3MGGA

Crystal structure of methyl transferase from methanosarcina mazei
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
246
structure length
246
Chain Sequence
ETLEKLLHHDTVYPPGAKVLEAGCGIGAQTVILAKNNPDAEITSIDISPESLEKARENTEKNGIKNVKFLQANIFSLPFEDSSFDHIFVCFVLEHLQSPEEALKSLKKVLKPGGTITVIEGDHGSCYFHPEGKKAIEAWNCLIRVQAYMKGNSLVGRQIYPLLQESGFEKIRVEPRMVYIDSSKPELVDGFILKTIIPMVEGVKEQSLKMQIIKEEEWEKGIEELHKTAEHGGTFCYTFFKGWGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Methyl Transferase from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Transferase
molecule keywords Methyltransferase
total genus 85
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mggA01
3G2MA 5GWXA 4NECA 4E70A 5FA8A 4PCLA 3EVCA 2PY6A 4R8SA 1G60A 2ERCA 2OBFA 3A4TA 3AWIA 3DXZA 2ZULA 3A27A 5DM1A 4A6EA 4E30A 4UOEA 1H1DA 5KS2A 2AOTA 2EX4A 5LQAA 3E8SA 1RI1A 1XTPA 3G5TA 3CGGA 4FSXA 2PT9A 4DZRA 1XJ5A 2IP2A 2PV0A 3EEYA 5E1OA 3U81A 1SQFA 2NXJA 3ER8A 4WVLA 3SVZA 2AOXA 3KQQA 2IBSA 2E5WA 2YQZA 5HFJA 1JTFA 3NDJA 4RVDA 5DM0A 1JR4A 5E2AA 1NW7A 5CVVA 4AUKA 1TW3A 3P97A 5M5BA 5HIMA 2GLUA 1Y8CA 1G55A 3E23A 4A6DA 4KRGA 2IPXA 3FTCA 2P3LA 1JQEA 3SX0A 5EKXA 2CWWA 2FK8A 1DUSA 4KWCA 2QYOA 3HM2A 3DR5A 3AXSA 3B3GA 1JQDA 3C6KA 4GUAA 3UJ8A 1EJ6A 4CTKA 2ZCJA 1G8SA 2G70A 2NXEA 3LKZA 5EVJA 4RVFA 4P7GA 5EIFA 1NW5A 1O9HA 3DP7A 2QM3A 5KVAA 5CUQA 3MTEA 3FYDA 1RI4A 1RJEA 5EC8A 3HP7A 2ONZA 4DF3A 5LQCA 2JG3A 2PVCA 1NV9A 3MQ2A 2O06A 1SVUA 2NP6A 3BWCA 2JHPA 3G8AA 3NVMB 1IXKA 3P2KA 2IGTA 3O31A 4DCGA 1QAOA 4OX9Y 2GA9A 2O05A 1P1CA 3UJ6A 4KDRA 1ZGAA 2ORED 3P9KA 5FWDA 4RTQA 4RWZA 5DRTA 2JH8A 3HA5A 3KPVA 4ISCA 4Y30A 4QDJA 3MHTA 1VL5A 2BM9A 1JG2A 3LDGA 3EEOA 3KU1A 1AQJA 1X1BA 1VPTA 2AN3A 2EJTA 2UYOA 5P8WA 5EMJA 2P40A 4FR0A 4EKIA 4EQZA 4YV1A 2AVDA 5K0CA 4ZTBA 2ZIEA 3GU3A 4KDCA 3TFWA 2PXCA 5CVEA 4F85A 2ZZKA 3DULA 2PX4A 3CBGA 2VP3A 3C3PA 3GNLA 3BGVA 10MHA 2QRVB 3EGVA 4BLWA 3FTFA 3REOA 2OKCA 4YMHA 4ER6A 2C7OA 3OCJA 2DULA 3MB5A 1KIAA 4CWAA 3FUTA 1IY9A 1L3BA 3BKWA 4ER3A 2V7EA 1UIRA 2FYTA 4CKCA 1FP1D 1AQIA 4FP9A 3UJBA 3QOXA 3LGAA 4C4AA 3FPHA 1Q0SA 1BC5A 5D1HA 2NYUA 4FSDA 5GP1A 4RTJA 3FYCA 4PYNA 4GOOD 1X1CA 5CVJA 2BR3A 2ZBQA 5E9WA 4HG2A 1YZHA 3DLIA 4PYLA 3DMHA 3UJ9A 4L7VA 2PGXA 4RTMA 4RTNA 5HIKA 1M6YA 2JHAA 2DPMA 3M6XA 4GOLD 3FPFA 2I9KA 2Y1XA 2HTEA 1NE2A 2P1DA 2ZIGA 1WXWA 3OU6A 5DX1A 5G02A 2ZBRA 3HCBA 3ER9A 3VC1A 2JH9A 3GRRA 3SMQA 1IM8A 2PX5A 2R3SA 3TPZA 1VQ1A 3GIWA 3HVIA 4R05A 3I58A 4AZWA 2OY0A 5FTWA 4ER7A 4P7FA 5K0NA 3ELDA 1BHJA 3B3JA 3P9IA 1D2GA 5FCDA 5K01A 5K0LA 3KQPA 3GWZA 2ZSUA 3Q87B 4PYIA 4E2ZA 4PINA 2A14A 3FTEA 1V39A 5LSAA 3DMFA 4H0NA 5C1IA 1FPQA 3TRKA 1JTEA 3DLCA 2FPOA 5BW4A 4BY9E 1HMYA 4CTJA 3EGIA 1M6EX 2VDWA 5FUBA 3MCZA 3EMBA 4PYQA 3KQYA 3JWHA 3KQWA 3G8BA 3FUXA 3G2QA 1RJDA 3LDUA 1NBHA 2BM8A 2BR4A 4OA8A 2OO3A 3EGEA 4X1OA 4F86A 4PYJA 1T43A 3I9FA 5F2NA 3FRHA 1SUIA 4PYOA 4EMSA 1L3CA 5T6BA 1AV6A 4RTLA 2VDUE 3EPPA 3GRYA 2P7IA 4XUEA 1WS6A 3L8DA 4ATNA 3BXOA 4AZSA 4F84A 3NTVA 4E2YA 3T7RA 2Z6AA 4JXJA 5CM2Z 3TLJA 1O54A 4P7JA 5FHRA 4BP1A 5GIOE 4RTKA 1VBFA 3SXJA 5DRYA 5KQSA 4GC5A 5K0BA 1P1BA 4CKBA 2JHCA 3ME5A 1R00A 3TM4A 9MHTA 5ICCA 1ZQ9A 3BGDA 3ANXA 3CJTA 3DTNA 5C0OE 3TQSA 4YUWA 4BLUA 4YV0A 1TW2A 4KVZA 4X60A 4C05A 1AF7A 1INLA 4E31A 3OZSA 2IBTA 3UFBA 1M0EA 5E8RA 3HVHA 4QVKA 4C06A 5DTRA 2LD4A 1YFJA 3G88A 4PNEA 2YR0A 2HNKA 3G89A 4QQNA 1WZNA 2HR1A 2I6GA 5MHTA 2G71A 5ERGB 3K0BA 2N47A 5E8JA 1ZG3A 3LSTA 2HWKA 3GO4A 3HNRA 4PCAA 4PYKA 5FQNA 1QANA 5EIWA 3NW9A 4PWYA 3BT7A 2EJUA 3A25A 5CCBA 2P3OA 3IHTA 2I62A 2YXDA 4GOND 4QPNA 1VE3A 3IV6A 4GEKA 4OQEA 3PB3A 2ESRA 3JWIA 2ADMA 3TR6A 2XVMA 3UA4A 2UYHA 3P71T 4R8RA 4U7TB 4XUCA 2HV9A 3KQTA 3DMGA 5E9JA 3V8VA 3CJRA 1EQAA 1RI5A 4Z2YA 3EVEA 2AOTB 3BUSA 4DMGA 3ELUA 3A26A 3LBFA 4R6WA 5CVDA 5EHIA 2YXEA 1DL5A 5GM2A 4LG1A 4YUVA 5T64A 3SGLA 4MHTA 3LBYA 1D2CA 2AN5A 1RJFA 3FUUA 2JJQA 1KHHA 5C9ZA 3R0QA 3PX3A 2HMYB 2PSSA 1OR8A 5IKMA 3SM3A 2IH2A 1R74A 3NJRA 4Y2HA 2YX1A 5FA5A 3VYWA 1R18A 2H00A 4AX8A 4YMGA 3PT9A 5HILA 3B3FA 3A7DA 3DUWA 5EMLA 4CXMA 2AOWA 1VLMA 2VS1A 3OE5A 5JUWA 3PVCA 1WXXA 3AJDA 3WSTA 5GIPE 4C03A 3P8ZA 4MWZA 5K0JA 2B78A 4PGHA 3UJDA 5BW5A 3G7UA 2GH1A 1NW8A 1P39A 2YTZA 2CMGA 4HGYA 4MIKA 1MJFA 1FP2A 3KQOA 2Z6QA 4HSGA 1B42A 4YV2A 1KPHA 5JR3A 4POOA 2IDKA 4HH4A 3GRVA 3AXTA 3EVFA 3SR4A 4G56A 2QY6A 3G2PA 5LQNA 4C04A 2FK7A 3LCCA 1YB2A 2B9EA 4E32A 2CKDA 2K4MA 3FZGA 1L3IA 3KR2A 2ZTHA 3PFGA 3F4KA 3HA7A 4P58A 1N7JA 2GAFA 2WA2A 3ERCA 2FRXA 4M7RA 3BWMA 3KPYA 3P2IA 3CKKA 4O29A 2UYQA 5E9QA 5EPEA 5HIJA 4EKGA 2XBMA 1MHTA 3KPWA 2OXTA 3K6RA 1I4WA 3RODA 3NMUF 2I7CA 2OB2A 3OZRA 2ZBPA 1NW3A 1NV8A 4X61A 4PIPA 2UZ4A 4QVGA 4RX1A 3T7TA 3TKAA 4RTRA 2H11A 2YUIA 1RI2A 3THSA 2F8LA 2VDVE 3PFHA 5EHGA 4PGGA 1XDUA 4E2WA 5DX8A 4MQ4A 2ZVJA 4QPPA 4PYMA 5LR6A 3FPJA 3MTIA 1KYZA 1R8XA 1JSXA 3UJCA 3M33A 3BZBA 5K8VA 2B3TA 2KW5A 2B2CA 3M4XA 3NVKI 5EGSA 3NDIA 3GRUA 1Q0TA 1FBNA 1P91A 3HVJA 2NXCA 2IDJA 3GJYA 3R3HA 4U7PB 1YUBA 1D2HA 4LECA 4WXHA 5DM4A 1G38A 4X63A 3HTXA 3BWYA 2BZGA 4LWPA 5T67A 4RSRA 3EVAA 2O57A 4R6XA 2NNWB 4ER5A 2AOVA 1L1EA 2GS9A 5K0GA 