3MGFA

Crystal structure of monomeric kusabira-orange (mko), orange-emitting gfp-like protein, at ph 7.5
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
213
structure length
212
Chain Sequence
SVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAKGGPMPFAFDLVSHVHRPFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKKILKMPGSHYISHRLVRKTEGNITELVEDAVAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fluorescent protein
publication title Crystal Structure of Monomeric Kusabira-Orange (MKO), Orange-Emitting GFP-like Protein, at pH 7.5
rcsb
source organism Verrillofungia concinna
molecule tags Fluorescent protein
total genus 58
structure length 212
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3mgfA00
1KYSA 4W6DA 4W6IA 2YE1A 4W6GA 1XMZA 3GL4A 2G16B 4W6LA 3SVSA 4GF6B 3BXCA 4W69A 2VVIA 4HE4A 1YJFA 2H5RA 3CGLA 4HQCA 2V4EA 3CFFA 5DTXA 3W1CA 2FZUA 4OQWA 4EULA 4ZINA 3SVOA 4U2VA 4W77A 2A50B 1YHHA 4PPJA 4W7RA 1ZGPA 3ZULA 3DQ8A 5HZOA 5DRFA 4ZIOA 2WIQA 3LF3A 2QU1A 3IR8A 1Q4AA 3U0KA 5HZSA 3CD1A 1F09A 4ORNA 2AWKA 4B5YA 4IK4A 4KPIA 1RMPA 2EMNA 3NT9A 4L1IA 5BTTB 2A54B 2A53B 4XL5A 5DPGA 2O24A 3M24A 4W6NA 1JC1A 2WISA 2DUIA 2HPWA 4L13A 2HGYA 4H3LA 4Q9WA 3VHTB 4Q7TA 1CV7A 1QY3A 3DQHA 1H4UA 2FL1A 4PFEA 4XGYA 4J88A 3PIBA 4W6CA 3SVRA 3U0NA 4Z4KA 3PJBA 4EMQA 2G6YA 3CFAA 2HRSA 2H5PA 1F0BA 3M22A 4W7XA 3ADFA 3LSAA 1OXFA 1EMGA 4BDUA 4XOWA 3G9AA 3ZTFA 2HQZA 1JBYA 3BX9A 2BTJA 4LJCA 3RWTA 1C4FA 4KW4A 4OHSA 4HQ8A 3DQEA 5DTZA 4W76A 4H3MA 3ST2A 3SRYA 4W6AA 2B3PA 4B30A 1EMCA 3NEZA 3EKHA 3DQNA 2H6VA 2VVHA 4KGEA 3GJ2A 5FVGA 5AQBB 1EMBA 4P76A 4W75A 3DQ5A 2G5ZB 5BQLA 3H1RA 3P8UA 3LVDA 2V4EC 4DKMA 2Z6ZA 4LQUA 2QLIA 2HQKA 3DQKA 3VICA 4W6TA 2ZMWA 2QLGB 3DQDA 4KEXA 3W1DA 1GGXA 1HCJA 5DTYA 3DQAA 3DQFA 1YJ2A 4ANJA 1YFPA 2H5OA 2AWMA 2QLEA 4OJ0A 2IE2A 1B9CA 5HBDA 2A52B 3SG6A 3I19A 2Z6YA 4GOBA 1Q4EA 2IB5A 3BXAA 2EMOA 3EVPA 3OSQA 2ARLA 3AI5A 3ZUFA 2H5QA 4W6PA 3PJ7A 2DUGA 1KP5A 2Y0GA 4KAGA 4TZGA 3S05A 1EMFA 2HJOA 3GEXA 4JFGA 2A56B 3DQ9A 4IZNA 1GL4A 4DXNA 5EBJA 2Q6PA 5J2OA 3SSVA 3DPXA 3NF0A 1EMEA 4ZBLA 4W6HA 5DPHA 5BTTA 2G6XA 2P4MA 3ED8A 1MOVA 4IK5A 5LTRA 2YFPA 5DRGA 4OGSA 1QYOA 3EK8A 1Q4CA 3VHTA 2ICRA 4EDOA 4ZB1A 4H47A 2VVJA 3CBEA 3WLCA 2OTEA 4W6FA 1G7KA 2DUEA 2WSNA 2C9JA 4KW8A 3SSYA 3EVRA 4ZF5A 3O77A 1MYWA 5EXBA 2WURA 4W6UA 4W6MA 3CD9A 4Q7UA 4R6DA 1EMKA 2OKWA 2ZO7A 3OGOA 2HGDA 4AR7A 1ZUXA 4EN1A 2DD7A 3DQ3A 2O29A 4Z4MA 5KTGA 3LS3A 5H87A 4P1QA 3SVCA 3GJ1A 1W7SA 3RWAA 3LVCA 3DQLA 5FHVA 3DQ2A 4XOVA 4DXMA 3AI4A 3SG5A 3DQ7A 2IOVA 4ZFSA 2VADA 4W7FA 3A8SA 3SV5A 3AKOA 3LF4B 4IK8A 1Z1PA 5EHUA 2WHTA 2A48A 4ZF3A 1XSSA 1HUYA 3KCTA 4W6BA 2H9WA 2QZ0A 3BXBA 2GX0A 1RRXA 2VAEA 4HQ9A 2OKYA 1ZGOA 4W7AA 4W6RA 2QLGA 2Z6XA 2AWJA 4DXIA 5DQMA 1Q4DA 4Q9XA 4J89A 3ZUJA 1W7UA 4JGEA 4H48A 1JBZA 4TZAA 3PJ5A 3MGFA 5HW9A 1Q73A 1EMAA 3U8PA 1MOUA 5FVIA 4DXQA 2EMDA 3EKJA 4L12A 3IP2A 4W6KA 2O2BA 3DPWA 4HVFA 1JC0A 1QYFA 1OXEA 4RYSA 4W73A 3H1OA 3ST3A 2GX2A 3EK7A 5LK4A 1UISA 5H88A 5DU0A 1YHGA 4W72A 4JC2A 1EMLA 3SG2A 2DUFA 4J8AA 3LVAA 3U8AA 5HGEA 5EJUA 3TMTA 3DQJA 2OJKA 2AH8A 5EXCI 5LTPA 2PXWA 5DQBA 2QLHA 4IK9A 2V4EB 2YDZA 5EB7A 2GW3A 3SVEA 3U8CA 2OTBA 3U0LA 4W6JA 1XAEA 2DDDA 5DPIA 5H89A 3E5VA 4R6BA 2G2SB 3GB3A 4H3NA 4I2YA 4DXOA 2ZMUA 3SSHA 4RTCA 4LW5A 1RMMA 5DY6A 4IK3A 2H8QA 2HFCA 4LJDC 3EVVA 1RM9A 3NEDA 2G3OA 4ZF4A 3DQ4A 3DPZA 2Q57A 3P28A 