3MGRA

Binding of rubidium ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrA00
4ZUXD 3AZLD 3REIC 3AZIC 3AN2C 3MGPB 3UTAB 1KX4A 3V9RB 3TU4C 4LD9A 4UUZA 3B6FD 1M18B 4R8PA 3MGRD 1H3OA 3VH6A 5GT3C 3WAAD 4Z66B 4G91C 4J8XC 4X23D 5B1LA 3C1BC 2CV5C 1B67A 1A7WA 4J8VA 5BNVA 3AZFD 4KGCA 4WU9D 3UT9D 3AYWA 3MVDB 3WA9D 5BO0B 5GXQA 5BT1D 1ID3B 3AZHB 3MNNC 1S32D 5E5AD 3AZMA 3B6GC 3C1CA 2BYMA 2YFVB 4CAYB 5B0YD 3AZKC 5B24D 3O62D 1P34D 5AV5A 3W96D 3VH5A 5AV6A 3MGQA 1P3FC 1HQ3B 1P3ID 1KX5D 5F99D 3KWQA 1P3BA 5AV8D 4G92C 3AFAB 3A6NC 3X1UB 3AV2A 3X1SB 3UTBA 3NQJA 5AV9A 2FJ7C 1P3KB 1F66D 1P3GD 2NZDB 5B31B 4J8WB 1JFIB 3W97A 1P3AB 4WU8D 1P3PA 3WTPB 1EQZB 5GSUB 1P3OA 4XUJC 3X1VB 1P3LA 1KX4C 3MGSA 4Z66D 4LD9C 3AV1B 5B1MB 2AROB 4R8PC 4ZBJB 5B2IA 3MVDD 3VH5T 1ID3D 4Z5TB 2JSSA 3B0CW 4H9PA 5AY8A 3AZEA 3AZJA 5CPKB 4J8VC 3AN2A 1ZLAB 4KGCC 3AYWC 5GXQC 4M6BA 3AZMC 3C1CC 3LZ1B 3R45A 4YM6A 1HQ3D 1TAFA 1M19B 5B1LB 2HUEB 5AVBA 5AV5C 5AV6C 3MGQC 3X1SD 4XZQA 2NQBC 4H9QB 3KWQC 1P3BC 5JA4B 1KX3B 5BNXA 1P3FD 4X23B 3MNNA 1P3KD 3AV2C 1HTAA 3UT9B 2HIOB 3B0BA 3UTBC 2NZDD 5FUGA 3KXBB 5AV9C 5B31D 4J8WD 5E5AB 3X1TB 3WTPD 1EQZD 4JJNB 5B0YB 5JRGB 5DNNA 2FJ7D 1P3MB 3W97C 5CPIC 1P3PC 5B0ZA 3X1VD 3REHA 1KX5B 3AV1D 2RVQC 3AZGB 5B1MD 4H9OB 2AROD 5B32A 1R4VA 5G49B 4QLCA 1P3LC 3WTPE 1M1AA 3MGSC 3WKJB 3KSYA 5CPKD 1AOIC 5GT0A 5B33A 5B40B 1ZLAD 2IO5C 3W98B 1P3OB 1TZYA 3LZ0B 3LELB 5CP6A 3AZEC 5AY8C 3AZJC 4HGAC 4YS3B 3LZ1D 4WU8B 1M19D 5B1LD 1F1EA 5B32G 4KGCD 4NE5A 5B2IB 4DRBA 5AVCC 4YM6C 2PYOA 3W99A 3RELB 2YFWB 3AZMD 1KX3D 3REIB 3AZIB 4KHAA 5AVBC 3AN2B 4H9RA 5B2JA 4H9NA 4J8UA 4XZQC 1M18C 2HIOD 4WNNB 3TU4B 5DNMA 1N1JA 5AV5D 4KUDA 3KXBD 1WWSA 4NFTA 3R45B 3X1TD 5GT3B 3NQUA 4JJND 1U35A 3KWQD 1P3BD 5JRGD 3REJC 4G91B 1P3MD 4J8XB 3C1BB 3AZNA 2CV5B 3B0DC 4ZUXA 3UTBD 3AZLA 4Z2MH 5DNNC 2NQBA 5BNXB 3AZGD 3MNNB 3B6GB 3AZKB 1BH9A 5B0ZC 5KDMB 3REHC 3B6FA 3WKJD 3MGRA 2F8NA 3WAAA 5B40D 5B32C 1P3FB 3W98D 1P3OD 4QLCC 3LZ0D 3LELD 4E44A 1M1AC 3AZFA 4G92B 4WU9A 4YS3D 3VH6T 3WA9A 3A6NB 2BYKB 