3MGGA

Crystal structure of methyl transferase from methanosarcina mazei
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
246
structure length
246
Chain Sequence
ETLEKLLHHDTVYPPGAKVLEAGCGIGAQTVILAKNNPDAEITSIDISPESLEKARENTEKNGIKNVKFLQANIFSLPFEDSSFDHIFVCFVLEHLQSPEEALKSLKKVLKPGGTITVIEGDHGSCYFHPEGKKAIEAWNCLIRVQAYMKGNSLVGRQIYPLLQESGFEKIRVEPRMVYIDSSKPELVDGFILKTIIPMVEGVKEQSLKMQIIKEEEWEKGIEELHKTAEHGGTFCYTFFKGWGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Methyl Transferase from Methanosarcina mazei
rcsb
source organism Methanosarcina mazei
molecule tags Transferase
molecule keywords Methyltransferase
total genus 85
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13847 Methyltransf_31 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3mggA01
4AZWA 5EHIA 3BWBA 3FTCA 3HVKA 1RI2A 3R3HA 3M4XA 4P7KA 4YUXA 3C6MA 2BH2A 1EJ0A 4RTQA 3HCFA 2YR0A 3HTXA 3E23A 3UA4A 2G72A 1JQDA 2IP2A 3UZUA 3DTNA 1TW2A 3PB3A 5K8VA 3M6WA 5BW5A 2KW5A 5BW4A 3EGIA 1O9GA 2PWPA 4CTKA 4RTNA 1ZG3A 4KVZA 1N7JA 4BLUA 3DMFA 4E33A 4GC5A 1NW7A 1XDUA 3NWEA 2NXJA 4GC9A 5GM1A 5EGSA 3I5UA 1KPIA 4DA4A 1X1BA 1QYRA 3JWGA 4FSXA 1Z3CA 2QE6A 4PYIA 4MTLA 3EVZA 4QVKA 2EX4A 2QY6A 2YX1A 1HMYA 5DM1A 3IHTA 5BP7A 2PXCA 4U7PB 4HGZA 5EEGA 3SMQA 5CD1A 3U81A 2PGXA 1VP3A 5EZSA 4RTPA 5T64A 1P1BA 2ZLBA 2Q41A 2JHPA 3MGGA 4V0RA 5M5BA 2ZZNA 2OYRA 3HVJA 3LX6A 4POOA 1RJDA 1XTPA 4PYOA 3CJTA 5ICFA 3FUTA 1NW3A 4ZTBA 3KU1A 1NBIA 2Y1WA 3C6KA 3GU3A 3KQSA 3M6UA 1R74A 4DM3A 3LKZA 4X61A 1NKVA 1TW3A 1MJFA 2EJUA 2IH2A 1RI3A 3B7PA 2CL5A 2P41A 4QQNA 1D2HA 10MHA 1AF7A 1BC5A 2EG5A 4CKEA 2AOVA 2AVDA 3FTDA 4IV0A 3AY0A 4GUAA 1M6YA 4ER0A 5E2AA 4OX9Y 4KDRA 3HA3A 5E1BA 5DWQA 4Y30A 3OU7A 5HFJA 2P3LA 1SQFA 2ZULA 4PYMA 3LGAA 4R6WA 5FCDA 1M0EA 2I7CA 4PYLA 4XUEA 3H2BA 5K09A 4OA5A 2PY6A 3KPWA 4OBXA 1X1AA 3KR1A 5EMMA 1YFLA 1XVAA 4M36A 3FYCA 2O05A 4CTJA 5DLYA 3EGEA 3THSA 3B89A 3TQSA 2P3QA 3SVZA 2Z6AA 3ANXA 5GOZA 2HTEA 2OB2A 2YUIA 5LQUA 2GH1A 1R8XA 3QV2A 5EIWA 5EKUA 1IXKA 3E7PA 7MHTA 3TR6A 5EEHA 3R24A 4PYKA 2B3TA 4U7TB 4EMSA 2UYQA 2UZ4A 3BT7A 5HIKA 4EKGA 5ERGB 5EKXA 4XCXA 3L8DA 4EKIA 1V39A 1QAQA 3GGDA 5C0OE 3MHTA 2JG3A 1F3LA 3EVGA 2PLWA 3GXOA 1M6EX 3MTIA 3NVMB 3MCTA 1JQ3A 2HNKA 2O57A 1EJ6A 2AOXA 3HA5A 3G89A 4FS8A 4RWZA 4C4AA 2FYTA 5KQRA 5LQNA 2O06A 1JQEA 5T6BA 2PJDA 1DL5A 1JG4A 4A6EA 2ZZKA 3Q7EA 3B5IA 3SSNA 2GPYA 2HV9A 3MERA 5C1IA 1Q0SA 3BGVA 3LSTA 2IGTA 5EG5A 2ZFUA 5E2BA 4AZTA 2C7RA 3TFWA 1KIAA 2BZGA 2A14A 1ORIA 3I58A 4GOLD 2AN4A 2AOUB 4X41A 3C3PA 4CKCA 4LG1A 1NW5A 2IDKA 2XYVA 3PS9A 3GJYA 4RX1A 5FUBA 4R8RA 2XYRA 2PVCA 3JWHA 4LWPA 3O4FA 5D1NA 5GP1A 2NP7A 4CKBA 5FA5A 2BR5A 2DULA 3KQOA 4PYNA 3TOSA 4E70A 3A25A 4YV2A 3B3GA 5K0EA 2GLUA 3EVDA 2PT9A 1QAOA 2V74B 4MQ4A 3MQ2A 5K0CA 2AZTA 3CVOA 4AZVA 3K6RA 3EEYA 5EVJA 5K0GA 2PXAA 3LDGA 3ELDA 3P2EA 3CJQA 2ZTHA 1YB2A 4QVGA 4RTSA 3GRVA 1KPGA 3LCUA 2PT6A 2CMGA 4FT2A 1RI4A 5DM2A 4DF3A 1VQ1A 2ERCA 5HIIA 3TPZA 1JTEA 3OE5A 5DT2A 5E9QA 1SQGA 1G8SA 1MHTA 2ZSUA 3BGIA 2P1DA 1RJFA 2OO3A 5DX1A 3A26A 3SSMA 1VPTA 2PX2A 4QTUB 3ELYA 2PV0A 4LECA 4GEKA 4M7RA 5DSXA 5FHRA 5T67A 3QOWA 3BXOA 3VC2A 1QANA 2ADMA 5K0LA 3DH0A 4XUCA 5B1SA 3UJ7A 1KXZA 3EVCA 3OCJA 4QQKA 2GB4A 4JXJA 4K6MA 4E32A 2I62A 3ORHA 2FK8A 3NMUF 3MCZA 5KQSA 4E2ZA 1N2XA 3GNLA 4HSGA 1L9KA 1O54A 2QYOA 5E8RA 3KR9A 2OB1A 1ZGJA 3HM2A 4ER3A 3SXJA 2NXEA 2GAFA 3CGGA 3KPUA 1I9GA 5EMKA 4P7GA 4RVGA 2QM3A 2VDVE 4NECA 4E2XA 3SR4A 2IH5A 5DXJA 5LR6A 3LDUA 2DPMA 4V0QA 5F2KA 5EMJA 3P8ZA 2IFTA 3KQTA 3KQMA 3PFHA 4FR0A 4C04A 2VDWA 5FQNA 4BLVA 3ER8A 5K03A 2AOTB 1D2GA 1WZNA 4Z2YA 3T7RA 3HVHA 3HCDA 5CVJA 1RI1A 1JG2A 1RJGA 3T7SA 1JG3A 1XCLA 2OKCA 2XVAA 3MTEA 2P3OA 4OQEA 3PFGA 1N7IA 3NWBA 4HG2A 2ZWVA 2AS0A 3HCEA 3PX3A 4M37A 1L3IA 5DM4A 3G2PA 4DCMA 4FZVA 3KHKA 3IEIA 3FTEA 1G6Q1 2YVLA 4H0NA 4RTKA 2H00A 1KYWA 2H11A 3KPYA 4PCAA 1D2CA 5DTMA 4RTMA 4HTFB 1G38A 3OZTA 1R6AA 1WG8A 1ZQ9A 2OPBA 3G5LA 1WXXA 4MIKA 1PRYA 5E1OA 5EPEA 4RTLA 4X60A 3VSEA 5DM0A 4AUKA 1AQJA 2P40A 3KQWA 4GOMD 2HR1A 2VS1A 1BHJA 1KHHA 5DTRA 3KQVA 2YXLA 2C7PA 1Q0TA 3OU2A 4PWYA 3FZGA 2ZIFA 1UFKA 2ZBRA 5FWDA 1NE2A 5HILA 2EFJA 3KR0A 1Y8CA 3DOUA 5DPMA 2I9KA 4KDCA 8MHTA 3JWJA 1WS6A 3SSOA 4IKPA 2XYQA 3MAGA 4E2WA 3C0KA 4KW7A 2YXEA 5K0NA 1OR8A 5JUWA 1SUSA 4IV8A 4QTTB 2ZIEA 3BWYA 4E2YA 5LQKA 4PINA 3CC8A 5EZQA 3M6XA 5G02A 1DCTA 4UOEA 2FHPA 2G70A 3EVAA 4Y2HA 4ER6A 1L3BA 2AR0A 5LSAA 3ERCA 1RI5A 3A7DA 5DRTA 4F85A 4KIFA 3KQPA 4ISCA 1H1DA 3BKXA 2ORED 3TLJA 2OZVA 5HOQA 1F38A 4RTRA 4EQZA 5K05A 1R8YA 3A27A 5MHTA 2V7EA 3KPJA 2OBFA 3P2KA 4HRAA 5GIPE 4QPNA 3KPVA 1VIDA 2NNWB 1FPQA 4R8SA 3GRZA 3DLIA 3UJ8A 3HA7A 3PX2A 3FUVA 1R18A 3CJRA 1WXWA 4HH4A 4BY9E 9MHTA 4RVDA 3FPGA 2XVMA 2H1RA 2K4MA 4YUZA 1NV8A 2P35A 4ER5A 1SKMA 2JHCA 1JSXA 2P8JA 2PXXA 5K0JA 2PSSA 3FPEA 5FWAA 3DXZA 5LQAA 2UYHA 4GF5A 4PGGA 3DR5A 2ONYA 3UJ9A 5EHGA 3VYWA 4RV9A 2LD4A 3T0IA 5ICEA 3GRRA 1XXLA 3NJRA 3NDIA 3KR2A 3CBGA 4KRGA 3FUUA 3CCFA 4BP1A 2ONZA 4GBED 3LCCA 4R6XA 4X1OA 4F84A 2E5WA 2WK1A 4CXMA 2ZWAA 5CVDA 3OZRA 1VL5A 3GIWA 3LDFA 3P71T 3X0DA 4C06A 5H02A 2UYCA 4A6DA 1U2ZA 5DRYA 3B3JA 5CM2Z 