3SVBA 3K1KA 3E5WA 2DUHA 3DQMA 3DQUA 5DPJA 4W74A 3ST4A 2A46A 2IB6A 4JRBA 5T3IA 2C9IA 3E5TA 2FWQA 4IK1A 3U0MA 4KF5C 4KF4A 2WHSA 1RMOA 1BFPA 4DKNA 4JEOA 3SSTA 3V3DA 3DQIA 2WSOA 3SS0A 3SVDA 2AWLA 1KYRA 4Q7RA 5DTLA 4NWSA 4JF9A 3KCSA 3O78A 1KYPA 4EDSA 2ZO6A 4W7CA 4W7EA 4LQTA 3UG0A 2HCGA 4AS8A 4LJDA 3ST0A 4W6SA 3SG3A 4XVPA 3SSLA 2JADA 4W7DA 2GW4B 4GESB 2DDCA 3SG7A 3NT3A 1EMMA 1QXTA 4W6OA 2WHUA 4KF5A 5EB6A 4KGFA 3LA1A 3CFHA 1OXDA 1S6ZA 1Z1QA 4B30B 1GFLA 1YHIA 3EK4A 2YE0A 2QT2A 2DD9A 2Z1OA 5F9GA 3DQ1A 3SG4A 1QYQA 1ZGQA 5LTQA 2A47A 2G6EA 3DQCA 1XA9A 2VZXA 2OGRA 1Q4BA 4DXPA 3SVNA 4KW9A 4OY4A 3SSKA 2POXA 1W7TA 3OSRA 5HZUA 4LJBA 2G3DB 4PPKA 3DQOA 3DQ6A 4RYWA 3WCKA 3CB9A 5BT0A 4UTSA 5FVFA 1XQMA 3TMRA 5EXUA 3VK1A 2B3QA 3SVUA 1H6RA 4N3DA 4PPLA 2AHAA 2QRFA 2RH7A 4KA9A 3SSPA 2PXSA 3UFZA 3WLDA 3EVUA 1YZWA 5HZTA
chains in the Genus database with same CATH superfamily
1KYSA 4W6DA 4W6IA 2YE1A 4W6GA 1XMZA 3GL4A 2G16B 4W6LA 3SVSA 4GF6B 3BXCA 4W69A 2VVIA 4HE4A 1YJFA 2H5RA 3CGLA 4HQCA 2V4EA 3CFFA 5DTXA 3W1CA 2FZUA 4OQWA 4EULA 4ZINA 3SVOA 4U2VA 4W77A 2A50B 1YHHA 4PPJA 4W7RA 1ZGPA 3ZULA 3DQ8A 5HZOA 5DRFA 4ZIOA 2WIQA 3LF3A 2QU1A 3IR8A 1Q4AA 3U0KA 5HZSA 3CD1A 1F09A 4ORNA 2AWKA 4B5YA 4IK4A 4KPIA 1RMPA 2EMNA 3NT9A 4L1IA 5BTTB 2A54B 2A53B 4XL5A 5DPGA 2O24A 3M24A 4W6NA 1JC1A 2WISA 2DUIA 2HPWA 4L13A 2HGYA 4H3LA 4Q9WA 3VHTB 4Q7TA 1CV7A 1QY3A 3DQHA 1H4UA 2FL1A 4PFEA 4XGYA 4J88A 3PIBA 4W6CA 3SVRA 3U0NA 4Z4KA 3PJBA 4EMQA 2G6YA 3CFAA 2HRSA 2H5PA 1F0BA 3M22A 4W7XA 3ADFA 3LSAA 1OXFA 1EMGA 4BDUA 4XOWA 3G9AA 3ZTFA 2HQZA 1JBYA 3BX9A 2BTJA 4LJCA 3RWTA 1C4FA 4KW4A 4OHSA 4HQ8A 3DQEA 5DTZA 4W76A 4H3MA 3ST2A 3SRYA 4W6AA 2B3PA 4B30A 1EMCA 3NEZA 3EKHA 3DQNA 2H6VA 2VVHA 4KGEA 3GJ2A 5FVGA 5AQBB 1EMBA 4P76A 4W75A 3DQ5A 2G5ZB 5BQLA 3H1RA 3P8UA 3LVDA 2V4EC 4DKMA 2Z6ZA 4LQUA 2QLIA 2HQKA 3DQKA 3VICA 4W6TA 2ZMWA 2QLGB 3DQDA 4KEXA 3W1DA 1GGXA 1HCJA 5DTYA 3DQAA 3DQFA 1YJ2A 4ANJA 1YFPA 2H5OA 2AWMA 2QLEA 4OJ0A 2IE2A 1B9CA 5HBDA 2A52B 3SG6A 3I19A 2Z6YA 4GOBA 1Q4EA 2IB5A 3BXAA 2EMOA 3EVPA 3OSQA 2ARLA 3AI5A 3ZUFA 2H5QA 4W6PA 3PJ7A 2DUGA 1KP5A 2Y0GA 4KAGA 4TZGA 3S05A 1EMFA 2HJOA 3GEXA 4JFGA 2A56B 3DQ9A 4IZNA 1GL4A 4DXNA 5EBJA 2Q6PA 5J2OA 3SSVA 3DPXA 3NF0A 1EMEA 4ZBLA 4W6HA 5DPHA 5BTTA 2G6XA 2P4MA 3ED8A 1MOVA 4IK5A 5LTRA 2YFPA 5DRGA 4OGSA 1QYOA 3EK8A 1Q4CA 3VHTA 2ICRA 4EDOA 4ZB1A 4H47A 2VVJA 3CBEA 3WLCA 2OTEA 4W6FA 1G7KA 2DUEA 2WSNA 2C9JA 4KW8A 3SSYA 3EVRA 4ZF5A 3O77A 1MYWA 5EXBA 2WURA 4W6UA 4W6MA 3CD9A 4Q7UA 4R6DA 1EMKA 2OKWA 2ZO7A 3OGOA 2HGDA 4AR7A 1ZUXA 4EN1A 2DD7A 3DQ3A 2O29A 4Z4MA 5KTGA 3LS3A 5H87A 4P1QA 3SVCA 3GJ1A 1W7SA 3RWAA 3LVCA 3DQLA 5FHVA 3DQ2A 4XOVA 4DXMA 3AI4A 3SG5A 3DQ7A 2IOVA 4ZFSA 2VADA 4W7FA 3A8SA 3SV5A 3AKOA 3LF4B 4IK8A 1Z1PA 5EHUA 2WHTA 2A48A 4ZF3A 1XSSA 1HUYA 3KCTA 4W6BA 2H9WA 2QZ0A 3BXBA 2GX0A 1RRXA 2VAEA 4HQ9A 2OKYA 1ZGOA 4W7AA 4W6RA 2QLGA 2Z6XA 2AWJA 4DXIA 5DQMA 1Q4DA 4Q9XA 4J89A 3ZUJA 1W7UA 4JGEA 4H48A 1JBZA 4TZAA 3PJ5A 3MGFA 5HW9A 1Q73A 1EMAA 3U8PA 1MOUA 5FVIA 4DXQA 2EMDA 3EKJA 4L12A 3IP2A 4W6KA 2O2BA 3DPWA 4HVFA 1JC0A 1QYFA 1OXEA 4RYSA 4W73A 3H1OA 3ST3A 2GX2A 3EK7A 5LK4A 1UISA 5H88A 5DU0A 1YHGA 4W72A 4JC2A 1EMLA 3SG2A 2DUFA 4J8AA 3LVAA 3U8AA 5HGEA 5EJUA 3TMTA 3DQJA 2OJKA 2AH8A 5EXCI 5LTPA 2PXWA 5DQBA 2QLHA 4IK9A 2V4EB 2YDZA 5EB7A 2GW3A 3SVEA 3U8CA 2OTBA 3U0LA 4W6JA 1XAEA 2DDDA 5DPIA 5H89A 3E5VA 4R6BA 2G2SB 3GB3A 