3MG5A

Core-streptavidin mutant f130l in complex with biotin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTLTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title A distal point mutation in the streptavidin-biotin complex preserves structure but diminishes binding affinity: experimental evidence of electronic polarization effects?
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Biotin-binding protein
total genus 27
structure length 119
sequence length 119
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 3mg5A00
2IZLB 2RTAA 2OFAA 1SWSA 4GGRA 1SWCA 2G5LA 1N7YA 2RTNB 3T6FA 4GGTA 2A5CA 3RY2A 3RE6A 3SZIA 2IZDB 1SWNA 3EW1A 1LCVA 2Y3FA 1SRGA 1VWMB 1SLGB 1SREA 2RTOB 1VWRB 2FHLA 1HY2A 4YVBA 2IZIA 2OFBA 2RTEB 4Z2PA 4Z28A 1LUQA 3MG5A 1SLFB 3T6LA 2GH7A 2RTCB 1PTSA 4CPHA 4Y5DA 4Z6JA 1NC9A 3WYPA 4BCSA 1MK5A 3RE5A 3VHMA 4GGZA 4BX5B 2C1QA 1HXLA 2AVIA 5B5GA 3SZHA 1N4JA 1NQMA 3FDCA 2CAMA 4GDAA 1Y53X 1VWAB 1VWCB 1N9MA 4OKAA 1SWRA 4U46A 2MF6A 1SWAA 1SWBA 3RDQA 5IRAA 3SZJA 1VWHB 1SWOA 1KFFA 2RTPB 3WZOA 5IRWA 1SRIA 2FHNX 1LDOA 1SWKA 1VWBB 1RSUB 1HQQA 2RTIB 4BX7B 1Y55X 1LELA 4GJVA 2RTRB 2A5BA 1SWHA 2RTGB 1SLEB 1NQNA 4CPFA 2RTMA 2UZ2A 1MEPA 1SWQA 3WZQA 2C4IA 1VWIB 1SWEA 3RY1A 2IZKA 1SLDB 2IZBA 1SWJA 2JGSA 1SWLA 1SWPA 1RXJA 5IRUA 2IZAA 4Y59A 3VHIA 1LDQA 4BX6A 1VWPB 3RDXA 3WZNA 4BJ8A 2IZGB 5K68A 1SWDA 1SRJA 4BBOA 5CHKA 1SWUA 1NDJA 2RTLA 4DNEA 1SRHA 3X00A 1RXKA 4JHQA 1VWNB 1RAVA 2C1SA 4CPIA 3RDOA 3WZPA 3WYQA 2OF9A 2IZHB 4CPHB 1N9YA 1IJ8A 4GJSA 1LCWA 1VWLB 4Z2VA 1KL5A 2IZCB 5B5FA 4JNJA 1STSB 4GD9A 1VWEB 4Z27A 2BC3A 1AVDA 1VWGB 2A8GA 2OF8A 4Z2OA 2RTHB 3T2XA 5JD2A 3VHHA 4CPEA 1N43A 1STPA 1VWFB 1VWDB 3PK2A 1WBIA 2RTBB 4BX5A 2RTDB 3VGWA 2UYWA 1MOYA 1RSTB 2IZEB 5K67A 2IZFB 1VWKB 2WPUA 1LCZA 1VWOB 2F01A 3RDMA 1VWQB 1KL3A 1DF8A 1SRFA 1SWTA 2RTQB 1AVEA 5F2BA 1RXHA 2ZSCA 1STRB 1KL4A 1I9HA 2RTJA 2QCBA 1SWGA 2RTFB 2RTKA 4IRWA 1NBXA 2Y32A 3MM0A 4BX6B 3EW2A 1HXZA 1VYOA 3T2WA 4BX7A 4I60A 1MM9A 2Y3EA 3RDUA 3RDSA 1Y52X 4EKVA 2IZJA 5L3YA 5CSEA 1VWJB 4JO6A 1SWFA
chains in the Genus database with same CATH superfamily
1AVGI 1S44A 2RTAA 1WUBA 3F9DA 4NNTA 2X45A 3BDRA 4GGRA 4MISA 4ES7A 1OEKA 4GGTA 3MX7A 3KZAA 3RY2A 2ZAIA 2Z4IA 5H9AA 1YP6A 2IZDB 2X34A 2Y3FA 3TZSA 3FYFA 1SLGB 2L67A 5B29A 1KQWA 1NGLA 1GXAA 5KICA 4QZUA 4YVBA 2IZIA 2OFBA 2QO5A 4OS0A 4YKMA 4MVEA 4YFQA 1ACDA 2G7BA 4R0BA 4IB8A 1JIWI 4B55A 1PTSA 5HWZA 4Y5DA 3RE5A 4NNSA 1GGLA 4GGZA 3VHMA 1HXLA 1SXXA 1YIVA 2LB6A 3B2KA 1NQMA 4OS3A 1G74A 4XMFA 3FR4A 1MDCA 1L6MA 3C78X 1OEJA 1Y53X 2K23A 3EMMA 3EM0A 3UEXA 4EEJA 2VDFA 1LPJA 4TKJA 1SWAA 4GNWA 4QGWA 4AZRA 5IRAA 5FENA 4BVMA 2KW1A 1SWOA 2OYBO 1DZMA 3D95A 2F73A 5KIDA 2FHNX 4CSBA 4ID2A 1G5WA 3HWGA 1HQQA 3FMZA 2OY8A 1MX7A 1Y55X 2ALLX 1JQPA 2A5BA 2JU8A 1HBPA 5DPQA 1JZUA 4QYNA 4LQZA 1IFCA 1E06A 2GTLN 2JU3A 5B3MO 1AQBA 4TLJA 5EDCA 4CPFA 4YBPA 4I3DA 2A3FX 5K06A 4I9RA 2ANSA 4M7MA 1ZRYA 1SLDB 2CBRA 2HZRA 4GZVA 2JGSA 3MVFA 4XMHA 5D47A 2QO4A 1RXJA 5IRUA 2AT8X 3APVA 4Y59A 2CM9A 4UU3A 3WVMA 1KQXA 1VWPB 1UZ2X 2R73A 3RDXA 5F7GA 5LJEA 2OVAA 3FELA 4NW4A 2FT9A 5K68A 4HPBA 3ZI8A 1I05A 2AF5A 1TVQA 2NNEA 1SRHA 5HZQA 2X8FA 1W5RA 4O4OA 2XSTA 2DJFA 1RXKA 4ZH9A 1OBQA 2C1SA 2RCQA 4INNA 3TGCA 4TJZA 3PP6A 2N93A 2OF9A 3PQSA 4CPHB 3K3LA 4BGFA 3SLOA 3ZWEA 2OFMX 1OBPA 2OL8O 1VPRA 2QM9A 3BY0A 5HA0A 