4B17A 4CWAA 4YUYA 2HMYB 3NW9A 4DMGA 3DXXA 3EGVA 1P1CA 2ZW9A 4G56A 2ZBQA 4OA8A 4PIPA 5D1HA 3TM5A 3E8SA 1L3CA 3M70A 3OZSA 2VDUE 2P7HA 1EIZA 1P39A 4PCLA 3TMAA 4C03A 1UIRA 5C9ZA 1AV6A 2AOUA 3P9NA 1SVUA 3UJAA 1KR5A 3THRA 4PGHA 4WXHA 1NW6A 1ZKDA 4C05A 4QDJA 4E31A 3VC1A 2ZCJA 1HNNA 3NTVA 2NYUA 3SX0A 3LL7A 3GO4A 1YUBA 1ORHA 2FPOA 1XCJA 3UJCA 4YMGA 3FYDA 4P7JA 1ZGAA 5F2OA 1SG9A 5EMLA 5CVEA 1FP1D 3BWMA 5EC8A 4XUDA 4E30A 3NVKI 4BLWA 3G5TA 1I4WA 1UWVA 4FGZA 4X63A 2ZIGA 3B3FA 4PIMA 3LBYA 2R6ZA 3OFJA 3AXSA 5P8WA 3RW9A 1EQAA 3I64A 3ME5A 3T7TA 3V8VA 3UBTA 4HTFA 3LHDA 5K01A 3C3YA 3FUWA 3M6VA 1KP9A 2B9EA 3DP7A 3OE4A 4LWOA 4P7FA 2F8LA 3ER9A 3G8BA 3ELUA 2PBFA 3F4KA 5FADA 3TKYA 1T43A 3JWIA 2BR4A 2NXNA 1VE3A 2FK7A 5E8JA 4YV0A 1FBNA 3IV6A 1JR4A 1QZZA 3AXTA 5CVUA 5HIMA 5EOVA 3TRKA 3AWIA 1JTFA 2IIPA 4WVLA 3LCVB 1X19A 1YZHA 3EVFA 3PT9A 3DMHA 3BZBA 3LECA 1TPYA 3S68A 3DMGA 3A7EA 3FPJA 2IH4A 5KYGA 1NV9A 3KQYA 1WY7A 5FHQA 3TM4A 4P58A 2UYOA 2HWKA 2C7QA 5HIJA 5FTWA 4PYJA 2G1PA 1DUSA 3IYLW 5FQOA 4PNEA 3BKWA 3G2MA 3WSTA 2AOTA 3V97A 2O07A 4KIGA 1B42A 1XJ5A 1PJZA 2PKWA 5KVAA 5LQCA 2WA1A 2I6GA 2OY0A 3DLCA 3P9KA 1NT2A 2AVNA 5F2NA 2XBMA 3O7WA 2P7IA 5E1DA 5FULA 4F86A 3QOXA 3GRUA 1G60A 3LBFA 3KKZA 4IWNA 4BP3A 5E9WA 3FTFA 2BM9A 2CWWA 2JHAA 4FP9A 1INLA 2PX5A 5K0BA 4OQDA 3HCCA 5IH3A 3SGLA 1G55A 3G88A 5CUQA 3ID6C 5GIOE 3LKDA 3LPMA 3UJDA 2N47A 4GQBA 3PVCA 4DZRA 1NBHA 2AN5A 2G8NA 2YQZA 3G7UA 4R05A 5EIFA 3UJ6A 1BOOA 3UWPA 2AN3A 3HEMA 2IBTA 5DTQA 4RVFA 1YZ3A 3HCBA 5EQJB 4DCGA 3GCZA 2YXDA 1YFJA 1NW8A 3NDJA 5FA8A 5KS2A 4MHTA 3AJDA 2ESRA 2JH8A 2O0LA 5GWXA 3REOA 3UJBA 1XDZA 3FUXA 2IPXA 3P97A 4FSDA 3DXYA 4AX8A 5DX0A 4DKJA 4EK9A 3BWCA 1JG1A 1XDSA 4L7VA 1O9HA 3FPFA 3G2QA 3P9IA 4QDKA 3UFBA 2BR3A 3OU6A 4GOOD 5ICGA 4YV1A 2CMHA 2Z6UA 5E1MA 3KQQA 2OXTA 1JSZA 3DUWA 3P9CA 3EMDA 3HVIA 4RSRA 3R6TA 2IDJA 2IBSA 1BKYA 3DULA 3O31A 3FRIA 1R00A 1X1CA 2JH9A 5GM2A 4MWZA 4C08A 5CCBA 2ZZMA 4YUVA 3FPHA 1VBFA 2B2CA 1ZHFA 4C07A 3A4TA 5DSTA 3BUSA 2PWYA 1P91A 4DQ0A 3M33A 1IY9A 2QRVA 2EJTA 2R3SA 2AOWA 4GOND 2B78A 4EVIA 3G2OA 2VZ9A 4AZSA 2JJQA 5LQJA 4PYQA 5GINE 1FJXA 2NP6A 1EG2A 4PONA 5E9JA 1I1NA 2FRXA 5ICCA 1KYZA 3I53A 4YMHA 3RODA 4RTJA 1YF3A 1VP9A 1IM8A 4YUWA 5CVVA 5DX8A 4ATNA 3MB5A 3HCAA 3E05A 5CCXA 4O29A 5K0FA 2BM8A 2VP3A 3UA3A 3GDHA 1QAMA 1L1EA 3EMBA 5U4XA 3FRHA 3OFKA 4FT4A 5LQRA 2ZBPA 2FCAA 3OPNA 1AQIA 1EAMA 3CKKA 1FP2A 3D2LA 2Z6QA 2NXCA 5IKMA 3Q87B 3P2IA 3RIEA 4HC4A 5DXAA 5HEKA 4KWCA 3EEOA 4QPPA 2GS9A 5JR3A 2WA2A 1VLMA 3EVBA 3PTAA 2GA9A 2Y1XA 3ELWA 3I9FA 4ER7A 2G71A 3GRYA 3G8AA 3BGDA 4RYLA 5HZMA 3R0QA 4M38A 3HNRA 4RTOA 3EPPA 5BXYA 2C7OA 3PLAE 5CIYA 3HP7A 2PX8A 3R9XB 2B25A 1G8AA 1KPHA 1RJEA 4HGYA 2CKDA 2ZVJA 3SM3A 4RVHA 4OBWA 3GWZA 3TKAA 2QRVB 1SUIA 2YTZA 3K0BA 3EVEA 1X1DA 2PX4A
chains in the Genus database with same CATH superfamily
2AD1A 1Q1ZA 4TKLA 1E7WA 3FTCA 4YO7A 3PXDA 2QE7D 4RNDB 2PCLA 3ZDYB 1X2EA 1QZXA 3GPIA 4NV3A 4F2PA 4IS2A 2GZ2A 4MVJF 2X42A 5ILQA 4YCSA 1AF4A 1GEGA 3TSCA 5ISMA 2CFSA 3ZCUA 3DE1X 1F5SA 2BE9A 3GG9A 5K8VA 3QKRA 3VR2D 5JJIA 4UARA 1T5SA 2C42A 1RLIA 2YVQA 1WW2A 3WMRA 1RAHA 2PWPA 1SBIA 3KL4A 4HWPA 2K7FA 1BCRB 1G2QA 2Q1XA 2R6FA 2W2NA 2YOHA 1XDUA 3GVHA 3L93A 2NXJA 2DE0X 4GP9A 5BSEA 4BXOB 3QJGA 3U44B 4KJZA 1FX1A 1SG6A 1QHYA 2ZU0C 4RD4A 1ABBA 1HDXA 1NVVR 1OLUA 4TN1A 4FWIB 2EHDA 4DJTA 2HWXA 3OCXA 4LGMA 5A7HA 3GLSA 1EVQA 1R5OA 5LJLA 2RC5A 2O8NA 3LNTA 5CT9A 3TG2A 1ZM4A 3SZUA 4XSGA 3FA2A 3TMYA 4BQRA 4D3FA 2PQ2A 1JEYB 1FFSA 4D9CA 3P27A 4UNIA 2LGJA 2QRLA 1XZPA 3OT5A 4JR1A 4M0PA 2W6JA 2E7ZA 4ZYLA 4X1IB 2ABWA 2FKNA 4CODB 1GY8A 4IIJF 4UPVA 2LCFA 1E3QA 1O95D 3CR7A 2VXCA 4ZTBA 4ARSA 4R7TA 4UU1A 1ID1A 1MJFA 4FDMA 1JA9A 2ZRDA 1PAUA 3BJIC 2QF7A 3B70A 3HGQA 1ISIA 4ILKA 5JYCA 2EYQA 3KT8A 4NNOA 4L72A 2VAWA 2QVLA 4Q4AB 4QSMA 4OQLA 2O1XA 4KAAA 3CUTA 3UMSA 2QV0A 2VHQA 4DR6B 2AN1A 1CY2A 2CHGA 1Z38A 4ZDIA 1Z2DA 2IE8A 4RJJA 1YCDA 3C5VA 5K8LA 2ZYIA 1Y9ZA 2ZULA 3OA0A 4K8OA 4Q1CA 3D59A 5JXGA 3L4JA 4GZ5A 4N8EA 2HGZA 4LY3A 2IW3A 2H3HA 1L5WA 1QO0A 1KSGA 5BN3B 5JSYA 5I7WA 3SS7X 1I0ZA 2H5LA 1QMGA 5KYUB 1X1AA 5FOTA 3DMTC 3ZC3A 4P32A 1PD0A 2H4HA 2OR3A 3U9TA 5EIOA 1LLFA 4XB2A 4GXQA 2W2KA 4TLBA 3VU1A 5B4TA 3OP1A 4NMMA 3WGTA 4F6CA 2NSLA 4HLUC 4HAOA 1N4AA 3GLGB 3QV2A 4BVFA 2Q6IA 4BV2A 4UHBA 1PNTA 1QV7A 2GN4A 4M0DA 4KNYA 4BCDA 1E4EB 1IHPA 4J16C 1ZWLA 3Q2KA 4GYWA 4DIMA 1NNUA 2BV3A 1UANA 3DL2A 1Z4PX 1HSZA 4YWHA 4EKIA 1BMFD 4Q7LA 3ENQA 1LCIA 2G07A 1ABFA 2JCSA 4MUJA 5AW5A 2A78A 5AQEA 3ZY6A 1Y1PA 1NJ8A 1YZQA 4N49A 1M1YA 3OFSA 2PRSA 4C01A 5IH7A 5BRJA 5K8UA 3WY9A 1JIUA 3H9UA 4ARZB 4JJIA 4NAHA 1ST3A 5ENVA 4O4IB 3T3MB 3BCSA 2HV9A 3A06A 3ESCA 4MCAA 3TQCA 3TVYA 3MERA 4EL5A 2BCJQ 1PJ8A 5MN4A 4N5MA 2ZFUA 5E2BA 1LXCA 1SFRA 2ZQ5A 3CXRA 3OX1A 4Q93A 4ETMA 5JFTA 1KI3A 4PZEA 3T1TA 4RCVA 1KRWA 4CKCA 1NW5A 1MO6A 1K7FB 3EEFA 2OCKA 4K8RB 1TYDE 4P4GA 4WCFC 3OKAA 4ETWA 4PYNA 1F06A 3OE1A 3JAWA 1B2LA 4KV9A 4Y7DA 1T3GA 5K0EA 3EQ7A 2PH5A 2V74B 5TQ2A 2EYUA 3FGZA 1AHPA 3P9YA 5KX5A 1DC8A 2BFFB 4P4UA 3F7TA 1E2LA 4JIGA 3ENZA 4QBIA 4R1NA 2HPHA 3SJZA 3LOQA 1IOWA 3PNVA 2A0XA 5EPOA 1Z13A 2Y0BA 