4H3NA 4I2YA 4DXOA 2ZMUA 3SSHA 4RTCA 4LW5A 1RMMA 5DY6A 4IK3A 2H8QA 2HFCA 4LJDC 3EVVA 1RM9A 3NEDA 2G3OA 4ZF4A 3DQ4A 3DPZA 2Q57A 3P28A 3SVBA 3K1KA 3E5WA 2DUHA 3DQMA 3DQUA 5DPJA 4W74A 3ST4A 2A46A 2IB6A 4JRBA 5T3IA 2C9IA 3E5TA 2FWQA 4IK1A 3U0MA 4KF5C 4KF4A 2WHSA 1RMOA 1BFPA 4DKNA 4JEOA 3SSTA 3V3DA 3DQIA 2WSOA 3SS0A 3SVDA 2AWLA 1KYRA 4Q7RA 5DTLA 4NWSA 4JF9A 3KCSA 3O78A 1KYPA 4EDSA 2ZO6A 4W7CA 4W7EA 4LQTA 3UG0A 2HCGA 4AS8A 4LJDA 3ST0A 4W6SA 3SG3A 4XVPA 3SSLA 2JADA 4W7DA 2GW4B 4GESB 2DDCA 3SG7A 3NT3A 1EMMA 1QXTA 4W6OA 2WHUA 4KF5A 5EB6A 4KGFA 3LA1A 3CFHA 1OXDA 1S6ZA 1Z1QA 4B30B 1GFLA 1YHIA 3EK4A 2YE0A 2QT2A 2DD9A 2Z1OA 5F9GA 3DQ1A 3SG4A 1QYQA 1ZGQA 5LTQA 2A47A 2G6EA 3DQCA 1XA9A 2VZXA 2OGRA 1Q4BA 4DXPA 3SVNA 4KW9A 4OY4A 3SSKA 2POXA 1W7TA 3OSRA 5HZUA 4LJBA 2G3DB 4PPKA 3DQOA 3DQ6A 4RYWA 3WCKA 3CB9A 5BT0A 4UTSA 5FVFA 1XQMA 3TMRA 5EXUA 3VK1A 2B3QA 3SVUA 1H6RA 4N3DA 4PPLA 2AHAA 2QRFA 2RH7A 4KA9A 3SSPA 2PXSA 3UFZA 3WLDA 3EVUA 1YZWA 5HZTA
chains in the Genus database with same CATH topology
1KYSA 4W6DA 4W6IA 2YE1A 4W6GA 1XMZA 3GL4A 2G16B 4W6LA 3SVSA 4GF6B 3BXCA 4W69A 2VVIA 4HE4A 1YJFA 2H5RA 3CGLA 4HQCA 2V4EA 3CFFA 5DTXA 3W1CA 2FZUA 4OQWA 4EULA 4ZINA 3SVOA 4U2VA 4W77A 2A50B 1YHHA 4PPJA 4W7RA 1ZGPA 3ZULA 3DQ8A 5HZOA 5DRFA 4ZIOA 2WIQA 3LF3A 2QU1A 3IR8A 1Q4AA 3U0KA 5HZSA 3CD1A 1F09A 4ORNA 2AWKA 4B5YA 4IK4A 4KPIA 1RMPA 2EMNA 3NT9A 4L1IA 5BTTB 2A54B 2A53B 4XL5A 5DPGA 2O24A 3M24A 4W6NA 1JC1A 2WISA 2DUIA 2HPWA 4L13A 2HGYA 4H3LA 4Q9WA 3VHTB 4Q7TA 1CV7A 1QY3A 3DQHA 1H4UA 2FL1A 4PFEA 4XGYA 4J88A 3PIBA 4W6CA 3SVRA 3U0NA 4Z4KA 3PJBA 4EMQA 2G6YA 3CFAA 2HRSA 2H5PA 1F0BA 3M22A 4W7XA 3ADFA 3LSAA 1OXFA 1EMGA 4BDUA 4XOWA 3G9AA 3ZTFA 2HQZA 1JBYA 3BX9A 2BTJA 4LJCA 3RWTA 1C4FA 4KW4A 4OHSA 4HQ8A 3DQEA 5DTZA 4W76A 4H3MA 3ST2A 3SRYA 4W6AA 2B3PA 4B30A 1EMCA 3NEZA 3EKHA 3DQNA 2H6VA 2VVHA 4KGEA 3GJ2A 5FVGA 5AQBB 1EMBA 4P76A 4W75A 3DQ5A 2G5ZB 5BQLA 3H1RA 3P8UA 3LVDA 2V4EC 4DKMA 2Z6ZA 4LQUA 2QLIA 2HQKA 3DQKA 3VICA 4W6TA 2ZMWA 2QLGB 3DQDA 4KEXA 3W1DA 1GGXA 1HCJA 5DTYA 3DQAA 3DQFA 1YJ2A 4ANJA 1YFPA 2H5OA 2AWMA 2QLEA 4OJ0A 2IE2A 1B9CA 5HBDA 2A52B 3SG6A 3I19A 2Z6YA 4GOBA 1Q4EA 2IB5A 3BXAA 2EMOA 3EVPA 3OSQA 2ARLA 3AI5A 3ZUFA 2H5QA 4W6PA 3PJ7A 2DUGA 1KP5A 2Y0GA 4KAGA 4TZGA 3S05A 1EMFA 2HJOA 3GEXA 4JFGA 2A56B 3DQ9A 4IZNA 1GL4A 4DXNA 5EBJA 2Q6PA 5J2OA 3SSVA 3DPXA 3NF0A 1EMEA 4ZBLA 4W6HA 5DPHA 5BTTA 2G6XA 2P4MA 3ED8A 1MOVA 4IK5A 5LTRA 2YFPA 5DRGA 4OGSA 1QYOA 3EK8A 1Q4CA 3VHTA 2ICRA 4EDOA 4ZB1A 4H47A 2VVJA 3CBEA 3WLCA 2OTEA 4W6FA 1G7KA 2DUEA 2WSNA 2C9JA 4KW8A 3SSYA 3EVRA 4ZF5A 3O77A 1MYWA 5EXBA 2WURA 4W6UA 4W6MA 3CD9A 4Q7UA 4R6DA 1EMKA 2OKWA 2ZO7A 3OGOA 2HGDA 4AR7A 1ZUXA 4EN1A 2DD7A 3DQ3A 2O29A 4Z4MA 5KTGA 3LS3A 5H87A 4P1QA 3SVCA 3GJ1A 1W7SA 3RWAA 3LVCA 3DQLA 5FHVA 3DQ2A 4XOVA 4DXMA 3AI4A 3SG5A 3DQ7A 2IOVA 4ZFSA 2VADA 4W7FA 3A8SA 3SV5A 3AKOA 3LF4B 4IK8A 1Z1PA 5EHUA 2WHTA 2A48A 4ZF3A 1XSSA 1HUYA 3KCTA 4W6BA 2H9WA 2QZ0A 3BXBA 2GX0A 1RRXA 2VAEA 4HQ9A 2OKYA 1ZGOA 4W7AA 4W6RA 2QLGA 2Z6XA 2AWJA 4DXIA 5DQMA 1Q4DA 4Q9XA 4J89A 3ZUJA 1W7UA 4JGEA 4H48A 1JBZA 4TZAA 3PJ5A 3MGFA 5HW9A 1Q73A 1EMAA 3U8PA 1MOUA 5FVIA 4DXQA 2EMDA 3EKJA 4L12A 3IP2A 4W6KA 2O2BA 3DPWA 4HVFA 1JC0A 1QYFA 1OXEA 4RYSA 4W73A 3H1OA 3ST3A 2GX2A 3EK7A 5LK4A 1UISA 5H88A 5DU0A 1YHGA 4W72A 4JC2A 1EMLA 3SG2A 2DUFA 4J8AA 3LVAA 3U8AA 5HGEA 5EJUA 3TMTA 3DQJA 2OJKA 2AH8A 5EXCI 5LTPA 