3MFVA

Crystal structure of human arginase i in complex with 2-aminohomohistidine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
313
structure length
313
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title 2-aminoimidazole amino acids as inhibitors of the binuclear manganese metalloenzyme human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2010-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3mfvA00
3E6VA 1T4TA 3DJ8A 4ITYA 3SKKA 4Q42A 4MYFA 4IU1A 4CEVA 5CEVA 1TA1A 3LHLA 1RLAA 4HZEA 1PQ3A 3THJA 1ZPEA 1R1OA 3MFWA 4RHJA 4GWCA 4MYLA 2PLLA 1GQ6A 1P8NA 1WOHA 5RLAA 4Q3PA 4Q40A 1T4PA 4HXQA 4RHQA 3SL1A 1HQGA 3LP4A 2CEVA 4Q3QA 1GQ7A 3MFVA 3MJLA 3TH7A 2ZAVA 1D3VA 1P8MA 4Q3UA 1HQ5A 4RHKA 1P8PA 3E8ZA 4GSZA 4I06A 4IU4A 1P8OA 4MYKA 3NIQA 3E6KA 1T5GA 4IXUA 4DZ4A 1ZPGA 3SJTA 1HQHA 2EIVA 1TBHA 4HWWA 1WVAA 4IE2A 3CEVA 4IXVA 3E8QA 4FCKA 3LP7A 1TBLA 4RHMA 4RLAA 4RHLA 3E9BA 3F80A 4MYNA 4Q3TA 3GN0A 3SL0A 4IU5A 3GMZA 3TF3A 4FCIA 3NIOA 2EF4A 1TBJA 1WOGA 4GSVA 1P8QA 1T4SA 3PZLA 4Q3VA 2A0MA 1CEVA 4Q3SA 5HJAA 4GWDA 1T5FA 4GSMA 4Q3RC 2EF5A 3KV2A 1WOIA 1WVBA 4Q3RA 1HQFA 2AEBA 4RHIA 4IU0A 4G3HA 1P8RA 1HQXA 3M1RA 3THHA 2PHOA 1P8SA 2PHAA 4MXRA 4IE1A 4Q41A 3NIPA 2RLAA 3MMRA 4IE3A 3RLAA 1XFKA 5HJ9A 1T4RA 3THEA
chains in the Genus database with same CATH superfamily
2VQMA 5LI3A 3E6VA 1T4TA 4A69A 3DJ8A 1ZZ0A 2GH6A 4ITYA 3SKKA 4QA4A 4Q42A 3RQDA 1C3SA 4MYFA 4IU1A 4CEVA 5CEVA 5JI5A 5D1DA 1TA1A 4QA6A 2VQOA 5G0XA 3LHLA 1RLAA 5A2SA 4QA5A 4HZEA 5G10A 4BZ6A 3EZTA 1T67A 4BKXB 1PQ3A 3EZPA 3THJA 4LXZA 5EFHA 1ZPEA 1R1OA 3EW8A 3MFWA 5EEKA 4RHJA 4GWCA 4MYLA 5DC7A 4ZUPA 2PLLA 1GQ6A 4QA1A 1P8NA 3F07A 5EEIA 1T69A 5G13A 5ICNB 3Q9EA 1WOHA 5EEMA 5FUEA 4Q3PA 5RLAA 3C0YA 4Q40A 1T4PA 5EEFA 5EFJD 4HXQA 4RHQA 3SL1A 3ZNRA 4ZUQA 1HQGA 5G0JA 3LP4A 2CEVA 5EF8A 4Q3QA 1GQ7A 3MFVA 3F0RA 3MJLA 3MENA 5G1AA 2VQWG 3MAXA 5DC6A 1C3PA 3TH7A 2ZAVA 1D3VA 1C3RA 5EFNA 1P8MA 5EFBD 4ZURA 4Q3UA 4ZUNA 2VQJA 1HQ5A 4RHKA 1P8PA 3E8ZA 4ZUOA 4GSZA 4QA3A 5G12A 4I06A 4IU4A 1P8OA 5EENA 4MYKA 5IWGA 4LY1A 5G1BA 3NIQA 2V5WA 3MZ6A 5EFGA 4BZ7A 4CBYA 4CQFA 3E6KA 1T5GA 4IXUA 4DZ4A 5D1CA 1ZPGA 5G0HA 4QA7A 3SJTA 4RN0A 5THSA 1HQHA 2EIVA 2VQVA 1TBHA 3MZ3A 4CBTA 4HWWA 1WVAA 