE8 A;  4HOB A;  2XAQ A;  4KMU X;  3WTS C;  1B1B A;  3E6M A;  3FHZ A;  3F22 A;  2VBZ A;  3I54 A;  3QPT A;  4UXN A;  3IRR A;  1SD4 A;  2LF7 A;  4HF0 A;  2RV8 A;  2QQ9 A;  3KFW X;  3I71 A;  4BQA A;  1RNL A;  3R0J A;  4LK1 F;  3WGH A;  2EV6 A;  2VC0 A;  2KIF A;  3ABT A;  3C3W A;  1R1V A;  4CZZ A;  3SFZ A;  3TQN A;  1FP2 A;  4JK1 X;  3WTV C;  2DPD A;  2FML A;  2H94 A;  2FBH A;  4M72 A;  3B02 A;  2VON A;  5DD4 A;  2ACJ A;  2P7V B;  2MH9 A;  2RN7 A;  2A61 A;  4BNC A;  1O3T A;  1YW9 A;  2A6H F;  1YLF A;  4IRI A;  3WU0 A;  4IRH A;  1FYL A;  5ICG A;  1XMK A;  2HKO A;  4RB2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...