2PXWA 5DQBA 2QLHA 4IK9A 2V4EB 2YDZA 5EB7A 2GW3A 3SVEA 3U8CA 2OTBA 3U0LA 4W6JA 1XAEA 2DDDA 5DPIA 5H89A 3E5VA 4R6BA 2G2SB 3GB3A 4H3NA 4I2YA 4DXOA 2ZMUA 3SSHA 4RTCA 4LW5A 1RMMA 5DY6A 4IK3A 2H8QA 2HFCA 4LJDC 3EVVA 1RM9A 3NEDA 2G3OA 4ZF4A 3DQ4A 3DPZA 2Q57A 3P28A 3SVBA 3K1KA 3E5WA 2DUHA 3DQMA 3DQUA 5DPJA 4W74A 3ST4A 2A46A 2IB6A 4JRBA 5T3IA 2C9IA 3E5TA 2FWQA 4IK1A 3U0MA 4KF5C 4KF4A 2WHSA 1RMOA 1BFPA 4DKNA 4JEOA 3SSTA 3V3DA 3DQIA 2WSOA 3SS0A 3SVDA 2AWLA 1KYRA 4Q7RA 5DTLA 4NWSA 4JF9A 3KCSA 3O78A 1KYPA 4EDSA 2ZO6A 4W7CA 4W7EA 4LQTA 3UG0A 2HCGA 4AS8A 4LJDA 3ST0A 4W6SA 3SG3A 4XVPA 3SSLA 2JADA 4W7DA 2GW4B 4GESB 2DDCA 3SG7A 3NT3A 1EMMA 1QXTA 4W6OA 2WHUA 4KF5A 5EB6A 4KGFA 3LA1A 3CFHA 1OXDA 1S6ZA 1Z1QA 4B30B 1GFLA 1YHIA 3EK4A 2YE0A 2QT2A 2DD9A 2Z1OA 5F9GA 3DQ1A 3SG4A 1QYQA 1ZGQA 5LTQA 2A47A 2G6EA 3DQCA 1XA9A 2VZXA 2OGRA 1Q4BA 4DXPA 3SVNA 4KW9A 4OY4A 3SSKA 2POXA 1W7TA 3OSRA 5HZUA 4LJBA 2G3DB 4PPKA 3DQOA 3DQ6A 4RYWA 3WCKA 3CB9A 5BT0A 4UTSA 5FVFA 1XQMA 3TMRA 5EXUA 3VK1A 2B3QA 3SVUA 1H6RA 4N3DA 4PPLA 2AHAA 2QRFA 2RH7A 4KA9A 3SSPA 2PXSA 3UFZA 3WLDA 3EVUA 1YZWA 5HZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYS A;  4W6D A;  4W6I A;  2YE1 A;  4W6G A;  1XMZ A;  3GL4 A;  2G16 B;  4W6L A;  3SVS A;  4GF6 B;  3BXC A;  4W69 A;  2VVI A;  4HE4 A;  1YJF A;  2H5R A;  3CGL A;  4HQC A;  2V4E A;  3CFF A;  5DTX A;  3W1C A;  2FZU A;  4OQW A;  4EUL A;  4ZIN A;  3SVO A;  4U2V A;  4W77 A;  2A50 B;  1YHH A;  4PPJ A;  4W7R A;  1ZGP A;  3ZUL A;  3DQ8 A;  5HZO A;  5DRF A;  4ZIO A;  2WIQ A;  3LF3 A;  2QU1 A;  3IR8 A;  1Q4A A;  3U0K A;  5HZS A;  3CD1 A;  1F09 A;  4ORN A;  2AWK A;  4B5Y A;  4IK4 A;  4KPI A;  1RMP A;  2EMN A;  3NT9 A;  4L1I A;  5BTT B;  2A54 B;  2A53 B;  4XL5 A;  5DPG A;  2O24 A;  3M24 A;  4W6N A;  1JC1 A;  2WIS A;  2DUI A;  2HPW A;  4L13 A;  2HGY A;  4H3L A;  4Q9W A;  3VHT B;  4Q7T A;  1CV7 A;  1QY3 A;  3DQH A;  1H4U A;  2FL1 A;  4PFE A;  4XGY A;  4J88 A;  3PIB A;  4W6C A;  3SVR A;  3U0N A;  4Z4K A;  3PJB A;  4EMQ A;  2G6Y A;  3CFA A;  2HRS A;  2H5P A;  1F0B A;  3M22 A;  4W7X A;  3ADF A;  3LSA A;  1OXF A;  1EMG A;  4BDU A;  4XOW A;  3G9A A;  3ZTF A;  2HQZ A;  1JBY A;  3BX9 A;  2BTJ A;  4LJC A;  3RWT A;  1C4F A;  4KW4 A;  4OHS A;  4HQ8 A;  3DQE A;  5DTZ A;  4W76 A;  4H3M A;  3ST2 A;  3SRY A;  4W6A A;  2B3P A;  4B30 A;  1EMC A;  3NEZ A;  3EKH A;  3DQN A;  2H6V A;  2VVH A;  4KGE A;  3GJ2 A;  5FVG A;  5AQB B;  1EMB A;  4P76 A;  4W75 A;  3DQ5 A;  2G5Z B;  5BQL A;  3H1R A;  3P8U A;  3LVD A;  2V4E C;  4DKM A;  2Z6Z A;  4LQU A;  2QLI A;  2HQK A;  3DQK A;  3VIC A;  4W6T A;  2ZMW A;  2QLG B;  3DQD A;  4KEX A;  3W1D A;  1GGX A;  1HCJ A;  5DTY A;  3DQA A;  3DQF A;  1YJ2 A;  4ANJ A;  1YFP A;  2H5O A;  2AWM A;  2QLE A;  4OJ0 A;  2IE2 A;  1B9C A;  5HBD A;  2A52 B;  3SG6 A;  3I19 A;  2Z6Y A;  4GOB A;  1Q4E A;  2IB5 A;  3BXA A;  2EMO A;  3EVP A;  3OSQ A;  2ARL A;  3AI5 A;  3ZUF A;  2H5Q A;  4W6P A;  3PJ7 A;  2DUG A;  1KP5 A;  2Y0G A;  4KAG A;  4TZG A;  3S05 A;  1EMF A;  2HJO A;  3GEX A;  4JFG A;  2A56 B;  3DQ9 A;  4IZN A;  1GL4 A;  4DXN A;  5EBJ A;  2Q6P A;  5J2O A;  3SSV A;  3DPX A;  3NF0 A;  1EME A;  4ZBL A;  4W6H A;  5DPH A;  5BTT A;  2G6X A;  2P4M A;  3ED8 A;  1MOV A;  4IK5 A;  5LTR A;  2YFP A;  5DRG A;  4OGS A;  1QYO A;  3EK8 A;  1Q4C A;  3VHT A;  2ICR A;  4EDO A;  4ZB1 A;  4H47 A;  2VVJ A;  3CBE A;  3WLC