1FE8A 2F00A 1CD5A 1EWRA 2CLLB 3SYLA 2XUGA 3NEYA 2C61A 4MSUA 4Q7QA 3TOCA 1CUIA 4X66B 3WXMA 1ZA2A 4YGYA 3KQHA 1WHTB 4CUZA 4G0WA 1R10A 2ZSUA 1M7HA 4U7GA 3EX7C 2C7GA 1JHYA 1FRNA 2BGIA 4G4SP 3A1TA 3DOCA 4D0RA 3AI2A 2RK4A 1Q7RA 3HBMA 2CY0A 4NU0A 3RROA 9LDBA 5F51A 1P7VA 1QANA 3NC0C 3SEFA 5B1SA 4DV0B 1D2NA 4K9QA 2FLKA 1E9FA 3L1IA 1R12A 5FFNA 5A3QA 3ETCA 3SQMA 3ZE1B 1JMVA 2W11A 2VBCA 1DBVO 3KALA 2OO7A 2NTEA 3TTUA 4LUCA 4H9GA 4ZCTA 4LNAA 4N39A 4MHOA 4OHRA 2KE5A 3N8HA 1HL7A 3OSZA 5CFQA 4HWOA 1T1GA 3KR9A 2OB1A 1PL7A 3AETB 1NRXA 3L6RA 3ONVA 3UCXA 3PIDA 2M9MA 3OQBA 1FX0A 1P1RA 2QM3A 1R5JA 4NEQA 4KZKA 4PRZA 3QITA 4Z7NB 1VLHA 3S7TA 1HETA 1YWGO 1T9AA 3TL3A 1W85B 2XYGA 1C29B 1EP2B 4I1PA 1XLTA 3E82A 4CKEB 1Z0DA 3BSFA 2YNMC 1YR8A 2UUOA 3H9QA 3HLTA 4FR0A 3I6MA 1ZN7A 2AOTB 2N42A 3OA2A 1D2GA 1G1AA 4LQLA 3ER8A 2QPAA 5LBUA 3KQKA 4G6ZA 3GLVA 4XX0B 1OH7A 2PUBA 2YHAA 4YRAA 2C2MA 1NY5A 1KMIY 1C0LA 1MTZA 3E3OA 3WLTA 3CPJB 3FCUB 1N1MA 3IQXA 1CR0A 4NU8X 1NUSA 5KREA 5BR4A 2PMBA 1TCVA 1PSWA 3G2PA 4M9XA 1NQXA 1DKRA 4YQYA 1U2SA 4CIXA 4YS6A 2H11A 2Q0QA 3OCCA 4O2AB 4PAQA 1KAEA 5IW8A 4DA7A 2C4TA 4LPKA 1OAOC 2Z3VA 1WG8A 3MHPA 1VCMA 4R31A 4ZYTA 5CB4B 1NLZA 3LL4A 4L6IA 3HU2A 3S1SA 4FMBB 3NGXA 2POCA 3SC4A 4NYIQ 3Q8XB 1ZJJA 2VS1A 1W8IA 1YZFA 4HDMA 3UK1A 4ECEA 4KCGA 4BFCA 1FJ2A 4OJYA 1WZIA 1QQ6A 3CPEA 5G41A 3OQMA 2RMKA 2HWUA 1Q57A 2OCAA 2WOOA 3OECA 2VQSA 1T9HA 1WS6A 2ZBEA 1QF7A 3L7OA 4TRNA 1TFRA 4QULA 1ECBA 2CNKA 1E6UA 5CTJA 2V5VA 1SUSA 2C7VA 4Q02A 2PMWB 1AZSC 3C4VA 3CF2A 1E60A 1EFVA 3IMFA 3I01A 4DQXA 3QXSA 1N0HA 2Y1FA 3WYAA 4O4JB 6ABPA 4ER6A 2H1CA 1RRGA 1SCUB 4YC7A 5YASA 5EJ8A 1M1ZA 3SQOA 3T3OA 1HM5A 2ICAA 3KZKA 3N2EA 5KVVA 1BS1A 3WYCA 1Q7GA 5ALRA 3L49A 1MB4A 1XQVA 2WJWA 4LXYA 4AWBA 2XXAA 5A6SA 2XMCA 3V80A 3ZK7A 2JEOA 2GXSA 2V7EA 2A84A 1H3FA 3K5HA 3KPJA 3P9QA 4IXTA 4EW2A 5HIAA 5GIPE 5A2QA 4MK4A 2G6TA 4R8SA 2Q4RA 3JARA 3F4BA 2CN1A 4EG8A 1TZJA 3UJ8A 5F7ZA 1UXOA 4Y2XA 5IX8A 3FUVA 5HJ7A 1NVVQ 1SKBA 2OVBA 1M5TA 3CJRA 3CVVA 1BH2A 2VBIA 3K8ZA 3I9MA 4KOEC 3W5VA 5LMCA 4OU5A 4I5DA 3F6PA 2JHCA 3GEEA 4MVJG 3HVRA 1WMSA 4ZU6X 4ZK2A 4W99A 4B85A 1YZKA 5BWMA 5LQAA 2UYHA 4PGGA 2DUUA 4ZKDA 1ELOA 2RARA 2PT5A 5FNZA 4C7OB 3ZXYA 2F1OA 4GOJA 1D6MA 4TMZA 2IU3A 1AQ6A 4JENA 1CUWA 4RABA 1ZD9A 1ZUNB 1DKOA 3JARB 3KAQA 3OFVA 1XQ6A 1DMSA 2P5UA 4G07A 1VL5A 5CVDA 5ED4A 4W6ZA 3K8YA 5DHAA 2ZEJA 4GRIA 3RK4A 1J8MF 3GJ3A 3W3AA 1M8KA 3I92A 3CH7A 3O3NB 1W2WB 4MW0A 4JJKA 1SCDA 4B17A 4U5QA 3U44A 3QPAA 1UXJA 2O7NA 1N9KA 4BFXA 1J25A 4W7HA 1BCRA 4EGJA 1L4GA 2NO0A 2FV8A 3HKEB 4XJTA 3UT5B 2B4YA 2BWJA 4WZAE 2Z8ZA 3GLFB 5G1OA 1AH2A 2ROQA 1EIZA 2QZ4A 5C9ZA 2HMVA 1RYNA 3L2OB 2P2CA 3DNMA 3PTLA 4I8IA 2V4UA 3AW8A 2GAOA 1UJBA 2J7PD 2NV0A 1EM8A 1R0RE 5FYQA 3RUIA 4BAUA 5CDUA 5HRUA 4PGHA 3NHLA 3RTDA 5F5NA 1T25A 4OQMA 4YIKA 1RAIA 1EB8A 6GPBA 1NJ6A 1J39A 3DP9A 4EY4A 2XUFA 3U1BA 2IYPA 2HCTA 2EL9A 3OCZA 4JLJA 2JLUA 1E7RA 3AEYA 2WUWE 3ON5A 3A32A 3DYBA 3PKJA 2GTIA 1U90A 4KFSA 2X2OA 4DTCA 4XDGA 4IFBA 3MJTA 1NNEA 3NX4A 5TF4A 1Q91A 3WNZA 4RE5A 1UJ5A 3KK0A 3ZHQA 1EQAA 3OHMA 1DAGA 5INTA 1L5NA 1Y37A 2TMGA 2R86A 2E6KA 3OZFA 3C1UA 2B9EA 3F3MA 4EPXA 1IXZA 4P7BA 1L7BA 2FK7A 4JSTA 4L0CA 5ALOA 4ENSA 2ECQA 4MAAA 5JH7B 2GXQA 5AXBA 1X1RA 3COZA 3MOGA 3K05A 3RI3A 3ZK8A 2Q4BA 1CZUA 4DHWA 4IMRA 1TIKA 3DPIA 4JEIA 5E6RB 1QFMA 3T5TA 4ZXPA 1IOLA 2WJVA 4BVJA 2ZIAA 1TCCA 4OXQA 3IEMA 4LYAA 2Q07A 4P58A 1DOAA 3IVGA 1GA4A 1NP7A 4I50A 4PW0A 4LWQA 3X1XA 4KYTA 3ZI4A 3OT4A 4UEJA 3WFZA 4PX3A 4E11A 4YRMA 4Q7KA 4AY5A 3Q9UA 4JVSB 2O07A 3NPMA 3KYCA 1RWVA 3N9IA 5HVNA 4FE4A 1SGWA 2RGXA 3L7BA 4WKCA 3LPAA 1ZRHA 5T4BA 5E1DA 1TKAA 1R3UA 1GL3A 3KKNA 4H3SA 3I12A 4WLEA 1UBTS 2FW8A 2UKDA 3GFVA 3QWFA 4L5IA 3JQ9A 1Q5PA 4RDHA 1XUOA 4UFOA 5ERXA 5BQFA 2VDRB 2VSXA 3MINB 1HURA 1DKQA 1I24A 2CDAA 3HL4A 4OBBA 1PGJA 2Y92A 3WWEA 1KFJB 3NFRA 2NZ2A 2G9ZA 1M75A 2M6KA 3ZXUB 2Y77A 3Q40A 2QU7A 1GPNA 4JDPA 2YHSA 3QI2A 4CGYA 2H2DA 4ESHA 3TGPA 3IQWA 3PC7A 3V8NA 2OVFA 4I4CA 3MG9A 3DZ8A 1UXIA 5DGCA 1JR2A 2HRZA 1Y8RA 1NW8A 1UKZA 4GNRA 1QRAA 2JH8A 4RD1A 5IC4A 2IXFA 1K8YB 1PLJA 1XCPA 1EQUA 3REOA 1RYDA 4QC2A 3E5MA 3OPMA 4ARVA 1XDSA 2DLNA 2PAFA 1Q1QA 2ZVQX 2FSPA 1RFLA 3VV3A 1FDOA 4IJKA 2BFFA 3UHJA 5FPKA 3DZHA 3RLFA 1I2DA 2GERA 5BOSA 5DGIA 2HJRA 2J0UA 3GEIA 4Q4CA 3PD1A 3ZWOA 1CLUA 5GM2A 1GKYA 1V47A 3OCUA 3ZGNA 1ML4A 2AXPA 2R6R1 4XR9A 2O1SA 3EZYA 1EAYA 3H7AA 1VBFA 3GA7A 3FTQA 2GM5A 4OQNA 4XFKA 4BN4A 5J2TA 4NATA 4E51A 1BFUA 2PLRA 1JJBA 2DFLA 3OJOA 1L8LA 4IG9A 3CLSD 3RYFA 1P4HA 2R47A 1V25A 3EVNA 2QBYA 2R3SA 4ZC1A 3EYAA 3STUA 4PVDA 2FLVA 3AJ9A 3G2OA 4DBLC 1COWD 3QU7A 4OOEA 3V1YA 5I4IA 4X1YA 3QWAA 5DHTA 1R0SA 4G1VA 3JQGA 2PFGA 3T3NA 5A05A 3A9CA 4D0NA 4MINA 2G9NA 3UIEA 5JS2A 3H5RA 3HGMA 2WUFA 3H99A 1ESNA 1NLUA 2FPMA 2UDPA 3GDHA 4DIFA 5EZYF 1L1EA 2JFWA 2JHGA 2XT6A 1EVIA 3CLKA 1BO6A 1XPJA 4FDAA 4YRNA 2ES4A 4FFRA 4NOJA 2GD0A 5D3MB 1UOPA 2H9YA 2H5EA 2VHXA 4LJYA 4LVOA 5SY9A 4QYIB 1C2YA 4E7OA 2VH1A 1D07A 1K4KA 2BTOA 1JZQA 2RGDA 3EIWA 3EBOA 3QYPA 4W63A 2WD7A 5DYNA 3USES 2FXVA 3NUGA 3PUXA 4CFYA 3PTAA 4C1NA 1ZUIA 4ER7A 3C5HA 4V39A 3MMSA 3PLAE 4PLTA 