1PJZA 5HZMA 8MHTA 3R6TA 1QZZA 3EVBA 3JWGA 3OPNA 4IV8A 1VP9A 4IWNA 4LWOA 3OFJA 1HNNA 1N7IA 1G6Q1 3LHDA 4BP3A 3KQMA 1NKVA 4DM3A 5KQRA 5GINE 2GPYA 2P8JA 5FWAA 1ORIA 3UBTA 5LQKA 1SG9A 3SSOA 4KIFA 5DSXA 4DA4A 2CL5A 1ZHFA 3C3YA 3HCDA 2C7RA 3EVZA 2CMHA 5E1BA 3HEMA 3I5UA 3SSNA 3I53A 4YUYA 2AVNA 2ZLBA 4V0QA 5E1MA 5K05A 1JQ3A 4FZVA 1ZGJA 5E2BA 2NXNA 3FTDA 3ELWA 3IYLW 4M38A 3TM5A 5DXJA 2PBFA 2AS0A 3H2BA 3OFKA 3X0DA 2ZWVA 2EG5A 2G1PA 1XCJA 3DXXA 3OU7A 1X1AA 3BWBA 1VIDA 5K03A 4PIMA 4GQBA 5KYGA 1ZKDA 2ZZMA 5DSTA 1EG2A 2GB4A 1EIZA 1Z3CA 5DPMA 5DTQA 5CVUA 3OE4A 2BH2A 3HCCA 2XYVA 1DCTA 2R6ZA 3E05A 1ORHA 4KIGA 2NP7A 1YFLA 3HVKA 2UYCA 5H02A 2ONYA 2IIPA 4OBXA 2PXAA 3G5LA 1QAQA 5HEKA 4QQKA 1TPYA 1XVAA 3O7WA 1UWVA 4QTUB 3LCUA 4IV0A 5EZSA 3TKYA 3ID6C 3PX2A 4M37A 5ICGA 3LCVB 4K6MA 1YF3A 1FJXA 3HCAA 3E7PA 2ZIFA 1I9GA 1KPGA 2PJDA 2ZW9A 5E1DA 3TMAA 3VSEA 4RV9A 1WG8A 3V97A 5HIIA 2C7PA 5F2KA 4HGZA 1X19A 4P7KA 4E2XA 1XDZA 2FHPA 3QOWA 4EVIA 2QE6A 5K0FA 3PTAA 4GBED 5GM1A 3FUVA 2AN4A 3FRIA 4EK9A 3IEIA 4YUZA 2QRVA 3DOUA 3KQSA 3B5IA 1R6AA 5CCXA 4QTTB 1EAMA 2PKWA 3M6WA 3EVDA 2ZWAA 4DCMA 1I1NA 3MCTA 3A7EA 2PLWA 5DWQA 3LX6A 1NBIA 2XVAA 3UJ7A 2IH5A 5DLYA 2P35A 3HCEA 3R24A 1F38A 3GXOA 5F2OA 3RIEA 5ICEA 3KR0A 2YXLA 3Q7EA 3QV2A 4QDKA 2P3QA 4OQDA 2PWPA 3VC2A 3T7SA 5FHQA 4V0RA 2IH4A 1N2XA 1KXZA 4GOMD 4RTPA 2V74B 5U4XA 1YZ3A 3GCZA 1JG3A 5EQJB 3FUWA 3LECA 4DQ0A 3ORHA 4FT4A 1F3LA 3M6VA 3KR9A 3C6MA 3I64A 1U2ZA 2IFTA 3FPEA 3LL7A 4FT2A 4HTFB 4RVHA 1SKMA 4C08A 2XYQA 5D1NA 4XCXA 4B17A 2AOUA 5DT2A 5LQUA 3GRZA 5EOVA 1XXLA 4GF5A 3KPUA 2Y1WA 3BKXA 3GDHA 4IKPA 1JG1A 5FULA 3CC8A 3KHKA 3S68A 5LQJA 3GGDA 1KPIA 2ZFUA 3P9CA 5EEHA 4ER0A 3M70A 1L9KA 3NWEA 3OU2A 2Q41A 3PS9A 2PX2A 3KQVA 2G8NA 4X41A 1VP3A 3R9XB 2P41A 2Z6UA 3EMDA 1RI3A 5GOZA 2WK1A 5BXYA 1WY7A 4RVGA 1PRYA 3HA3A 1XCLA 1X1DA 5K09A 2AR0A 2OB1A 7MHTA 1XDSA 1BOOA 1EJ0A 1G8AA 1SQGA 4FGZA 1NT2A 2P7HA 4HRAA 3B89A 5FQOA 3SSMA 1BKYA 2WA1A 3JWJA 5DX0A 5EMMA 1O9GA 5B1SA 4AZVA 5EMKA 2B25A 5K0EA 3T0IA 4GC9A 2OYRA 2PX8A 3MAGA 3P2EA 3EVGA 5BP7A 4HTFA 1KR5A 4KW7A 4E33A 3PLAE 2OPBA 5EEGA 4AZTA 5DM2A 2PXXA 4DKJA 1KYWA 3DH0A 3KR1A 3NWBA 4XUDA 3UZUA 5IH3A 1RJGA 1QYRA 3P9NA 1JSZA 1JG4A 3THRA 2YVLA 5FADA 4BLVA 4C07A 4CKEA 1R8YA 5EKUA 4YUXA 2ZZNA 4RTSA 1NW6A 2FCAA 2EFJA 2BR5A 3HCFA 4OBWA 4RYLA 3OZTA 3UA3A 5CIYA 2PT6A 3MERA 2H1RA 3KPJA 4MTLA 5CD1A 1KP9A 3TOSA 4RTOA 4HC4A 2G72A 4OA5A 3O4FA 3MGGA 3C0KA 4M36A 4PONA 3ELYA 3BGIA 3KKZA 5HOQA 2AZTA 5EZQA 5ICFA 2PWYA 2AOUB 3AY0A 3CCFA 5LQRA 3LPMA 2OZVA 1QAMA 3DXYA 2VZ9A 3LKDA 2O07A 3LDFA 5DTMA 3CJQA 3G2OA 5EG5A 4FS8A 3D2LA 1UFKA 3M6UA 2O0LA 2C7QA 5DXAA 3B7PA 3RW9A 3CVOA 3UWPA 3UJAA 2XYRA 1SUSA 3FPGA
chains in the Genus database with same CATH superfamily
2CVOA 3TO5A 4EYKA 4PCLA 1AHHA 1XE3A 5JXHA 4XX1A 3K94A 4NVRA 3TDKA 1M1UA 4E30A 5I4BA 3TAXA 2NIPA 2OCIA 3H4MA 1K7SN 3NNNA 3E35A 2XJ4A 4RETA 3WXBA 5LQAA 1GPWB 1YJBA 3TJRA 4QPZA 1PJRA 2RHOA 3N70A 3ZWMA 5JCOC 5LYJB 4R2KA 5LA6F 2HU2A 2NXJA 1AQLA 1R0WA 1ZOIA 4EYGA 2GM4A 4G81A 5AJYA 3EIFA 2KX7A 3LYLA 2R6R1 1ITZA 2XOKA 3W05A 3C8ZA 5G0WA 4DRYA 4PQYA 2JI4A 1PJCA 1Z8HA 3EB9A 1RMTA 1VJRA 1WEKA 2YJ6A 4A6DA 2PK3A 3H5AA 4KODA 4UAJA 4DC0A 1A7KA 1O1YA 3DW3X 1BWRA 5CITA 1VPWA 4OAPA 4LXYA 1LU9A 2HDOA 3TNDA 5AKZA 4Q4AB 1DRVA 2BMWA 2G5CA 4C3ZA 1W5TA 3D4NA 2OR3A 4G8DA 4YT5A 5JNRA 3D8HA 1CQXA 1JAYA 2ATCA 3FPKA 3OCCA 1Q0RA 4HQOA 5TR9A 1I3NA 1B93A 1NOKA 4TQAA 3C7CB 2CHGA 3D5QA 1BCSA 2PVCA 3C5VA 1KSHA 3D0KA 3QEMB 2JATA 5AHWA 3ANTA 4XWTA 4EGSA 2Y1FA 2ZYDA 4C7OA 1R0LA 2BGLA 1H8ED 2FPIB 3BE4A 4EB6B 4M2LA 3RRBA 2FVYA 2QWXA 3MC1A 4DBVO 4UNRA 1FVXA 4KREA 5ICMA 2DKOA 1JA0A 4ML3A 1I94B 5HFAA 1CNEA 1WMEA 1ZGAA 3K53A 3U7QB 2BCGY 4QATA 3OM8A 5BUQA 5CDSA 2O4UX 3JQ6A 4WUVA 4ZMBA 2BM9A 3OZUA 4H7DA 4NAHA 2GFHA 4QU0A 1OOEA 2J9YB 2G08A 5C2JB 4ACBA 1XAHA 1HDZA 2NV6A 5K0CA 2NZXA 2SNIE 4BNYA 1VA4A 3I6IA 2ZT5A 1I2MA 2OZLA 1EXMA 2LDBA 4QEKA 4A8JA 2FQYA 1F06A 3L0BA 5GJBA 1K5PA 3SBOA 1DO0A 1PJSA 4PO3X 4IGAA 1PVVA 1RCFA 4EECA 1M1NB 3MMZA 3O0TA 3REOA 1GCIA 4ARSA 1TNDA 3T4XA 5IDWA 1ZMTA 2DBZA 2M9MA 4G67A 1NHGA 2Y77A 4Q9JA 3KUXA 3MS2A 1RHUA 1SHTX 1NA5A 1J00A 3I1JA 2VUIB 1IY9A 3ZGNA 1T4BA 3KJZA 5BMVB 3KUUA 1D2NA 1FP1D 3PRHA 1MR3F 5CFOA 3SS8A 4BGEA 1V71A 2WSMA 1QRUA 4DZTA 2ZI9A 4LRTB 1RD4A 2NYUA 2HV8A 5EE5B 3RVSA 1OT3A 2XD4A 2QAGA 4K6FA 4DCUA 5EMHA 5BR7A 2DC1A 4IIDA 3PPVA 4KQWA 4E3ZA 3HXOA 1M34A 2WJHA 1OWLA 3NHJA 5FL3A 3HADA 3PXGA 4AT1A 1XLTC 3EJ6A 2NVUB 3R3UA 3LZDA 4I9FA 4D0GA 1N32B 1M6YA 1H0RA 3EISA 4KN9S 4C22A 1ZK1A 1X7ZA 4LK3A 2GEFA 2ID4A 4Z9AA 2OHOA 2FB9A 1Q1BA 1RIFA 2HTEA 3CW2A 1T6XA 3GQBB 2P1DA 1TYEB 3ANSA 2ZIGA 3LWBA 2FI1A 3DVRX 1YRQA 3T5DA 1B0PA 3PR2B 1RC1A 1NSYA 3GEBA 3K9NA 2IX9A 1HTBA 2I4RA 1KVQA 3CLVA 3FNBA 3GGSA 2PX5A 3HR8A 3TPZA 3WA7A 2CLOB 4NBWA 2EZ9A 3IAM6 1EZZA 5DDIP 3ZH9B 1LD3A 4DG8A 4AQ7A 1P4GA 1M2OA 3F8SA 1BDBA 1FRQA 3PJEA 4CF5A 3G2IA 5LZ4A 3SZLA 4MA5A 4B35A 2H0QA 4FFPA 1E6KA 3NGMA 4OK3A 3GLFE 2VTBB 4DDUA 5BW4A 5LYJF 2PRZA 4Z9BA 5FUBA 4CL0A 1HDGO 1VPEA 5EIEA 4MVJP 1YZNA 3JD0A 3Q40A 3EMBA 5U4QA 4A1OA 2H1WA 2IHKA 