A;  2OTE A;  4W6F A;  1G7K A;  2DUE A;  2WSN A;  2C9J A;  4KW8 A;  3SSY A;  3EVR A;  4ZF5 A;  3O77 A;  1MYW A;  5EXB A;  2WUR A;  4W6U A;  4W6M A;  3CD9 A;  4Q7U A;  4R6D A;  1EMK A;  2OKW A;  2ZO7 A;  3OGO A;  2HGD A;  4AR7 A;  1ZUX A;  4EN1 A;  2DD7 A;  3DQ3 A;  2O29 A;  4Z4M A;  5KTG A;  3LS3 A;  5H87 A;  4P1Q A;  3SVC A;  3GJ1 A;  1W7S A;  3RWA A;  3LVC A;  3DQL A;  5FHV A;  3DQ2 A;  4XOV A;  4DXM A;  3AI4 A;  3SG5 A;  3DQ7 A;  2IOV A;  4ZFS A;  2VAD A;  4W7F A;  3A8S A;  3SV5 A;  3AKO A;  3LF4 B;  4IK8 A;  1Z1P A;  5EHU A;  2WHT A;  2A48 A;  4ZF3 A;  1XSS A;  1HUY A;  3KCT A;  4W6B A;  2H9W A;  2QZ0 A;  3BXB A;  2GX0 A;  1RRX A;  2VAE A;  4HQ9 A;  2OKY A;  1ZGO A;  4W7A A;  4W6R A;  2QLG A;  2Z6X A;  2AWJ A;  4DXI A;  5DQM A;  1Q4D A;  4Q9X A;  4J89 A;  3ZUJ A;  1W7U A;  4JGE A;  4H48 A;  1JBZ A;  4TZA A;  3PJ5 A;  3MGF A;  5HW9 A;  1Q73 A;  1EMA A;  3U8P A;  1MOU A;  5FVI A;  4DXQ A;  2EMD A;  3EKJ A;  4L12 A;  3IP2 A;  4W6K A;  2O2B A;  3DPW A;  4HVF A;  1JC0 A;  1QYF A;  1OXE A;  4RYS A;  4W73 A;  3H1O A;  3ST3 A;  2GX2 A;  3EK7 A;  5LK4 A;  1UIS A;  5H88 A;  5DU0 A;  1YHG A;  4W72 A;  4JC2 A;  1EML A;  3SG2 A;  2DUF A;  4J8A A;  3LVA A;  3U8A A;  5HGE A;  5EJU A;  3TMT A;  3DQJ A;  2OJK A;  2AH8 A;  5EXC I;  5LTP A;  2PXW A;  5DQB A;  2QLH A;  4IK9 A;  2V4E B;  2YDZ A;  5EB7 A;  2GW3 A;  3SVE A;  3U8C A;  2OTB A;  3U0L A;  4W6J A;  1XAE A;  2DDD A;  5DPI A;  5H89 A;  3E5V A;  4R6B A;  2G2S B;  3GB3 A;  4H3N A;  4I2Y A;  4DXO A;  2ZMU A;  3SSH A;  4RTC A;  4LW5 A;  1RMM A;  5DY6 A;  4IK3 A;  2H8Q A;  2HFC A;  4LJD C;  3EVV A;  1RM9 A;  3NED A;  2G3O A;  4ZF4 A;  3DQ4 A;  3DPZ A;  2Q57 A;  3P28 A;  3SVB A;  3K1K A;  3E5W A;  2DUH A;  3DQM A;  3DQU A;  5DPJ A;  4W74 A;  3ST4 A;  2A46 A;  2IB6 A;  4JRB A;  5T3I A;  2C9I A;  3E5T A;  2FWQ A;  4IK1 A;  3U0M A;  4KF5 C;  4KF4 A;  2WHS A;  1RMO A;  1BFP A;  4DKN A;  4JEO A;  3SST A;  3V3D A;  3DQI A;  2WSO A;  3SS0 A;  3SVD A;  2AWL A;  1KYR A;  4Q7R A;  5DTL A;  4NWS A;  4JF9 A;  3KCS A;  3O78 A;  1KYP A;  4EDS A;  2ZO6 A;  4W7C A;  4W7E A;  4LQT A;  3UG0 A;  2HCG A;  4AS8 A;  4LJD A;  3ST0 A;  4W6S A;  3SG3 A;  4XVP A;  3SSL A;  2JAD A;  4W7D A;  2GW4 B;  4GES B;  2DDC A;  3SG7 A;  3NT3 A;  1EMM A;  1QXT A;  4W6O A;  2WHU A;  4KF5 A;  5EB6 A;  4KGF A;  3LA1 A;  3CFH A;  1OXD A;  1S6Z A;  1Z1Q A;  4B30 B;  1GFL A;  1YHI A;  3EK4 A;  2YE0 A;  2QT2 A;  2DD9 A;  2Z1O A;  5F9G A;  3DQ1 A;  3SG4 A;  1QYQ A;  1ZGQ A;  5LTQ A;  2A47 A;  2G6E A;  3DQC A;  1XA9 A;  2VZX A;  2OGR A;  1Q4B A;  4DXP A;  3SVN A;  4KW9 A;  4OY4 A;  3SSK A;  2POX A;  1W7T A;  3OSR A;  5HZU A;  4LJB A;  2G3D B;  4PPK A;  3DQO A;  3DQ6 A;  4RYW A;  3WCK A;  3CB9 A;  5BT0 A;  4UTS A;  5FVF A;  1XQM A;  3TMR A;  5EXU A;  3VK1 A;  2B3Q A;  3SVU A;  1H6R A;  4N3D A;  4PPL A;  2AHA A;  2QRF A;  2RH7 A;  4KA9 A;  3SSP A;  2PXS A;  3UFZ A;  3WLD A;  3EVU A;  1YZW A;  5HZT A; 
#chains in the Genus database with same CATH topology