2PX8A 2I7DA 2OGUA 1KFBB 3SM3A 1OPXA 2WIDA 2HL6A 3GWZA 1RRMA 2P2YA 5DLPA 4HHEA 5DN9A 1YDFA 3IUEA 3ESXA 1CT9A 1PYGA 1J2JA 3JR7A 3OOYA 4RVUA 3QUBA 5F76A 1UADA 2VPYA 1Z4IA 2ZPUA 4RD0A 4ZCIA 5AQ1A 2WF5A 3FYTA 1WETA 1QLHA 1B2RA 1XNJA 5GZ1A 4J0HA 1S96A 1TW2A 1OA0A 4S05A 2JFXA 3UJPA 2JIRA 1I3KA 2EKLA 2VPPA 3I8XA 2WIKA 3A2NA 2QWXA 1IMOA 4FEYA 3UICA 1UBOS 4JB3A 1TGVA 3EEBA 3LGSA 2B8WA 3FCCA 3OG9A 1SKYE 5DSZA 4E33A 3QLJA 1LZLA 5GM1A 2PKRA 1P45A 1KPIA 3NANA 3FWPA 1X1BA 2FXIA 1ZH4A 4AN4A 4MTLA 4NCHA 3RSOA 3PJDA 4CDGA 1X9HA 1GNRA 3OUTA 2GF0A 2P67A 4HNSA 4J76A 1N57A 4U7PB 3ZH9B 1HYQA 1MC4A 1CP3A 2JDID 4QARA 2A9KA 4B40A 3GG2A 3MRXA 2JHPA 3EZLA 1A7AA 1ESZA 3CPSA 5FRDA 5HUHA 4R3WA 1I7QB 1VC2A 1ULZA 4IQ8A 3A4LA 1CZOA 5ALEA 3FUTA 4V1CI 2IEGA 1ZRNA 4U0KA 3KQSA 1DAHA 2RHCA 2BZ0A 4PX5A 3RDPA 2PUEA 4WTOA 2XADA 1J8VA 1JDJA 2QKYA 3IKVA 1H1LA 3TX6A 4BNHA 3KTOA 1DO2A 2H31A 1IRIA 2LRHA 4R1PA 1EVLA 1I14A 2HMUA 3EF0A 4L9AA 3TB4A 3NB0A 3VZBA 1Q83A 1SH7A 2JAHA 3GK3A 3LPDA 3WYBA 3ZJYA 4MI3A 4DCVA 1VHWA 3HA3A 4NABA 2O3JA 3RF7A 3NOQA 1CUHA 2OHOA 3W2IA 1XZHA 3O8NA 3KB6A 1WPQA 4PYMA 1LQ2A 5KPJA 2CBGA 2O0KA 2FOLA 4BQNA 2J5BA 3VKWA 4A4DA 2ZR0A 2D0OB 2BGTA 5J1TB 3A3OA 1I2MA 3K8OE 1JIQA 1YO6A 2ZI5A 3KR1A 5AVWA 1P72A 3CPHA 4NPAA 3W4KA 5KMGB 3ROTA 3BILA 2ZCUA 1NQVA 2Z3WA 3THSA 1N6IA 1UPCA 4F1KA 3Q8KA 2A5JA 2CZCA 2YV3A 3I1IA 4XJVA 5TSDA 1EXDA 2OBMA 4PANA 4TROA 3CX3A 3IP9A 3ZLVA 1SHZA 3DZCA 3LC1O 4GAEA 1PDWA 4L8WB 4QPJC 4D9HA 1QHHB 2QNRA 3WIDA 4OSEA 5KEIA 3DVRX 3TR6A 1XEXB 3A9SA 3L9XA 2GPTA 2DRIA 3JRNA 1ODJA 3A1DA 4Q05A 3GJ6A 5ARBA 1VKHA 4G84A 4XQ9A 4YP6A 3STXA 2AWOA 2PL5A 3KVNA 4GR4A 1SCNE 2F1KA 1FX0B 2Z5VA 3K9NA 4CFZA 4DXDA 3DMTA 1GPUA 4LSGA 1UUFA 1IQUA 1ECPA 2GPAA 2PLWA 1JKJA 3B6KA 3MTIA 3S27A 5AOBA 3MCTA 3WGKA 4JP8A 3CNLA 4LF9B 4ZQEA 1JQ3A 2NYAA 2O57A 3FVVA 3G89A 4AKEA 5TE9A 2Y66A 3N5CA 2KM1A 3L0IB 2RH9B 5H83A 1Q0ZA 4C7MA 4CV1A 1WDTA 2JGLA 1GLGA 1IN5A 2QNIA 4HB4A 2IYXA 1F20A 1V6AA 1C14A 4DQKA 1OBOA 5JBNA 1LVGA 2GEBA 5J2TF 3ER6A 4LG1A 3RHTA 3NM4A 4Z0HO 1PR1A 3L07A 4XPZA 4TYNA 2I8AA 2ZJ7A 2IEIA 3R7WB 3GLRA 1U9YA 4PZAA 3W78A 3KQOA 3TOSA 1DRVA 4MA5A 3TTWA 3NAQA 3UKOA 3VMMA 1LK7A 1DQYA 1QAOA 2AR7A 2I7TA 3CN9A 4HQKA 4ODIA 3V8MA 4DMKA 2CXHA 4EG1A 4Z3KA 1YVDA 4KRXA 5ERYA 4BO2A 4K6FA 3GB9A 4HGPA 3A1NA 4LJSA 3TZEA 2AG1A 4XGNA 3GDFA 5CFRA 4L0DA 3Q5GA 1FUYB 4H3KB 4GDFA 2WUEA 2LDBA 2PS9A 1OZHA 5FBKA 2PT6A 1OX4A 4YFYA 4JY7A 4XSVA 3FJ1A 3C6BA 3O4IA 1IUKA 1JDBB 2ZJBA 1GZUA 1XROA 1XRPA 2EW8A 2FSSA 5AKXA 5TGZA 3R0XA 5BWLA 1EFUA 1SQGA 1YBMA 2C4NA 1ZUNA 2C4HA 2NO9A 2PNFA 4GI7A 5HE8A 5SYAA 3M6AA 3EY9A 3L05A 4F8EA 5DX1A 1S1CA 2PX2A 1G6KA 1ZO8A 4LKRA 5ALUA 5I45A 2I91A 2JJ1A 1C7JA 5TV2A 4WOJA 1KU0A 4O2LA 4TMKA 1T15A 3GGPA 2IY8A 3T99A 3IUPA 3F0TA 1PL6A 1ZOOA 1KK2A 3WWDA 1RR6A 4CMIB 5HKKD 2X0RA 5FOSA 3MTDA 5JMTA 1UKEA 3RKUA 1TUBA 3P52A 1KH3A 1KOJA 2FWNA 1FMJA 2QSUA 4MJ7A 4XFJA 1MJNA 4IEFB 3S8MA 4CQMA 2CHFA 4Z54A 3R5FA 3IB6A 4H1WA 4KFRA 4F9TA 2E4UA 2O2YA 3T4PA 2WZQA 3MLAA 3UK6A 2FOIA 1BJTA 1I6LA 1A9ZA 2W90A 2OZPA 3S99A 3QGMA 3HB1A 2W0SA 1FNSA 3D7MA 4MICA 3KLNA 3D4OA 1SJ9A 4R8LA 5EUBA 3SY8A 4AMYA 1IN6A 3V4OA 5EIBC 3BE8A 4BNTA 2IFTA 4EKNB 2GQ0A 1BWPA 1CXZA 5D01A 1YS4A 1ZH0A 2IODA 1GUAA 3EC1A 4UU7A 4RL4A 5BMVA 4FYYA 1SCQA 1HOXA 1PJ2A 3HCDA 2PQ0A 2YBDA 1GZ6A 2HA4A 2Q21A 3FUCA 3BGWA 4XH9B 3TPFA 3IQDB 3B82A 3PI6A 4M49A 2HYIC 3LFUA 3LLUA 2QAIA 4IOLA 4C0BA 4FNGA 4JYBA 4UNQA 5JJCA 2AS0A 4FZJA 3KHKA 4Q1AA 1O58A 4RXMA 2IHJA 3KKMA 3LYAA 4PCUA 2C9OA 2VHWA 3PXAA 1G38A 1AD2A 3REQA 2ZVPX 1XCOA 4HNQA 1GR0A 2ZBDA 1P5JA 2TS1A 3NVDA 3OLVA 1R37A 5CGQB 3AL2A 3VSEA 5JXIA 2A7XA 4FHEA 1LVUA 4OTZA 1TNDA 1XHLA 2EBWA 1KZ7B 3KQWA 2VK2A 5TPZA 3PPXA 4BLPA 3H2SA 3PHBE 5AKZA 2GYYA 1MRZA 1ZNWA 2EZ8A 2G1KA 2YXLA 3BL6A 3K8QA 2GXUA 3SSAA 5HYVA 2ZIFA 1RP1A 4UKDA 5IRCD 3KO8A 3STHA 4AG5A 4E30A 2AC4A 3KXKA 3MUEA 2A5YB 1GTJ1 1XCMA 2ZUVA 5E6SB 3U0VA 3JVEA 4QEZA 4QATA 4J4BA 4XGQA 2HT1A 3RF6A 1VHJA 2VA8A 3C0KA 1JT2A 4P31A 3WNVA 2QZPA 3NO4A 3BWYA 2V7BA 1BDHA 4BLSA 3U7RA 1R5NA 3ZZ0A 4OUDA 3BSWA 4EZBA 1P3DA 2FUKA 1I3OA 3IIJA 4JITA 4B0PA 2G17A 3BYZA 1LJLA 3V8QA 3WYNA 4CMAA 1ZITA 3R5SA 2PRIA 3EG5A 3TLJA 1E9DA 4EQZA 3GH1A 2OUKA 2OCLA 3PCTA 2FGKA 3H13A 5EJ5A 4KQKA 3P2KA 3HXMA 2NTJA 2VCHA 2XOKD 5B3JA 4HEA6 4NFLA 3TJMA 3KDSE 4IDDA 4PIVA 1WUHS 1EYZA 2PKCA 3DA8A 3HA7A 4N4AA 3MBOA 4P3XA 5DCWA 1MJGM 2GASA 3SJBA 1JPVA 4RJKA 1NP6A 1RTTA 4RVDA 1RKQA 4WNIA 2G0NA 3SPXA 2CC2A 3KXPA 5JZBA 1ZK1A 3QSYA 3NHRA 1NVFA 4OYRA 5BMVF 3PFBA 3A14A 4W4TA 3K70B 4TX1A 1G3RA 3PIIA 4CG0A 1NYQA 1KI7A 1XF9A 1L7RA 2CXOA 4D79A 4BPBA 4A2QA 1T2NA 5JDCA 3TIFA 1KMNA 2C2ZA 4EUFA 2B34A 1V1JA 1P0QA 2F9MA 2NAPA 3FG9A 2WM8A 3EFEA 4HX9A 1PD1A 1PQ4A 2FMXA 4JL8A 1ISMA 2YASA 4OJMX 4AJ1A 2DFKB 1GNQA 3FI9A 4AJJA 4B6GA 4BFUA 5CTAA 4IZIA 2R1ZA 1GUDA 3N8KA 3DMNA 2HTFA 5HBRA 3V2HA 3ZNOA 3O8QB 2BFCA 2QTHA 4QNMA 1HMPA 2G9UA 4XLLA 4R0NA 2SECE 2H2AA 4CWAA 3L4BA 1XJQA 4X6LA 4EKYA 1V7ZA 3EGVA 1SG0A 3QF4A 2I80A 4JSRA 5F7JA 2EIHA 1GG5A 4PSUA 4RPHA 2GNOA 3UOGA 1T36B 3ZDAA 4D9MA 3PE3A 5DMHA 5FWXB 5TNXA 1NI4A 1HE4A 5FTNA 1OGIA 3TAXA 2J3HA 