3VG5A 5D8JA 4RUUA 3D97A 3FIQA 2BS5A 1PBOA 4PSQA 3BU1A 1HN2A 3I17A 1AVDA 3BX7A 4U3QA 4A8ZA 3QKGA 1EXSA 2BT9A 2OF8A 2RTHB 1D2UA 2WSJA 4I9SA 3T2XA 4L1NA 1DZKA 1VWFB 2DM5A 4O3XB 1WBIA 2OFRX 5C0NA 5D48A 1YUPA 1U17A 2RTBB 1O8VA 2L9CA 3BU9A 3JQOA 4BX5A 3HPEA 1MOYA 1RSTB 2IZEB 3KFFA 4U8UO 2IZFB 1VWKB 1XCAA 5EZ2A 4FBRA 2F01A 4WFVA 2BS6A 2QMIA 2VFCA 4QGXA 1SRFA 5BVTA 5IO7A 2RTQB 2A2UA 2X32A 5D4AA 4QRLA 3FR5A 2O62A 2BLGA 1FDQA 2ZSCA 4TKBA 3SLTA 1B8EA 2RTJA 2LFOA 1ICMA 1BJ7A 1FENA 4NV8A 2QOSC 2OL6O 5HTDA 1HXZA 3FENA 5B10O 2FTBA 4BX7A 3APUA 1BM5A 1BSOA 4MVKA 1SMPI 4Y0QA 3RDSA 5L8OA 1ALBA 1BRQA 1LIDA 5L3YA 1VWJB 2L5PA 3I0AA 1UYOX 1P6PA 4KCAA 2IZLB 5B27A 1RBPA 4ORWA 2OFAA 1HQPA 1O1UA 1X71A 4ZGUA 3BX8A 4A60A 2CZUA 2RTNB 3C77X 2IFBA 3T6FA 3NP1A 3RE6A 4CDDA 1I78A 1LCVA 1PBYA 2GTLM 5KHPA 1SRGA 1SREA 1UYNX 2RTOB 5EEEA 1DZJA 1VYGA 3OE3A 4O9SA 4O3ZA 1BBPA 2BHVA 3KVNA 1TOUA 3S26A 3NQKA 3U0DA 3ZW1B 4Z2PA 3ZW0A 1SLFB 2P8GA 5HZ5A 3PPTA 2AT3X 3KFGA 3NQ9A 4Z6JA 1NC9A 3LV4A 1FEMA 3WYPA 2X56A 2MHDA 1D3SA 1EUOA 5HCCC 5HTEA 5B5GA 3PH6A 4YCHA 4IAXA 3B2JA 4ZCBA 4GDAA 1ZNKA 2WQ9A 1VWAB 1FJ1E 1VWCB 3KFIA 2X46A 3PEDA 4GKCA 4EXZA 1IFBA 1QWDA 2GC9A 4HFOA 3DSZA 4IB6A 4OKAA 2MF6A 4YFPA 1SWBA 4U9CA 3FA8A 2NNDA 3CMPA 2G8CO 4QNIA 2GTLO 5LKFA 3WZOA 2HLVA 1PMPA 2X55A 1VWBB 3EC5A 4AZPA 1RSUB 5IRWA 2X8SA 1AELA 2RTIB 2GTFX 3KQ0A 1LELA 2OZQA 3LHNA 1SWHA 1HMSA 1DF3A 1KT6A 2QO6A 1U18A 3CQRA 1SY2A 1KT5A 1SLEB 2A13A 3OBLA 3EYCA 3O2YA 2RTMA 2YMSA 4NV7A 1SWQA 3NPOA 2X4MA 5B11O 1TOWA 3HTYA 3S60A 3WOVA 1VWIB 3WZQA 1SWEA 2IZKA 3P24A 4YGGA 2IZBA 4DQ3A 1SWJA 3NR3A 4PJ2A 5D45A 1QY2A 3B2IA 5FQ8E 4O4XA 1LDQA 3IFBA 4ZH6A 1QFTA 4O3WA 3RSWA 1JBHA 1EIOA 3WZNA 3OJYC 2OY5O 3C76X 3WJGA 1B0OA 1SRJA 2ACOA 5CHKA 5H9LA 4AZNA 2RD7C 3UEVA 1JJUA 3CWKA 4A1YA 4JHQA 1LNMA 3FA7A 3L4RA 3WXQA 2RA6A 3SAOA 3WYQA 3HOEA 2IZHB 5IO5A 2JU7A 2AKQA 5F6BA 1IJ8A 1I06A 4TQ2A 1IKJA 4Z2VA 2IZCB 2WUTA 3VG2A 3TGBA 3HK1A 3B2HA 5B5FA 4OMWA 1SA8A 4JNJA 5HZ9A 4GD9A 2X8TA 1GT1A 2BC3A 4QQ1A 1A2DA 1VWGB 4XMEA 1KT4A 3D4RA 3FW5A 5JD2A 3PDFA 2OVEA 4MEEA 2BSZA 4AZOA 5LJCA 1VWDB 4RUNA 3VE2A 1BSYA 3HWFA 4OS8A 1FTPA 4A1HA 4ALOA 3P6EA 1EPAA 4ZJ0A 4MIRA 1ZNLA 3TGAA 5LJHA 5FFHA 1VWOB 2MWHA 2L68A 3CBCA 4XMGA 4BOEA 1B4MA 2LKKA 2I5ZO 3BRNA 1RXHA 3RZYA 3UEWA 1H91A 1OEEA 4YDBA 4DQ4A 3P6GA 4FBVA 4YBUA 2LBVA 2RTKA 1A3YA 2VFBA 1IW2A 2JMBA 4HPCA 1K3BA 4K19A 4LZVA 4XMCA 4BX6B 3STMX 4KT5A 1MM9A 2Y3EA 3RDUA 3VG6A 4HPAA 4EKVA 1N0SA 4HWMA 4ODDA 2HZQA 2Q2MA 1OPAA 4HPDA 1A18A 2IZJA 4FBOA 1FE3A 5CSEA 5FQ7E 1X89A 1TW4A 1SWFA 1YWDA 2WWPA 2Q9SA 4KC8A 1JYDA 3F6ZB 4TNNA 4YKOA 1K24A 1KGLA 1SWSA 1CRBA 1SWCA 1A57A 1N7YA 1MUPA 1ZNEA 1B56A 3CKFA 3SZIA 5F6ZA 5H9NA 3ELXA 4KH8A 1SWNA 2JN3A 3VG4A 1HMTA 1LIBA 3FEKA 4GH7A 3U9PC 4AW8A 1T68X 1AB0A 1W4TA 5EPQA 4AZMA 2FHLA 3ZUOA 1R0UA 4KC7A 3P6DA 1SXUA 2MJIA 1GX8A 1LUQA 3OD9A 3Q34A 1CBIA 3STNA 4AYHA 4UU2A 2RTCB 4I3BA 3ZZVA 5HCDC 3LTWA 4CPHA 5B2AO 5EDBA 2C1QA 2AVIA 3FLLA 2GJ5A 1N4JA 3SZHA 1JJXA 2FLJA 3HOLA 3PECA 2PI3O 3BSZE 3UEUA 4YFRA 3AEHA 1FELA 3ELZA 2FWVA 1YWBA 2CBSA 1CBSA 2JOZA 3G7XA 3NX2A 4Y0PA 1E5PA 3APWA 2W2FA 3CKGA 3RDQA 4GK9A 3SZJA 3WBGA 1QFVA 2W2AA 3CR6A 1KFFA 2RTPB 1O1VA 1SRIA 3JS1A 1LDOA 4I6SA 5AJCA 4ZHHA 4EDEA 2NP1A 3WJBA 1VYFA 1YWCA 2RTGB 3SLJA 3P6CA 1XKIA 1GT5A 3O19A 1CJ5A 2HMBA 1LIEA 1T8VA 2UZ2A 1EQDA 1X8NA 4KIIA 2ZAGA 3RWXA 