3MFVA

Crystal structure of human arginase i in complex with 2-aminohomohistidine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
313
structure length
313
Chain Sequence
RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title 2-aminoimidazole amino acids as inhibitors of the binuclear manganese metalloenzyme human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2010-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3mfvA00
1PQ3A 1WOIA 3E6VA 3SL0A 1GQ7A 3E6KA 4Q3QA 4RHIA 3TF3A 3CEVA 1T5GA 2EF4A 3MFVA 4Q3RA 1D3VA 1TBLA 1CEVA 4I06A 4GSZA 4IE3A 1GQ6A 2A0MA 4RLAA 2EF5A 2AEBA 3PZLA 1P8QA 1R1OA 4IU0A 4HXQA 4Q3VA 1TBJA 3RLAA 1T4PA 4GSMA 3LHLA 4RHJA 3MFWA 1P8NA 5HJAA 3M1RA 1T4SA 4HWWA 1WOGA 2ZAVA 1HQHA 3SKKA 1P8RA 4CEVA 5CEVA 3MJLA 4G3HA 1P8PA 2PLLA 4Q3RC 3SJTA 1HQ5A 4Q3SA 3E8QA 4RHLA 4IXUA 4IE2A 4GWCA 3SL1A 1HQGA 3GN0A 1WVBA 4GWDA 3NIQA 1ZPGA 4MXRA 4RHQA 4MYKA 4GSVA 4DZ4A 1P8MA 2RLAA 3KV2A 4RHMA 3THJA 1T5FA 3DJ8A 4HZEA 4Q3PA 3LP7A 3GMZA 1RLAA 3E9BA 1TBHA 4Q3TA 1HQFA 3TH7A 1T4TA 1P8SA 4Q41A 4FCKA 1TA1A 4MYLA 4MYFA 4Q42A 3NIPA 1WVAA 4IE1A 2PHOA 3MMRA 3LP4A 3THEA 1WOHA 4IXVA 1HQXA 3NIOA 2PHAA 4IU4A 1T4RA 4FCIA 4Q3UA 1P8OA 4Q40A 3THHA 4ITYA 4IU1A 4MYNA 5RLAA 2EIVA 2CEVA 5HJ9A 4RHKA 3E8ZA 1XFKA 3F80A 1ZPEA 4IU5A
chains in the Genus database with same CATH superfamily
3MAXA 5A2SA 1PQ3A 1WOIA 1ZZ1A 3E6VA 5EEFA 3SL0A 4BZ7A 1GQ7A 4BKXB 3E6KA 4Q3QA 4RHIA 2V5XA 4BZ9A 5BWZA 3TF3A 3CEVA 1T5GA 2EF4A 3MFVA 4Q3RA 1D3VA 1TBLA 1CEVA 5EFJD 4I06A 4GSZA 3ZNSA 4IE3A 4QA5A 1GQ6A 5G1CA 2A0MA 4RLAA 2EF5A 2GH6A 4QA6A 5FCWA 5IWGA 2AEBA 1ZZ0A 3PZLA 1P8QA 4ZUOA 1R1OA 4IU0A 5G0JA 4HXQA 5D1DA 2V5WA 4Q3VA 1TBJA 3RLAA 1T4PA 3LHLA 4GSMA 4QA4A 4RHJA 3MFWA 3Q9CA 5G0XA 2VQVA 1P8NA 5FUEA 5IX0A 5THUA 1T4SA 3M1RA 4HWWA 5G12A 5HJAA 1WOGA 2ZAVA 1HQHA 3SKKA 1P8RA 4CEVA 4CQFA 5G0GA 4BZ8A 3EZTA 3MZ3A 5EF7A 3SFFA 5DC8A 5CEVA 4QA3A 5JI5A 3MJLA 4G3HA 5G1AA 5G17A 3F07A 5G3WA 5G0YA 5DC7A 1P8PA 2PLLA 4Q3RC 3SJTA 1HQ5A 4Q3SA 5THTA 4LXZA 5EFBD 3F0RA 3E8QA 4RHLA 3EW8A 2VQMA 4IE2A 4IXUA 3ZNRA 4GWCA 3SL1A 1HQGA 5EENA 5G0IA 3GN0A 1WVBA 4GWDA 4ZURA 2VQJA 3EWFA 3NIQA 5ICNB 5THVA 1W22A 4LY1A 1ZPGA 1C3SA 4MXRA 3Q9BA 5D1BA 1ZZ3A 4RN0A 4RN2A 5D1CA 4RHQA 