1O5TA 3EY4A 4LJ6A 3OJFA 3UPDA 2CFTA 4LZAA 4UXIA 5EE9A 4D41A 2EFHB 2HLPA 1SBNE 3QP9A 2C9MA 5E4FA 3OC6A 4M0FA 4NR0A 1SUFA 4WUVA 1TAHA 2Z83A 1LTHR 2OHJA 4QT0A 3E70C 1JFFB 2FMIA 2WF6A 5FFFA 1RIFA 3FHJA 1GDDA 3SQNA 1NOJA 3QWBA 5K3BA 1DMRA 1ZCZA 3JQ7B 4RCZA 2O14A 1KZ9A 1BSVA 1A8HA 2AI3A 2XQKA 3TSZA 1IDN1 1Q77A 2B1GA 4QWMA 1SIBE 2R84A 2QR2A 4GLOA 4DMFA 4H60A 2YHIB 2WF9A 2WP8J 4F04A 1COZA 3PHLA 4X63A 5JFGA 5HP4A 4V24A 3OFJA 4UTZA 1PVDA 3RW9A 3I64A 3VVLA 5H9WA 1JFVA 4QGFA 2EDAA 2PRKA 4CL3A 4AP5A 1Z7WA 2EFDB 2J7PA 1O0SA 2YJ6A 4BMSA 5C5CA 3AZQA 5MDHA 1VE3A 4ECAA 1WNTA 1WV0A 3H4MA 3AIOA 3O38A 3IVRA 4BJ1A 3ROPA 2IIPA 4IGAA 5JQGF 1N0VC 1TZ2A 2AMYA 3OI7A 4Q4LA 3DW1X 4DCSA 5C7IO 1XVIA 4LY6A 2NZUG 4UXJA 1XDWA 3RSCA 2F7SA 3ORFA 4MP6A 1NV9A 3KWMA 5DBOA 3JR3A 4GZMA 3DC7A 3AVQA 3NBMA 3PHHA 4NFSA 4LRXA 3ILSA 4MO9A 1UP6A 4YRPA 5HJEA 5ITZB 1N6PA 1U9CA 1VL2A 2F17A 1QPBA 2P9TA 1BTOA 1XTQA 2A30A 2WU3A 3R41A 4EGSA 1JU4A 1XJ0A 4KIGA 2WSSA 2RAUA 4EEKA 3ZS9A 1XLTC 4M0UA 1IY1A 4HEHA 2WQZA 3ICEA 1VJDA 4JFRA 4QU5A 4F1WA 4BB9A 3H5IA 3O7WA 3ANYB 4MRRA 4GXNA 521PA 4AKGA 3DFFA 1CCWA 1NI3A 3LPLA 3U19A 1Z0IA 3MJRA 4MGIR 2PZAA 4TUYB 3WL4A 5HTOA 1L5SA 1EU1A 4LZWA 1XD9A 2TMKA 3LPCA 1SB8A 5IH3A 2ZT8A 1L5LA 3K9GA 1KIFA 5JSHA 2GMWA 1PKXA 1Z75A 2RBKA 3ID6C 3IIKA 3MD0A 1EWYA 4X8OA 5GIOE 1RWNA 3TLGB 5EIFA 3EBLA 5IJAA 3AUJB 5CBPA 3EMVA 4MI9A 4I0WB 4NZYA 4ZOLA 3L06A 2HCRA 5KNCH 4KO4S 2DZDA 1UPAA 4A23A 3LBHA 2P75A 2ESRA 4O0LA 1K0FA 3VSCA 4KU4A 1JEYA 4J91A 3GPBA 1WQ3A 2NO4A 5JD3A 3OTHA 1ADGA 1J0XO 1WZEA 4LNUB 4OI4A 2PZEA 2W6ID 2W8ZA 4HUJA 2OESA 2IEAA 4L78A 1UBNA 1AKMA 4OO3A 5DX0A 4DKJA 1O9HA 1PEAA 4G1EB 4GBJA 4FGUA 3L1JA 4QDKA 5MFPA 2XEDA 4IW3B 2WJPA 3BMXA 5C2JB 1Y3DE 4IX1A 5LZ7A 3TTTA 3I30X 4LCBA 3L7LA 3HVIA 1NXPA 1SBTA 4FOSA 4E6PA 5C81A 2Y8EA 2HIMA 2B82A 2R7KA 4GVLA 1W35A 2VZ0A 2O2GA 3EXG1 1JT9A 3LBAA 4JL6A 3A1WA 1BGWA 2GN2A 2OILA 3C74A 2H2FA 1TUIA 1BU8A 3K96A 3L0ZA 3UV7A 4GZ6A 4UNRA 1P6UA 4NBRA 5HQ3B 1FNMA 4DSNA 1XF1A 2GD1O 2AG5A 3D6AA 5KYUA 5EZ6B 3AVXA 1TK2A 1C8VB 1ZOLA 4WADA 3OO0A 1G9TA 3LRPA 2C29D 4X64B 4DOMA 2ZI9A 4D9BA 3V5NA 5J2UA 2IZ7A 1TUBB 5B1YA 2NP6A 2CSUA 1S7CA 3T3IA 1J20A 4Q9JA 3KRTA 1A5SB 3EK2A 3I53A 3L7MA 3NCHA 1Y5MA 2WU8A 1FY2A 5EN4A 1VP9A 1IM8A 3A1VA 3X1DA 4EFDA 4II3A 1JWLA 2C9DA 5EHQA 4J7AA 5IUKC 3Q85A 2GARA 2VHVA 3DE0X 2ZUTA 3GLIB 5FLXA 1NYLA 3V7YA 1PBTA 1Z36A 4IDPA 4KDFA 5KO2A 4QX6A 1NF2A 1C4WA 2BHSA 5ECYA 1BS9A 2Z6QA 1ZNQO 2D2IA 3AM4A 2J0QA 1JDSA 2NUAA 3F6RA 3QQ5A 1DX6A 4ZV9A 1WXDA 1JHVA 4UFPA 3GCGA 5BWCA 5ITVA 1UFQA 3AO0B 3PCXA 1G3UA 5EJAA 5AW0A 2OCIA 1C8KA 2QTTA 1QFYA 1XYYA 2YV5A 3KXLA 4HRVA 5JH7F 4MO2A 5MFZA 1T3ZA 1Z6PA 3P1JA 4FHGA 4MUKA 4X7BA 1TECE 2XMSA 3GX1A 4LOLA 4DG5A 3V4FA 1ZZGA 3DDSA 2H06A 3D3WA 1XTTA 3AQ4A 3IQZA 3LKVA 4ZAZA 3RVMA 1JIIA 3RYIB 3WMFA 1MRNA 1AXGA 3VNVA 2BH2A 4E08A 4HJXA 3HTXA 3ULKA 4L50A 1AIPA 1JB1A 1LPAB 1PBNA 2R79A 3K2BA 3PEVA 2IXAA 3IOMA 4I7EA 4O2AF 5ABPA 3RSFA 2HEIA 4MOWA 2QOEA 4UUNA 3SS9X 4MAMA 3VH4A 4DQVA 4ESVA 4BL5A 5BW4A 3AH8A 2C3YA 1SR8A 4J0CA 1BXRB 3GA0A 2VQFB 3P5BA 1SK8A 4KVZA 1F7UA 2XCTB 1Y3FE 3G0IA 3T7IA 4DKXA 3L4EA 3HNOA 2RGWA 3H0KA 4NCKA 1CUYA 5CP8A 4YBRA 3ZW7A 1U0RA 3RREA 2RCNA 1HFEL 1Z3CA 2GK6A 3JRXA 3JWGA 4GSYA 1N6LA 5IFLA 1RQLA 4JOQA 3DVSX 2FLWA 1CSEE 4HBGA 4DLKA 2ZSKA 1PDOA 3B9BA 1ZD1A 2AX3A 3C45A 1MCZA 4JNKA 3TE7A 3W3AH 4TWBA 4Z7JA 2G1UA 1PV2A 4K7JA 2H0QA 4LTMA 4CEHB 3NJ4A 1V1RB 2EGUA 4C0XA 4UTRA 2I1LA 1CP2A 1KA9H 3CINA 2EDCA 2XSZA 4H7PA 2GPJA 4BKOA 1QFXA 2WHPA 2GCIA 1NBIA 1ZJWA 3MILA 1BVYF 1BDMA 4O4HA 3BRWD 2P9ZA 4Q9NA 1U63A 1EGQA 1IU9A 5DLEA 5AVUA 2JJYA 2P6NA 1UJCA 2O4UX 3RYFB 2JI6A 1T8UA 3SKXA 1O96B 3R0ZA 3T7CA 3ZGOA 2B98A 3EARA 5JY1A 1GV1A 2EZ9A 2XCOA 2PNJA 4AECA 3R7SA 2VJKA 4B4KA 2BDUA 1VBMA 2Z0MA 2CJWA 1C80A 2UV8A 1DIHA 5BV2P 3I42A 1CJBA 2CK3A 2H1WA 4P82A 2Q28A 1TTPB 3QX9A 3O4RA 3Q9SA 4HSEA 4I8XA 4XE5A 3RH0A 3SOZA 2YN0A 4KQIA 3QKTA 2I2DA 2D2XA 3KYDA 3W04A 4ENTA 4OB7A 5G4KA 1FFXB 5FOQA 1F2VA 1OMOA 2G3YA 4ZI3A 1D1PA 4HQFA 1IM5A 4X20B 2G6BA 4OREX 2O05A 4MWSA 4OXIA 2ATIA 4C0AC 1NL3A 2BFCB 2X7XA 3B89A 1KDOA 5J9FA 5JI3E 5HCIA 1IBMB 1GRCA 1K66A 1OC2A 3ANXA 2OB2A 2FX5A 3OT1A 4I6EA 4J49A 3Q72A 1Y33E 3H7IA 4OXXA 4QIHA 1PZNA 5EWJA 2X8WA 2PUDA 4KREA 4KIUA 5EWMB 1F7VA 4OGGA 1MH9A 1EM6A 4HH1A 4OV6B 1GFZA 4BMDA 1QRSA 3RUFA 4MYCA 4REOA 1F3LA 3QEKA 1RQNA 3MHTA 3GXOA 1VIMA 3KJHA 4ACAA 2XNSA 1KHTA 3LP8A 4G1BA 4UVIA 4FE7A 2ZUWA 3S2GA 3T94A 4DLYA 1RS0A 1RD4A 5LPNA 2H18A 2O54A 5T6BA 5A62A 2NYVA 3Q7EA 3B5IA 4EPVA 2FF5A 4YNBA 1X1SA 3QNUA 3VHQA 4J3JA 2IELA 3OLQA 3LSTA 1GNPA 1WU8A 3N59A 1MQ8B 1HE8B 4KQ1A 4B74A 1DPFA 4I9UA 5BOVA 4C78A 4LVCA 1RM3A 3UJBA 4G5RA 2Y99A 1PO7A 3B9QA 3WJ1A 2HSJA 1PE0A 1W85A 1WJGA 4MS3B 5GAJA 5I6DA 4JT9A 3DCIA 3R5HA 3GCXA 4R3NA 2ZJ4A 1F8GA 1JP7A 1B6GA 3FH0A 3OJEA 1VG0B 1Q19A 2IF0A 5FL7A 4GKJB 1NU8A 3RC8A 4CKZA 2CUZA 2C98A 1ECLA 2D13A 4QGSA 2XUIA 4QXAA 1S2OA 3TRFA 2NT4A 1AMOA 3PQ5A 1V71A 4GLLA 3HU1A 4LF6B 1ODSA 4ZEXA 1LW6E 3KUUA 3QVMA 3ZCRA 5JADA 4ZD6A 1KC3A 2CMGA 5ALWA 2X2PA 4P93A 2UZ1A 2A7QA 4ZQHA 3MZ0A 4JBYA 4LYJA 1B76A 1E1CA 3GVCA 3FYHA 