1XTJA 4BZPA 1MX9A 4UTOA 4YV7A 3TE7A 4R0NA 1JHXA 1R0ZA 1I3LA 2Q9UA 1HDIA 3HZOA 4CKYA 1H23A 1BDMA 1V16B 3X1JA 1PNRA 3PQFA 4UCFA 1ICEA 2DHQA 5LXTF 3SICE 1EJBA 5BV2P 1HLGA 5EIAA 2M98A 3T95A 4F12A 2HL6A 2RAVA 2WYIA 2FRDC 4A5SA 3G8CA 5ALPA 4TTJA 1QF6A 5ARDA 2R6CA 3TLJA 1GNSA 3W8NA 1P6QA 4Q4JA 4DLBA 5FOTA 2O1SA 2O5EA 1AS3A 2XUHA 1SXQA 3S8MA 4YLYA 2LE0A 3DM5A 3QKWA 4GZ6A 1WDMA 4FFRA 4EMUA 5KREA 3U44B 4N7BA 1QZ3A 1VIMA 3UENA 1EEHA 1JB9A 3QFRA 3IQEA 1N8SA 2J33A 4O2RA 3IX7A 4N1AA 4O5OA 2QG6A 3DYVA 2I3AA 3BRWA 4ME6A 3V7FA 2IBTA 3LRPA 4GMXA 3QA3E 1KMMA 3OFND 3L8GA 2F8MA 2L42A 1ZMXA 3I6BA 2HA5A 2UZAA 4AO8A 2H1OA 2GVNA 2XCUA 2KE5A 3NRBA 3GQVA 4QQNA 4CNQA 1XNJA 5BW8A 4YHHB 3U3ZA 1GSAA 1C0LA 1L7BA 2Q99A 3CPEA 5M2QA 3OVMA 4E7PA 2BM1A 4QSMA 5CCDA 1HG0A 4XCVA 1TAGA 3GJTA 1IJEA 3IBGA 2PLRA 2QX8A 1XZKA 3O8OB 2ZREA 4OX9Y 2ESRA 4MQFA 1P8JA 5C46F 3LUDA 5HE8A 2NZ8A 1EP9A 2QB5A 4YP6A 3JARB 1U9IA 2XVMA 3UA4A 4U7WA 1H2BA 3KQTA 4KEAA 2NPIA 3O91A 2BE7A 2OORA 3VDMA 1ZO8A 1A5SB 2R1VB 3A6HA 1RI5A 1T4CB 1W6RA 2YWXA 3IQIX 3CUKA 4RORA 1XNGA 3C16C 1E3EA 2LV8A 5EHIA 5ARBA 1NBMA 3RC8A 4LG1A 3DUFB 4CEIB 4KIJA 1TU4A 4X8LA 4XEUA 3RFVA 2NMVA 1VHQA 3Q3HA 4MRMA 2XYHA 4JXXA 5I7VA 4NESA 5CAEA 3U26A 4RS3A 4DV1B 2X1LA 1ZP6A 1W29A 1AIPA 2F3PA 1CLUA 2J7KA 3AUUA 2G04A 4QFMA 5E6RB 3T4UA 5HGXA 4D81A 1CETA 3JRXA 1XA4A 3ZYCA 1KK0A 1HYGA 1JQLB 4YR7A 2V1XA 5KYVA 1JU3A 1SR8A 4XDZA 3SNHA 3ZTYA 3ZDAA 2FG7C 4O4JF 4C03A 1XZHA 4D8UA 2PUBA 2C3YA 4TV9B 4UCXA 4XDHA 3QBDA 3UJDA 1JKJB 1IL0A 1GYPA 4EY7A 3ZE8A 2B9VA 2YIDA 2QA5A 4N82A 1CKEA 3VR5A 4B9AA 1I7DA 1M6VA 1OTYA 5AHKA 3EGWA 1V7CA 3CCBA 3GNTA 1V25A 4E4YA 1KPHA 5CBKA 1BMFA 1XF1A 4BKQA 4KI0A 3KJIA 5F9FA 4QASA 3VOSA 1IWOA 1SIOA 2P2DA 4H7FA 4KOEC 4C4OA 2Q5CA 3VKHA 3GLIA 1JU9A 1LXCA 4G5OA 3K5WA 3QVSA 1SHJA 3HA7A 1W34A 4TVKA 1ODTC 3HFSA 1NL3A 1N34B 3ZHCA 1M2HA 2VQEB 2ZB3A 4AIIA 2FRXA 3DEHA 4L85A 4N3GA 3Q98A 3R9WA 4CN9A 3GDFA 5E9QA 2IYEA 1XFDA 2OV1A 1UBEA 1UWLA 2PIAA 2GKOA 2XBUA 3HA2A 4G85A 2BSAA 4QUIA 5EJMA 1L7MA 4KQ9A 3R7SA 3KTOA 4WV3A 2GN2A 2OB2A 4YB8A 2XUGA 1DIGA 1TDJA 2A9PA 4QVGA 4ADSG 3NXSA 5BT9A 1ZD2P 3DOJA 3RTGA 3BCUA 5B1HA 1UPXA 1N2ZA 2W6OA 4GXQA 2ZVJA 4QPPA 2P78A 1MTOA 2CSXA 4YALA 1ZRSA 3CNOA 1GCGA 1MVOA 3LS2A 3PENA 5GVRA 2VBGA 4KJXA 5JS7A 3BZBA 1PFQA 1RQLA 2JIDA 1W5FA 3ZHVA 1VI5A 1E7WA 5IT4A 1Z73A 2F00A 1FF9A 2H7CA 4J8PA 4J1TA 1TJ3A 3HHPA 3BK2A 3MWEB 1WB6A 1U28A 3N6VA 4NEQA 3ES9A 4LECA 4PSAA 2JIOA 3OPMA 4WUTA 4DOMA 4EI7A 1WZ2A 1P61B 1OWMA 2W2MA 2GZAA 1CVLA 1QV6A 2NT4A 4H1TA 1EFVA 4JJEA 5HZMA 1N5RA 4NXMB 1DG9A 3IBYA 3IDZA 1DJLA 4UMFA 1WAMA 3QVKA 1S4MA 1TF7A 4IDAA 4BP3A 1JWLA 3IOEA 2FN4A 4HAWA 1Z7YA 5SY6A 3SQNA 5E6SB 3OCVA 2IP4A 2I5PO 4JEMA 3WV4A 2EZ8A 1KKLA 2ZITA 3OO1A 3O1HB 3HCDA 2IYVA 4WY2A 5KMGA 2AD1A 2H6EA 3FSEA 2AVNA 2B35A 5K05A 1UAGA 4RPIA 3MJDA 3ROGA 4P3OA 3W77A 4WZAE 4O08A 4CM6A 4ZHQA 3JY6A 2FMTA 3COZA 1ONBA 1CRLA 1WF6A 2FUCA 1M54A 2XDQB 5CR9A 5KSPA 3RSSA 4MS1A 3V55A 4FZJA 4RABA 1AMUA 2GASA 2HRCA 3SQMA 3R5KA 4YQEA 2ZZMA 4QJBA 4NJEA 1WQ4A 1G66A 3NU1A 1EIZA 1Z3CA 1VMAA 4LCEA 1XG5A 3W8RA 3W9UA 4X91A 4HDOB 3QE2A 2R6ZA 4R7ZA 2VF5X 1WW2A 2JGEA 5EINA 5H1YA 3TTYA 4ZN6A 3HWSA 5IEBA 1ORDA 1MABA 3HVKA 1SBZA 2OA0A 2BFPA 3CX6A 3PHLA 1KEZA 3F6EX 1TXGA 3IB3A 5T57A 4MW0A 4QTUB 4R2JA 4TN1A 2O14A 2P65A 5BRAA 1Z47A 2D1TA 1QH8B 4LJ9A 3KVNA 4HATA 4MUBA 5KOHB 1SXPA 1I9GA 2ZW9A 3PYLA 5A04A 4JQCA 1WG8A 4DSZA 5BN3A 1T0PA 2IIVA 3HG7A 2GM9A 1CPYA 2HA4A 3QOWA 4ZU1X 1QC5B 3BSFA 4MW6A 1Y81A 2I2DA 2Y1EA 3GDGA 3PRYA 5D51S 5DBOA 3JRNA 4UDYX 2R7MA 5IAEA 2WE7A 1H42A 2B37A 3KQSA 3PNQA 3W5VA 4LZJA 1F14A 2EKLA 5K5EA 4KQ6A 4QXMA 3L84A 4RQBA 1WXFA 5AOCA 2C2MA 2XUIA 3QXCA 1ZVVA 4YXFA 4JUIA 5FI3A 4A73A 5BMVA 1Q7EA 1MIOB 1W93A 4D43A 3P5BA 3V1YA 3G49A 1R5NA 1SB8A 5C5DA 3OIYA 1MAAA 3K32A 1MBZA 4FYMA 1F8XA 4RENA 1SWVA 1SZPA 3KVVA 1KFBB 5H8WA 5EIBD 1GARA 1X80A 2V74B 2O3RA 2FFQA 1RWKA 2JGIA 5AI5A 1U2DA 3HDVA 1ZXXA 2XQFA 5E95A 1KBZA 2O8VA 8ATCA 2EGHA 5DB4A 2RMKA 1VCHA 2GLTA 5KTKA 3AWDA 3GJ7A 4NH4A 1XDWA 3QFCA 2ZXEA 4OP3A 5GVSA 4N5DA 1KYTA 3TX2A 3VPGA 3WQBA 2EGUA 2O2XA 4RK4A 3KPUA 3GCDA 1JPNA 1Z4KA 3A4YA 1F4VA 2QW8A 2WHXA 1ZI6A 3M70A 4OJMX 2FPSA 2OV4A 2QNRA 3DMTA 5HW0A 5DNDA 4BAUA 3D59A 1Q1QA 3H04A 5FNZA 3TZEA 4K87A 2X4GA 2QVLA 5B6PA 2EIXA 2Z43A 4L2IB 3I2IA 5H16A 1SVMA 1QWOA 1XCLA 1T9GS 1SIBE 3A6JA 2QRNA 2RJOA 2DXIA 1H8HD 2I2AA 2M6RA 4BE4A 1HDOA 1GPUA 1WW3A 5LYJA 3GMSA 1L1RA 2MCFA 4DVJA 3PJRA 1OZFA 1EK6A 4FOOA 3DVAA 4PG6A 4RSMA 1FC0A 4MSUA 3T9EA 3N8IA 1PZXA 5PNTA 4EY4A 3TGPA 1VKOA 4TTRA 3WRXC 1L8AA 1GLVA 2RGDA 3K0HA 3DWGA 3P9ZA 3X1WA 4DWWA 3JTEA 1Y8QA 3MA0A 3N39C 2RHCA 3HWX1 2AHRA 4FMCB 4G8CA 3L8EA 3QUQA 3WL5A 1JG4A 3SF8A 4C07A 4ZIRA 1L8QA 2C97A 4M98A 3UOWA 2FE1A 2EFJA 2BR5A 4MW5A 5DNAA 4HFMA 4MTLA 5IU6A 1KI6B 1Z15A 3IIIA 1GA4A 1Y9JA 3FVTA 4HC4A 4MCAA 4PBTA 1SCDA 1T1EA 1SURA 2WOJA 1WX1A 1AUPA 1R64A 2H5LA 3IGFA 2PLNA 3C85A 3P20A 4Z3OA 2OAP1 4R69A 5EZQA 1UT6A 4WWHA 1H5NA 2Y1GA 1PLJA 3A6ZA 3DBIA 1QZUA 2W43A 2P8SA 1D4AA 3DXYA 3TTTA 4H59A 2QHXA 1W36C 1ODJA 4ENPA 1MO4A 5AJHA 2OQ2A 3P94A 2Q4RA 1QE3A 4FJ1A 