 1KYS A;  4W6D A;  4W6I A;  2YE1 A;  4W6G A;  1XMZ A;  3GL4 A;  2G16 B;  4W6L A;  3SVS A;  4GF6 B;  3BXC A;  4W69 A;  2VVI A;  4HE4 A;  1YJF A;  2H5R A;  3CGL A;  4HQC A;  2V4E A;  3CFF A;  5DTX A;  3W1C A;  2FZU A;  4OQW A;  4EUL A;  4ZIN A;  3SVO A;  4U2V A;  4W77 A;  2A50 B;  1YHH A;  4PPJ A;  4W7R A;  1ZGP A;  3ZUL A;  3DQ8 A;  5HZO A;  5DRF A;  4ZIO A;  2WIQ A;  3LF3 A;  2QU1 A;  3IR8 A;  1Q4A A;  3U0K A;  5HZS A;  3CD1 A;  1F09 A;  4ORN A;  2AWK A;  4B5Y A;  4IK4 A;  4KPI A;  1RMP A;  2EMN A;  3NT9 A;  4L1I A;  5BTT B;  2A54 B;  2A53 B;  4XL5 A;  5DPG A;  2O24 A;  3M24 A;  4W6N A;  1JC1 A;  2WIS A;  2DUI A;  2HPW A;  4L13 A;  2HGY A;  4H3L A;  4Q9W A;  3VHT B;  4Q7T A;  1CV7 A;  1QY3 A;  3DQH A;  1H4U A;  2FL1 A;  4PFE A;  4XGY A;  4J88 A;  3PIB A;  4W6C A;  3SVR A;  3U0N A;  4Z4K A;  3PJB A;  4EMQ A;  2G6Y A;  3CFA A;  2HRS A;  2H5P A;  1F0B A;  3M22 A;  4W7X A;  3ADF A;  3LSA A;  1OXF A;  1EMG A;  4BDU A;  4XOW A;  3G9A A;  3ZTF A;  2HQZ A;  1JBY A;  3BX9 A;  2BTJ A;  4LJC A;  3RWT A;  1C4F A;  4KW4 A;  4OHS A;  4HQ8 A;  3DQE A;  5DTZ A;  4W76 A;  4H3M A;  3ST2 A;  3SRY A;  4W6A A;  2B3P A;  4B30 A;  1EMC A;  3NEZ A;  3EKH A;  3DQN A;  2H6V A;  2VVH A;  4KGE A;  3GJ2 A;  5FVG A;  5AQB B;  1EMB A;  4P76 A;  4W75 A;  3DQ5 A;  2G5Z B;  5BQL A;  3H1R A;  3P8U A;  3LVD A;  2V4E C;  4DKM A;  2Z6Z A;  4LQU A;  2QLI A;  2HQK A;  3DQK A;  3VIC A;  4W6T A;  2ZMW A;  2QLG B;  3DQD A;  4KEX A;  3W1D A;  1GGX A;  1HCJ A;  5DTY A;  3DQA A;  3DQF A;  1YJ2 A;  4ANJ A;  1YFP A;  2H5O A;  2AWM A;  2QLE A;  4OJ0 A;  2IE2 A;  1B9C A;  5HBD A;  2A52 B;  3SG6 A;  3I19 A;  2Z6Y A;  4GOB A;  1Q4E A;  2IB5 A;  3BXA A;  2EMO A;  3EVP A;  3OSQ A;  2ARL A;  3AI5 A;  3ZUF A;  2H5Q A;  4W6P A;  3PJ7 A;  2DUG A;  1KP5 A;  2Y0G A;  4KAG A;  4TZG A;  3S05 A;  1EMF A;  2HJO A;  3GEX A;  4JFG A;  2A56 B;  3DQ9 A;  4IZN A;  1GL4 A;  4DXN A;  5EBJ A;  2Q6P A;  5J2O A;  3SSV A;  3DPX A;  3NF0 A;  1EME A;  4ZBL A;  4W6H A;  5DPH A;  5BTT A;  2G6X A;  2P4M A;  3ED8 A;  1MOV A;  4IK5 A;  5LTR A;  2YFP A;  5DRG A;  4OGS A;  1QYO A;  3EK8 A;  1Q4C A;  3VHT A;  2ICR A;  4EDO A;  4ZB1 A;  4H47 A;  2VVJ A;  3CBE A;  3WLC A;  2OTE A;  4W6F A;  1G7K A;  2DUE A;  2WSN A;  2C9J A;  4KW8 A;  3SSY A;  3EVR A;  4ZF5 A;  3O77 A;  1MYW A;  5EXB A;  2WUR A;  4W6U A;  4W6M A;  3CD9 A;  4Q7U A;  4R6D A;  1EMK A;  2OKW A;  2ZO7 A;  3OGO A;  2HGD A;  4AR7 A;  1ZUX A;  4EN1 A;  2DD7 A;  3DQ3 A;  2O29 A;  4Z4M A;  5KTG A;  3LS3 A;  5H87 A;  4P1Q A;  3SVC A;  3GJ1 A;  1W7S A;  3RWA A;  3LVC A;  3DQL A;  5FHV A;  3DQ2 A;  4XOV A;  4DXM A;  3AI4 A;  3SG5 A;  3DQ7 A;  2IOV A;  4ZFS A;  2VAD A;  4W7F A;  3A8S A;  3SV5 A;  3AKO A;  3LF4 B;  4IK8 A;  1Z1P A;  5EHU A;  2WHT A;  2A48 A;  4ZF3 A;  1XSS A;  1HUY A;  3KCT A;  4W6B A;  2H9W A;  2QZ0 A;  3BXB A;  2GX0 A;  1RRX A;  2VAE A;  4HQ9 A;  2OKY A;  1ZGO A;  4W7A A;  4W6R A;  2QLG A;  2Z6X A;  2AWJ A;  4DXI A;  5DQM A;  1Q4D A;  4Q9X A;  4J89 A;  3ZUJ A;  1W7U A;  4JGE A;  4H48 A;  1JBZ A;  4TZA A;  3PJ5 A;  3MGF A;  5HW9 A;  1Q73 A;  1EMA A;  3U8P A;  1MOU A;  5FVI A;  4DXQ A;  2EMD A;  3EKJ A;  4L12 A;  3IP2 A;  4W6K A;  2O2B A;  3DPW A;  4HVF A;  1JC0 A;  1QYF A;  1OXE A;  4RYS A;  4W73 A;  3H1O A;  3ST3 A;  2GX2 A;  3EK7 A;  5LK4 A;  1UIS A;  5H88 A;  5DU0 A;  1YHG A;  4W72 A;  4JC2 A;  1EML A;  3SG2 A;  2DUF A;  4J8A A;  3LVA A;  3U8A A;  5HGE A;  5EJU A;  3TMT A;  3DQJ A;  2OJK A;  2AH8 A;  5EXC I;  5LTP A;  2PXW A;  5DQB A;  2QLH A;  4IK9 A;  2V4E B;  2YDZ A;  5EB7 A;  2GW3 A;  3SVE A;  3U8C A;  2OTB A;  3U0L A;  4W6J A;  1XAE A;  2DDD A;  5DPI A;  5H89 A;  3E5V A;  4R6B A;  2G2S B;  3GB3 A;  4H3N A;  