1UK7A 2P4UA 2ZBVA 4ZVQA 3ZWDA 1QS0A 2XGJA 2H4WA 2HJHA 1BA3A 2OLEA 3D6VA 3I1YA 3NOXA 4GPEA 4LECA 2RE8A 3D3NA 4DIOA 1XKLA 3PNSA 3QOWA 2VP6A 4JB2A 3UGJA 5JMWA 2Q3HA 1HRDA 2QXYA 3M3HA 3UJ7A 1B8UA 4ZV7A 3LCJA 3BDVA 4X44A 3PNMA 4JQZA 4IXWA 2YMPA 4MUFA 2YMLA 4EYEA 1AQNA 1QK4A 4KO2S 2PU5A 4KK3A 1VKRA 1A9PA 3R3SA 4FFBA 5HZHA 4Y67A 5JY6A 3BDAA 2PGOA 4ROTA 4TWJA 3IFSA 4F60A 4LJKA 2CMFA 1FDSA 1MOPA 1L7DA 1YASA 2FPGB 5KYXA 1JFTA 1FVXA 1DKLA 4X84A 5BNIA 5LYJF 2GILA 3LDUA 3TQHA 2GOYA 3U31A 2VI5A 2NN3C 1X80B 2MOKA 2VWQA 2IOFA 1XVUA 3BRCA 3I83A 3PFHA 3P96A 1D04A 4M8LA 4Q1EA 4C04A 3F5MA 3STWA 3S8EA 1ZZEA 3HY6A 3KYJB 5AI4A 2BFBB 1KSJA 3AZPA 3JQ8A 3NKVA 4Y9DA 1XRQA 3DUFB 4D3SA 2BMDA 3GEBA 3D4IA 3HEAA 4CKXA 4D4MA 3ASVA 3W6NA 1W30A 4JBHA 1I32A 1N7IA 3HU5A 1Z9BA 4H1HA 1G20B 1U5BA 2JGIA 3QEMB 3R7AA 1YA6A 5EUCA 2Y76A 4DCMA 3N8NA 4M37A 2P77A 3UPUA 1C5KA 4LXGA 1NTOA 4ZREA 3W5CA 5KYWA 4PCAA 4QFMA 4R2XA 3D4NA 5DB4A 3O8OB 4IIHA 4V38A 5JSKA 4S1WA 1PHPA 1W8DA 1XDDA 4JUIA 2CLOB 1RC1A 3ZJUA 4IEIA 5BSRA 3Q8LA 1ZQ9A 3I6BA 3D5QA 3L6CA 3QA3E 4ND8B 4WJLA 4OMCA 5CPFA 5J2UF 3DE2X 2EW2A 2PX3A 2D8MA 3N0XA 3TCKA 1U2TA 1TEHA 3NHUA 1PZGA 1GCUA 3E5NA 1GCIA 1YRQA 2HRBA 1CQJA 2HMTA 1YQGA 3GUZA 1DLJA 1OB2A 2GYVA 1F2TB 3Q6IA 2LVBA 1ISFA 3STVA 5JAMA 1VSVA 2G5GX 1ZC3A 4C4OA 1I80A 2C95A 1US8B 1YKFA 3C14C 3GDWA 7MDHA 4W9MC 3B2EA 4TL7A 2VEOA 3O8OA 1IHOA 1ZONA 3L7AA 3QI7A 1T1RA 5K3SA 3G8DA 1KYIA 5FUQA 1RRFA 2RIRA 2ZPAA 5G02A 3EXHB 3DE3X 1WY5A 4MZXA 1JJAA 2I1WA 3B1FA 1YRWA 1NUPA 3HSKA 4RU1A 2M98A 3QY0A 2YZGA 3UHOA 5IMSA 2O5VA 2FZVA 1E2GA 1GQSA 2OGZA 4FFNA 4F3NA 1YZGA 1W5EA 3D3KA 3QRWA 4NTZA 1F38A 3RVRA 3NXSA 1PFGA 4J1SA 2PSHA 4N5NA 3QE9Y 3SU8A 3GJTA 3AESA 4US1R 1FPQA 4ZHQF 3GGCA 5JNVA 4NOMA 2AN9A 1XEFA 3G2KA 5F3WB 3RJ9A 2WHQA 3JQRA 4Q9KA 1JB9A 3PX2A 1PVVA 1R18A 2HIHA 1GG2A 2GFIA 3H11B 2Q9AA 4TYQA 2MYNA 3SBDA 1T9GS 2EAUA 2XMDA 4Y0NA 1S2LA 2O50A 3MUOA 2L2QA 5EUMA 1EG7A 2V6GA 4GLFA 3TLEA 4PHHA 3H1TA 3EWIA 4EG3A 4EUNA 2JJ2A 2QYTA 1FUUA 5F12A 3A04A 3FPEA 1AN9A 2R4UA 2CMDA 5REQB 4B48A 2PZMA 4Q21A 4WZAA 4Q6WA 5K4AA 3GJSA 2VDJA 4RV9A 3H4VA 5TB5A 4BNMA 2VYVA 4YROA 5E7JA 5ARDA 4CV3A 5ICEA 5LZ4A 5B64A 4DR4B 5FJJA 4BO9A 4BWVA 1DADA 3WNBA 1NN0A 1D6NA 1XQ1A 1V41E 1Y4DE 2NACA 1IZ8A 3LLMA 5LOVF 4R6XA 4X1OA 4BRZA 5C46F 2QXTA 4DA9A 2ZWAA 4X90A 4X7RA 1IBRA 1P1FA 2GM9A 4WEOA 1M2FA 2OCBA 3K72B 1UKYA 3CB4A 3OD1A 4JOSA 1FK8A 4MX8A 2CEKA 3WGZA 4JT2A 5CH3A 3B3JA 4LOJA 4RETA 4EECA 5CDGA 1A5ZA 1QX3A 1UMDA 4WXYB 4DTIA 3FM9A 3DXXA 4JZKA 3K35A 3RNOA 3SCZA 3CRMA 3PQDA 1V26A 3AESB 3PSAA 5AR1A 1LDGA 1WCYA 4TXHA 1OGJA 2EF1A 1L3CA 4P3NA 5FBQB 1A4IA 5KOJA 5EE0A 2P7HA 1WX1A 4B3HA 3L46A 4KR3A 2HSDA 4XYGA 1VKNA 4RDIA 1E7MA 1K7CA 3CB2A 3VZSA 1G5QA 1GAJA 2NX2A 3JX9A 4BGEA 4ETNA 1JEQB 4TOIA 4YAEA 1K6IA 4M3NA 1I2CA 2QTBA 3K1TA 5I9LA 1H4TA 1V35A 4BAGA 2IXEA 3TQTA 2FSGA 3DKRA 3GAMA 5JYDA 1YVPA 4P7JA 5D8DA 1QYXA 4DLNA 4X6XA 4EI8A 3RSGA 4D74A 5IAGA 4D9NA 1I10A 3I2JA 3R23A 2IJGX 4W9RA 2DTXA 1S3GA 5GV7A 1QQAA 3ZBQA 3QEAZ 1T26A 4N3AA 4V2UA 4RY9A 4XWYA 5JAIA 2NWQA 4XWOA 3KEOA 5KNDD 2VJBA 1ZR2A 4N76A 2EU8A 3NYQA 2JFGA 1NQAO 1MZPA 3FN4A 3VJMA 3LA8A 1DJOA 2F8LA 2XODA 3O8QA 3W2EA 3MLBA 2FEOA 4KBGA 3EULA 3LCRA 3ZDRA 3HSSA 1YJCA 3QHPA 3SC2B 2B6HA 2WU4A 3GJ4A 4R0VA 3TRKA 1UMCB 3AR5A 4HO1X 4NARA 1FP4A 3EFOA 1GAWA 4DXHA 3EB9A 4HUQB 4PGAA 5DNAA 2HRQA 5DIZA 1QH8A 4FOOA 5KYGA 1CF4A 4BYGA 3RYCA 2L69A 2CWDA 4F4CA 1UM9A 5AKEA 3VDXA 5IXJA 4PYJA 4QKQA 1LSJA 1DUSA 1FCJA 3SJAA 1VMIA 5IVPA 3WRWA 2KBFA 2JDIA 3NLLA 2O8BA 4J0EA 5AW4A 1JNXX 2C1EA 2FDRA 2R8PA 4DREA 3EBPA 4ZCPA 5GZ6A 5JCOC 1A8SA 4M8KA 4L1KA 1EX6A 4MVJM 4OPMA 5F52A 1OYYA 1I13A 2C3PA 3HLKA 3IAS6 3AETA 1WUTA 5F98A 3B6JA 3GMIA 4L9WA 2X9QA 1QXSA 2BSAA 1K4YA 1KY5A 1SBQA 1E94E 1V4NA 2V8BA 3AB3A 5ES3A 1QIIA 5LKAA 4QU0A 1SRQA 1M7GA 1YQQA 2PIAA 3GD7A 4MVXA 3I9KA 3KD3A 3U80A 3WI7A 1UP7A 2BFAA 1NVTA 1G55A 3LF2A 4RPLA 1OTHA 1E1NA 3VDQA 4ZA2A 2FPIB 5LXTA 4YJ3B 3CNEA 2DHCA 2H92A 3AJ8A 3HI6A 3W9BA 1II8A 3FPSA 3P2JA 4R1SA 3SKVA 4ZYYA 1O8BA 1XYVA 1B0UA 2H54A 1KOLA 2JVIA 3TRJA 1BHSA 2NNLD 4B6RA 2FFBA 1T29A 2Z95A 3IS3A 4Y6GB 1FFHA 1RAGA 1TYAE 1Y6QA 4J0KA 5FX2A 5A3JA 2J1LA 1NQOA 4DRXB 5DLDA 1YONA 1M6VB 4HVTA 3CKYA 3CTMA 1OT5A 2O7RA 4OKNA 1OHHD 4RESA 2P9GA 4FSDA 4J0GA 3T5MA 4CLRA 4WCVA 4HUTA 5KC8A 1VCOA 3BWCA 4WCFB 4BHTA 4YJGA 3I28A 1Q0RA 4O2BA 4MIYA 2AHRA 4WIAA 4JUCA 3T95A 1W36B 3OU6A 1GGKA 4MHSA 4YJFB 1L4MA 5CYOA 4F2DA 2DPLA 3MAJA 2QP9X 3PSHA 3WNDA 4OLHA 4YMLA 1TAUA 2HX1A 1LDBA 4IR7A 4TKUA 2JGAA 1E2EA 3Q1LA 5AI8A 2BFWA 1AA6A 5IVIA 3V8RA 2NTYC 4CU5A 2Q99A 1WZCA 3A6HA 2XGGA 2B2CA 3DEHA 3LJKA 4B4WA 3KEGA 1FXSA 2Q4OA 1XALA 3QJ5A 1T8RA 1USUA 1F51E 2BGLA 3CZPA 3U3MA 3DF7A 4DQ0A 4F5WA 4FB4A 3J80A 1C3OB 2CZGA 1HWYA 1KYQA 1A4RA 4DUYB 4F92B 3BJEA 3P2MA 3TTVA 3LYHA 4YXFA 1GPYA 2JRCA 4TVKA 1PN3A 1V5EA 3RHZA 1J56A 3EFBA 5T41A 2OYCA 1Z6YA 2ZYWX 5KMGA 4BWFB 2GZ3A 4ZV4A 1EG2A 2ZROA 4F2HA 3A4IA 5LBTA 4E94A 5HHTA 1LF0A 3F5SA 3GNTA 1GM5A 1QGZA 2W6MA 3E05A 2OLJA 2FFQA 3MUNA 4KFCA 3OZXA 4JJ4A 1A7UA 3NVAA 1QDUA 3F6SA 1HQDA 3NHZA 5LIRA 4RMHA 2CDCA 1MB0A 3W1WA 