4BZ5A 4MYKA 5EEIA 4GSVA 5G13A 1P8MA 2RLAA 3KV2A 4RHMA 3THJA 4DZ4A 3MZ6A 5G11A 4CBYA 1T5FA 3DJ8A 4HZEA 4Q3PA 3LP7A 3GMZA 4QA0A 1RLAA 5EFNA 3E9BA 3EZPA 3RQDA 4BZ6A 4RN1A 1T69A 1TBHA 4Q3TA 1HQFA 2VQWG 3TH7A 1T4TA 3MENA 1P8SA 5G10A 4Q41A 4FCKA 1C3PA 1TA1A 4MYLA 3C0YA 4MYFA 5EF8A 3C0ZA 4Q42A 3NIPA 1WVAA 4IE1A 2PHOA 3MMRA 5DC6A 3LP4A 2VQOA 1T67A 3THEA 4A69A 1WOHA 4QA7A 3MZ4A 1VKGA 4IXVA 1HQXA 3C10A 3NIOA 2VCGA 5EFHA 4ZUQA 3MZ7A 5LI3A 2PHAA 5THSA 3Q9EA 3Q9FA 4IU4A 1T4RA 4FCIA 4Q3UA 2VQQA 4QA1A 3F06A 1P8OA 5DC5A 4Q40A 3THHA 4CBTA 4ITYA 5EFGA 4IU1A 5G1BA 4MYNA 5EFKB 4QA2A 4ZUMA 5RLAA 2EIVA 4ZUPA 2CEVA 5HJ9A 5G0HA 5EEKA 4RHKA 5EEMA 4ZUNA 3E8ZA 3SFHA 1T64A 1XFKA 3F80A 1C3RA 1ZPEA 4IU5A
chains in the Genus database with same CATH topology
1PQ3A 1WOIA 3E6VA 3SL0A 1GQ7A 3E6KA 4Q3QA 4RHIA 3TF3A 3CEVA 1T5GA 2EF4A 3MFVA 4Q3RA 1D3VA 1TBLA 1CEVA 4I06A 4GSZA 4IE3A 1GQ6A 2A0MA 4RLAA 2EF5A 2AEBA 3PZLA 1P8QA 1R1OA 4IU0A 4HXQA 4Q3VA 1TBJA 3RLAA 1T4PA 4GSMA 3LHLA 4RHJA 3MFWA 1P8NA 5HJAA 3M1RA 1T4SA 4HWWA 1WOGA 2ZAVA 1HQHA 3SKKA 1P8RA 4CEVA 5CEVA 3MJLA 4G3HA 1P8PA 2PLLA 4Q3RC 3SJTA 1HQ5A 4Q3SA 3E8QA 4RHLA 4IXUA 4IE2A 4GWCA 3SL1A 1HQGA 3GN0A 1WVBA 4GWDA 3NIQA 1ZPGA 4MXRA 4RHQA 4MYKA 4GSVA 4DZ4A 1P8MA 2RLAA 3KV2A 4RHMA 3THJA 1T5FA 3DJ8A 4HZEA 4Q3PA 3LP7A 3GMZA 1RLAA 3E9BA 1TBHA 4Q3TA 1HQFA 3TH7A 1T4TA 1P8SA 4Q41A 4FCKA 1TA1A 4MYLA 4MYFA 4Q42A 3NIPA 1WVAA 4IE1A 2PHOA 3MMRA 3LP4A 3THEA 1WOHA 4IXVA 1HQXA 3NIOA 2PHAA 4IU4A 1T4RA 4FCIA 4Q3UA 1P8OA 4Q40A 3THHA 4ITYA 4IU1A 4MYNA 5RLAA 2EIVA 2CEVA 5HJ9A 4RHKA 3E8ZA 1XFKA 3F80A 1ZPEA 4IU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQ3 A;  1WOI A;  3E6V A;  3SL0 A;  1GQ7 A;  3E6K A;  4Q3Q A;  4RHI A;  3TF3 A;  3CEV A;  1T5G A;  2EF4 A;  3MFV A;  4Q3R A;  1D3V A;  1TBL A;  1CEV A;  4I06 A;  4GSZ A;  4IE3 A;  1GQ6 A;  2A0M A;  4RLA A;  2EF5 A;  2AEB A;  3PZL A;  1P8Q A;  1R1O A;  4IU0 A;  4HXQ A;  4Q3V A;  1TBJ A;  3RLA A;  1T4P A;  4GSM A;  3LHL A;  4RHJ A;  3MFW A;  1P8N A;  5HJA A;  3M1R A;  1T4S A;  4HWW A;  1WOG A;  2ZAV A;  1HQH A;  3SKK A;  1P8R A;  4CEV A;  5CEV A;  3MJL A;  4G3H A;  1P8P A;  2PLL A;  4Q3R C;  3SJT A;  1HQ5 A;  4Q3S A;  3E8Q A;  4RHL A;  4IXU A;  4IE2 A;  