5GT0C 5B33C 5CPIA 1P3LD 3MGSD 4EO5C 1TZYC 1S32A 5CPJA 5CP6C 2FJ7B 2F8NH 5B24A 5B2ID 4AWLC 1P34A 3W96A 3RELD 3AZED 3REKC 2F8NG 3REID 3AZID 3AN2D 1P3IA 5GSUC 1B6WA 5F99A 1AOIA 2PYOC 5AV8A 3KUYA 3W99C 3TU4D 4CSRA 4XUJB 5B2JC 5GT3D 4J8UC 1Q9CA 1KX4B 2F8NK 4LD9B 5DNMC 4KUDC 4J8XD 1F66A 4UUZB 3C1BD 2CV5D 1P3GA 4R8PB 1H3OB 4XZQD 5AVCA 1U35C 3MGPA 3MNND 3UTAA 4H9RB 3LJAC 3B6GD 3AZNC 4J8VB 3V9RA 5BNVB 4KGCB 3AZKD 4ZUXC 3AZLC 3AYWB 5GXQB 1M18A 3AZMB 3C1CB 2BYMB 4Z66A 3B6FC 3REJA 3MGRC 5AV5B 3MVDA 3WAAC 5BO0A 5AV6B 5B0ZD 3A6ND 3MGQB 3AZHA 2NQBB 3KWQB 1P3BB 3AZFC 5B32D 4WU9C 3WA9C 3AV2B 4DRAA 1S32C 3UTBB 5CPJC 3NQJB 5AV9B 1HQ3A 5B33D 5C3IC 5B24C 3O62C 1P34C 3W96C 3AFAA 4XUJD 3X1UA 3X1SA 2LY8A 1P3IC 5CPIB 3W97B 5F99C 1P3PB 5AV8C 3KUYC 1KX4D 1BH8A 4LD9D 1P3KA 4R8PD 2NZDA 5B31A 1JFIA 1P3LB 3MGSB 1P3AA 3WTPA 1EQZA 5B2JD 3REKA 1F66C 1AOIB 4J8VD 4J8UD 5GSUA 1P3GC 2IO5B 3AYWD 5DNMD 4KUDD 5GXQD 5BS7A 3MGPC 2CWEA 4H9PB 5AY8B 3UTAC 3AZEB 4HGAB 3AZJB 3C1CD 3VH5W 3AV1A 3B0CT 2AROA 5AV6D 3MGQD 5AVCB 4Z5TA 4YM6B 4Z66C 1TAFB 5B31G 5CPKA 2NQBD 4NE6A 1ZLAA 5AVBB 3MVDC 3LJAA 3AV2D 1ID3C 3AZHC 4XZQB 2F8ND 3LZ1A 5AV9D 1M19A 4Z2MG 3REJB 1WWIA 5FUGB 1HQ3C 3W97D 5CPID 3B0DB 1P3PD 4H9QA 5JA4A 1KX3A 5CPJD 5DNNB 4X23A 4H9SA 3AFAC 2RVQD 3X1UC 3X1SC 3UT9A 2HIOA 5B0ZB 3KXBA 3REHB 5E5AA 3X1TA 1P3KC 4JJNA 1AOID 5B32B 5B0YA 5JRGA 3KUYD 2NZDC 1P3MA 3O62A 5B31C 4QLCB 4J8WC 1M1AB 1P3AC 5AY8D 3WTPC 3AZJD 1EQZC 5GT0B 5B33B 1KX5A 3AZGA 1BH8B 4EO5B 1TZYB 5BS7C 5CP6B 4H9OA 4NE3A 5G49A 3X1VC 4E45A 5AVCD 4YM6D 4AWLB 3WKJA 3AV1C 3MGPD 5B1MC 3UTAD 5B40A 3REKB 2AROC 5AVBD 3W98A 4ZBJC 3LZ0A 3LELA 2PYOB 4Z5TC 1M18D 3W99B 5CPKC 4YS3A 1ZLAC 4KHAB 4WU8A 5CHLB 5B2JB 4H9NB 4J8UB 3REJD 5DNMB 1N1JB 2L5AA 4KUDB 3LZ1C 3AZHD 3RELA 2YFWA 1M19C 3NQUB 5B1LC 4WZSB 2HUEC 3REIA 3AZIA 1U35B 5DNND 1KU5A 3LJAB 3AZNB 4WNNA 3TU4A 4ZUXB 3AZLB 1KX3C 1ID3A 3REHD 4X23C 4H9SC 5GT3A 2YFVA 4CAYA 3UT9C 2HIOC 1BH9B 4J8XA 5BT1C 3KXBC 3AFAD 4QLCD 3X1UD 3C1BA 2CV5A 1M1AD 3B6FB 5E5AC 3MGRB 2F8NB 3X1TC 