5FP0A 3E3AA 2X6QA 3UCXA 5C18A 5JO0A 2XMDA 4IF4A 3S7ZA 4B74A 4ZCMA 4EKDA 3FPGA 4RZ3A 4XVUA 4PRLA 3SLRA 5CM9C 3ONFA 3FHJA 4ND8B 1GQFA 3IDOA 2OBFA 2YY6A 2Q0XA 2Z95A 1HWYA 2DR0A 2ZULA 4MQ6A 4O8ZA 2AFHA 3ZN2A 5GJCA 3ECCA 1G1AA 4ARUA 4FFLA 5BNZA 4FZRA 4E13A 3K1ZA 1XTPA 1EVYA 1SQ0A 3CGGA 2XGOA 1ZD5A 4HPWA 4TTPA 2KSQA 3JWPA 4XUGB 3RIHA 1XTKA 4Q3KA 3B1VA 2F1OA 1G16A 3G7SA 3QKIA 3VZSA 3W5JA 4OI2A 5KC8A 1DKRA 1N4DA 4J07A 3CF0A 1UPAA 5KKCA 4MV0A 1BQEA 2H5EA 4GIBA 1YCDA 3CNEA 4KSBA 2F55A 4XLTA 5AK6A 5CXXA 5HIMA 2JF0A 2GLUA 3ONDA 2Z8XA 4CM9D 1S3GA 5FBKA 4BMNA 3NFYA 5EKXA 3W3ZB 2FK8A 3TL2A 1DWQA 1KVUA 4IKEA 4B4WA 3LVBA 2P4HX 1U9JA 2A9JA 4TMFA 3QU7A 4QQ8A 2FDXA 3CGWA 3FCEA 3LI2A 3OF2A 3CNBA 4NG5A 4JLUA 4ZQHA 5AM5A 4LVUA 1JEQB 4PFSA 3U4DA 4QM6A 2Q3FA 2VC2B 4RVFA 3UKDA 4UM9B 5KTNA 5E4FA 2Z4RA 4KO1S 4WI1A 4PVDA 1LF0A 2OCGA 4M22A 4ZQGA 3U37A 1SH7A 1Z2EA 1IN8A 1F0PA 3DP7A 1V11A 2GVDC 4UVIA 3MTEA 4ZP1A 1EVJA 4LYAA 2OV8A 4Z8XA 4X64B 5EC8A 4H4CA 4XSHA 1N2CB 4D2IA 3F0TA 2XI4A 1R9GA 2CZCA 5B1IA 2VSNA 5I7OA 2AC2A 2M6KA 1PR4A 2C2XA 1FVOA 2J6CA 4FIDA 3LMKA 1VECA 2AF3C 2B4KA 4JOCA 2WJWA 3RSHA 5GAJA 4WFJA 1NP3A 3UMCA 1EK1A 3GJRA 4WZBB 4ZANA 3RJZA 4L4XA 3D6FA 2QP4A 3R5SA 5DRTA 4AN0A 1Z25A 2H0AA 3NJ8A 2EFHB 1OXBB 5DP1A 3B1KA 3LVQE 4QDJA 4RJIA 4F3YA 3S27A 2PSHA 3DEJA 2SCUA 4IX9A 3K9FC 2AN3A 5P8WA 4JLMA 1SA0B 2W11A 2RC5A 1ZSVA 3HJGA 3I1FA 4NJMA 4QDZA 5JNVA 1TIKA 1CULC 4O25A 2OG2A 4E5KA 1GDTA 4C7MA 4YMUA 2EWWA 5BMOA 1X3SA 1BE1A 2ZYVX 4BUJA 4G4SO 5ARCA 2VRCA 1ZOOA 3VHLB 1NGSA 3WQSB 2F64A 4ZCSA 1LPOA 1M9NA 2E4WA 2ZVQX 4YTEA 3ZQJA 2VTBA 4GZ5A 4CJXA 3A10A 1TJ5A 3UMJA 3IB6A 1UK6A 6ADHA 1R0YA 5J2UF 4BYMA 4YJGB 3GCXA 1L3BA 2Z9DA 3HWRA 4DSAA 1VTKA 3TQIA 3WICA 1D6SA 2VDRB 1P9NA 3VNQA 3WGUA 2YDYA 4P3YA 3Q85A 2XW6A 3BE8A 3FPHA 4JWTA 1DKLA 1Q3TA 1RWPA 4M0MA 3KWJA 4QREA 5CDTA 4FYJA 5KSWB 3B60A 1HEYA 1TTPB 1GPBA 1IZ7A 1P6UA 3RRMA 4PN3A 1UQTA 3GDOA 3MJVA 2XUAA 3A4MA 1HA3A 3UNXA 2IE0A 4NE2A 1T26A 4TV8B 5E9WA 1P4JA 3ANMA 4YXWA 4WJKB 1QP4A 2Y0EA 2GJSA 1YJ5A 2VNJA 1Z5ZA 3ZI7A 1K5GA 1VMKA 3PSHA 2J9XB 5JJLA 3ICPA 2XUPA 3G17A 3KC2A 1CRWG 3F73A 3K92A 1QIKA 3KCNA 3ABOB 1QMGA 1YOBA 2CL7X 4GM1A 3CMCO 3HNPA 4AZWA 4E88A 1PUJA 3WGVA 2GXUA 3DF7A 5FCDA 1D2GA 4ZOAA 5JJ5A 1F12A 4QYSA 3CT4A 3GWZA 3DQPA 4JASB 5FI0B 2ZJ5A 2ZB2A 4C6RA 4WOCA 4ED9A 4EUEA 1US8A 3M4ZA 4RVCA 3UMMA 1WL8A 1JAHA 4QOJA 2G83A 5CDFA 1KDZA 1MENA 2FV8A 2K5UA 2ZUVA 2J7PA 3D02A 3EZGA 4RGYA 4UOQA 3DLCA 4D3DA 4WKPA 4CRWB 1H05A 3GVPA 1RSZA 2YVKA 1J7JA 3KOZA 4EMBA 4AFNA 3JQ8B 4A9AA 3F7MA 4MGYR 2JLWA 1XEXA 1XO1A 4K6OA 5C35A 1MG0A 3LZ6A 3QU9A 3J80A 4OA8A 5A02A 4PZZA 5FUQA 5F2NA 5KEIA 2E5FA 2ZP1A 3FRHA 4RIEA 4JLBA 5BSVA 1JXMA 3SHVA 2FP3A 2O6HA 4RF5A 3VAZA 1ISGA 2E87A 2VT7A 4M1QA 4LZAA 1HRKA 3VR4D 5JDIC 2P5YA 3NHBA 3TLGA 3MLAA 5FBVB 4G84A 4WKOA 1DT5A 1O54A 1UH5A 3H2GA 4MS3B 1ZCAA 4MQFB 4B79A 4W8HA 4EW3A 1A04A 4P32A 5AVRA 3ZCQA 5IEJA 3OY7A 1ZHHA 1E0KA 1ZIDA 4QGFA 4LV6A 3CJTA 2JCYA 2MMCA 2R1VA 3S6JA 2OK7A 1G18A 1W59A 1NTRA 2BSXA 1Y1RA 1SXJA 1QK4A 2ZRGA 2BP7A 3B7GA 3CB2A 1M2GA 3IHWA 3K5PA 1A0OA 4HNHA 2C4UA 2AIRA 5DNWA 1B6GA 1SK8A 1GAJA 4H4DA 1GV1A 2DFTA 2XY4A 3AY6A 4TLAA 1LF5A 4OLJA 4UUMA 4NEGA 4URZR 2JW5A 1HE2A 2Q3LA 2IJGX 4U3JA 1A72A 1JS1X 2A7QA 2AI2A 2ZT7A 3KRTA 4FOLA 2ZRQA 4FUQA 4FC7A 4W8OA 4DEYA 3IQXA 4G5SA 4XFKA 4HGQA 5FQNA 5A7HA 5TMBA 1H93A 5H83A 1CJUC 3T12A 2UVPA 3WGGA 2GPWA 2HO4A 4K28A 1G6KA 4LNUB 3I04M 1E3WB 1C29B 4ICIA 5EP1A 3QMWA 5LOVF 2A0KA 2X42A 1P8AA 4ZO4A 1Z74A 4D80A 4A0SA 1I6MA 1OLUB 1A27A 3NEYA 5GGXA 3Q0TA 4GBMA 5FA6A 1LY1A 1CQIA 4LYDA 2TS1A 4NIMA 1YKSA 4GL4A 3SC4A 4MW2A 1FDOA 3DW1X 1YKFA 4AP9A 3I52A 4RZHA 2VDQB 5T64A 4ABTA 4POAA 1EEXB 1P5ZB 1BGVA 2C59A 2EIHA 2FW7A 4H60A 2A5LA 2WSSD 1P4HA 2Y99A 2HK7A 2D0IA 4CUKA 2IS4A 3HB7A 1UOEA 5JV5A 4LOIA 4LXQA 4YS6A 2HT6A 2WM9B 5C52B 3B3FA 2I3ZA 1QHHA 2XMRA 4EZEA 3THOA 3NRCA 1NNEA 1VLMA 3AO0B 3OE5A 1HSOA 1RCUA 1EQUA 4G1FA 2GZ2A 3LFTA 5FOWA 2I9PA 3P8ZA 4YRCA 3K35A 3KSDO 4PC3A 4L02A 2PNJA 3SE0A 5K0JA 5KX5F 4NFLA 5LU8A 4RZIA 1NJSA 1ZVQA 2GH1A 1XZGA 2C5AA 1F2VA 2IS6A 2ZWIA 2WIAA 3AUFA 5F21A 4QELA 1A98A 4LY3A 4EY8A 1QZXA 4RS4A 2BFMA 1SCQA 5AW8A 5JECA 1B42A 2LDXA 3E5HA 1ZK0A 3VRHA 7REQB 1TI7A 3C7DB 2ZJYA 2HQBA 4NY1A 2H29A 2REOA 3QRWA 3R20A 3GLSA 4LRUA 1EFRD 4L74A 1LPSA 1CFJA 1RM0A 2QPOA 3AINA 5FWNA 5HQ3A 1XYVA 1CF4A 1DBIA 1HNXB 2LVBA 1BVRA 2C61A 1XA0A 1ZJZA 4RM2A 5AWFC 1NNSA 2K6GA 1XEWX 2ZTHA 3VH4A 2AJLI 1E9CA 3THYB 3T3NA 2UUBB 4WKBA 5AVTA 1K7EB 2B4TO 2GAFA 3NUGA 4CMGA 3WLLA 2I67A 4A23A 3H2JA 3CKKA 2VYNA 3HKDA 3HSSA 2XBMA 3H99A 1U0TA 4JI2B 2BUCA 4QGAA 2ZJ3A 4HMQA 5U1PA 2O8CB 3MTDA 2OHJA 1EA5A 3A70A 4QZVA 2UZ4A 4IIHA 1UMBA 4HYTA 1JG6A 2YW2A 1CCWA 1UXOA 2H11A 3L07A 4NQZA 4ZT6A 3UJHA 2F8LA 1NJGA 2JI6A 3JR3A 4BEVA 5B7QA 1E9SA 1ZUNB 1AK1A 2WF7A 1N4AA 2XRZA 2IDMA 1P31A 1DKOA 2QL5A 4BWFB 2AF4C 1UL1X 3DZIA 1JVNA 1T1RA 3G2JA 3N7TA 3M4XA 4RV4A 2EARA 3G9UA 4JJIA 3ZDXB 3D54D 1QYWA 2FQXA 1FQKA 3HVJA 4TV9F 2ZUEA 1D2HA 3BH0A 1DJPA 5GMOA 2VK2A 2WWRA 4Z49A 1DOHA 1FFCA 1Z6AA 2GS9A 2GUGA 3RQIA 4UTRA 1M83A 3ACDA 4DCOA 1CFZA 