4IE2A 5DC5A 3ZNSA 4BZ9A 3MZ4A 3CEVA 4IXVA 3E8QA 4FCKA 3LP7A 3EWFA 1TBLA 4RHMA 4RLAA 5G11A 1ZZ3A 4RHLA 3F06A 5G0GA 3E9BA 5DC8A 3Q9BA 5G0IA 3F80A 4MYNA 1VKGA 4Q3TA 3GN0A 5FCWA 3C0ZA 5G3WA 3SL0A 4IU5A 3Q9CA 5G1CA 3GMZA 3TF3A 4BZ5A 4FCIA 4RN2A 3C10A 1T64A 2EF4A 3NIOA 1TBJA 1WOGA 4GSVA 3SFFA 1P8QA 5EF7A 5BWZA 1T4SA 3PZLA 4Q3VA 2A0MA 4RN1A 5EFKB 5THVA 1CEVA 4Q3SA 5HJAA 5G17A 4GWDA 1T5FA 4GSMA 4Q3RC 4QA0A 2EF5A 3SFHA 3KV2A 1WOIA 4BZ8A 4ZUMA 1WVBA 4Q3RA 2AEBA 1HQFA 1W22A 5D1BA 5G0YA 3Q9FA 4RHIA 4IU0A 2V5XA 4G3HA 1P8RA 1HQXA 1ZZ1A 3M1RA 3THHA 2PHOA 1P8SA 2PHAA 4MXRA 4QA2A 4IE1A 4Q41A 3NIPA 5THTA 2RLAA 3MMRA 2VQQA 4IE3A 3RLAA 3MZ7A 1XFKA 5HJ9A 5IX0A 5THUA 1T4RA 2VCGA 3THEA
chains in the Genus database with same CATH topology
3E6VA 1T4TA 3DJ8A 4ITYA 3SKKA 4Q42A 4MYFA 4IU1A 4CEVA 5CEVA 1TA1A 3LHLA 1RLAA 4HZEA 1PQ3A 3THJA 1ZPEA 1R1OA 3MFWA 4RHJA 4GWCA 4MYLA 2PLLA 1GQ6A 1P8NA 1WOHA 5RLAA 4Q3PA 4Q40A 1T4PA 4HXQA 4RHQA 3SL1A 1HQGA 3LP4A 2CEVA 4Q3QA 1GQ7A 3MFVA 3MJLA 3TH7A 2ZAVA 1D3VA 1P8MA 4Q3UA 1HQ5A 4RHKA 1P8PA 3E8ZA 4GSZA 4I06A 4IU4A 1P8OA 4MYKA 3NIQA 3E6KA 1T5GA 4IXUA 4DZ4A 1ZPGA 3SJTA 1HQHA 2EIVA 1TBHA 4HWWA 1WVAA 4IE2A 3CEVA 4IXVA 3E8QA 4FCKA 3LP7A 1TBLA 4RHMA 4RLAA 4RHLA 3E9BA 3F80A 4MYNA 4Q3TA 3GN0A 3SL0A 4IU5A 3GMZA 3TF3A 4FCIA 3NIOA 2EF4A 1TBJA 1WOGA 4GSVA 1P8QA 1T4SA 3PZLA 4Q3VA 2A0MA 1CEVA 4Q3SA 5HJAA 4GWDA 1T5FA 4GSMA 4Q3RC 2EF5A 3KV2A 1WOIA 1WVBA 4Q3RA 1HQFA 2AEBA 4RHIA 4IU0A 4G3HA 1P8RA 1HQXA 3M1RA 3THHA 2PHOA 1P8SA 2PHAA 4MXRA 4IE1A 4Q41A 3NIPA 2RLAA 3MMRA 4IE3A 3RLAA 1XFKA 5HJ9A 1T4RA 3THEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6V A;  1T4T A;  3DJ8 A;  4ITY A;  3SKK A;  4Q42 A;  4MYF A;  4IU1 A;  4CEV A;  5CEV A;  1TA1 A;  3LHL A;  1RLA A;  4HZE A;  1PQ3 A;  3THJ A;  1ZPE A;  1R1O A;  3MFW A;  4RHJ A;  4GWC A;  4MYL A;  2PLL A;  1GQ6 A;  1P8N A;  1WOH A;  5RLA A;  4Q3P A;  4Q40 A;  1T4P A;  4HXQ A;  4RHQ A;  3SL1 A;  1HQG A;  3LP4 A;  2CEV A;  4Q3Q A;  1GQ7 A;  3MFV A;  3MJL A;  3TH7 A;  2ZAV A;  1D3V A;  1P8M A;  4Q3U A;  1HQ5 A;  4RHK A;  1P8P A;  3E8Z A;  4GSZ A;  4I06 A;  4IU4 A;  1P8O A;  4MYK A;  3NIQ A;  3E6K A;  1T5G A;  4IXU A;  4DZ4 A;  1ZPG A;  3SJT A;  1HQH A;  2EIV A;  