4JJNC 3WAAB 5GT0D 5B0YC 5JRGC 1P3MC 1TZYD 3B6GA 5CP6D 3AZFB 3AZKA 4WU9B 5KDMA 3WA9B 1KX5C 3AZGC 1P3AD 1S32B 5CPJB 3VH6W 3REKD 1P3FA 5C3IB 5GSUD 5B24B 3O62B 2PYOD 3WKJC 1P34B 1ULYA 3W99D 3W96B 3A6NA 4J8WA 2BYKA 5B40C 3W98C 1P3IB 1P3OC 5F99B 3LZ0C 4WV4B 3LELC 5AV8B 3KUYB 2FJ7A 4YS3C 4CSRB 1BFMA 4WU8C 4Z5TD 3X1VA 1U35D 5B1MA 1F66B 5B2IC 3LJAD 3AZND 1P3GB 3RELC 4XUJA
chains in the Genus database with same CATH superfamily
4ZUXD 3AZLD 3REIC 3AZIC 3AN2C 3MGPB 3KFUG 3UTAB 1KX4A 3V9RB 3TU4C 4LD9A 4UUZA 3B6FD 1M18B 4R8PA 3MGRD 1H3OA 3VH6A 5GT3C 3WAAD 4Z66B 4G91C 4J8XC 4X23D 5B1LA 3C1BC 2CV5C 1B67A 1A7WA 4J8VA 5BNVA 3AZFD 4KGCA 4WU9D 3UT9D 3AYWA 3MVDB 3WA9D 5BO0B 5GXQA 5BT1D 4UPKA 1ID3B 3AZHB 3MNNC 1S32D 5E5AD 3AZMA 3B6GC 3C1CA 2BYMA 2YFVB 4CAYB 5B0YD 3AZKC 5B24D 3O62D 1Z2CB 1P34D 5AV5A 3W96D 3VH5A 5AV6A 3MGQA 1P3FC 1HQ3B 1P3ID 1KX5D 5F99D 3KWQA 1P3BA 3EPLA 5AV8D 4G92C 2G5HC 3AFAB 3A6NC 3X1UB 3AV2A 3X1SB 3UTBA 3NQJA 5AV9A 2FJ7C 1P3KB 1F66D 1P3GD 2NZDB 5B31B 4J8WB 1JFIB 3W97A 1P3AB 4WU8D 1P3PA 3WTPB 1EQZB 5GSUB 1P3OA 4XUJC 3X1VB 1P3LA 1KX4C 3MGSA 4Z66D 4LD9C 3AV1B 5B1MB 2AROB 4R8PC 4ZBJB 5B2IA 3MVDD 3VH5T 1T3UA 1ID3D 4Z5TB 2JSSA 3B0CW 4H9PA 5AY8A 3AZEA 3AZJA 5CPKB 4J8VC 3AN2A 1ZLAB 4KGCC 3AYWC 3FDDA 5GXQC 4M6BA 3AZMC 3C1CC 3LZ1B 3R45A 4YM6A 1HQ3D 1TAFA 1M19B 5B1LB 2HUEB 5AVBA 5AV5C 5AV6C 2DQNC 3MGQC 3X1SD 4XZQA 2NQBC 2Y2JA 4H9QB 3KWQC 1P3BC 5JA4B 1KX3B 5BNXA 1P3FD 4X23B 3MNNA 2VQRA 1P3KD 3AV2C 1HTAA 3UT9B 2HIOB 3B0BA 3UTBC 2NZDD 5FUGA 3KXBB 5AV9C 5B31D 4J8WD 5E5AB 3X1TB 2XD5A 3WTPD 1EQZD 4JJNB 2ZY3A 5B0YB 5JRGB 5DNNA 2FJ7D 1P3MB 3W97C 5CPIC 1P3PC 5B0ZA 3X1VD 3REHA 1KX5B 3AV1D 2RVQC 3AZGB 5B1MD 4H9OB 2AROD 5B32A 1R4VA 5G49B 4QLCA 1P3LC 3WTPE 1M1AA 2Y2KA 3MGSC 3WKJB 3KSYA 5CPKD 1AOIC 5GT0A 5B33A 5B40B 3EG5B 2IO5C 1ZLAD 3W98B 1P3OB 1TZYA 3LZ0B 3LELB 5CP6A 3F6TA 3AZEC 5AY8C 3AZJC 4HGAC 4YS3B 3LZ1D 4WU8B 1M19D 5B1LD 1F1EA 5B32G 4KGCD 4NE5A 5B2IB 4DRBA 5AVCC 4YM6C 2PYOA 3W99A 3AL0C 3RELB 2YFWB 3AZMD 1KX3D 3REIB 3AZIB 4KHAA 5AVBC 