1U0GA 1RM4A 3EVBA 2FSHA 4PNZA 4F4HA 3T1OA 1WZCA 3LUPA 1P1IA 2MJLA 3PEVA 4G5FA 2WUWE 4M8IA 4QOFA 3NAMA 2P8JA 4R1PA 4QTYA 1GZ7A 2ZUCA 3ZGYA 4OHXA 1LJUA 1J8FA 2V03A 2G17A 4ZVUA 4JIGA 1GGJA 2CL5A 1XZBA 2IX3A 2Q6TA 1J5XA 3BDIA 3I53A 1OFUX 3UEOA 2PH7A 2YWGA 3VGPA 3IKJA 4ZFNA 2VSXA 4OQLA 2H07A 4OQFA 9ATCA 1JEQA 3HU2A 1X39A 1TMYA 2GYVA 3OFKA 4BV8A 5JXWA 4YRMA 3JQQA 1KJWA 1QK3A 4BRZA 4HAYA 1JJIA 3LG2A 1VIDA 3GJSA 2PKRA 3ETCA 2HSWA 4B6RA 3BD6A 1HDCA 1ZISA 2VK4A 4EEZA 1EUYA 1HLFA 3ANLA 3GJ8A 4KR6A 5DTQA 1XUOA 3TMYA 2PQ0A 2WU4A 2Y9MB 1N6RA 2ZU0C 4MUIA 4X1KA 4ARIA 2OO5A 5LZ8A 2BHRA 3E05A 1DCTA 1BEUB 5HBGA 1I3KA 2O20A 4P4NA 4Z0TA 4C2UA 2ONYA 3UT0A 4ES6A 2DERA 3MELA 1K3FA 2I66A 4XVQA 2WNIA 4UUOA 4EY6A 2X14A 4PPGA 4HI0E 2O0HA 2R00A 4KHPB 1SC1A 4IIXA 4JP3A 4AN4A 1NBWB 1YU6A 3N59A 3ZI4A 1Q16A 5FAXA 3ND9A 1PJAA 4QFCA 1Y33E 4QXAA 1XRSB 4CUJA 3T3OA 2B7CA 2VKTA 2J4CA 3E7FA 4OB8A 1Q2XA 3UPDA 1IY0A 1WKBA 2NTYC 1CIVA 3O2QB 4B1FA 1R16A 4F96A 1OX4A 3KKEA 3RS0A 2YHAA 1U3UA 2FHPA 3N8HA 3N8NA 5K8CA 2PKQP 1C9KA 2FP4B 5IYZB 4FDLA 4NYMQ 1THMA 5BN3B 3DOUA 2G80A 4YFVA 4TZ0A 5LLTA 4F6RB 1TA9A 2H1SA 2YMLA 1WSDA 4I2VA 4WCDA 5KKNB 5L51A 1NXTA 1DP4A 3NV9A 3UW1A 4J2OA 4B3TB 1RVV1 1OLOA 4C2BA 4TS3A 2B1RA 2FW6A 3KJGA 2IKQA 4K6GA 3RVJA 1ZMBA 4XB2A 1F38A 4I4TF 4PLHA 3WK5A 2SECE 2Y68A 3Q7EA 3DMDA 4Q9LA 3UUFA 4BEBA 5CFQA 5E9AA 1FDUA 1GAXA 1E9EA 1JR3E 2DPXA 4HNGA 9LDBA 4FSHA 1QIJA 4V0RA 4ZC1A 3UJ3X 4C30A 4B3BA 1UBKS 4GI7A 4BQEA 4KKXB 2AYYA 4TL6A 5F7ZA 2HYIC 1B8PA 3LECA 3EUAA 9LDTA 3ORHA 1CDDA 1O5IA 4D57A 3A0UA 5DU2A 4D98A 3VO2A 5LFAA 3EIUA 4F1JA 1CS0A 1NWHA 1VKRA 2UZ1A 4LRXA 4P2BA 2QTMA 2QYHA 5DWDA 5BYBA 3DDUA 2C2YA 4FNGA 4MQLA 4Z86A 5EOVA 1S5PA 1Y8QB 2EKZA 3O8QB 4M76B 3GLRA 3ML1A 4OUDB 4RD2A 3CC8A 4HAZA 3RUIA 5IJZA 1YR2A 3P9CA 4RADA 1PT9A 1ZN9A 1MN6A 1NLMA 1U7DA 1V9SA 4KP7A 1NSTA 2JLUA 3NWEA 1C8KA 2QTLA 1WIWA 4TXNA 2J85A 1XMJA 3ZK8A 2B7LA 2FKAA 1V41E 1CZHA 1WVIA 4TXHA 4ZAWA 5GOZA 3KALA 2X41A 3S2SA 4B73A 4AK9A 4Z7OB 1RHKA 3HUDA 1AQNA 1AGPA 4Y2QA 3K8QA 1A8PA 3AKEA 4HXFB 3AEXA 2PS1A 3WGMA 2BISA 3T34A 1EJ0A 2CHVA 2F43B 5DCWA 4ALKA 5AW9A 5EMMA 3EQ9A 1YOVB 4PTLA 2OXCA 5BVGA 1CUJA 1JLMA 4M46A 4ZV7A 4DR1B 4R5MA 2OYRA 2YXNA 3Q6IA 2IF2A 4QICA 4WFIA 1PVDA 4Y2RA 1R4ZA 2QK4A 4B85A 1PWEA 1VMEA 2L2QA 3DH0A 2H18A 5IVDA 3U44A 4XR4A 1QYRA 1VYVA 3DGEC 3GV0A 4KDFA 4MVJH 5BN4B 2IF0A 3AEKB 3THRA 1FYDA 3CONA 3ODPA 2H1CA 4C87A 2ZZNA 4M87A 4LZOA 3UA3A 2R5WA 4YECA 2FSPA 4WERA 1GP2A 5IF9A 1OH5A 2H65A 1T9BA 3DNPA 3LQYA 5LZ7A 3PFNA 3MPOA 2AFIE 3E9DA 1QH1B 3DPUA 4RXTA 3M9WA 2XT9A 4NCAA 1XKXA 4ZO8A 1M8GA 5I9IA 4OQZA 1MCZA 3BMOA 1F8GA 2VSYA 3UWOA 4LWZA 2GM5A 4DB2A 1P1RA 1ULTA 4XKJA 1EHYA 1AQ6A 3B7PA 5JO9A 2NTNA 3Q7TA 2FGKA 4NZPA 4DMUB 4LKOA 1KK2A 2ALJA 2HBRA 2AK3A 2AWNA 1J8VA 4WVFA 3P45A 4CODB 4LE2A 3TNJA 3H2IA 4HQLA 4Y6OA 3RJTA 1H1DA 1O87A 3T0FA 3FPAA 1J9GA 4FHCA 5C8DA 3AM1A 3TUIC 3PXAA 1ODCA 4IJQA 2UVDA 2AW3A 3DTVA 1TUBB 2IXDA 1ORVA 1Z8FA 3KQQA 4IHJA 5D3ZA 1O9BA 4F45A 4I55A 1FJGB 3ZE6A 3H8WA 3O3CA 4ZYVA 5KTYA 4G0ZA 3VQTA 4AKEA 4AROA 3H1AA 1RC8A 4Q00A 4U7GA 5FBRB 3FTCA 3EC2A 5COBA 4MVJM 5CW1A 3N05A 4HDMB 1KP3A 1YL7A 1KYYA 2NYRA 4U6QA 5F64A 2PGIA 4LOHA 4D9BA 1E62A 1A1VA 4JI0B 3LCMA 1OYWA 4Z8YA 4YJGA 2NXEA 2OSVA 1Z37A 4WGFA 4AJPA 2ZB4A 1A8QA 1L6RA 2BFEA 1ZLYA 5KDLA 3D4OA 3N2IA 3FPCA 3A3YA 1BFUA 3K9WA 4HYEA 4YJDA 4X3PA 5BMVF 3CSDA 3TVTA 5BOVA 3UAYA 5KTTA 1UZLA 4UU0A 3ZWNA 5HKKD 4DA7A 3NP7A 4E5PA 1RLTA 1RRFA 2ONZA 5TSDA 4OYHA 2O06A 2PZJA 3RS3A 2VDMB 4X93A 4CQMD 4BB0A 1WXIA 1T1IA 1QQ5A 3N75A 3ZWXA 2AXEA 2CBXA 3TVYA 1POWA 4BX8A 4ZGWA 4TOIA 1OX6A 4LYYA 1W0JA 1P2VA 1P62B 2OP1A 1CZNA 3A6LA 3F67A 3C3XA 3JRWA 1AK2A 1AKMA 4GO1A 2GA9A 4RVUA 2Q0QA 1V6SA 3DV2A 2OM6A 4WOJA 4EYEA 5KQGA 3EPJA 3HU3A 4A2WA 3CRNA 1VJ5A 4G0MA 5L7TA 4MVJA 4QJ3A 2FOXA 4BVLA 4W99A 4ENWA 3KBOA 1Z0AA 5IT5A 3C5EA 2PJUA 1VPTA 3H2HA 4MYCA 3NBAA 1JXAA 1PR5A 2XTJA 3BAZA 4QGHA 2G4LA 2J3HA 2RSLA 2B61A 2FVXA 2ZIEA 4GI2A 2VQFB 5A03A 2PBZA 2ZE6A 1UBNA 5BQXA 3CBGA 4JV5B 2WQ6A 3AR8A 4HO1X 3K6SA 2L0XA 3AQ4A 3GUZA 2XTAA 5JASA 1P0FA 3ZLJA 2VP5A 3COPA 5ALNA 1FDVA 1N9GA 1ILEA 4DR5B 2I8CA 1N8NA 3TMKA 2R87A 4BCDA 3D7KA 2AW5A 1TYCA 3IIKA 5JCZA 2VYVD 3DMPA 3JQ8A 5IUNC 3SFVA 1WM1A 3K05A 1T3HA 4ER3A 1TU3A 2XDYA 4WN9A 3GLGA 5G1PA 5C3UA 3AKYA 2HK9A 2CHUA 1PAUA 3DEKA 3LC2O 4ZHQF 4ZGBA 1XNRB 2HWWA 1TGYA 1O95D 3FYCA 1ENOA 3Q3CA 4NARA 4YJFB 1XRMA 3QPDA 4TTIA 3RK1A 4IOLA 3ESBA 1MXHA 2CJFA 2V58A 3VR1A 3G9ZA 2J5BA 4RTMA 1L7OA 2YWEA 3L4BA 4IH4A 3HL4A 2OBYA 2GN4A 4DMCA 1DG1G 1K7YA 4Q82A 4MLDA 4EUSA 5JIBA 1AGRA 4MMXB 1WB5A 2IYYA 1OYYA 3NUZA 1EA7A 3GFOA 2QM8A 3PQ4A 5KNDD 4OU4A 4BEJA 2IW1A 3PXBA 2IV2X 1GEEA 2ODTX 2IGBA 3BQ9A 3ER9A 1ZNXA 1TU0A 2R3SA 3R3WA 1W8IA 2G76A 4Y9UA 1S2GA 2D4HA 3D81A 4MS1B 1L4YA 2CJWA 5JW6A 1G6HA 3GLKA 4QUBA 1TZMA 3KQPA 4PXYA 4CG1A 1RKUA 5J43A 3Q8LA 1GXSA 3HP4A 4PYIA 1K8YB 4MS3A 3AHJA 1A4UA 4P3XA 5JNSA 1J33A 2X9QA 3AMVA 2BI8A 2EBFX 3GOHA 1NP6A 3PEUA 2B8EA 3OT1B 2QTVA 4GP7A 4QULA 2NZYA 5L40A 1I2ZA 4JYAB 1IRIA 1WXQA 5JLJA 2WC1A 4LMRA 4IDPA 3G9XA 3FUXA 3P96A 4J0FA 3V4RA 2R6FA 3MTGA 