4I2Y A;  4DXO A;  2ZMU A;  3SSH A;  4RTC A;  4LW5 A;  1RMM A;  5DY6 A;  4IK3 A;  2H8Q A;  2HFC A;  4LJD C;  3EVV A;  1RM9 A;  3NED A;  2G3O A;  4ZF4 A;  3DQ4 A;  3DPZ A;  2Q57 A;  3P28 A;  3SVB A;  3K1K A;  3E5W A;  2DUH A;  3DQM A;  3DQU A;  5DPJ A;  4W74 A;  3ST4 A;  2A46 A;  2IB6 A;  4JRB A;  5T3I A;  2C9I A;  3E5T A;  2FWQ A;  4IK1 A;  3U0M A;  4KF5 C;  4KF4 A;  2WHS A;  1RMO A;  1BFP A;  4DKN A;  4JEO A;  3SST A;  3V3D A;  3DQI A;  2WSO A;  3SS0 A;  3SVD A;  2AWL A;  1KYR A;  4Q7R A;  5DTL A;  4NWS A;  4JF9 A;  3KCS A;  3O78 A;  1KYP A;  4EDS A;  2ZO6 A;  4W7C A;  4W7E A;  4LQT A;  3UG0 A;  2HCG A;  4AS8 A;  4LJD A;  3ST0 A;  4W6S A;  3SG3 A;  4XVP A;  3SSL A;  2JAD A;  4W7D A;  2GW4 B;  4GES B;  2DDC A;  3SG7 A;  3NT3 A;  1EMM A;  1QXT A;  4W6O A;  2WHU A;  4KF5 A;  5EB6 A;  4KGF A;  3LA1 A;  3CFH A;  1OXD A;  1S6Z A;  1Z1Q A;  4B30 B;  1GFL A;  1YHI A;  3EK4 A;  2YE0 A;  2QT2 A;  2DD9 A;  2Z1O A;  5F9G A;  3DQ1 A;  3SG4 A;  1QYQ A;  1ZGQ A;  5LTQ A;  2A47 A;  2G6E A;  3DQC A;  1XA9 A;  2VZX A;  2OGR A;  1Q4B A;  4DXP A;  3SVN A;  4KW9 A;  4OY4 A;  3SSK A;  2POX A;  1W7T A;  3OSR A;  5HZU A;  4LJB A;  2G3D B;  4PPK A;  3DQO A;  3DQ6 A;  4RYW A;  3WCK A;  3CB9 A;  5BT0 A;  4UTS A;  5FVF A;  1XQM A;  3TMR A;  5EXU A;  3VK1 A;  2B3Q A;  3SVU A;  1H6R A;  4N3D A;  4PPL A;  2AHA A;  2QRF A;  2RH7 A;  4KA9 A;  3SSP A;  2PXS A;  3UFZ A;  3WLD A;  3EVU A;  1YZW A;  5HZT A; 
#chains in the Genus database with same CATH homology
 1KYS A;  4W6D A;  4W6I A;  2YE1 A;  4W6G A;  1XMZ A;  3GL4 A;  2G16 B;  4W6L A;  3SVS A;  4GF6 B;  3BXC A;  4W69 A;  2VVI A;  4HE4 A;  1YJF A;  2H5R A;  3CGL A;  4HQC A;  2V4E A;  3CFF A;  5DTX A;  3W1C A;  2FZU A;  4OQW A;  4EUL A;  4ZIN A;  3SVO A;  4U2V A;  4W77 A;  2A50 B;  1YHH A;  4PPJ A;  4W7R A;  1ZGP A;  3ZUL A;  3DQ8 A;  5HZO A;  5DRF A;  4ZIO A;  2WIQ A;  3LF3 A;  2QU1 A;  3IR8 A;  1Q4A A;  3U0K A;  5HZS A;  3CD1 A;  1F09 A;  4ORN A;  2AWK A;  4B5Y A;  4IK4 A;  4KPI A;  1RMP A;  2EMN A;  3NT9 A;  4L1I A;  5BTT B;  2A54 B;  2A53 B;  4XL5 A;  5DPG A;  2O24 A;  3M24 A;  4W6N A;  1JC1 A;  2WIS A;  2DUI A;  2HPW A;  4L13 A;  2HGY A;  4H3L A;  4Q9W A;  3VHT B;  4Q7T A;  1CV7 A;  1QY3 A;  3DQH A;  1H4U A;  2FL1 A;  4PFE A;  4XGY A;  4J88 A;  3PIB A;  4W6C A;  3SVR A;  3U0N A;  4Z4K A;  3PJB A;  4EMQ A;  2G6Y A;  3CFA A;  2HRS A;  2H5P A;  1F0B A;  3M22 A;  4W7X A;  3ADF A;  3LSA A;  1OXF A;  1EMG A;  4BDU A;  4XOW A;  3G9A A;  3ZTF A;  2HQZ A;  1JBY A;  3BX9 A;  2BTJ A;  4LJC A;  3RWT A;  1C4F A;  4KW4 A;  4OHS A;  4HQ8 A;  3DQE A;  5DTZ A;  4W76 A;  4H3M A;  3ST2 A;  3SRY A;  4W6A A;  2B3P A;  4B30 A;  1EMC A;  3NEZ A;  3EKH A;  3DQN A;  2H6V A;  2VVH A;  4KGE A;  3GJ2 A;  5FVG A;  5AQB B;  1EMB A;  4P76 A;  4W75 A;  3DQ5 A;  2G5Z B;  5BQL A;  3H1R A;  3P8U A;  3LVD A;  2V4E C;  4DKM A;  2Z6Z A;  4LQU A;  2QLI A;  2HQK A;  3DQK A;  3VIC A;  4W6T A;  2ZMW A;  2QLG B;  3DQD A;  4KEX A;  3W1D A;  1GGX A;  1HCJ A;  5DTY A;  3DQA A;  3DQF A;  1YJ2 A;  4ANJ A;  1YFP A;  2H5O A;  2AWM A;  2QLE A;  4OJ0 A;  2IE2 A;  1B9C A;  5HBD A;  2A52 B;  3SG6 A;  3I19 A;  2Z6Y A;  4GOB A;  1Q4E A;  2IB5 A;  3BXA A;  2EMO A;  3EVP A;  3OSQ A;  2ARL A;  3AI5 A;  3ZUF A;  2H5Q A;  4W6P A;  3PJ7 A;  2DUG A;  1KP5 A;  2Y0G A;  4KAG A;  4TZG A;  3S05 A;  1EMF A;  2HJO