5LJGA 5LJBA 1QQSA 1SWLA 1SWPA 1EIIA 3VHIA 4WBKA 2HYSA 3BLGA 3N91A 4I95A 1GX3A 1HMRA 3IA8A 2IZGB 3TF6A 1MX8A 1SWUA 2DJGA 1X8UA 1RLBE 1GT4A 3AKNA 4NYRA 3X00A 5HZ8A 3S5XA 2NNQA 3AKMA 5IXGA 1JMZA 4ZHFA 2POAA 4CPIA 4QZTA 2FGSA 3WZPA 1G7NA 4GU8A 4ZHGA 4ZR2A 4GUZA 5BVQA 3UAQA 5L8IA 3WJDA 3ZW2A 4EFGA 1DZPA 1DFVA 3RKGA 1KL5A 2AMMX 1ERBA 4LZUA 1QY1A 1ML7A 1X8OA 5EEDA 5FQ6E 2WR6A 1BRPA 4WFUA 4Z27A 2G78A 5HCEC 2A8GA 3ZW1A 4ZHDA 4ARHA 4ORXA 5IO6A 4CPEA 2FS6A 5AJBA 1N43A 5HZ6A 1HBQA 4GNYA 3PK2A 2A2GA 2EU7X 4YCEA 1CBQA 2PY1A 2RTDB 1ZNDA 3VGWA 4YGHA 3S5VA 2FRSA 3RDMA 2WPUA 1LCZA 4IB9A 4ORUA 1VWQB 1KL3A 5CE4A 4O4UA 2MO5A 1EI5A 2HKDA 1AVEA 2KT4B 4CDEA 4EQAC 4YDAA 2JW1A 4QGVA 1JV4A 1UREA 1EPBA 1Y9TA 1ADLA 1JYJA 1SWGA 1LICA 2QCBA 3O22A 1X8PA 1U0XA 1NBXA 3VG3A 3FA6A 3ZUIA 2W2BA 2YG2A 3MM0A 1G85A 1VYOA 3T2WA 3Q6LA 4I60A 4N7DA 1DC9A 3VE1A 2LBAA 1TXLA 2AT5X 3F8AA 4IB7A 5CYBA 3CQNA 1T0VA 4YH0A 1QG5A 1E02A 2RQ0A 2Z4HA 4FQBB 4I3CA 3FA9A 4Y0RA 1KT3A 2OL7A 3D9WA 3VU1A 1ZNGA 2G5LA 2WQAE 2LA7A 2FR3A 4GRJA 4GDZA 2A5CA 4IAWA 4OEMA 4N7CA 2CZTA 4C5PA 5DG4A 4MVIA 3EW1A 4ZHCA 1OPBA 1ICNA 1VWMB 4NLJA 2FKJA 1VWRB 3MBTA 2Q2PA 1E2TA 2MM3A 1LF7A 4NYQA 3ZQ3A 2OVSA 1HY2A 1BWYA 5JR8A 2ASNX 2RTEB 5BYPA 2QOMA 4Z28A 3MG5A 3T6LA 2GH7A 4GETA 4IABA 4M6SA 1SXYA 4D6BA 3EBKA 4YMYA 3E3CA 4BCSA 3PQUA 3JSQA 1MK5A 4BX5B 4CDCA 4COTA 1KZWA 3VG7A 3FW4A 5LJKA 3FDCA 2CAMA 4OMXA 1I4UA 4ZFXA 2KD2A 2Q39A 4AZQA 2AT6X 1N9MA 2AT0X 3FEPA 3D96A 3SOTA 1KZXA 2RCTA 1OBUA 1NP4A 1SWRA 1Y0GA 1W6FA 1BEBA 3BS2A 3GE2A 4U46A 4U8UM 1EALA 1KOIA 1VWHB 1PM1X 1ZNHA 2FS7A 1GT3A 2AH7X 3GAQA 1IKEA 1SWKA 1QY0A 2AL0X 4BX7B 2KTDA 3HWDA 2R74A 2RTRB 4GJVA 4O3YA 4IMNA 5BVSA 5AEOA 1S7DA 3CBSA 1Z24A 1NQNA 2G79A 2I5VO 1MEPA 2FKGA 1MVGA 2C4IA 1E00A 4D6AA 3APXA 1GKAB 3RY1A 4XMDA 1ERXA 1YWAA 4CV7A 3T1DA 1JMXA 4WHIA 1S2PA 2IZAA 3NADA 5H8TA 5HA1A 4GE1A 4FGIB 4ORSA 4BX6A 1X8QA 3NBXX 3NX1A 1NP1A 4BJ8A 1EW3A 2M4LA 2OY1O 5H9KA 1SWDA 4OELA 2HNXA 4BBOA 5F58A 1NDJA 1SY1A 2RTLA 4DNEA 1SY0A 2E4JA 1LKEA 2WEWA 4ML7B 4NLIA 3WJFA 1VWNB 3U03A 1RAVA 3ZW0B 3RDOA 3KFHA 2CM4A 2KTSA 4JGLA 3FIDA 4MVLA 1N9YA 4GJSA 1JJJA 1LCWA 1VWLB 2Q4NA 3P6FA 5F1EA 4BQUA 1LIFA 3HWEA 4NP1A 1STSB 4IMOA 2R56A 1SXWA 2K62A 1BSQA 2XKLA 3EBWA 1VWEB 3QQ2A 4O49A 4O4SA 4ORYA 1I04A 2F09A 3PH5A 1PEEA 5LKEA 2ACPX 4Z2OA 3AUMO 3VHHA 1LFOA 1STPA 4ON1A 3P6HA 3B2LA 1GKAA 3DTQA 3NQ3A 5HBSA 5HAEA 1QABE 2UYWA 1YP7A 4LKPA 4LKTA 4TKHA 5LJDA 5K67A 4DCBA 2FR2A 3RBYA 1DF8A 3VPJE 1SWTA 1SY3A 4IBAA 4Y0SA 5F2BA 4ZGFA 1CBRA 1GX9A 4CDFA 4L3RA 3V8UA 1DV9A 2A0AA 3H3IA 4QAEA 4QYPA 1STRB 4U8UN 3STKA 1KXOA 1KL4A 1I9HA 2RTFB 4IRWA 4YGZA 1OSPO 2Y32A 4CK4A 3EW2A 2OVDA 1IIUA 3P02A 5AQ6A 1KT7A 2WEXA 5FAZA 3WJEA 5L8NA 1Y9LA 1BLRA 1Y52X 3WJCA 2RN4A 4ORRA 1GM6A 3FR2A 2OY7A 4JO6A 4ALBA
chains in the Genus database with same CATH topology
2IZLB 2RTAA 2OFAA 1SWSA 4GGRA 1SWCA 2G5LA 1N7YA 2RTNB 3T6FA 4GGTA 2A5CA 3RY2A 3RE6A 3SZIA 2IZDB 1SWNA 3EW1A 1LCVA 2Y3FA 1SRGA 1VWMB 1SLGB 1SREA 2RTOB 1VWRB 2FHLA 1HY2A 4YVBA 2IZIA 2OFBA 2RTEB 4Z2PA 4Z28A 1LUQA 3MG5A 1SLFB 3T6LA 2GH7A 2RTCB 1PTSA 4CPHA 4Y5DA 4Z6JA 1NC9A 3WYPA 4BCSA 1MK5A 3RE5A 3VHMA 4GGZA 4BX5B 2C1QA 1HXLA 2AVIA 5B5GA 3SZHA 1N4JA 1NQMA 3FDCA 2CAMA 4GDAA 1Y53X 1VWAB 1VWCB 1N9MA 4OKAA 1SWRA 4U46A 2MF6A 1SWAA 1SWBA 3RDQA 5IRAA 3SZJA 1VWHB 1SWOA 1KFFA 2RTPB 3WZOA 5IRWA 1SRIA 