1TBH A;  4HWW A;  1WVA A;  4IE2 A;  3CEV A;  4IXV A;  3E8Q A;  4FCK A;  3LP7 A;  1TBL A;  4RHM A;  4RLA A;  4RHL A;  3E9B A;  3F80 A;  4MYN A;  4Q3T A;  3GN0 A;  3SL0 A;  4IU5 A;  3GMZ A;  3TF3 A;  4FCI A;  3NIO A;  2EF4 A;  1TBJ A;  1WOG A;  4GSV A;  1P8Q A;  1T4S A;  3PZL A;  4Q3V A;  2A0M A;  1CEV A;  4Q3S A;  5HJA A;  4GWD A;  1T5F A;  4GSM A;  4Q3R C;  2EF5 A;  3KV2 A;  1WOI A;  1WVB A;  4Q3R A;  1HQF A;  2AEB A;  4RHI A;  4IU0 A;  4G3H A;  1P8R A;  1HQX A;  3M1R A;  3THH A;  2PHO A;  1P8S A;  2PHA A;  4MXR A;  4IE1 A;  4Q41 A;  3NIP A;  2RLA A;  3MMR A;  4IE3 A;  3RLA A;  1XFK A;  5HJ9 A;  1T4R A;  3THE A; 
#chains in the Genus database with same CATH topology
 2VQM A;  5LI3 A;  3E6V A;  1T4T A;  4A69 A;  3DJ8 A;  1ZZ0 A;  2GH6 A;  4ITY A;  3SKK A;  4QA4 A;  4Q42 A;  3RQD A;  1C3S A;  4MYF A;  4IU1 A;  4CEV A;  5CEV A;  5JI5 A;  5D1D A;  1TA1 A;  4QA6 A;  2VQO A;  5G0X A;  3LHL A;  1RLA A;  5A2S A;  4QA5 A;  4HZE A;  5G10 A;  4BZ6 A;  3EZT A;  1T67 A;  4BKX B;  1PQ3 A;  3EZP A;  3THJ A;  4LXZ A;  5EFH A;  1ZPE A;  1R1O A;  3EW8 A;  3MFW A;  5EEK A;  4RHJ A;  4GWC A;  4MYL A;  5DC7 A;  4ZUP A;  2PLL A;  1GQ6 A;  4QA1 A;  1P8N A;  3F07 A;  5EEI A;  1T69 A;  5G13 A;  5ICN B;  3Q9E A;  1WOH A;  5EEM A;  5FUE A;  4Q3P A;  5RLA A;  3C0Y A;  4Q40 A;  1T4P A;  5EEF A;  5EFJ D;  4HXQ A;  4RHQ A;  3SL1 A;  3ZNR A;  4ZUQ A;  1HQG A;  5G0J A;  3LP4 A;  2CEV A;  5EF8 A;  4Q3Q A;  1GQ7 A;  3MFV A;  3F0R A;  3MJL A;  3MEN A;  5G1A A;  2VQW G;  3MAX A;  5DC6 A;  1C3P A;  3TH7 A;  2ZAV A;  1D3V A;  1C3R A;  5EFN A;  1P8M A;  5EFB D;  4ZUR A;  4Q3U A;  4ZUN A;  2VQJ A;  1HQ5 A;  4RHK A;  1P8P A;  3E8Z A;  4ZUO A;  4GSZ A;  4QA3 A;  5G12 A;  4I06 A;  4IU4 A;  1P8O A;  5EEN A;  4MYK A;  5IWG A;  4LY1 A;  5G1B A;  3NIQ A;  2V5W A;  3MZ6 A;  5EFG A;  4BZ7 A;  4CBY A;  4CQF A;  3E6K A;  1T5G A;  4IXU A;  4DZ4 A;  5D1C A;  1ZPG A;  5G0H A;  4QA7 A;  3SJT A;  4RN0 A;  5THS A;  1HQH A;  2EIV A;  2VQV A;  1TBH A;  3MZ3 A;  4CBT A;  4HWW A;  1WVA A;  4IE2 A;  5DC5 A;  3ZNS A;  4BZ9 A;  3MZ4 A;  3CEV A;  4IXV A;  3E8Q A;  4FCK A;  3LP7 A;  3EWF A;  1TBL A;  4RHM A;  4RLA A;  5G11 A;  1ZZ3 A;  4RHL A;  3F06 A;  5G0G A;  