3AN2B 4H9RA 5B2JA 4H9NA 4J8UA 4XZQC 1M18C 2HIOD 4WNNB 3TU4B 5DNMA 1N1JA 5AV5D 4KUDA 3KXBD 1WWSA 4NFTA 3R45B 3X1TD 5GT3B 3NQUA 4JJND 1U35A 3KWQD 1P3BD 5JRGD 3REJC 4G91B 1P3MD 3A1KA 4J8XB 3C1BB 3AZNA 2CV5B 3B0DC 4ZUXA 3UTBD 3AZLA 1W2EA 4Z2MH 5DNNC 2NQBA 5BNXB 3AZGD 3MNNB 3B6GB 3AZKB 1BH9A 5B0ZC 5KDMB 3H0RC 3REHC 3B6FA 3WKJD 3MGRA 2JE5A 2F8NA 3WAAA 5B40D 5B32C 1P3FB 2W8SA 3W98D 1P3OD 4QLCC 3LZ0D 3LELD 4E44A 2DF4C 3AZFA 1M1AC 4G92B 2FFFB 4WU9A 4YS3D 3VH6T 3WA9A 3H0LC 3A6NB 2BYKB 5GT0C 5B33C 5CPIA 1P3LD 3MGSD 4EO5C 1TZYC 1S32A 5CPJA 5CP6C 2FJ7B 2F8NH 5B24A 5B2ID 4AWLC 1P34A 3W96A 3RELD 3AZED 3REKC 2F8NG 3REID 3AZID 3AN2D 1P3IA 5GSUC 1B6WA 5F99A 1AOIA 2J8PA 2PYOC 5AV8A 3KUYA 3W99C 3TU4D 4CSRA 2Y2QA 4XUJB 5B2JC 5GT3D 4J8UC 1Q9CA 1KX4B 2F8NK 4LD9B 5DNMC 4KUDC 4J8XD 1F66A 4UUZB 3C1BD 2CV5D 1P3GA 4R8PB 1H3OB 4XZQD 2Y2HA 5AVCA 1U35C 3MGPA 2Y2OA 3MNND 3UTAA 4H9RB 3LJAC 3B6GD 3AZNC 4J8VB 3V9RA 5BNVB 4KGCB 3AZKD 4ZUXC 3AZLC 3AYWB 5GXQB 1M18A 3AZMB 3C1CB 2BYMB 4Z66A 3P5JB 3B6FC 3REJA 3MGRC 5AV5B 3MVDA 3WAAC 5BO0A 5AV6B 5B0ZD 3A6ND 3MGQB 4WJ3C 3AZHA 2NQBB 3KWQB 1P3BB 3AZFC 5B32D 4WU9C 3WA9C 3AV2B 2Y2IA 2Y2LA 4DRAA 1S32C 3UTBB 5CPJC 3NQJB 5AV9B 1HQ3A 2ZY5A 5B33D 5C3IC 5B24C 3O62C 1P34C 3W96C 3AFAA 4XUJD 3X1UA 3X1SA 2LY8A 1P3IC 5CPIB 3W97B 5F99C 1P3PB 5AV8C 3KUYC 2BG1A 1KX4D 2Y2PA 1BH8A 2ZY2A 4LD9D 1P3KA 2F2AC 4R8PD 2NZDA 5B31A 1JFIA 1P3LB 1PZRA 3MGSB 1P3AA 3A1IA 3WTPA 1EQZA 5B2JD 3REKA 1F66C 1AOIB 4J8VD 4J8UD 5GSUA 1P3GC 2IO5B 2JCHA 3AYWD 5DNMD 4KUDD 5GXQD 5BS7A 3MGPC 2CWEA 4H9PB 5AY8B 3UTAC 3AZEB 4HGAB 3AZJB 3C1CD 3VH5W 3AV1A 3B0CT 2AROA 5AV6D 3MGQD 5AVCB 4Z5TA 4YM6B 4Z66C 1TAFB 5B31G 5CPKA 2NQBD 2G5IC 4NE6A 5AVBB 1ZLAA 3EPHA 3MVDC 3LJAA 3AV2D 1ID3C 3AZHC 4XZQB 2F8ND 3LZ1A 5AV9D 1M19A 4Z2MG 3REJB 1WWIA 5FUGB 1HQ3C 3W97D 5CPID 3B0DB 1P3PD 4H9QA 5JA4A 1KX3A 5CPJD 5DNNB 4X23A 4H9SA 3AFAC 2RVQD 3X1UC 3H0MC 3X1SC 3UT9A 2HIOA 2Y2GA 5B0ZB 3KXBA 3REHB 5E5AA 3X1TA 1P3KC 4JJNA 1AOID 5B32B 5B0YA 5JRGA 3KUYD 2NZDC 1P3MA 3O62A 5B31C 4QLCB 