2FHNX 1LDOA 1SWKA 1VWBB 1RSUB 1HQQA 2RTIB 4BX7B 1Y55X 1LELA 4GJVA 2RTRB 2A5BA 1SWHA 2RTGB 1SLEB 1NQNA 4CPFA 2RTMA 2UZ2A 1MEPA 1SWQA 3WZQA 2C4IA 1VWIB 1SWEA 3RY1A 2IZKA 1SLDB 2IZBA 1SWJA 2JGSA 1SWLA 1SWPA 1RXJA 5IRUA 2IZAA 4Y59A 3VHIA 1LDQA 4BX6A 1VWPB 3RDXA 3WZNA 4BJ8A 2IZGB 5K68A 1SWDA 1SRJA 4BBOA 5CHKA 1SWUA 1NDJA 2RTLA 4DNEA 1SRHA 3X00A 1RXKA 4JHQA 1VWNB 1RAVA 2C1SA 4CPIA 3RDOA 3WZPA 3WYQA 2OF9A 2IZHB 4CPHB 1N9YA 1IJ8A 4GJSA 1LCWA 1VWLB 4Z2VA 1KL5A 2IZCB 5B5FA 4JNJA 1STSB 4GD9A 1VWEB 4Z27A 2BC3A 1AVDA 1VWGB 2A8GA 2OF8A 4Z2OA 2RTHB 3T2XA 5JD2A 3VHHA 4CPEA 1N43A 1STPA 1VWFB 1VWDB 3PK2A 1WBIA 2RTBB 4BX5A 2RTDB 3VGWA 2UYWA 1MOYA 1RSTB 2IZEB 5K67A 2IZFB 1VWKB 2WPUA 1LCZA 1VWOB 2F01A 3RDMA 1VWQB 1KL3A 1DF8A 1SRFA 1SWTA 2RTQB 1AVEA 5F2BA 1RXHA 2ZSCA 1STRB 1KL4A 1I9HA 2RTJA 2QCBA 1SWGA 2RTFB 2RTKA 4IRWA 1NBXA 2Y32A 3MM0A 4BX6B 3EW2A 1HXZA 1VYOA 3T2WA 4BX7A 4I60A 1MM9A 2Y3EA 3RDUA 3RDSA 1Y52X 4EKVA 2IZJA 5L3YA 5CSEA 1VWJB 4JO6A 1SWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZL B;  2RTA A;  2OFA A;  1SWS A;  4GGR A;  1SWC A;  2G5L A;  1N7Y A;  2RTN B;  3T6F A;  4GGT A;  2A5C A;  3RY2 A;  3RE6 A;  3SZI A;  2IZD B;  1SWN A;  3EW1 A;  1LCV A;  2Y3F A;  1SRG A;  1VWM B;  1SLG B;  1SRE A;  2RTO B;  1VWR B;  2FHL A;  1HY2 A;  4YVB A;  2IZI A;  2OFB A;  2RTE B;  4Z2P A;  4Z28 A;  1LUQ A;  3MG5 A;  1SLF B;  3T6L A;  2GH7 A;  2RTC B;  1PTS A;  4CPH A;  4Y5D A;  4Z6J A;  1NC9 A;  3WYP A;  4BCS A;  1MK5 A;  3RE5 A;  3VHM A;  4GGZ A;  4BX5 B;  2C1Q A;  1HXL A;  2AVI A;  5B5G A;  3SZH A;  1N4J A;  1NQM A;  3FDC A;  2CAM A;  4GDA A;  1Y53 X;  1VWA B;  1VWC B;  1N9M A;  4OKA A;  1SWR A;  4U46 A;  2MF6 A;  1SWA A;  1SWB A;  3RDQ A;  5IRA A;  3SZJ A;  1VWH B;  1SWO A;  1KFF A;  2RTP B;  3WZO A;  5IRW A;  1SRI A;  2FHN X;  1LDO A;  1SWK A;  1VWB B;  1RSU B;  1HQQ A;  2RTI B;  4BX7 B;  1Y55 X;  1LEL A;  4GJV A;  2RTR B;  2A5B A;  1SWH A;  2RTG B;  1SLE B;  1NQN A;  4CPF A;  2RTM A;  2UZ2 A;  1MEP A;  1SWQ A;  3WZQ A;  2C4I A;  1VWI B;  1SWE A;  3RY1 A;  2IZK A;  1SLD B;  2IZB A;  1SWJ A;  2JGS A;  1SWL A;  1SWP A;  1RXJ A;  5IRU A;  2IZA A;  4Y59 A;  3VHI A;  1LDQ A;  4BX6 A;  1VWP B;  3RDX A;  3WZN A;  4BJ8 A;  2IZG B;  5K68 A;  1SWD A;  1SRJ A;  4BBO A;  5CHK A;  1SWU A;  1NDJ A;  2RTL A;  4DNE A;  1SRH A;  3X00 A;  1RXK A;  4JHQ A;  1VWN B;  1RAV A;  2C1S A;  4CPI A;  3RDO A;  3WZP A;  3WYQ A;  2OF9 A;  2IZH B;  4CPH B;  1N9Y A;  1IJ8 A;  4GJS A;  1LCW A;  1VWL B;  4Z2V A;  1KL5 A;  2IZC B;  5B5F A;  4JNJ A;  1STS B;  4GD9 A;  1VWE B;  4Z27 A;  2BC3 A;  1AVD A;  1VWG B;  2A8G A;  2OF8 A;  4Z2O A;  2RTH B;  3T2X A;  5JD2 A;  3VHH A;  4CPE A;  1N43 A;  1STP A;  1VWF B;  1VWD B;  3PK2 A;  1WBI A;  2RTB B;  4BX5 A;  2RTD B;  3VGW A;  2UYW A;  1MOY A;  1RST B;  2IZE B;  5K67 A;  2IZF B;  1VWK B;  2WPU A;  1LCZ A;  1VWO B;  2F01 A;  3RDM A;  1VWQ B;  1KL3 A;  1DF8 A;  1SRF A;  1SWT A;  2RTQ B;  1AVE A;  5F2B A;  1RXH A;  2ZSC A;  1STR B;  1KL4 A;  1I9H A;  2RTJ A;  2QCB A;  1SWG A;  2RTF B;  2RTK A;  4IRW A;  1NBX A;  2Y32 A;  3MM0 A;  4BX6 B;  3EW2 A;  1HXZ A;  1VYO A;  3T2W A;  4BX7 A;  4I60 A;  1MM9 A;  2Y3E A;  3RDU A;  3RDS A;  1Y52 X;  4EKV A;  2IZJ A;  5L3Y A;  5CSE A;  1VWJ B;  4JO6 A;  1SWF A; 
#chains in the Genus database with same CATH topology