1KETA 1KJNA 3P9SA 4KKXB 1E4OA 1O6GA 3MWLA 5JAUA 3NRJA 2DPHA 2DQYA 2BJHA 4EW1A 2IITA 3THOA 1SZDA 3EVBA 2PSDA 1A9XB 2BYTA 3I9FA 3F7MA 3AHEA 5A4FS 1CU1A 1QWOA 4C87A 2ZYHA 3HNRA 3KSUA 3R9XB 2NAFA 1JDTA 1TJNA 2ZVJA 3W8FA 4OBWA 3QIAA 2ZSBA 2D2FA 3M6MD 4B46A 1DEXA 4FC7A 3SFZA 2R97A 1T3TA 4KC0A 3IERA 1FLAA 2P2GA 2Z5LA 5BQOA 4DMHA 1FEZA 4D4HA 4F5EA 1XI2A 1A7JA 4R4JA 3I9JA 4EG7A 4YAOA 2Y1DA 4GVPA 5IDYA 3UZUA 1DAPA 3I09A 4YAIA 4AMBA 1OX4B 1IBCA 4LRTB 2G1JA 3NOVA 2RI6A 2W7TA 3ZUPA 3VTFA 5KTPA 3KDPA 4HDRB 1EVKA 2CLMB 5FLYA 5KKAA 1U4NA 4ARUA 2DH5A 1Q21A 3L7IA 4IUBS 1FYWA 4ZOQI 1LC3A 1EIWA 5IYZF 4RMIA 2BN4A 3DBOB 4F4IA 3AHDA 3SDSA 3T3HA 4CG3A 4PHGA 3T9CA 1IVYA 3KJIA 3TXAA 3FMIA 4FSXA 4G2TA 4IHJA 3TFOA 2XE6A 1NI5A 3VNBA 2DH6A 3WYEA 2CYAA 2BGKA 2ACVA 5ICMA 1GTVA 5K9ZA 1FLVA 2NZXA 2BGUA 4OOFA 4C3OB 1IHYA 3O82A 3I2IA 1SB9A 1UMKA 3C3JA 4RTPA 4NYJQ 4DM7A 2C4WA 3U7FB 2IS6A 1J4AA 3PWTA 1XTPA 1WKVA 4JR2A 2Q6LA 2YWBA 4JBWA 5A4JA 2ZKLA 1P5HA 1G0NA 4Z9BA 4MLZA 2C0PA 2Y1WA 4EKEA 5KJ1A 4WD3A 1QP8A 3M6UA 4QXQA 5JMOA 3V2GA 2E85A 5F7OA 1FMFA 1RXWA 3FNFA 1S8FA 3BIWA 3C7AA 3MN1A 4TWRA 2IS1A 2YICA 3I9V6 3S40A 2GWHA 1BC5A 2EX0A 2J32A 4I5IA 5DVZA 3G79A 2CNNA 3GJQA 2AVDA 1CX9B 2ZE5A 4EG0A 5A9SB 3UMYA 4GUAA 4ER0A 3DC2A 4DEXA 3EQ9A 5E1BA 2AJLI 1NWCA 3O0TA 4IVRA 3AF1A 4BCBA 4GP7A 4IDEA 2C2WA 4HYYA 4O2RA 5F1OA 5D87A 3GYGA 3LGAA 5FCDA 1JEOA 1MNAA 4LQ4A 4JK3A 4AY3A 3H2BA 1YOVB 2NO1A 2B4KA 1CULC 3OTIA 4NCNA 5TPZD 4OFZA 3PR1A 3CSDA 5B57C 1XU9A 4EY3A 2C5GA 3RK0A 1MOZA 4NESA 4QVIA 5IVKA 4CDMA 4XIYA 1V43A 3HWWA 1QCCA 2QLLA 4QJIA 5EJGA 2J3QA 2Q3FA 2H4ZA 1KQFA 3QOFA 1WP4A 5FA6A 4QDZA 2O48X 1RVV1 5K99A 1LVHA 4TZTA 1ORRA 2X8JB 3LC2O 3MJ4A 1SXPA 3ND6A 3T0FA 4RVSA 2GN9A 2VJAA 3GT3A 5IBQA 5J5AA 2JLWA 1G8GA 1CEXA 3DWFA 4CFSA 4ZN6A 1R64A 3GGDA 4IHAA 1P80A 2BLNA 3AUTA 2J59A 2XT9A 3NVMB 5FUYA 4IQGA 5C8YA 3IMGA 1OAOA 3GY0A 3KELA 3MQ4A 4TMFA 4C4AA 5JPDA 4PRKA 2VSOA 1TZBA 4MRMB 1DAIA 4PLVA 4DLSA 1ZAKA 2JGKA 1LLDA 4I6GA 4C5CA 2IYTA 1ZM7A 2DT8A 4YVFA 3RM3A 3GZJA 1M2OB 3FMFA 3IAUA 2QVGA 4NJEA 4Y1GA 1HNWB 4I4TF 4AJPA 4IICA 1MO5A 2XYVA 4LI0A 4D44A 3G9XA 3TSWA 4K9NA 2NP7A 1RFGE 1EBBA 4WQMA 3INNA 4E07A 3BB4A 3I9LA 1MB3A 4M1EA 1WM1A 2GXAA 3Q3CA 4RV4A 3TSYA 1T3LA 3A25A 4O4JF 3IGFA 4P2BA 3TOVA 1CZNA 3E9DA 1P2SA 2QLFA 3E9MA 3K0CC 3TVTA 2X3YA 1OXVA 1DS6A 2B36A 3UBMA 5ELMA 2DUNA 3HRHA 4J16A 2AMLA 4BU1A 1H2EA 3R77A 5HDBB 1UM9B 4YMSA 3B1JA 1P0FA 1IPEA 1XZFA 4Z9FA 2FZCA 3RUHA 5E9QA 1TYEB 4FHCA 1MHTA 3WAJA 1NMQA 1PGNA 4RJLA 1XNQB 3L7JA 1M3SA 1GKLA 1DT3A 3TNJA 4JVLA 2G28A 4QTUB 5KYYA 1CW2B 3WLOA 4AUNA 4XX1A 1WBBA 4JV5B 4Z4QA 4Y2SA 4D42A 1TUEA 3OESA 1I1HA 1QCDA 2AFRA 3OCJA 4HUQA 1V1RA 1DBSA 1YV9A 2QN3A 4QUHA 5IJ0B 4CIDA 3VKHA 3QUTA 4WK0B 2EKQA 2BEKA 3RC9A 1NNI1 1GRNA 1XVTA 4JJ7A 5LP6B 2QR5A 4JC5A 4RMJA 1B1AA 1N6NA 4LZZA 4QSHA 2QYOA 4DV6B 3GEDA 3DOOA 5IT0A 4YJDA 4MEAA 3IULA 4BX8A 1E63A 3WA7A 4O1MA 4X65B 2VDVE 5IKPA 4YJ3A 4YPFA 4LF5B 4UHKA 2IUYA 4XWTA 1I2ZA 4EHKA 1B1CA 1ZUHA 2P5SA 5F1YA 5IXSA 1D0VA 3AEQB 1M1YE 2F2TA 3F9IA 3Q6NA 2Y0PA 2OHHA 2UZAA 4YR7A 4G5YA 1WPRA 3OEHD 1R16A 4KLAA 1WXQA 3UWKA 1HLDA 1K0UA 4F9EA 721PA 2CNWA 2I4IA 4HDQB 2DHRA 4IUYA 1G4UR 1ZXLA 2Z2YA 1QVAA 4ITRC 1PT6A 2XGSA 4G4GA 5I48A 4LOIA 5A6VA 4RZ3A 5F9HA 2HJSA 3ROKA 2QUJA 2PR7A 1R88A 5ITWA 5DM4A 5TMPA 1DG1G 3MWYW 5LZ8A 2K7ZA 2YVLA 2ETXA 4H0NA 3ETJA 5CAEB 3P19A 4JUBA 3MCVA 2W0MA 4QDXA 4HTFB 1N4DA 1Q7TA 1RAEA 1KDRA 3PLNA 2WFAA 3U6BA 4G89A 5E4TA 2XZOA 1PRYA 5CHYA 2XPCA 4X60A 5DM0A 2HWWA 2J45A 1JIJA 1TMYA 1BWQA 1V8DA 3E7DA 4LMPA 3KJZA 1Z7YA 4RD6A 4WL0A 5DTRA 5FEMA 3VTKA 5DASA 3OMXA 3GRFA 4PWYA 1WZ2A 1MVNA 1C7ZA 2ZBRA 1W9MA 4WLFA 1OFVA 1C1XB 1P2FA 5E9AA 1NAHA 2CE7A 2CXUA 1UDWA 3CW2A 3DOUA 4HLUA 4KYUA 4LYDA 2V4ZA 3N2GB 4NU6A 1UT6A 2D4HA 4UEOA 4W8GA 4PLCA 4I9HA 2V7QD 3MYRA 2GESA 3HR4A 4MS3A 2AFIB 5THQA 5KVQA 4FFMA 1HXHA 4E2YA 1EUCB 4PINA 2V3CC 1VBKA 2F90A 3CLVA 1VBNA 1ONPA 1GZ7A 1D2RA 1DP4A 5LSAA 1FPMA 3ZIDA 2B0JA 4WY5A 4BKRA 3ERCA 4GH5A 4UDNA 5DRTA 1FNNA 3C39A 3TXXA 4OAQA 2CFCA 1YFZA 1TJ3A 1OFGA 2R4QA 5LA6A 2IK8A 4Q1FA 4TT3A 3WYDA 4J7UA 3ZY4A 3L01A 1XQ9A 3PDCA 3LXUX 1A2OA 3BBLA 3KPVA 3QBTA 2VAMA 4GM4A 5CFZA 4ZCMA 5HF8A 3GRZA 4HMQA 2I3GA 4K2HA 3AJAA 2FX3A 3IP6A 4M9UA 2GPBA 2GRAA 2IXGA 2P91A 1WXWA 4WXRA 3Q9LA 3IH5A 5BYAA 4GP6A 2W6PA 1VLQA 4GYJA 4ERNA 3F46A 4CEJA 2A1UB 5HG0A 2Z5FA 1TQ6A 1VRCA 2P8JA 2ZSAA 3O94A 1WB5A 2W98A 5K0JA 1O87A 2G63A 1ENYA 1S2NA 3B6EA 5CH5A 3JQPA 2PLNA 1V9SA 3R20A 1L7XA 3VYWA 1B7GO 4IL5A 4OQYA 5HXAA 1QBGA 5U1PA 3O03A 1WOMA 1OROA 3AI1A 2DEUA 4HYEA 2H5IA 1PZHA 4BV9A 3LCCA 3WK5A 2WUDA 5JAZA 5EP1A 3D8RA 3PBKA 4KAXA 3F47A 2WP0A 5K7SA 3PC8A 5CT4A 2VA9A 2ZE6A 2CD9A 3E1SA 4FU0A 3DTVA 1E32A 3G6WA 2PKEA 1N8TA 2BEVA 3IPYA 1X74A 5F4BA 5LA6B 4RLFA 5C53B 2A4KA 1TM1E 2V0NA 3JZMA 4G56A 4MPRA 3PNQA 4C4ZA 3AT1A 3ZW8A 1FSZA 2JARA 2VRCD 1FVOA 2Y3IA 3IV9A 5K3AA 4DEYA 3B3AA 4L5BA 4DQDA 1XZKA 1ES9A 2I8CA 2O1EA 4OL9A 3V7UA 2LE0A 5KU1A 2XRZA 3GN1A 1YVEI 4ND3A 1DQRA 3UJAA 4MPJA 4UTOA 4TWZA 5AUQA 4A26A 5F7XA 1GZHB 5F5XA 2Z9BA 4G5GA 1O5OA 2ECKA 4I1IA 4X3PA 1OY1A 2X86A 5EAIA 3KWLA 4KNVA 