4J8WC 1M1AB 1P3AC 5AY8D 3WTPC 3AZJD 1EQZC 2ZM5A 5GT0B 5B33B 3EPKA 1KX5A 3AZGA 1BH8B 4EO5B 1TZYB 5BS7C 2UWXA 5CP6B 4H9OA 4NE3A 5G49A 2Y2MA 3X1VC 4E45A 5AVCD 4YM6D 4AWLB 3WKJA 3AV1C 3MGPD 5B1MC 2Y2NA 3UTAD 5B40A 3REKB 2AROC 5AVBD 3W98A 4ZBJC 3LZ0A 3LELA 2PYOB 4Z5TC 1M18D 3W99B 5CPKC 4YS3A 1ZLAC 4KHAB 4WU8A 5CHLB 5B2JB 4H9NB 4J8UB 3REJD 5DNMB 1N1JB 2L5AA 4KUDB 3LZ1C 3IP4C 3AZHD 3RELA 2YFWA 1M19C 3NQUB 5B1LC 4WZSB 2HUEC 3REIA 3AZIA 1U35B 5DNND 1KU5A 3LJAB 3AZNB 4WNNA 3TU4A 2XD1A 4ZUXB 3AZLB 1KX3C 1ID3A 3REHD 4X23C 4H9SC 5GT3A 2YFVA 4CAYA 3UT9C 2HIOC 1BH9B 4J8XA 5BT1C 3KXBC 3AFAD 4QLCD 3X1UD 3C1BA 2CV5A 1M1AD 3B6FB 5E5AC 3MGRB 2F8NB 3X1TC 4JJNC 3WAAB 5GT0D 5B0YC 5JRGC 1P3MC 1TZYD 3B6GA 5CP6D 3AZFB 3AZKA 4WU9B 5KDMA 3WA9B 1KX5C 3AZGC 1P3AD 1S32B 5CPJB 3VH6W 3REKD 1P3FA 5C3IB 5GSUD 3EPJA 5B24B 3O62B 2PYOD 3WKJC 1P34B 1ULYA 2RIQA 3W99D 2ZY4A 3W96B 3A6NA 4J8WA 2BYKA 5B40C 3W98C 1P3IB 1P3OC 5F99B 4DQYB 3LZ0C 4WV4B 3LELC 5AV8B 3KUYB 2FJ7A 4YS3C 4CSRB 1BFMA 4WU8C 4Z5TD 3X1VA 1U35D 5B1MA 1F66B 5B2IC 3LJAD 3AZND 1P3GB 3RELC 4XUJA
chains in the Genus database with same CATH topology
4ZUXD 3AZLD 3REIC 3AZIC 3AN2C 3MGPB 3KFUG 3UTAB 1KX4A 3V9RB 3TU4C 4LD9A 4UUZA 3B6FD 1M18B 4R8PA 3MGRD 1H3OA 3VH6A 5GT3C 3WAAD 4Z66B 4G91C 4J8XC 4X23D 5B1LA 3C1BC 2CV5C 1B67A 1A7WA 4J8VA 5BNVA 3AZFD 4KGCA 4WU9D 3UT9D 3AYWA 3MVDB 3WA9D 5BO0B 5GXQA 5BT1D 4UPKA 1ID3B 3AZHB 3MNNC 1S32D 5E5AD 3AZMA 3B6GC 3C1CA 2BYMA 2YFVB 4CAYB 5B0YD 3AZKC 5B24D 3O62D 1Z2CB 1P34D 5AV5A 3W96D 3VH5A 5AV6A 3MGQA 1P3FC 1HQ3B 1P3ID 1KX5D 5F99D 3KWQA 1P3BA 3EPLA 5AV8D 4G92C 2G5HC 3AFAB 3A6NC 3X1UB 3AV2A 3X1SB 3UTBA 3NQJA 5AV9A 2FJ7C 1P3KB 1F66D 1P3GD 2NZDB 5B31B 4J8WB 1JFIB 3W97A 1P3AB 4WU8D 1P3PA 3WTPB 1EQZB 5GSUB 1P3OA 4XUJC 3X1VB 1P3LA 1KX4C 3MGSA 4Z66D 4LD9C 3AV1B 5B1MB 2AROB 4R8PC 4ZBJB 5B2IA 3MVDD 3VH5T 1T3UA 1ID3D 4Z5TB 2JSSA 3B0CW 4H9PA 5AY8A 3AZEA 3AZJA 5CPKB 4J8VC 3AN2A 1ZLAB 4KGCC 3AYWC 3FDDA 5GXQC 4M6BA 3AZMC 3C1CC 3LZ1B 3R45A 4YM6A 1HQ3D 1TAFA 1M19B 5B1LB 2HUEB 