 1AVG I;  1S44 A;  2RTA A;  1WUB A;  3F9D A;  4NNT A;  2X45 A;  3BDR A;  4GGR A;  4MIS A;  4ES7 A;  1OEK A;  4GGT A;  3MX7 A;  3KZA A;  3RY2 A;  2ZAI A;  2Z4I A;  5H9A A;  1YP6 A;  2IZD B;  2X34 A;  2Y3F A;  3TZS A;  3FYF A;  1SLG B;  2L67 A;  5B29 A;  1KQW A;  1NGL A;  1GXA A;  5KIC A;  4QZU A;  4YVB A;  2IZI A;  2OFB A;  2QO5 A;  4OS0 A;  4YKM A;  4MVE A;  4YFQ A;  1ACD A;  2G7B A;  4R0B A;  4IB8 A;  1JIW I;  4B55 A;  1PTS A;  5HWZ A;  4Y5D A;  3RE5 A;  4NNS A;  1GGL A;  4GGZ A;  3VHM A;  1HXL A;  1SXX A;  1YIV A;  2LB6 A;  3B2K A;  1NQM A;  4OS3 A;  1G74 A;  4XMF A;  3FR4 A;  1MDC A;  1L6M A;  3C78 X;  1OEJ A;  1Y53 X;  2K23 A;  3EMM A;  3EM0 A;  3UEX A;  4EEJ A;  2VDF A;  1LPJ A;  4TKJ A;  1SWA A;  4GNW A;  4QGW A;  4AZR A;  5IRA A;  5FEN A;  4BVM A;  2KW1 A;  1SWO A;  2OYB O;  1DZM A;  3D95 A;  2F73 A;  5KID A;  2FHN X;  4CSB A;  4ID2 A;  1G5W A;  3HWG A;  1HQQ A;  3FMZ A;  2OY8 A;  1MX7 A;  1Y55 X;  2ALL X;  1JQP A;  2A5B A;  2JU8 A;  1HBP A;  5DPQ A;  1JZU A;  4QYN A;  4LQZ A;  1IFC A;  1E06 A;  2GTL N;  2JU3 A;  5B3M O;  1AQB A;  4TLJ A;  5EDC A;  4CPF A;  4YBP A;  4I3D A;  2A3F X;  5K06 A;  4I9R A;  2ANS A;  4M7M A;  1ZRY A;  1SLD B;  2CBR A;  2HZR A;  4GZV A;  2JGS A;  3MVF A;  4XMH A;  5D47 A;  2QO4 A;  1RXJ A;  5IRU A;  2AT8 X;  3APV A;  4Y59 A;  2CM9 A;  4UU3 A;  3WVM A;  1KQX A;  1VWP B;  1UZ2 X;  2R73 A;  3RDX A;  5F7G A;  5LJE A;  2OVA A;  3FEL A;  4NW4 A;  2FT9 A;  5K68 A;  4HPB A;  3ZI8 A;  1I05 A;  2AF5 A;  1TVQ A;  2NNE A;  1SRH A;  5HZQ A;  2X8F A;  1W5R A;  4O4O A;  2XST A;  2DJF A;  1RXK A;  4ZH9 A;  1OBQ A;  2C1S A;  2RCQ A;  4INN A;  3TGC A;  4TJZ A;  3PP6 A;  2N93 A;  2OF9 A;  3PQS A;  4CPH B;  3K3L A;  4BGF A;  3SLO A;  3ZWE A;  2OFM X;  1OBP A;  2OL8 O;  1VPR A;  2QM9 A;  3BY0 A;  5HA0 A;  3VG5 A;  5D8J A;  4RUU A;  3D97 A;  3FIQ A;  2BS5 A;  1PBO A;  4PSQ A;  3BU1 A;  1HN2 A;  3I17 A;  1AVD A;  3BX7 A;  4U3Q A;  4A8Z A;  3QKG A;  1EXS A;  2BT9 A;  2OF8 A;  2RTH B;  1D2U A;  2WSJ A;  4I9S A;  3T2X A;  4L1N A;  1DZK A;  1VWF B;  2DM5 A;  4O3X B;  1WBI A;  2OFR X;  5C0N A;  5D48 A;  1YUP A;  1U17 A;  2RTB B;  1O8V A;  2L9C A;  3BU9 A;  3JQO A;  4BX5 A;  3HPE A;  1MOY A;  1RST B;  2IZE B;  3KFF A;  4U8U O;  2IZF B;  1VWK B;  1XCA A;  5EZ2 A;  4FBR A;  2F01 A;  4WFV A;  2BS6 A;  2QMI A;  2VFC A;  4QGX A;  1SRF A;  5BVT A;  5IO7 A;  2RTQ B;  2A2U A;  2X32 A;  5D4A A;  4QRL A;  3FR5 A;  2O62 A;  2BLG A;  1FDQ A;  2ZSC A;  4TKB A;  3SLT A;  1B8E A;  2RTJ A;  2LFO A;  1ICM A;  1BJ7 A;  1FEN A;  4NV8 A;  2QOS C;  2OL6 O;  5HTD A;  1HXZ A;  3FEN A;  5B10 O;  2FTB A;  4BX7 A;  3APU A;  1BM5 A;  1BSO A;  4MVK A;  1SMP I;  4Y0Q A;  3RDS A;  5L8O A;  1ALB A;  1BRQ A;  1LID A;  5L3Y A;  1VWJ B;  2L5P A;  3I0A A;  1UYO X;  1P6P A;  4KCA A;  2IZL B;  5B27 A;  1RBP A;  4ORW A;  2OFA A;  1HQP A;  1O1U A;  1X71 A;  4ZGU A;  3BX8 A;  4A60 A;  2CZU A;  2RTN B;  3C77 X;  2IFB A;  3T6F A;  3NP1 A;  3RE6 A;  4CDD A;  1I78 A;  1LCV A;  1PBY A;  2GTL M;  5KHP A;  1SRG A;  1SRE A;  1UYN X;  2RTO B;  5EEE A;  1DZJ A;  1VYG A;  3OE3 A;  4O9S A;  4O3Z A;  1BBP A;  2BHV A;  3KVN A;  1TOU A;  3S26 A;  3NQK A;  3U0D A;  3ZW1 B;  4Z2P A;  3ZW0 A;  1SLF B;  2P8G A;  5HZ5 A;  3PPT A;  2AT3 X;  3KFG A;  3NQ9 A;  4Z6J A;  1NC9 A;  3LV4 A;  1FEM