1RXVA 3LDUA 4JMLA 4HGPA 2WD7B 2YRWA 4KQCA 1WPRA 4M53A 3GK3A 1BKDR 2NUPB 2OV6A 2VEOA 1RM5A 1H6AA 1X2EA 3T7EA 1C3EA 4ENRA 3G82C 1NBAA 1RACA 1YVRA 3FFAA 1K63A 5KOHA 1QV7A 2P7IA 1AKNA 1VE5A 2A5DA 1O4WA 2FY8A 1U2DC 1E5DA 1QVAA 2BDEA 2CVHA 4WHMA 5LUAA 3I0ZA 3MNFA 3RUHA 3SQLA 4BWYA 1J25A 1EUDA 3DDHA 4AY4A 1JKFA 1TEVA 1NI4A 1JPVA 1WNFA 3RUAA 1OLSA 5DM60 3K70B 1PFVA 2Q3DA 4E3WA 1BE6A 4OHKA 5SICE 4IGFA 5BQ5A 1P9OA 3IA7A 1ULUA 3N86A 3AL2A 2ZJ1A 3AF3A 3JQAA 3JAKB 3WWPA 4IBOA 2SHKA 3I2JA 4IIGA 1IY8A 2MOKA 4V0LA 3A1EA 3GMTA 1AF7A 1AA6A 4HJXA 4IICA 1USUA 4C06A 4F8YA 4BFYA 4MUFA 3B85A 3EOBI 1M75A 4PNEA 4WA8A 1QGZA 2CNNA 3Q0IA 4N0QA 4TKUA 3AILA 3JQCA 3KXLA 2ZPAA 4JXKA 1UFQA 4P35A 4Q24A 3V9AA 1CZRA 2FCRA 1WPGA 3TAUA 3GPBA 1WWKA 5EPOA 3TWOA 1J2JA 2DUMA 3QXXA 3OEYA 4I1RA 3F9CA 2ZKIA 5ECDA 3V7NA 4EHAA 1KSFX 2QVZX 4BNUA 5I9NA 1E3LA 3FJ1A 4JJ7A 1OCEA 3P71T 4FMPA 4C7BA 1BH2A 1JHYA 1TF2A 1MJ5A 2ADFA 2JBAB 3U19A 1Z88A 4PHTA 3ZY5A 1ZCFA 2O9JA 4MIOA 1E1QD 1G0OA 3MG9A 2V65A 1C8LA 3ELUA 1U8XX 4KQIA 3VR2D 2AUNA 3RYIA 1USWA 3RV4A 1MEEA 1YQDA 3GG9A 4FE3A 5J4HA 3T15A 2HJVA 2MR6A 3WB9A 1SD2A 1O94D 3B1XA 3CTMA 5CA1B 1SD1A 3PX3A 3WIUA 4XXHA 1H22A 3N6RA 3IIEA 2YZ2A 4UHEA 3S7TA 3TTXA 5I7EA 4DV5B 2JJMA 3PC3A 3VV2A 2G77B 2PG3A 1M2FA 3DVAB 3VSDA 4AMUA 2VRBA 5ALJA 5HFNA 2PH5A 4B2YA 4D9EA 2AYXA 3FCSB 2AE1A 1XAGA 4P22A 4G25A 5D5HA 4NU6A 5L7YA 3RT1A 4HNUA 3G7UA 3S81A 1RPJA 1Z5GA 4L0CA 2IZ5A 5AM1A 1YBFA 2B6HA 2ZR9A 1FP2A 5IXSA 3NWOA 3KQOA 4O4HF 4WSOA 3GLHE 1QCYA 3WWDA 1QHYA 1Z8DA 2CYAA 1K7XB 2A2ZA 2OXFA 1N6NA 5FPKA 1E2MA 1RMQA 2YL2A 5D86A 2YJTD 4G4JA 4W9NA 4LF5B 1L3IA 1Y6QA 2P77A 4AO7A 1DRWA 3KLBA 4XRRA 2YYZA 1ZSNA 2FJ0A 1LGYA 3WKBA 4QL3A 5AVKA 4GSLA 5EPEA 3LOUA 2H54A 2PA3A 1G5PA 2LGJA 3ZHXA 4BV3A 2EC5A 1HT0A 5BUCA 2D7CA 2CKMA 2WT8A 3T7KA 4I50F 3A6PC 1COWD 4LXTA 3D2BA 3OZRA 2AV6A 3P4UA 3ZV3A 4Z6KA 3MS4A 1KJ8A 1V7PC 3H0KA 2AMFA 3ASUA 1K7FB 3KO8A 3QPAA 3W1WA 1HZZC 4DIKA 2XOXA 2JIPA 3LC7O 2R00C 2VUHB 1PD1A 2HTFA 2E9SA 2WJ6A 3JASA 3O21A 3PFCA 4HRVA 1XDUA 2GK3A 3BMOB 3I05A 5DE3A 5G0TA 3STXA 4WTOA 2BMDA 4PYMA 4IYRA 1M1NA 4YRIA 3N8DA 3N9IA 3QLUC 4RGBA 1E2HA 1NWCA 2I7VA 3M33A 3OF3A 1BMFD 4RY9A 4ODIA 5CXQA 5FDFA 1RXUA 4HRYA 2YNMC 3FH0A 3HXKA 3LM8A 1XPRA 2RG1A 3GJYA 3GZTB 3DAFA 3E3MA 2A9OA 1Q0QA 2NOAA 2WHPB 3FGPA 4GRIA 1V3QE 5CDHA 1KFKB 5FOXA 3M1LA 4G5QA 4DN6A 4J9VA 1DKMA 4Z4CA 4ERXA 1PJZA 4QECA 2Y1DA 4K5QA 1JVBA 3OPNA 4UNSA 4X7RA 4MRNA 3Q9SA 3WX0A 2P0YA 4I3GA 2VYCA 1WBBA 4H7PA 1F6DA 4NTZA 2JGFA 4DUGA 4W1SA 1QHNA 2AUMA 1NMEA 3BMCB 1HZJA 3KYBA 5JNWA 1HI9A 3VKFA 3KZMA 3LUCA 4K05A 3W5BA 3ESQA 5DSXA 3HSYA 1IK4A 1C14A 1ENZA 3I30X 3KKMA 3OQIA 4JT9A 5LZ5A 3X43A 2IU4A 3AC0A 1E2JA 3UMGA 2ZLBA 2H8GA 3PIIA 1IZYA 3LT5A 1HKUA 1UUFA 3CX8A 2VPIA 2A5GA 2EXXA 4JBWA 3KTFA 1RPTA 4XOUA 3BS4A 2BFEB 2JA1A 4BBPA 2QU8A 2FUG1 5EP3A 2CF6A 3PIRA 1OPXA 3FWPA 5AO9A 1DJMA 3IJPA 2XB9A 1BWSA 3CEAA 4QODA 4A2PA 2C78A 4BGDA 3WE7A 1Z22A 2GB4A 2JC3A 3E3LA 2FFBA 2HHJA 4WXMA 4HWTA 4CG2A 2Y93A 2XYVA 3WYEA 2C0PA 4JOBA 4GYYA 4FTWA 3ONEA 3K8ZA 5BV0A 2QROA 3P19A 2XYPA 4TT3A 2HCJB 5FTMA 2BWJA 3PGLA 4FZ5A 4KQKA 4BB9A 2C82A 4E4TA 3BB3A 3B36A 1C9JA 4DLKA 1TCAA 2W22A 3FAZA 1A8HA 2XECA 3IJEB 5H7XA 3U1BA 1Z12A 1PWZA 1X15A 3EF0A 2F67A 3QU2A 1QHSA 4XYEA 5EYPA 2ODBA 1NVGA 2QUJA 4HX5A 3FPLA 3K1TA 4MQEA 3TZQA 3GY0A 3AEUA 1KJQA 2ET6A 1XZLA 3FSRA 3MMNA 5B30A 1MC4A 4EPYA 1G5QA 2E6UX 5WRFA 5BUSA 1LV7A 3T41A 2R79A 5CB8A 4CU2A 1II8B 4BMYA 1D0IA 2ZIZA 1YZFA 4TRMA 4WD3A 4Y6SA 1Y4AE 4A91A 1H2YA 1PG5A 2P9ZA 4YP0A 1U9YA 4B40A 1Z5NA 1JLRA 4FFOA 1D4FA 4JQYA 2JGDB 4OD0A 1IPFA 1NBIA 3KHTA 4PF1A 3DNMA 3MSCA 4FD2A 5KQPA 3ZGVA 1OV6A 1P1JA 4AZ3B 1ZKMA 2EFEB 2GILA 4KXFB 4NQRA 5I6DA 2V8OA 4OU5A 1Y0BA 4G1MB 4RL6A 4AL4A 4PAMA 8OHMA 1AKQA 3V1MA 2YFYA 1CR4A 4GXTA 3TQHA 4HVLA 3REFA 4Q19A 1VA5A 3M6VA 4JBYA 1MT0A 1DJOA 5E7IA 1CRPA 1OZGA 3GJ5A 1NUQA 4INOA 4NCHA 2WRZA 3B3AA 4MTCA 4HDAA 1UXGA 4P5PA 3RUEA 2XB2A 4FEAA 2WV7A 4N7RA 5JSYA 3WDMA 5C8YF 1NTOA 1NNLA 2R48A 2QN7A 1N3BA 3U5TA 5SZJA 4X71A 4UKDA 2WZDA 3EMDA 1R6XA 2EKPA 5ALEA 2C3UA 1CTQA 1TVKB 1DOZA 3BORA 1GXSB 4JD5A 3EASA 1NATA 5I7AA 2VDNB 3ZWPA 1GAQA 1E1RD 2AR0A 1LEHA 1HC7A 1CQZA 4Z1MD 4WZZA 5CBPA 5K6TA 5ISMA 1Z07A 1BFKA 3A0RB 4AJ2A 3VH2A 3S1SA 3L4KA 4I8IA 3B89A 4MV9A 1ECLA 1LFDB 2WA1A 2OO7A 3N58A 4GPBA 1O9GA 4MUMA 4PICA 4QXPA 821PA 5I7HA 1AKEA 1NXXA 4DRZA 3VYVA 1IXRC 3C1UA 3EVGA 4B7CA 2WBLC 3QPWA 13PKA 1BVUA 1LLFA 4K2AA 2FN3A 3ZWWA 4MUKA 4D3ZA 2IHJA 3L0CA 4CQLA 1I01A 3S8EA 2HLDD 1SCUB 4U2KA 3DWIA 4EKNB 1UDRA 1M76A 1TO2E 4OGKA 3GJXC 3H9JA 5LOVB 2CEKA 5AH0A 4CMKA 1EK0A 5JAOA 3QUAA 2C4KA 3ENZA 2O3JA 1U0LA 2H8KA 1J1ZA 2ORIA 3HB4X 2VRWA 2XT6A 3TOSA 1L5KA 4RTOA 1HKHA 3HDJA 3RAFC 1H2EA 5KINB 2X0RA 4XVHA 5E38A 4LF9B 3ROQA 1TX4B 4FQ8A 3A04A 4QWWA 4U7JA 2O2DA 5AK4A 4NYIR 5KYKA 4ZK2A 2Y2UA 5ERXA 4K6KA 2WZQA 4HMPA 4IY1A 1RYMA 3K0AA 2VATA 2YYSA 3FXAA 1XLVA 3AHCA 1E3WA 1JHOA 2FR1A 1EUCA 2W48A 4ZYUA 4Y2JA 2NU9A 4UUBA 1U1GA 3USCS 3ADKA 4AQDA 1SCNE 3L7MA 2I8AA 1CUDA 2R62A 2YJZA 3L79A 2R44A 1EDEA 4ZMSA 1AVTA 1R1DA 4XM2A 1V5WA 2QXUA 3JZIA 3QQPA 2ODWA 