4HD8A 4YRQA 1ZJ4A 5EHNA 2HK6A 2BFBA 3JQ8B 5HGJA 4XDHA 3TJRA 2FPOA 2OP1A 4YLGA 3VJRA 2WC1A 4X71A 5ALKA 4C1BA 1CZLA 1GGHA 4RGQA 3SWWA 1DEKA 3ZDBA 2O2DA 1C9DB 2R6AA 3PC8C 3O47A 4TTVA 5EMLA 4EA8A 1UC8A 2NZWA 4WLNA 3I73A 5D5PA 3W0LB 4F5YA 3LK6A 4RPCA 2OBBA 4YLYA 4B81A 3PKIA 1A9XA 2QAGB 1R8SA 1H0KA 1QLWA 1BQEA 2MR6A 2HHLA 2R66A 3K0KA 3MJHA 2AW5A 4OFBA 4UHCA 1US8A 5EUQB 4FWBA 4MEBA 3RTAA 2QSYA 1MFZA 4INAA 1M8FA 4CM4A 3TNFA 1YR9A 4HQRA 5JHHB 3M9XA 4WN9A 5FADA 5E7MA 3ROGA 1K3FA 5FV4A 1C1YA 3LY8A 2UVQA 1JQBA 4I1SA 3FNHA 2IDZA 5JALA 1CRQA 4RSHA 2J3IA 2JFVA 1QYWA 2WKSA 2VTBB 2W2VA 2HB6A 1UAGA 4UDYX 2OG1A 3LECA 3BS4A 3SLKA 4HT3B 1D1QA 3K92A 1WY7A 1D8TA 1PEDA 1U8FO 4O0MA 2DR0A 4GYYA 4KWHA 3R76A 1EHYA 2F8MA 2J0VA 3Q3IA 3O75A 2VTEA 3TPCA 1TVMA 3DSRA 3FHOA 3K31A 3IYLW 4DIEA 4PNEA 4CM9D 4R0MA 5FWYA 5FTLA 2FSHA 2Q1TA 2YW2A 5AOVA 2DJ5A 1ETHA 4FXOA 5BMVB 1QTIA 2BY4A 3ROMA 3ZYZA 3AERA 1L5MA 3QE3A 3UXHA 1JQ5A 5IUJC 4RQUA 4HB2A 2PBZA 4B7CA 3VU3A 2PJUA 1SRRA 4QAQA 3KUXA 3F1KA 3LBFA 3KKZA 1YNOA 4YT5A 1G59A 4KLZA 1R0ZA 3ZZMA 4LXIA 2JHAA 2NVBA 1RM5A 4B4OA 2NUBA 2QZSA 3U7IA 6ADHA 1EHCA 4EI2A 4RFLA 1FMLA 1TRKA 3N3BC 4LYGA 3PPIA 2YJZA 4M55A 3NGLA 3OLXA 3UJDA 3LBIA 1AO0A 2IZ1A 3DHWC 1L5GB 1HQYE 3GL9A 1D03A 2IPMA 3M82A 4OQZA 4CG1A 3PPYA 1DQPA 2DMRA 3R3UA 5T8KC 5H4GA 3TL6A 3WB1A 3O4HA 3W06A 3ROXA 3W2HA 1TKCA 4N65A 2KX7A 1UFOA 3PF8A 1BNCA 3F2VA 2C4UA 3IAEA 1I1QB 4CF4A 5JD5A 3DXYA 4FYHA 3L8HA 2YXBA 2NO6A 1W36C 1HK7A 2ST1A 3G5AA 4G97A 4A7PA 4C88A 1A7KA 3PI7A 3SP1A 1V1MB 3AQIA 4HI0E 1XTSA 4Y6OA 2ZT7A 1LKZA 5F35A 1HEIA 3A3KA 3GLUA 3HDQA 2QR3A 1GVNB 3N8IA 3NYWA 1BKYA 3CURA 1U7DA 3IKMB 4KIWA 1X1CA 4TWAA 4L27A 3OURA 1BEZA 4YUVA 2WY2D 3U7EB 3X2SA 4B7UA 4G5SA 3H2KA 1UKCA 1ZHFA 2VK4A 4NE7A 2KBEA 4H6VA 3W77A 1BJRE 2BKAA 1JZTA 3JYPA 4ZZ2A 2BZSA 4HEJA 4ND4A 1X92A 5CA0F 1L7QA 4LC1A 3ACCA 3K73O 1JSCA 4ME6A 1Q1AA 2OG2A 2OKGA 4AJ9A 5HS4A 1CF2O 3IHWA 3WXBA 2VWPA 3R74A 5G4LA 3KHUA 3IMCA 4Q01A 1ST2A 2WNIA 4RA9A 1SQSA 3E9QA 1SOUA 4XPIA 1J9EA 1ZEMA 2BTQA 2P27A 3PICA 4MWEA 2GZRA 4L0QA 1NQWA 2IYFA 3H0EA 4NMHA 3GCDA 3VZPA 4BN5A 5CDSA 1AS3A 5DX8A 1C9NA 4JJFA 3WGLA 2POQX 2WM3A 1PNQA 2YINC 3AUFA 5FKJA 3WSWA 1CHNA 3ZKAA 2JLSA 1MG5A 2RDMA 3VRHA 1R9NA 4WJZA 1W75A 2CBZA 2X40A 4P5DA 3V33A 3WK6A 5LQRA 4MQFB 3PK0A 3I9V1 2FPLA 2LKDA 3QBEA 4KQWA 5CK4A 3STYA 1ZD4A 4ZT4A 2ARKA 1XLVA 3EQ2A 1P6QA 3BX1A 1JPNA 1P7WA 3HJTA 5JR3A 3AGQA 3FHTA 4V0NA 5K0TA 4XTRA 3ZWAA 3GVPA 3R0QA 4M38A 2JPDA 1ARZA 3QUAA 4L5YA 4K9DA 5DH9A 1TEXA 1MV8A 4ZAXA 3RS0A 3ZE9A 4HL6A 2HRDA 4R2HA 4P53A 4XDYA 8ADHA 4MVWA 2GSWA 4LI3X 5H3HA 3ZQ6A 2GGSA 1SVOA 5AO9A 3Q1KA 4DCOA 1X7WB 3OAAD 4AAYA 4LRSB 3TTYA 3EASA 2RAFA 2UVPB 4LXXA 3EXFB 3VYRB 2GNAA 4Z9YA 4QBGB 4CUJA 2GCGA 3E2MA 2AFHA 3FBTA 4LJ7A 3E23A 2VTDA 1MVLA 4U2FA 3UA4A 2D62A 3ZKWB 4DC0A 5A1JA 1KWKA 1H4SA 2BONA 4YMUA 3ECAA 1EUYA 3CVWA 5BN1A 2VG8A 1CS0A 5E4JA 5LC1A 2ZRMA 5BW5A 1HDIA 3DO6A 3G17A 5CDTA 4JXXA 1UKAA 3B1YA 4PZUA 1Z5PA 4CF7A 2WJAA 4BNDA 1KBZA 2AT1A 4R16A 3IEKA 1N7JA 3PQEA 1M34B 4HJRA 4V03A 3SX4A 3U39A 1SBCA 2OMEA 3CZMA 3NWEA 3Q3HA 3CF0A 4GC5A 4TV9B 2JAOA 3VU9A 5K2OA 4DA4A 4EYGA 5EP4A 3S70A 1X3LA 4LCJA 1D0SA 2EBFX 4J1TA 2JFFA 3BFXA 4GI5A 1NBMD 1GGVA 3BQ9A 2EX4A 3MA0A 3NM6B 4YGXB 2W8BA 5GONF 4ZYXA 1H23A 3PRHA 4RDCA 4RW0A 1V7CA 1FTQA 4FMDB 1QORA 1H9AA 5AHWA 3UJHA 5EEGA 5CLLA 1OVMA 5ADUS 3PHIA 2JH3A 2O8DA 2ZLBA 1PFWA 4V0RA 1T3HA 3ESDA 5BWNA 3BDIA 1OI4A 2I6XA 4DLBA 3IUNA 1NW3A 3V8PA 1KEVA 2A59A 1ZOPA 3BREA 1XEXA 1JQAA 1XZAA 2IXDA 2XE8A 2JAWA 3EOZA 2F67A 4KSCA 4WN3A 2WWYA 1AB6A 1UBGA 2GPWA 4M54A 1M6HA 3QY9A 4YXWD 4HQ6A 4OHFA 1LH0A 5AK5A 2X5NA 1E1RA 1JMYA 1F6BA 1SEPA 3CNNA 1E59A 3I01M 1Z0FA 1JR6A 3AY0A 4KQJA 2QQ5A 5EIXA 2C31A 2BBSA 4CIWA 4BV8A 3EHDA 2IYEA 3TLMA 3ZVNA 4J2HA 1KQNA 1A2QA 1BYUA 2O0MA 2RIPA 3QPUA 3WB0A 2C88A 3ETEA 3RTGA 1WPGA 1KK0A 4XUEA 5K3OA 1E3JA 1V95A 4ALLA 4MCJA 1QDEA 1YFLA 1MP0A 1PWZA 3JASA 4LZNA 4JP1A 4XRRA 4AO6A 4ZVMA 3FCAA 5DM60 3IOBA 2OBLA 1K7YA 1XX6A 3TUIC 3EH1A 1BE1A 1UDXA 1GZSA 5DYWA 4PZLA 2MSEB 4L85A 3AV3A 3U4QB 1XXHB 5MN5A 1N6RA 1T5TA 2ID9A 1VB5A 3KHSA 4QAJA 4PC1A 4RL6A 5DP2A 1RWMA 3A58B 5TARA 3CRZA 5HIKA 1XZLA 1O57A 2CF6A 2QN1A 3L8DA 4PZZA 1ZMRA 1IFXA 3V1TC 2HXYA 1QAQA 1RKXA 3FOAA 1U4OA 2XAUA 3OWXA 3PRKE 3QUCA 1ISPA 5MN6A 2Q6TA 2BKUA 1QIGA 2OGTA 1OUMA 3PNOA 3NFYA 2FYTA 3RV4A 1Z07A 5KDOA 5ENDA 4FEGA 2F62A 3ZEAA 3ZCTA 3JVUA 5FBZA 1OILA 3UG7A 3ZIAA 1I7LA 3CZRA 2EEZA 3T54A 5KPDA 1E7QA 3B20A 3DV0A 1DEHA 2FWBA 1Q0SA 3BGVA 4KXUA 1MAWA 5FWNA 3BERA 3R6LA 2Z6UA 3E1KA 2FEPA 4S1VA 1VLZA 4CKWB 5BV1A 1WB4A 2XYRA 4LWPA 4ZXFA 4G23A 5JLAA 4JSYA 5K8TA 1XD8A 1T0BA 3D2CA 1U7TA 3FR8A 4RFSB 5GMOA 3CZQA 4KGDA 2NSJA 3D6HA 4Y3UA 3WK4A 4E70A 3CISA 5KTNA 1L1FA 2O9JA 2VYVD 3E3MA 4MB0A 2PT9A 1QGED 2ID7A 2CL6X 4W9NA 3V4LA 1YS2X 3GQBA 4OJKA 4EQ6B 4EM6A 2XR1A 5B5SA 3I0MA 2EC5A 4BRUA 4F7WA 4M76B 2O8CA 1O77A 1WHSA 2OQIA 2RGNA 2QTAA 2BH9A 4E1VA 3DV0B 2DT5A 4L5AA 2PHZA 3VO2A 4H7DA 4P4TA 4QREA 5KUTA 3K2IA 2GJ4A 2OV3A 3VZRA 5BPFA 5AW7A 4UHEA 3KJGA 4XD2A 1AGXA 4AJKA 1C9JA 2PWZA 4JYMA 5TDHA 4MPDA 5A9SA 3IDOA 1P0IA 3EAFA 1X87A