A;  3WYP A;  2X56 A;  2MHD A;  1D3S A;  1EUO A;  5HCC C;  5HTE A;  5B5G A;  3PH6 A;  4YCH A;  4IAX A;  3B2J A;  4ZCB A;  4GDA A;  1ZNK A;  2WQ9 A;  1VWA B;  1FJ1 E;  1VWC B;  3KFI A;  2X46 A;  3PED A;  4GKC A;  4EXZ A;  1IFB A;  1QWD A;  2GC9 A;  4HFO A;  3DSZ A;  4IB6 A;  4OKA A;  2MF6 A;  4YFP A;  1SWB A;  4U9C A;  3FA8 A;  2NND A;  3CMP A;  2G8C O;  4QNI A;  2GTL O;  5LKF A;  3WZO A;  2HLV A;  1PMP A;  2X55 A;  1VWB B;  3EC5 A;  4AZP A;  1RSU B;  5IRW A;  2X8S A;  1AEL A;  2RTI B;  2GTF X;  3KQ0 A;  1LEL A;  2OZQ A;  3LHN A;  1SWH A;  1HMS A;  1DF3 A;  1KT6 A;  2QO6 A;  1U18 A;  3CQR A;  1SY2 A;  1KT5 A;  1SLE B;  2A13 A;  3OBL A;  3EYC A;  3O2Y A;  2RTM A;  2YMS A;  4NV7 A;  1SWQ A;  3NPO A;  2X4M A;  5B11 O;  1TOW A;  3HTY A;  3S60 A;  3WOV A;  1VWI B;  3WZQ A;  1SWE A;  2IZK A;  3P24 A;  4YGG A;  2IZB A;  4DQ3 A;  1SWJ A;  3NR3 A;  4PJ2 A;  5D45 A;  1QY2 A;  3B2I A;  5FQ8 E;  4O4X A;  1LDQ A;  3IFB A;  4ZH6 A;  1QFT A;  4O3W A;  3RSW A;  1JBH A;  1EIO A;  3WZN A;  3OJY C;  2OY5 O;  3C76 X;  3WJG A;  1B0O A;  1SRJ A;  2ACO A;  5CHK A;  5H9L A;  4AZN A;  2RD7 C;  3UEV A;  1JJU A;  3CWK A;  4A1Y A;  4JHQ A;  1LNM A;  3FA7 A;  3L4R A;  3WXQ A;  2RA6 A;  3SAO A;  3WYQ A;  3HOE A;  2IZH B;  5IO5 A;  2JU7 A;  2AKQ A;  5F6B A;  1IJ8 A;  1I06 A;  4TQ2 A;  1IKJ A;  4Z2V A;  2IZC B;  2WUT A;  3VG2 A;  3TGB A;  3HK1 A;  3B2H A;  5B5F A;  4OMW A;  1SA8 A;  4JNJ A;  5HZ9 A;  4GD9 A;  2X8T A;  1GT1 A;  2BC3 A;  4QQ1 A;  1A2D A;  1VWG B;  4XME A;  1KT4 A;  3D4R A;  3FW5 A;  5JD2 A;  3PDF A;  2OVE A;  4MEE A;  2BSZ A;  4AZO A;  5LJC A;  1VWD B;  4RUN A;  3VE2 A;  1BSY A;  3HWF A;  4OS8 A;  1FTP A;  4A1H A;  4ALO A;  3P6E A;  1EPA A;  4ZJ0 A;  4MIR A;  1ZNL A;  3TGA A;  5LJH A;  5FFH A;  1VWO B;  2MWH A;  2L68 A;  3CBC A;  4XMG A;  4BOE A;  1B4M A;  2LKK A;  2I5Z O;  3BRN A;  1RXH A;  3RZY A;  3UEW A;  1H91 A;  1OEE A;  4YDB A;  4DQ4 A;  3P6G A;  4FBV A;  4YBU A;  2LBV A;  2RTK A;  1A3Y A;  2VFB A;  1IW2 A;  2JMB A;  4HPC A;  1K3B A;  4K19 A;  4LZV A;  4XMC A;  4BX6 B;  3STM X;  4KT5 A;  1MM9 A;  2Y3E A;  3RDU A;  3VG6 A;  4HPA A;  4EKV A;  1N0S A;  4HWM A;  4ODD A;  2HZQ A;  2Q2M A;  1OPA A;  4HPD A;  1A18 A;  2IZJ A;  4FBO A;  1FE3 A;  5CSE A;  5FQ7 E;  1X89 A;  1TW4 A;  1SWF A;  1YWD A;  2WWP A;  2Q9S A;  4KC8 A;  1JYD A;  3F6Z B;  4TNN A;  4YKO A;  1K24 A;  1KGL A;  1SWS A;  1CRB A;  1SWC A;  1A57 A;  1N7Y A;  1MUP A;  1ZNE A;  1B56 A;  3CKF A;  3SZI A;  5F6Z A;  5H9N A;  3ELX A;  4KH8 A;  1SWN A;  2JN3 A;  3VG4 A;  1HMT A;  1LIB A;  3FEK A;  4GH7 A;  3U9P C;  4AW8 A;  1T68 X;  1AB0 A;  1W4T A;  5EPQ A;  4AZM A;  2FHL A;  3ZUO A;  1R0U A;  4KC7 A;  3P6D A;  1SXU A;  2MJI A;  1GX8 A;  1LUQ A;  3OD9 A;  3Q34 A;  1CBI A;  3STN A;  4AYH A;  4UU2 A;  2RTC B;  4I3B A;  3ZZV A;  5HCD C;  3LTW A;  4CPH A;  5B2A O;  5EDB A;  2C1Q A;  2AVI A;  3FLL A;  2GJ5 A;  1N4J A;  3SZH A;  1JJX A;  2FLJ A;  3HOL A;  3PEC A;  2PI3 O;  3BSZ E;  3UEU A;  4YFR A;  3AEH A;  1FEL A;  3ELZ A;  2FWV A;  1YWB A;  2CBS A;  1CBS A;  2JOZ A;  3G7X A;  3NX2 A;  4Y0P A;  1E5P A;  3APW A;  2W2F A;  3CKG A;  3RDQ A;  4GK9 A;  3SZJ A;  3WBG A;  1QFV A;  2W2A A;  3CR6 A;  1KFF A;  2RTP B;  1O1V A;  1SRI A;  3JS1 A;  1LDO A;  4I6S A;  5AJC A;  4ZHH A;  4EDE A;  2NP1 A;  3WJB A;  1VYF