4GWC A;  3SL1 A;  1HQG A;  3GN0 A;  1WVB A;  4GWD A;  3NIQ A;  1ZPG A;  4MXR A;  4RHQ A;  4MYK A;  4GSV A;  4DZ4 A;  1P8M A;  2RLA A;  3KV2 A;  4RHM A;  3THJ A;  1T5F A;  3DJ8 A;  4HZE A;  4Q3P A;  3LP7 A;  3GMZ A;  1RLA A;  3E9B A;  1TBH A;  4Q3T A;  1HQF A;  3TH7 A;  1T4T A;  1P8S A;  4Q41 A;  4FCK A;  1TA1 A;  4MYL A;  4MYF A;  4Q42 A;  3NIP A;  1WVA A;  4IE1 A;  2PHO A;  3MMR A;  3LP4 A;  3THE A;  1WOH A;  4IXV A;  1HQX A;  3NIO A;  2PHA A;  4IU4 A;  1T4R A;  4FCI A;  4Q3U A;  1P8O A;  4Q40 A;  3THH A;  4ITY A;  4IU1 A;  4MYN A;  5RLA A;  2EIV A;  2CEV A;  5HJ9 A;  4RHK A;  3E8Z A;  1XFK A;  3F80 A;  1ZPE A;  4IU5 A; 
#chains in the Genus database with same CATH topology
 3MAX A;  5A2S A;  1PQ3 A;  1WOI A;  1ZZ1 A;  3E6V A;  5EEF A;  3SL0 A;  4BZ7 A;  1GQ7 A;  4BKX B;  3E6K A;  4Q3Q A;  4RHI A;  2V5X A;  4BZ9 A;  5BWZ A;  3TF3 A;  3CEV A;  1T5G A;  2EF4 A;  3MFV A;  4Q3R A;  1D3V A;  1TBL A;  1CEV A;  5EFJ D;  4I06 A;  4GSZ A;  3ZNS A;  4IE3 A;  4QA5 A;  1GQ6 A;  5G1C A;  2A0M A;  4RLA A;  2EF5 A;  2GH6 A;  4QA6 A;  5FCW A;  5IWG A;  2AEB A;  1ZZ0 A;  3PZL A;  1P8Q A;  4ZUO A;  1R1O A;  4IU0 A;  5G0J A;  4HXQ A;  5D1D A;  2V5W A;  4Q3V A;  1TBJ A;  3RLA A;  1T4P A;  3LHL A;  4GSM A;  4QA4 A;  4RHJ A;  3MFW A;  3Q9C A;  5G0X A;  2VQV A;  1P8N A;  5FUE A;  5IX0 A;  5THU A;  1T4S A;  3M1R A;  4HWW A;  5G12 A;  5HJA A;  1WOG A;  2ZAV A;  1HQH A;  3SKK A;  1P8R A;  4CEV A;  4CQF A;  5G0G A;  4BZ8 A;  3EZT A;  3MZ3 A;  5EF7 A;  3SFF A;  5DC8 A;  5CEV A;  4QA3 A;  5JI5 A;  3MJL A;  4G3H A;  5G1A A;  5G17 A;  3F07 A;  5G3W A;  5G0Y A;  5DC7 A;  1P8P A;  2PLL A;  4Q3R C;  3SJT A;  1HQ5 A;  4Q3S A;  5THT A;  4LXZ A;  5EFB D;  3F0R A;  3E8Q A;  4RHL A;  3EW8 A;  2VQM A;  4IE2 A;  4IXU A;  3ZNR A;  4GWC A;  3SL1 A;  1HQG A;  5EEN A;  5G0I A;  3GN0 A;  1WVB A;  4GWD A;  4ZUR A;  2VQJ A;  3EWF A;  3NIQ A;  5ICN B;  5THV A;  1W22 A;  4LY1 A;  1ZPG A;  1C3S A;  4MXR A;  3Q9B A;  5D1B A;  1ZZ3 A;  4RN0 A;  4RN2 A;  5D1C A;  4RHQ A;  4BZ5 A;  4MYK A;  5EEI A;  4GSV A;  5G13 A;  1P8M A;  2RLA A;  3KV2 A;  4RHM A;  3THJ A;  4DZ4 A;  3MZ6 A;  5G11 A;  4CBY A;  1T5F A;  3DJ8 A;  4HZE A;  4Q3P A;  3LP7 A;  3GMZ A;  4QA0 