3E9B A;  5DC8 A;  3Q9B A;  5G0I A;  3F80 A;  4MYN A;  1VKG A;  4Q3T A;  3GN0 A;  5FCW A;  3C0Z A;  5G3W A;  3SL0 A;  4IU5 A;  3Q9C A;  5G1C A;  3GMZ A;  3TF3 A;  4BZ5 A;  4FCI A;  4RN2 A;  3C10 A;  1T64 A;  2EF4 A;  3NIO A;  1TBJ A;  1WOG A;  4GSV A;  3SFF A;  1P8Q A;  5EF7 A;  5BWZ A;  1T4S A;  3PZL A;  4Q3V A;  2A0M A;  4RN1 A;  5EFK B;  5THV A;  1CEV A;  4Q3S A;  5HJA A;  5G17 A;  4GWD A;  1T5F A;  4GSM A;  4Q3R C;  4QA0 A;  2EF5 A;  3SFH A;  3KV2 A;  1WOI A;  4BZ8 A;  4ZUM A;  1WVB A;  4Q3R A;  2AEB A;  1HQF A;  1W22 A;  5D1B A;  5G0Y A;  3Q9F A;  4RHI A;  4IU0 A;  2V5X A;  4G3H A;  1P8R A;  1HQX A;  1ZZ1 A;  3M1R A;  3THH A;  2PHO A;  1P8S A;  2PHA A;  4MXR A;  4QA2 A;  4IE1 A;  4Q41 A;  3NIP A;  5THT A;  2RLA A;  3MMR A;  2VQQ A;  4IE3 A;  3RLA A;  3MZ7 A;  1XFK A;  5HJ9 A;  5IX0 A;  5THU A;  1T4R A;  2VCG A;  3THE A; 
#chains in the Genus database with same CATH homology
 3E6V A;  1T4T A;  3DJ8 A;  4ITY A;  3SKK A;  4Q42 A;  4MYF A;  4IU1 A;  4CEV A;  5CEV A;  1TA1 A;  3LHL A;  1RLA A;  4HZE A;  1PQ3 A;  3THJ A;  1ZPE A;  1R1O A;  3MFW A;  4RHJ A;  4GWC A;  4MYL A;  2PLL A;  1GQ6 A;  1P8N A;  1WOH A;  5RLA A;  4Q3P A;  4Q40 A;  1T4P A;  4HXQ A;  4RHQ A;  3SL1 A;  1HQG A;  3LP4 A;  2CEV A;  4Q3Q A;  1GQ7 A;  3MFV A;  3MJL A;  3TH7 A;  2ZAV A;  1D3V A;  1P8M A;  4Q3U A;  1HQ5 A;  4RHK A;  1P8P A;  3E8Z A;  4GSZ A;  4I06 A;  4IU4 A;  1P8O A;  4MYK A;  3NIQ A;  3E6K A;  1T5G A;  4IXU A;  4DZ4 A;  1ZPG A;  3SJT A;  1HQH A;  2EIV A;  1TBH A;  4HWW A;  1WVA A;  4IE2 A;  3CEV A;  4IXV A;  3E8Q A;  4FCK A;  3LP7 A;  1TBL A;  4RHM A;  4RLA A;  4RHL A;  3E9B A;  3F80 A;  4MYN A;  4Q3T A;  3GN0 A;  3SL0 A;  4IU5 A;  3GMZ A;  3TF3 A;  4FCI A;  3NIO A;  2EF4 A;  1TBJ A;  1WOG A;  4GSV A;  1P8Q A;  1T4S A;  3PZL A;  4Q3V A;  2A0M A;  1CEV A;  4Q3S A;  5HJA A;  4GWD A;  1T5F A;  4GSM A;  4Q3R C;  2EF5 A;  3KV2 A;  1WOI A;  1WVB A;  4Q3R A;  1HQF A;  2AEB A;  4RHI A;  4IU0 A;  4G3H A;  1P8R A;  1HQX A;  3M1R A;  3THH A;  2PHO A;  1P8S A;  2PHA A;  4MXR A;  4IE1 A;  4Q41 A;  3NIP A;  2RLA A;  3MMR A;  4IE3 A;  3RLA A;  1XFK A;  5HJ9 A;  1T4R A;  3THE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...