A;  1YWC A;  2RTG B;  3SLJ A;  3P6C A;  1XKI A;  1GT5 A;  3O19 A;  1CJ5 A;  2HMB A;  1LIE A;  1T8V A;  2UZ2 A;  1EQD A;  1X8N A;  4KII A;  2ZAG A;  3RWX A;  5LJG A;  5LJB A;  1QQS A;  1SWL A;  1SWP A;  1EII A;  3VHI A;  4WBK A;  2HYS A;  3BLG A;  3N91 A;  4I95 A;  1GX3 A;  1HMR A;  3IA8 A;  2IZG B;  3TF6 A;  1MX8 A;  1SWU A;  2DJG A;  1X8U A;  1RLB E;  1GT4 A;  3AKN A;  4NYR A;  3X00 A;  5HZ8 A;  3S5X A;  2NNQ A;  3AKM A;  5IXG A;  1JMZ A;  4ZHF A;  2POA A;  4CPI A;  4QZT A;  2FGS A;  3WZP A;  1G7N A;  4GU8 A;  4ZHG A;  4ZR2 A;  4GUZ A;  5BVQ A;  3UAQ A;  5L8I A;  3WJD A;  3ZW2 A;  4EFG A;  1DZP A;  1DFV A;  3RKG A;  1KL5 A;  2AMM X;  1ERB A;  4LZU A;  1QY1 A;  1ML7 A;  1X8O A;  5EED A;  5FQ6 E;  2WR6 A;  1BRP A;  4WFU A;  4Z27 A;  2G78 A;  5HCE C;  2A8G A;  3ZW1 A;  4ZHD A;  4ARH A;  4ORX A;  5IO6 A;  4CPE A;  2FS6 A;  5AJB A;  1N43 A;  5HZ6 A;  1HBQ A;  4GNY A;  3PK2 A;  2A2G A;  2EU7 X;  4YCE A;  1CBQ A;  2PY1 A;  2RTD B;  1ZND A;  3VGW A;  4YGH A;  3S5V A;  2FRS A;  3RDM A;  2WPU A;  1LCZ A;  4IB9 A;  4ORU A;  1VWQ B;  1KL3 A;  5CE4 A;  4O4U A;  2MO5 A;  1EI5 A;  2HKD A;  1AVE A;  2KT4 B;  4CDE A;  4EQA C;  4YDA A;  2JW1 A;  4QGV A;  1JV4 A;  1URE A;  1EPB A;  1Y9T A;  1ADL A;  1JYJ A;  1SWG A;  1LIC A;  2QCB A;  3O22 A;  1X8P A;  1U0X A;  1NBX A;  3VG3 A;  3FA6 A;  3ZUI A;  2W2B A;  2YG2 A;  3MM0 A;  1G85 A;  1VYO A;  3T2W A;  3Q6L A;  4I60 A;  4N7D A;  1DC9 A;  3VE1 A;  2LBA A;  1TXL A;  2AT5 X;  3F8A A;  4IB7 A;  5CYB A;  3CQN A;  1T0V A;  4YH0 A;  1QG5 A;  1E02 A;  2RQ0 A;  2Z4H A;  4FQB B;  4I3C A;  3FA9 A;  4Y0R A;  1KT3 A;  2OL7 A;  3D9W A;  3VU1 A;  1ZNG A;  2G5L A;  2WQA E;  2LA7 A;  2FR3 A;  4GRJ A;  4GDZ A;  2A5C A;  4IAW A;  4OEM A;  4N7C A;  2CZT A;  4C5P A;  5DG4 A;  4MVI A;  3EW1 A;  4ZHC A;  1OPB A;  1ICN A;  1VWM B;  4NLJ A;  2FKJ A;  1VWR B;  3MBT A;  2Q2P A;  1E2T A;  2MM3 A;  1LF7 A;  4NYQ A;  3ZQ3 A;  2OVS A;  1HY2 A;  1BWY A;  5JR8 A;  2ASN X;  2RTE B;  5BYP A;  2QOM A;  4Z28 A;  3MG5 A;  3T6L A;  2GH7 A;  4GET A;  4IAB A;  4M6S A;  1SXY A;  4D6B A;  3EBK A;  4YMY A;  3E3C A;  4BCS A;  3PQU A;  3JSQ A;  1MK5 A;  4BX5 B;  4CDC A;  4COT A;  1KZW A;  3VG7 A;  3FW4 A;  5LJK A;  3FDC A;  2CAM A;  4OMX A;  1I4U A;  4ZFX A;  2KD2 A;  2Q39 A;  4AZQ A;  2AT6 X;  1N9M A;  2AT0 X;  3FEP A;  3D96 A;  3SOT A;  1KZX A;  2RCT A;  1OBU A;  1NP4 A;  1SWR A;  1Y0G A;  1W6F A;  1BEB A;  3BS2 A;  3GE2 A;  4U46 A;  4U8U M;  1EAL A;  1KOI A;  1VWH B;  1PM1 X;  1ZNH A;  2FS7 A;  1GT3 A;  2AH7 X;  3GAQ A;  1IKE A;  1SWK A;  1QY0 A;  2AL0 X;  4BX7 B;  2KTD A;  3HWD A;  2R74 A;  2RTR B;  4GJV A;  4O3Y A;  4IMN A;  5BVS A;  5AEO A;  1S7D A;  3CBS A;  1Z24 A;  1NQN A;  2G79 A;  2I5V O;  1MEP A;  2FKG A;  1MVG A;  2C4I A;  1E00 A;  4D6A A;  3APX A;  1GKA B;  3RY1 A;  4XMD A;  1ERX A;  1YWA A;  4CV7 A;  3T1D A;  1JMX A;  4WHI A;  1S2P A;  2IZA A;  3NAD A;  5H8T A;  5HA1 A;  4GE1 A;  4FGI B;  4ORS A;  4BX6 A;  1X8Q A;  3NBX X;  3NX1 A;  1NP1 A;  4BJ8 A;  1EW3 A;  2M4L A;  2OY1 O;  5H9K A;  1SWD A;  4OEL A;  2HNX A;  4BBO A;  5F58 A;  1NDJ A;  1SY1 A;  2RTL A;  4DNE A;  1SY0 A;  2E4J A;  1LKE A;  2WEW A;  4ML7 B;  4NLI A;  3WJF A;  1VWN B;  3U03 A;  1RAV A;  3ZW0 B;  3RDO A;  3KFH A;  2CM4 A;  2KTS A;  4JGL A;  3FID A;  4MVL A;  1N9Y A;  4GJS