2IRWA 4JGGA 1H65A 3SIXA 3AW9A 2IKSA 3BFXA 3C5CA 1CQJA 3IE2A 1W0JD 2FEAA 4KFCA 3L1JA 4K9QA 2J09A 4XGKA 1CQPA 1PUIA 4ZO7A 3H5IA 4AU1A 4EUKA 2JCVA 1AY0A 2TYSB 5DGTA 2RB5A 1ZWKA 4MB2A 1N2OA 1PWXA 3GPLA 1A77A 1NPTO 2J0VA 5G40A 3WIDA 4JS0A 4F46A 3DO6A 2A9VA 3ZQUA 3NLLA 2QQEA 3TQQA 1QHHB 1EWRA 3ZV7A 5BWBA 3BMXA 1MIHA 1N9GB 5F5LA 3THWB 1D09A 3BZUA 3C6KA 2VJOA 1JU4A 4B5KA 3DZGA 1RJWA 3VM6A 1ZH0A 1G5RA 1VB3A 5DTJA 4XIFA 5A2QA 1FVHA 6ABPA 1LCIA 1G8SA 2ZJ4A 3F8WA 2XVYA 2H3EA 3HB1A 3WBKA 1XK7A 3RGGA 3K09A 3SR0A 4DHWA 3CPHA 4P3PA 6PFKA 2JG3A 2H31A 3LGSA 4YFYA 2QT1A 4HDRB 2NP6A 3G02A 5DN6D 1ZD3A 3LA6A 1UKVY 3L8FA 4FYXA 3F5SA 1XHLA 1M2WA 4LDRA 2IEGA 2R5FA 5KMGB 1HETA 1MX1A 1TFRA 2KWIA 2PX3A 4QXRA 4F4JA 2BYTA 2BUBA 3D6UA 2AWOA 4MR8A 3L1IA 3ROPA 1CUFA 3HM9A 1JJFA 5IK2D 4C2TA 1U2EA 4JLSA 5GONB 4G5GA 5TRTA 3DBLB 2CT8A 1MX5A 1YS6A 1XAJA 2OEPA 5K6RA 2J0UB 3BXEA 3CLHA 3IT3A 4FI3C 4D9MA 1AQJA 1CF9A 1DXHA 2LRHA 1G59A 3DVQX 4ZWNA 5EMJA 1FMFA 4EQZA 4F9GA 4YRBA 2XB4A 3IH5A 3PHBE 1G4HA 1IBRA 1SB9A 4R2XA 3HPQA 3RVNA 2I54A 1DDOA 5K3DA 1JPUA 2Z1DA 4D3XA 2V0GA 3E5MA 5IWAB 5AJXA 10MHA 5KNCH 3DJYA 2JI7A 3H6KA 3V8RA 3A36A 1U8EA 2RH8A 3L6OO 1I3CA 4US1R 2XUZA 2I2XB 3EEFA 4FYWA 4LXXA 3TF5A 5IC4A 2IK8A 4K9OA 1KORA 4YRQA 1CR0A 2E18A 1RU3A 1XU7A 3GFQA 3I12A 1TM5E 4G09A 5ADVA 4DLVA 3AI2A 5LU9A 2Z0MA 3FTQA 3W8EA 2GO7A 3GLHB 3C1AA 1LPAB 1PK7A 5DCUA 3ZJ5A 2O8FB 1EGMB 1RBQA 2I65A 3GWGA 4LDJA 2ZRNA 3OOEA 3QG5A 5GP1A 5AI9A 1PTKA 3C3KA 2JD1A 4XQEA 4NCKA 3HJRA 4U8GA 2N9UA 4DL9A 4E21A 3RU3A 1J8YF 4HG2A 3ZBTA 2M1XA 3ZCPA 3D3WA 3S29A 2O8DB 2OZLB 4DMLA 1DV2A 4RTNA 4XWKA 4GQIA 1XRNA 4EJ0A 1LSUA 4LQDA 1YK0A 2FOIA 4PRKA 3M6XA 1Z16A 2DLDA 2VP4A 3ZHZA 4BQNA 3AZPA 4BVAA 1V35A 4DUZB 1FTGA 2H9YA 1WOMA 4W1QA 1GFWA 2V3WA 4J4HA 3GFFA 3WQHA 1XIVA 2XPCA 3VKUA 1VZ2A 3LTEA 3C97A 4WL0A 2Y92A 4B75A 1HM5A 1Z6QA 5L3SA 3EDOA 3DOEA 2OSBA 3WLEA 4UU7A 1M3SA 3GAAA 3IERA 4RIIA 2Q29A 1IQ0A 1NX6A 1SCJA 3BERA 3P9IA 2E48A 3PSAA 1YCFA 4QUGA 4B6PA 3TGLA 1NXWA 1EFTA 2X8AA 5FUYA 3RASA 4COOA 1KAQA 4JI8B 2QX9A 1EU1A 2WVHA 4QYTA 7ADHA 3HJUA 1ECBA 4WY5A 3NCHA 1XMOB 2QYTA 1JTEA 2RGYA 4OGFA 4FWTA 1HMYA 2GFQA 1ESEA 2FHSA 2Q3JA 2QL6A 2GHRA 4AXXA 4OGWA 3ESCA 1U4NA 3UK6A 1V9CA 2K87A 3GA0A 1B8UA 1Q74A 2IPOA 1XJ0A 3HLKA 2O3UA 3N07A 2F9FA 4J6EA 2ZXUA 3HQ4O 1Z7EA 2ZGVA 1NBHA 2BM8A 2BR4A 2QW1A 4AKSA 5I45A 2D06A 5DBEX 2QD2A 3ETGA 3WJAA 1FW6A 1KJ9A 2EV9A 2Q5OA 3TD2A 3U2QA 4K3UA 4ITRC 1WMSA 3I9NA 4CL2A 1C7JA 2OGSA 3L5KA 5BRJA 3PLNA 5FJIA 1IPEA 5B3KA 2RHRA 4GPZA 2Z6AA 3AI7A 4ZDWA 1VBMA 2E3JA 3SJUA 5GIOE 3Q4GA 4QDUA 3SXJA 5HOEA 1MW8X 1VMIA 1CDEA 1P0PA 3DAPA 1UAYA 2F3RA 2JHCA 3I5MA 4D79A 4S1NA 3ME5A 1H6DA 2FEMA 1BX0A 3OQ6A 3RG2A 3LV8A 3WRYA 4DNXA 1T6NA 4LY0A 5EVCA 5REQA 1T6YA 1EBBA 4QEZA 3ZZNA 5L7WA 3IIMA 1PHPA 1T5BA 4DEVA 1K9SA 1K7CA 1RRGA 1TFUA 2DJIA 3SF8B 4YV0A 4WW0A 3BE6A 1IN1A 3COYA 1INLA 1UJ5A 1GZUA 1PZEA 3DE7X 5EJ9A 3QJGA 1VKZA 3IPCA 1SVSA 4UDNA 1E7YA 4WMLA 3FMVA 4RAQA 4BLQA 4YY3B 1C0PA 4XB1A 1TMOA 2I6GA 5CA0B 2G71A 2FWMX 4PZYA 4QG7A 1WPQA 2XXJA 1QPBA 2N42A 2ANCA 2KHZA 3JW8A 3OX2A 5FOVA 3SZGA 5BT8A 3FN4A 2JJ1D 3K1AB 3ENVA 5CLGA 1B15A 4LMPA 5JS2A 1V8BA 1XYGA 3JS5A 4C6TA 3L9XA 3H5VA 5LMZA 2HIAA 3MS7A 4KOAA 1VE3A 3ZS8A 3FFWA 3GXBA 4KXMA 2P3SA 1I33A 2PH3A 4AS3A 3W5SA 5M34A 1MKYA 4ETNA 3NEJA 2J3MA 1MNAA 5B7NA 4RHEA 4ENTA 3GLQA 2C9DA 3H75A 3QYPA 4OL9A 2W6IA 2DT5A 4NFSA 2XODA 3FOEC 1PQ4A 2JKVA 2YWHA 1EQAA 3OZBA 3ZIDA 4TMXA 2CCGA 1JEJA 3QW4B 5CX4A 1NG9A 3EA0A 3H2YA 2DHCA 1XR3A 4JBLA 2XTMA 4KH1A 1BYUA 2HA2A 2OUIA 4EARA 1PDVA 3WIEA 4Y9DA 5D01A 1H3FA 4LBWA 4PX9A 2Y8EA 4PZDA 3PUHA 5DIZA 2QJRA 1KZYC 1R18A 1NMSA 4WEQA 1P19A 5EWJA 4YWHA 4NICA 5HILA 3O9MA 3RYHA 3WJ2A 4TYMA 1MW9X 4QU8A 3ZXIA 2JFVA 2YV1A 4UBIA 4BU1A 4DJ5X 3ELBA 3CLUC 3H9GA 1P5RA 1ZLXA 2P2SA 2TMDA 5FNVA 4A8HA 4R7GA 4ND4A 4YLEA 4PGHA 4FFDA 4FU0A 4Q7KA 4UTXA 3NONA 3U7QA 3W5UA 3GCGA 3NHMA 4GM0A 3CRQA 4HDKA 4ZT5A 4IDDA 2PGLA 2JHFA 4GOXA 3V4VB 2XMQA 3QYJA 3E53A 1JR2A 3MGAA 3U31A 1N8TA 2VUSA 3U13A 2OC4A 1L4FA 1COZA 1DCKA 1VFPA 4BATA 4D3YA 1O08A 2OHVA 4KAAA 2WYOA 3PKJA 2QY6A 3RAJA 1DAOA 1QH1A 2ZSKA 1YB2A 1YB1A 2V7TA 2CKDA 2V4ZA 1UMCB 4NRDA 2FWPA 4B8WA 5JWOA 3ED5A 1XZPA 1DEAA 4P58A 3I3OA 4HEA6 1YC2A 3NC1C 4ZQIA 2AHOA 1GV0A 5HSGA 1UC5B 2EFCB 1ONSA 1U3VA 4RHXA 4A8JC 3BA6A 4R16A 2OXTA 2IYUA 4BO4A 1FSZA 3OETA 3NMUF 2QE7A 5AW6A 4TV9A 2ZBPA 3N53A 1ZMRA 4PIPA 3VYRB 1ZMOA 3MK31 4MLPA 4GLBA 1YZYA 4OHUA 5AM0A 1PE0A 4OQ4A 4JN6B 2XNHA 1QB8A 4LOAA 2C29D 1E1DA 2O2CA 3EH1A 4XEHA 2F3UA 2Q5IA 3ZCXA 3DFUA 221PA 3P0IA 4F9TA 1GA1A 4LY9A 3EBOA 3TJMA 3KKPA 4Y7CA 4N8SA 5ELMA 5DMHA 4GR4A 4BLSA 3NDIA 2DPHA 3FYHA 1EFRA 1E9AA 4IO1A 4LSGA 1JIQA 2BFWA 1LBEA 1RRPA 2R1UA 2BHLA 2VDJA 1FQJA 2Y9PB 5CURA 5DLPA 3VO9A 1U6KA 4EHJA 4PFJA 4CU5A 2DR2A 2WJJA 5TPZD 2VN8A 3D7LA 5GQSA 2XQKA 1TC1A 3L7LA 4L78A 5JWHA 4MRAA 1Z39A 2WVJA 2BEKA 1SRQA 1H4QA 2GEJA 5FPQA 1KDOA 1E3JA 3LHDA 4DR3B 2R751 4CFSA 1RJ9B 1PT7A 3MMXA 3T7AA 4DV2B 4RD6A 1E5VA 1EB8A 3VBEA 5GADl 3A6GA 4ZXFA 1K86A 1HXHA 3LT1A 4P54A 3LDHA 2I2CA 4RK1A 4B8ZA 5LZ9A 2BAGA 2C94A 2YIMA 3O4VA 