A;  1RLA A;  5EFN A;  3E9B A;  3EZP A;  3RQD A;  4BZ6 A;  4RN1 A;  1T69 A;  1TBH A;  4Q3T A;  1HQF A;  2VQW G;  3TH7 A;  1T4T A;  3MEN A;  1P8S A;  5G10 A;  4Q41 A;  4FCK A;  1C3P A;  1TA1 A;  4MYL A;  3C0Y A;  4MYF A;  5EF8 A;  3C0Z A;  4Q42 A;  3NIP A;  1WVA A;  4IE1 A;  2PHO A;  3MMR A;  5DC6 A;  3LP4 A;  2VQO A;  1T67 A;  3THE A;  4A69 A;  1WOH A;  4QA7 A;  3MZ4 A;  1VKG A;  4IXV A;  1HQX A;  3C10 A;  3NIO A;  2VCG A;  5EFH A;  4ZUQ A;  3MZ7 A;  5LI3 A;  2PHA A;  5THS A;  3Q9E A;  3Q9F A;  4IU4 A;  1T4R A;  4FCI A;  4Q3U A;  2VQQ A;  4QA1 A;  3F06 A;  1P8O A;  5DC5 A;  4Q40 A;  3THH A;  4CBT A;  4ITY A;  5EFG A;  4IU1 A;  5G1B A;  4MYN A;  5EFK B;  4QA2 A;  4ZUM A;  5RLA A;  2EIV A;  4ZUP A;  2CEV A;  5HJ9 A;  5G0H A;  5EEK A;  4RHK A;  5EEM A;  4ZUN A;  3E8Z A;  3SFH A;  1T64 A;  1XFK A;  3F80 A;  1C3R A;  1ZPE A;  4IU5 A; 
#chains in the Genus database with same CATH homology
 1PQ3 A;  1WOI A;  3E6V A;  3SL0 A;  1GQ7 A;  3E6K A;  4Q3Q A;  4RHI A;  3TF3 A;  3CEV A;  1T5G A;  2EF4 A;  3MFV A;  4Q3R A;  1D3V A;  1TBL A;  1CEV A;  4I06 A;  4GSZ A;  4IE3 A;  1GQ6 A;  2A0M A;  4RLA A;  2EF5 A;  2AEB A;  3PZL A;  1P8Q A;  1R1O A;  4IU0 A;  4HXQ A;  4Q3V A;  1TBJ A;  3RLA A;  1T4P A;  4GSM A;  3LHL A;  4RHJ A;  3MFW A;  1P8N A;  5HJA A;  3M1R A;  1T4S A;  4HWW A;  1WOG A;  2ZAV A;  1HQH A;  3SKK A;  1P8R A;  4CEV A;  5CEV A;  3MJL A;  4G3H A;  1P8P A;  2PLL A;  4Q3R C;  3SJT A;  1HQ5 A;  4Q3S A;  3E8Q A;  4RHL A;  4IXU A;  4IE2 A;  4GWC A;  3SL1 A;  1HQG A;  3GN0 A;  1WVB A;  4GWD A;  3NIQ A;  1ZPG A;  4MXR A;  4RHQ A;  4MYK A;  4GSV A;  4DZ4 A;  1P8M A;  2RLA A;  3KV2 A;  4RHM A;  3THJ A;  1T5F A;  3DJ8 A;  4HZE A;  4Q3P A;  3LP7 A;  3GMZ A;  1RLA A;  3E9B A;  1TBH A;  4Q3T A;  1HQF A;  3TH7 A;  1T4T A;  1P8S A;  4Q41 A;  4FCK A;  1TA1 A;  4MYL A;  4MYF A;  4Q42 A;  3NIP A;  1WVA A;  4IE1 A;  2PHO A;  3MMR A;  3LP4 A;  3THE A;  1WOH A;  4IXV A;  1HQX A;  3NIO A;  2PHA A;  4IU4 A;  1T4R A;  4FCI A;  4Q3U A;  1P8O A;  4Q40 A;  3THH A;  4ITY A;  4IU1 A;  4MYN A;  5RLA A;  2EIV A;  2CEV A;  5HJ9 A;  4RHK A;  3E8Z A;  1XFK A;  3F80 A;  1ZPE A;  4IU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...