5AVBA 5AV5C 5AV6C 2DQNC 3MGQC 3X1SD 4XZQA 2NQBC 2Y2JA 4H9QB 3KWQC 1P3BC 5JA4B 1KX3B 5BNXA 1P3FD 4X23B 3MNNA 2VQRA 1P3KD 3AV2C 1HTAA 3UT9B 2HIOB 3B0BA 3UTBC 2NZDD 5FUGA 3KXBB 5AV9C 5B31D 4J8WD 5E5AB 3X1TB 2XD5A 3WTPD 1EQZD 4JJNB 2ZY3A 5B0YB 5JRGB 5DNNA 2FJ7D 1P3MB 3W97C 5CPIC 1P3PC 5B0ZA 3X1VD 3REHA 1KX5B 3AV1D 2RVQC 3AZGB 5B1MD 4H9OB 2AROD 5B32A 1R4VA 5G49B 4QLCA 1P3LC 3WTPE 1M1AA 2Y2KA 3MGSC 3WKJB 3KSYA 5CPKD 1AOIC 5GT0A 5B33A 5B40B 3EG5B 2IO5C 1ZLAD 3W98B 1P3OB 1TZYA 3LZ0B 3LELB 5CP6A 3F6TA 3AZEC 5AY8C 3AZJC 4HGAC 4YS3B 3LZ1D 4WU8B 1M19D 5B1LD 1F1EA 5B32G 4KGCD 4NE5A 5B2IB 4DRBA 5AVCC 4YM6C 2PYOA 3W99A 3AL0C 3RELB 2YFWB 3AZMD 1KX3D 3REIB 3AZIB 4KHAA 5AVBC 3AN2B 4H9RA 5B2JA 4H9NA 4J8UA 4XZQC 1M18C 2HIOD 4WNNB 3TU4B 5DNMA 1N1JA 5AV5D 4KUDA 3KXBD 1WWSA 4NFTA 3R45B 3X1TD 5GT3B 3NQUA 4JJND 1U35A 3KWQD 1P3BD 5JRGD 3REJC 4G91B 1P3MD 3A1KA 4J8XB 3C1BB 3AZNA 2CV5B 3B0DC 4ZUXA 3UTBD 3AZLA 1W2EA 4Z2MH 5DNNC 2NQBA 5BNXB 3AZGD 3MNNB 3B6GB 3AZKB 1BH9A 5B0ZC 5KDMB 3H0RC 3REHC 3B6FA 3WKJD 3MGRA 2JE5A 2F8NA 3WAAA 5B40D 5B32C 1P3FB 2W8SA 3W98D 1P3OD 4QLCC 3LZ0D 3LELD 4E44A 2DF4C 3AZFA 1M1AC 4G92B 2FFFB 4WU9A 4YS3D 3VH6T 3WA9A 3H0LC 3A6NB 2BYKB 5GT0C 5B33C 5CPIA 1P3LD 3MGSD 4EO5C 1TZYC 1S32A 5CPJA 5CP6C 2FJ7B 2F8NH 5B24A 5B2ID 4AWLC 1P34A 3W96A 3RELD 3AZED 3REKC 2F8NG 3REID 3AZID 3AN2D 1P3IA 5GSUC 1B6WA 5F99A 1AOIA 2J8PA 2PYOC 5AV8A 3KUYA 3W99C 3TU4D 4CSRA 2Y2QA 4XUJB 5B2JC 5GT3D 4J8UC 1Q9CA 1KX4B 2F8NK 4LD9B 5DNMC 4KUDC 4J8XD 1F66A 4UUZB 3C1BD 2CV5D 1P3GA 4R8PB 1H3OB 4XZQD 2Y2HA 5AVCA 1U35C 3MGPA 2Y2OA 3MNND 3UTAA 4H9RB 3LJAC 3B6GD 3AZNC 4J8VB 3V9RA 5BNVB 4KGCB 3AZKD 4ZUXC 3AZLC 3AYWB 5GXQB 1M18A 3AZMB 3C1CB 2BYMB 4Z66A 3P5JB 3B6FC 3REJA 3MGRC 5AV5B 3MVDA 3WAAC 5BO0A 5AV6B 5B0ZD 3A6ND 3MGQB 4WJ3C 3AZHA 2NQBB 3KWQB 1P3BB 3AZFC 5B32D 4WU9C 3WA9C 3AV2B 2Y2IA 2Y2LA 4DRAA 1S32C 3UTBB 5CPJC 3NQJB 5AV9B 1HQ3A 2ZY5A 5B33D 5C3IC 5B24C 3O62C 1P34C 3W96C 3AFAA 4XUJD 3X1UA 3X1SA 2LY8A 1P3IC 5CPIB 3W97B 5F99C 1P3PB 5AV8C 3KUYC 2BG1A 1KX4D 