4ND7A 2RGGA 4JVLA 3SEFA 1XTIA 4YRSA 2BFDA 1TB4A 3DL4A 1WBJB 5JMOA 4PLVA 3ORYA 1AXGA 1DELA 1NONA 3MWEA 1IBLB 3A9CA 2NUBA 3RBZA 4PTZA 4B3GA 4LN1A 3ENNA 3BWXA 1H2FA 4IAOA 1DTWA 4GQBA 1R8QA 2ZI7A 1S2MA 4FEGA 2Q7DA 5AYVA 2OE2A 5IP5A 5KYXB 5FLXA 2AZXA 1W5SA 1E9RA 2GCNA 2R66A 2VWPA 3LPNA 2XMBA 3ZHBA 1Z4OA 1E6LA 3KBBA 4C29A 4MQBA 2ZSBA 3EEIA 4EM6A 1QTNA 2YCBA 3UJNA 3JTMA 3P0RA 4A16A 1PX2A 5ITWA 2DETA 1E0SA 1T5LA 3NWJA 5H3CA 1P2SA 1YDHA 4OBXA 1JDBB 2PQ6A 3ZLUA 1IQPA 1LWOA 1IHOA 4OXXA 3RNLA 1AK9A 2JGDA 4KXVA 3RC3A 3SHQA 2AZ4A 5JPCA 1YVDA 5B4UA 2RHDA 3H1PA 3VUEA 2QAJA 3HCAA 4B6EA 2AQIA 3ZXUB 3H0EA 3OI7A 1HL7A 1UC9A 5DSZA 2ZIFA 2XDQA 3VSEA 4ARBA 3T3EA 1ESCA 1L0BA 2VHXA 2OQVA 3RHZA 4HGZA 1X19A 1JIXA 2EATA 1MQAA 1NVVR 3V6MA 5KHLB 3BIWA 2C8KA 2M2IA 1I14A 1QVRA 3KWMA 3MWJA 3GH1A 3QNWA 4QHYA 3VSAA 5HM8A 4NBUA 2FW0A 2GETA 4IFIA 5DLEA 2DX7A 2W4QA 2ZTVA 4WGGA 4CCSA 2FZVA 1YRLA 4BBJA 1PX0A 3ICEA 1LX7A 1C2TA 1H5UA 1N2JA 2J3DA 3AG6A 3I6MA 4OFZA 4P33A 4UUNA 5KNDH 2P0EA 5KI6A 3CNLA 2JFQA 5BQOA 4WXPA 4OMFG 3A7EA 1U0EA 5COAA 2X0KA 1W75A 3BD8A 4JOQA 3V33A 3RU7A 2VFAA 5CCEA 4UU1A 3GXOA 3QG1A 1SOUA 1TVKA 2Q46A 2WIFA 3DEZA 3F9IA 3LHKA 3QENA 2P3QA 3HL0A 3UFXB 2ZRCA 3LD9A 4KLNA 4A2QA 5FHQA 3GIDA 2H1LA 1XCMA 1E63A 1SM4A 1JLHA 1CG6A 1BTOA 3FNQA 3OCUA 1THZA 2F1HA 3D8BA 3MM4A 3PFKA 5LP6F 4DPKA 1PJ4A 4NPCA 1A9RA 1TYZA 4C1BA 1I7SB 2WLTA 3DHEA 4TT8A 4TMYA 4D9IA 4EYSA 621PA 1C4KA 8LDHA 3H1TA 3G2LA 3C6MA 1ZGZA 3AKCA 3FHLA 2OLKA 3UMYA 5LB2A 3FM9A 2RFLA 1AUQA 1TCUA 1U2QA 2H2FA 1XEWY 4LJKA 3BL5A 1T5HX 4GF5A 4GE0A 2WQZA 3H7IA 2Q3EA 5EZYA 3SQOA 3RF7A 3R5HA 2DY1A 5AKEA 3TLXA 3NANA 3G59A 2JLSA 2YQ5A 2ZAYA 1OFGA 4N76A 5C7IO 4ZVKA 1NVWQ 1ZITA 5IJWA 2ECKA 4P0TA 1USGA 3L8MA 1ZH6A 4JBHA 2C20A 1MH1A 2EKDA 1GQQA 3SCZA 2ZE8A 4UREA 1GSHA 3JQGB 4FHZA 1DCMA 3GVIA 3ZUGA 4UEJA 2W8BA 1ADBA 1CHDA 1LWNA 4GLOA 1CQJB 4RIGA 2Q62A 1PNVA 3IJ5A 4NBSA 3ND6A 4KITB 1T9ZA 3OOSA 1YMUA 5BSTA 2PX8A 3MAGA 4XSVA 5B57C 1XQYA 3UH1A 1EUCB 2YRFA 1U8FO 2H2IA 4YJ3F 3WJ1A 5LVAA 3AB7A 3VI3B 4BNHA 4DKJA 4LF8B 3NT5A 3UOAB 4CV2A 1GADO 1PJBA 3B20A 4LHEA 1UXJA 1ESMA 2ODEA 2YV2A 3AF2A 3D7SA 2A92A 3IT2A 4LGMA 1FMJA 3BBLA 1WCIA 3CQ9A 3PCXA 4IJUA 4PZ9A 4WESA 5L3QB 4RPCA 1C1DA 3DAGA 1MO2A 3H19A 3ZY3A 5LP6C 2I34A 4TVSA 3H84A 3HEAA 3V7WA 4U0KA 4ZU6X 2G67A 1OBHA 2EZ4A 4IG4A 4TMTA 2HRZA 4IV5A 4ZYLA 3CVJA 1HE4A 4JENA 5K0ZA 3F1KA 4Q9NA 2MT9A 2R5NA 5CB4A 1NUHA 3N0RA 3KAPA 4O2AA 3LPMA 3C3BA 2P62A 5H70A 4AF7A 4H1WA 3AEYA 4ABYA 1EI9A 2J08A 1A95A 3R5TA 3W06A 1EVZA 1M6WA 2IXGA 4YCNA 4FUTA 5H81A 3UAZA 1Q77A 2QG9A 4UZFA 1ZIYA 2J7PD 4C7VA 1DX9A 3HC7A 2I78A 1RQXA 1T1SA 3EVCA 3MLBA 4KPEC 2ERCA 3WMFA 1LBHA 1VOTA 3DWEX 3I1YA 2VCEA 4UM8B 4F60A 2VPXA 2RI0A 1N2SA 1D03A 3V4SA 2IP2A 2BGNA 5H9VA 4EI2A 3RUFA 1Y1TA 4R9RA 1DWOA 1JAIA 4OY3A 2PU7A 4V0MA 2GD2A 1X74A 3EWAA 3PQ6A 2RAUA 4EGQA 1QX3A 2HPHA 2NUTB 3VVMA 4DHEA 1JTFA 3MT7A 5ALRA 4RH1A 1OY1A 2VRNA 1LS1A 2BEWB 3PUZA 1R37A 2O2SA 4URWR 3QTBA 3WO1A 4NBVA 5IZCA 1NE7A 5T4FA 3TSCA 3SX0A 1NMQA 4B5LA 5JADA 4F3RA 3N6XA 1A1SA 1QUEA 2JGNA 2P9EA 3QOFA 2P27A 2GDJA 5KJEA 4BVGA 3B6ZA 5JZSA 1YI1A 1L5NA 4O2BF 4C4XA 4JZKA 3V5NA 3L7IA 4YHBA 3B2NA 4RD3A 3AGQA 4AP6A 1NW5A 4KQ2A 1WJGA 1H2XA 3D0QA 1MB2A 2OP0A 2Q1UA 3E9NA 2X8WA 3EUWA 1EUQA 2HADA 3H2SA 3TR0A 1KY4A 2DQYA 4YJHA 1T5SA 5LQCA 3QEAZ 3JQBA 5LNK1 2R4UA 5DT9A 3W3AH 3IR6A 4UXHA 2KM1A 5FFFA 5IANA 2R8OA 2JI9A 1A2OA 3WNBA 4P3NA 1EWYA 1C41A 4ZPXA 4QJ5A 1UOOA 3ZU4A 1Y5MA 2BTQA 3J81A 1EE9A 4LQ4A 5TV2A 3QE0A 2JH3A 4O4IB 3MJHA 3AM3A 4BMDA 1H1LB 2QAIA 2V6JA 2EL9A 5LYYA 4MR7B 2JANA 3Q12A 1X7YA 4RWZA 2ZPUA 3HA5A 3LFHA 2IHNA 2VH2A 1FP6A 3CLRC 4A8TA 4B4OA 1KDYA 4W5OA 3DZFA 1CZKA 2EJTA 5HVNA 1H3NA 4EKIA 1U8CB 1TZJA 4B6FA 2QBYA 5KTMA 1YASA 3AF4A 4WNAA 1KE1A 3TQFA 3VYSB 4TKLA 5DJ5A 4F85A 5TGTA 2C5LA 1U3CA 3OP4A 2XVXA 4EG7A 1ZAYA 2YYAA 2WYUA 3O8BA 4K86A 4C4ZA 2C92A 1HFEL 2GSWA 3LYAA 3VBCA 2QRVB 2HHCA 3JALB 3KZNA 1P2UA 5LJLA 4O3FA 5ALQA 2WDZA 2C7OA 3O90A 4RD4A 1ADYA 1R5BA 3ZJVA 1UKBA 4GHWA 3IMKA 4YJ3B 5AJZA 2Y0DA 1W1UA 3JYPA 4DUGD 4OIMA 2HYDA 2J3LA 3UJBA 2GKSA 4CCYA 5BRNA 1MQ8B 1Q0SA 4U2FA 4P86A 4UE6A 4ARAA 2IEAA 4H31A 1H4TA 2IC5A 3MVEA 4JKIA 1AKVA 1SC6A 3Q7RA 2C2HA 3KEGA 4LVOA 3S2EA 5AIBA 3IODA 4C0LA 2FWJA 2JGJA 4CVNA 1S2LA 1A9XA 3HRKA 2O0JA 2BR3A 3EQ7A 4W7IA 5COQA 1T8WA 1W25A 2C99A 3I37X 3N8KA 1HDXA 1DDIA 2EHDA 3FMOB 3SLGA 1A9QA 4UXJA 2XMPA 5EP4A 2JHAA 1IFXA 4WASA 3UC5A 3SC2B 3S0JA 4I1PA 3MUFA 4P38A 1BDJA 1LPBB 4WFQA 3CH7A 4YBZA 3T1VA 3LLUA 2HJRA 4MW7A 2AG5A 4JU8A 3UWDA 1OAOC 1Q0ZA 1QVZA 1NQVA 4CCAA 3HV0A 2JH9A 3GNQA 1P0IA 3SIPA 4I1UA 4J90A 1IM8A 1QS0B 3QKSB 4BVHA 4QXOA 1DBSA 2DWOA 2I7DA 5LBTA 1E2NA 1WTAA 2OY0A 3KYIB 4B81A 1B43A 2PEZA 3I01M 1F2TB 1EGAA 4BNDB 4Y3UA 4N6NA 4AAYA 5KBYA 2PRIA 1RJ9A 3RTEA 1LVGA 2A1TS 2IYQA 4PYRA 4KE7A 2IIQA 3OLVA 3B6JA 3F49S 1RXYA 2O0KA 1GPLA 1DIOB 5JI3E 4PXSA 1EK5A 4YA6A 3V7YA 3HJBA 1J0AA 5KU7A 3MTQA 2H06A 2WWWA 4RZXA 4QYMA 3F5FA 4BLRA 4D5EA 4LF6B 4DLTA 2UKDA 5J58A 3DT9A 3CVXA 2E5LB 2HX1A 3SDBA 3KQWA 4I81A 2FG6C 1JEEA 4COKA 2QP9X 3EGOA 1AJEA 4EUHA 1GU0A 1T43A 5IM4A 4M60A