A;  1JJJ A;  1LCW A;  1VWL B;  2Q4N A;  3P6F A;  5F1E A;  4BQU A;  1LIF A;  3HWE A;  4NP1 A;  1STS B;  4IMO A;  2R56 A;  1SXW A;  2K62 A;  1BSQ A;  2XKL A;  3EBW A;  1VWE B;  3QQ2 A;  4O49 A;  4O4S A;  4ORY A;  1I04 A;  2F09 A;  3PH5 A;  1PEE A;  5LKE A;  2ACP X;  4Z2O A;  3AUM O;  3VHH A;  1LFO A;  1STP A;  4ON1 A;  3P6H A;  3B2L A;  1GKA A;  3DTQ A;  3NQ3 A;  5HBS A;  5HAE A;  1QAB E;  2UYW A;  1YP7 A;  4LKP A;  4LKT A;  4TKH A;  5LJD A;  5K67 A;  4DCB A;  2FR2 A;  3RBY A;  1DF8 A;  3VPJ E;  1SWT A;  1SY3 A;  4IBA A;  4Y0S A;  5F2B A;  4ZGF A;  1CBR A;  1GX9 A;  4CDF A;  4L3R A;  3V8U A;  1DV9 A;  2A0A A;  3H3I A;  4QAE A;  4QYP A;  1STR B;  4U8U N;  3STK A;  1KXO A;  1KL4 A;  1I9H A;  2RTF B;  4IRW A;  4YGZ A;  1OSP O;  2Y32 A;  4CK4 A;  3EW2 A;  2OVD A;  1IIU A;  3P02 A;  5AQ6 A;  1KT7 A;  2WEX A;  5FAZ A;  3WJE A;  5L8N A;  1Y9L A;  1BLR A;  1Y52 X;  3WJC A;  2RN4 A;  4ORR A;  1GM6 A;  3FR2 A;  2OY7 A;  4JO6 A;  4ALB A; 
#chains in the Genus database with same CATH homology
 2IZL B;  2RTA A;  2OFA A;  1SWS A;  4GGR A;  1SWC A;  2G5L A;  1N7Y A;  2RTN B;  3T6F A;  4GGT A;  2A5C A;  3RY2 A;  3RE6 A;  3SZI A;  2IZD B;  1SWN A;  3EW1 A;  1LCV A;  2Y3F A;  1SRG A;  1VWM B;  1SLG B;  1SRE A;  2RTO B;  1VWR B;  2FHL A;  1HY2 A;  4YVB A;  2IZI A;  2OFB A;  2RTE B;  4Z2P A;  4Z28 A;  1LUQ A;  3MG5 A;  1SLF B;  3T6L A;  2GH7 A;  2RTC B;  1PTS A;  4CPH A;  4Y5D A;  4Z6J A;  1NC9 A;  3WYP A;  4BCS A;  1MK5 A;  3RE5 A;  3VHM A;  4GGZ A;  4BX5 B;  2C1Q A;  1HXL A;  2AVI A;  5B5G A;  3SZH A;  1N4J A;  1NQM A;  3FDC A;  2CAM A;  4GDA A;  1Y53 X;  1VWA B;  1VWC B;  1N9M A;  4OKA A;  1SWR A;  4U46 A;  2MF6 A;  1SWA A;  1SWB A;  3RDQ A;  5IRA A;  3SZJ A;  1VWH B;  1SWO A;  1KFF A;  2RTP B;  3WZO A;  5IRW A;  1SRI A;  2FHN X;  1LDO A;  1SWK A;  1VWB B;  1RSU B;  1HQQ A;  2RTI B;  4BX7 B;  1Y55 X;  1LEL A;  4GJV A;  2RTR B;  2A5B A;  1SWH A;  2RTG B;  1SLE B;  1NQN A;  4CPF A;  2RTM A;  2UZ2 A;  1MEP A;  1SWQ A;  3WZQ A;  2C4I A;  1VWI B;  1SWE A;  3RY1 A;  2IZK A;  1SLD B;  2IZB A;  1SWJ A;  2JGS A;  1SWL A;  1SWP A;  1RXJ A;  5IRU A;  2IZA A;  4Y59 A;  3VHI A;  1LDQ A;  4BX6 A;  1VWP B;  3RDX A;  3WZN A;  4BJ8 A;  2IZG B;  5K68 A;  1SWD A;  1SRJ A;  4BBO A;  5CHK A;  1SWU A;  1NDJ A;  2RTL A;  4DNE A;  1SRH A;  3X00 A;  1RXK A;  4JHQ A;  1VWN B;  1RAV A;  2C1S A;  4CPI A;  3RDO A;  3WZP A;  3WYQ A;  2OF9 A;  2IZH B;  4CPH B;  1N9Y A;  1IJ8 A;  4GJS A;  1LCW A;  1VWL B;  4Z2V A;  1KL5 A;  2IZC B;  5B5F A;  4JNJ A;  1STS B;  4GD9 A;  1VWE B;  4Z27 A;  2BC3 A;  1AVD A;  1VWG B;  2A8G A;  2OF8 A;  4Z2O A;  2RTH B;  3T2X A;  5JD2 A;  3VHH A;  4CPE A;  1N43 A;  1STP A;  1VWF B;  1VWD B;  3PK2 A;  1WBI A;  2RTB B;  4BX5 A;  2RTD B;  3VGW A;  2UYW A;  1MOY A;  1RST B;  2IZE B;  5K67 A;  2IZF B;  1VWK B;  2WPU A;  1LCZ A;  1VWO B;  2F01 A;  3RDM A;  1VWQ B;  1KL3 A;  1DF8 A;  1SRF A;  1SWT A;  2RTQ B;  1AVE A;  5F2B A;  1RXH A;  2ZSC A;  1STR B;  1KL4 A;  1I9H A;  2RTJ A;  2QCB A;  1SWG A;  2RTF B;  2RTK A;  4IRW A;  1NBX A;  2Y32 A;  3MM0 A;  4BX6 B;  3EW2 A;  1HXZ A;  1VYO A;  3T2W A;  4BX7 A;  4I60 A;  1MM9 A;  2Y3E A;  3RDU A;  3RDS A;  1Y52 X;  4EKV A;  2IZJ A;  5L3Y A;  5CSE A;  1VWJ B;  4JO6 A;  1SWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...