2Y2PA 1BH8A 2ZY2A 4LD9D 1P3KA 2F2AC 4R8PD 2NZDA 5B31A 1JFIA 1P3LB 1PZRA 3MGSB 1P3AA 3A1IA 3WTPA 1EQZA 5B2JD 3REKA 1F66C 1AOIB 4J8VD 4J8UD 5GSUA 1P3GC 2IO5B 2JCHA 3AYWD 5DNMD 4KUDD 5GXQD 5BS7A 3MGPC 2CWEA 4H9PB 5AY8B 3UTAC 3AZEB 4HGAB 3AZJB 3C1CD 3VH5W 3AV1A 3B0CT 2AROA 5AV6D 3MGQD 5AVCB 4Z5TA 4YM6B 4Z66C 1TAFB 5B31G 5CPKA 2NQBD 2G5IC 4NE6A 5AVBB 1ZLAA 3EPHA 3MVDC 3LJAA 3AV2D 1ID3C 3AZHC 4XZQB 2F8ND 3LZ1A 5AV9D 1M19A 4Z2MG 3REJB 1WWIA 5FUGB 1HQ3C 3W97D 5CPID 3B0DB 1P3PD 4H9QA 5JA4A 1KX3A 5CPJD 5DNNB 4X23A 4H9SA 3AFAC 2RVQD 3X1UC 3H0MC 3X1SC 3UT9A 2HIOA 2Y2GA 5B0ZB 3KXBA 3REHB 5E5AA 3X1TA 1P3KC 4JJNA 1AOID 5B32B 5B0YA 5JRGA 3KUYD 2NZDC 1P3MA 3O62A 5B31C 4QLCB 4J8WC 1M1AB 1P3AC 5AY8D 3WTPC 3AZJD 1EQZC 2ZM5A 5GT0B 5B33B 3EPKA 1KX5A 3AZGA 1BH8B 4EO5B 1TZYB 5BS7C 2UWXA 5CP6B 4H9OA 4NE3A 5G49A 2Y2MA 3X1VC 4E45A 5AVCD 4YM6D 4AWLB 3WKJA 3AV1C 3MGPD 5B1MC 2Y2NA 3UTAD 5B40A 3REKB 2AROC 5AVBD 3W98A 4ZBJC 3LZ0A 3LELA 2PYOB 4Z5TC 1M18D 3W99B 5CPKC 4YS3A 1ZLAC 4KHAB 4WU8A 5CHLB 5B2JB 4H9NB 4J8UB 3REJD 5DNMB 1N1JB 2L5AA 4KUDB 3LZ1C 3IP4C 3AZHD 3RELA 2YFWA 1M19C 3NQUB 5B1LC 4WZSB 2HUEC 3REIA 3AZIA 1U35B 5DNND 1KU5A 3LJAB 3AZNB 4WNNA 3TU4A 2XD1A 4ZUXB 3AZLB 1KX3C 1ID3A 3REHD 4X23C 4H9SC 5GT3A 2YFVA 4CAYA 3UT9C 2HIOC 1BH9B 4J8XA 5BT1C 3KXBC 3AFAD 4QLCD 3X1UD 3C1BA 2CV5A 1M1AD 3B6FB 5E5AC 3MGRB 2F8NB 3X1TC 4JJNC 3WAAB 5GT0D 5B0YC 5JRGC 1P3MC 1TZYD 3B6GA 5CP6D 3AZFB 3AZKA 4WU9B 5KDMA 3WA9B 1KX5C 3AZGC 1P3AD 1S32B 5CPJB 3VH6W 3REKD 1P3FA 5C3IB 5GSUD 3EPJA 5B24B 3O62B 2PYOD 3WKJC 1P34B 1ULYA 2RIQA 3W99D 2ZY4A 3W96B 3A6NA 4J8WA 2BYKA 5B40C 3W98C 1P3IB 1P3OC 5F99B 4DQYB 3LZ0C 4WV4B 3LELC 5AV8B 3KUYB 2FJ7A 4YS3C 4CSRB 1BFMA 4WU8C 4Z5TD 3X1VA 1U35D 5B1MA 1F66B 5B2IC 3LJAD 3AZND 1P3GB 3RELC 4XUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX D;  3AZL D;  3REI C;  3AZI C;  3AN2 C;  3MGP B;  3UTA B;  1KX4 A;  3V9R B;  3TU4 C;  4LD9 A;  4UUZ A;  3B6F D;  1M18 B;  4R8P A;  3MGR D;  1H3O A;  3VH6 A;  5GT3 C;  3WAA D;  4Z66 B;  4G91 C;  4J8X