A;  3GEX A;  4JFG A;  2A56 B;  3DQ9 A;  4IZN A;  1GL4 A;  4DXN A;  5EBJ A;  2Q6P A;  5J2O A;  3SSV A;  3DPX A;  3NF0 A;  1EME A;  4ZBL A;  4W6H A;  5DPH A;  5BTT A;  2G6X A;  2P4M A;  3ED8 A;  1MOV A;  4IK5 A;  5LTR A;  2YFP A;  5DRG A;  4OGS A;  1QYO A;  3EK8 A;  1Q4C A;  3VHT A;  2ICR A;  4EDO A;  4ZB1 A;  4H47 A;  2VVJ A;  3CBE A;  3WLC A;  2OTE A;  4W6F A;  1G7K A;  2DUE A;  2WSN A;  2C9J A;  4KW8 A;  3SSY A;  3EVR A;  4ZF5 A;  3O77 A;  1MYW A;  5EXB A;  2WUR A;  4W6U A;  4W6M A;  3CD9 A;  4Q7U A;  4R6D A;  1EMK A;  2OKW A;  2ZO7 A;  3OGO A;  2HGD A;  4AR7 A;  1ZUX A;  4EN1 A;  2DD7 A;  3DQ3 A;  2O29 A;  4Z4M A;  5KTG A;  3LS3 A;  5H87 A;  4P1Q A;  3SVC A;  3GJ1 A;  1W7S A;  3RWA A;  3LVC A;  3DQL A;  5FHV A;  3DQ2 A;  4XOV A;  4DXM A;  3AI4 A;  3SG5 A;  3DQ7 A;  2IOV A;  4ZFS A;  2VAD A;  4W7F A;  3A8S A;  3SV5 A;  3AKO A;  3LF4 B;  4IK8 A;  1Z1P A;  5EHU A;  2WHT A;  2A48 A;  4ZF3 A;  1XSS A;  1HUY A;  3KCT A;  4W6B A;  2H9W A;  2QZ0 A;  3BXB A;  2GX0 A;  1RRX A;  2VAE A;  4HQ9 A;  2OKY A;  1ZGO A;  4W7A A;  4W6R A;  2QLG A;  2Z6X A;  2AWJ A;  4DXI A;  5DQM A;  1Q4D A;  4Q9X A;  4J89 A;  3ZUJ A;  1W7U A;  4JGE A;  4H48 A;  1JBZ A;  4TZA A;  3PJ5 A;  3MGF A;  5HW9 A;  1Q73 A;  1EMA A;  3U8P A;  1MOU A;  5FVI A;  4DXQ A;  2EMD A;  3EKJ A;  4L12 A;  3IP2 A;  4W6K A;  2O2B A;  3DPW A;  4HVF A;  1JC0 A;  1QYF A;  1OXE A;  4RYS A;  4W73 A;  3H1O A;  3ST3 A;  2GX2 A;  3EK7 A;  5LK4 A;  1UIS A;  5H88 A;  5DU0 A;  1YHG A;  4W72 A;  4JC2 A;  1EML A;  3SG2 A;  2DUF A;  4J8A A;  3LVA A;  3U8A A;  5HGE A;  5EJU A;  3TMT A;  3DQJ A;  2OJK A;  2AH8 A;  5EXC I;  5LTP A;  2PXW A;  5DQB A;  2QLH A;  4IK9 A;  2V4E B;  2YDZ A;  5EB7 A;  2GW3 A;  3SVE A;  3U8C A;  2OTB A;  3U0L A;  4W6J A;  1XAE A;  2DDD A;  5DPI A;  5H89 A;  3E5V A;  4R6B A;  2G2S B;  3GB3 A;  4H3N A;  4I2Y A;  4DXO A;  2ZMU A;  3SSH A;  4RTC A;  4LW5 A;  1RMM A;  5DY6 A;  4IK3 A;  2H8Q A;  2HFC A;  4LJD C;  3EVV A;  1RM9 A;  3NED A;  2G3O A;  4ZF4 A;  3DQ4 A;  3DPZ A;  2Q57 A;  3P28 A;  3SVB A;  3K1K A;  3E5W A;  2DUH A;  3DQM A;  3DQU A;  5DPJ A;  4W74 A;  3ST4 A;  2A46 A;  2IB6 A;  4JRB A;  5T3I A;  2C9I A;  3E5T A;  2FWQ A;  4IK1 A;  3U0M A;  4KF5 C;  4KF4 A;  2WHS A;  1RMO A;  1BFP A;  4DKN A;  4JEO A;  3SST A;  3V3D A;  3DQI A;  2WSO A;  3SS0 A;  3SVD A;  2AWL A;  1KYR A;  4Q7R A;  5DTL A;  4NWS A;  4JF9 A;  3KCS A;  3O78 A;  1KYP A;  4EDS A;  2ZO6 A;  4W7C A;  4W7E A;  4LQT A;  3UG0 A;  2HCG A;  4AS8 A;  4LJD A;  3ST0 A;  4W6S A;  3SG3 A;  4XVP A;  3SSL A;  2JAD A;  4W7D A;  2GW4 B;  4GES B;  2DDC A;  3SG7 A;  3NT3 A;  1EMM A;  1QXT A;  4W6O A;  2WHU A;  4KF5 A;  5EB6 A;  4KGF A;  3LA1 A;  3CFH A;  1OXD A;  1S6Z A;  1Z1Q A;  4B30 B;  1GFL A;  1YHI A;  3EK4 A;  2YE0 A;  2QT2 A;  2DD9 A;  2Z1O A;  5F9G A;  3DQ1 A;  3SG4 A;  1QYQ A;  1ZGQ A;  5LTQ A;  2A47 A;  2G6E A;  3DQC A;  1XA9 A;  2VZX A;  2OGR A;  1Q4B A;  4DXP A;  3SVN A;  4KW9 A;  4OY4 A;  3SSK A;  2POX A;  1W7T A;  3OSR A;  5HZU A;  4LJB A;  2G3D B;  4PPK A;  3DQO A;  3DQ6 A;  4RYW A;  3WCK A;  3CB9 A;  5BT0 A;  4UTS A;  5FVF A;  1XQM A;  3TMR A;  5EXU A;  3VK1 A;  2B3Q A;  3SVU A;  1H6R A;  4N3D A;  4PPL A;  2AHA A;  2QRF A;  2RH7 A;  4KA9 A;  3SSP A;  2PXS A;  3UFZ A;  3WLD A;  3EVU A;  1YZW A;  5HZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...