C;  4X23 D;  5B1L A;  3C1B C;  2CV5 C;  1B67 A;  1A7W A;  4J8V A;  5BNV A;  3AZF D;  4KGC A;  4WU9 D;  3UT9 D;  3AYW A;  3MVD B;  3WA9 D;  5BO0 B;  5GXQ A;  5BT1 D;  1ID3 B;  3AZH B;  3MNN C;  1S32 D;  5E5A D;  3AZM A;  3B6G C;  3C1C A;  2BYM A;  2YFV B;  4CAY B;  5B0Y D;  3AZK C;  5B24 D;  3O62 D;  1P34 D;  5AV5 A;  3W96 D;  3VH5 A;  5AV6 A;  3MGQ A;  1P3F C;  1HQ3 B;  1P3I D;  1KX5 D;  5F99 D;  3KWQ A;  1P3B A;  5AV8 D;  4G92 C;  3AFA B;  3A6N C;  3X1U B;  3AV2 A;  3X1S B;  3UTB A;  3NQJ A;  5AV9 A;  2FJ7 C;  1P3K B;  1F66 D;  1P3G D;  2NZD B;  5B31 B;  4J8W B;  1JFI B;  3W97 A;  1P3A B;  4WU8 D;  1P3P A;  3WTP B;  1EQZ B;  5GSU B;  1P3O A;  4XUJ C;  3X1V B;  1P3L A;  1KX4 C;  3MGS A;  4Z66 D;  4LD9 C;  3AV1 B;  5B1M B;  2ARO B;  4R8P C;  4ZBJ B;  5B2I A;  3MVD D;  3VH5 T;  1ID3 D;  4Z5T B;  2JSS A;  3B0C W;  4H9P A;  5AY8 A;  3AZE A;  3AZJ A;  5CPK B;  4J8V C;  3AN2 A;  1ZLA B;  4KGC C;  3AYW C;  5GXQ C;  4M6B A;  3AZM C;  3C1C C;  3LZ1 B;  3R45 A;  4YM6 A;  1HQ3 D;  1TAF A;  1M19 B;  5B1L B;  2HUE B;  5AVB A;  5AV5 C;  5AV6 C;  3MGQ C;  3X1S D;  4XZQ A;  2NQB C;  4H9Q B;  3KWQ C;  1P3B C;  5JA4 B;  1KX3 B;  5BNX A;  1P3F D;  4X23 B;  3MNN A;  1P3K D;  3AV2 C;  1HTA A;  3UT9 B;  2HIO B;  3B0B A;  3UTB C;  2NZD D;  5FUG A;  3KXB B;  5AV9 C;  5B31 D;  4J8W D;  5E5A B;  3X1T B;  3WTP D;  1EQZ D;  4JJN B;  5B0Y B;  5JRG B;  5DNN A;  2FJ7 D;  1P3M B;  3W97 C;  5CPI C;  1P3P C;  5B0Z A;  3X1V D;  3REH A;  1KX5 B;  3AV1 D;  2RVQ C;  3AZG B;  5B1M D;  4H9O B;  2ARO D;  5B32 A;  1R4V A;  5G49 B;  4QLC A;  1P3L C;  3WTP E;  1M1A A;  3MGS C;  3WKJ B;  3KSY A;  5CPK D;  1AOI C;  5GT0 A;  5B33 A;  5B40 B;  1ZLA D;  2IO5 C;  3W98 B;  1P3O B;  1TZY A;  3LZ0 B;  3LEL B;  5CP6 A;  3AZE C;  5AY8 C;  3AZJ C;  4HGA C;  4YS3 B;  3LZ1 D;  4WU8 B;  1M19 D;  5B1L D;  1F1E A;  5B32 G;  4KGC D;  4NE5 A;  5B2I B;  4DRB A;  5AVC C;  4YM6 C;  2PYO A;  3W99 A;  3REL B;  2YFW B;  3AZM D;  1KX3 D;  3REI B;  3AZI B;  4KHA A;  5AVB C;  3AN2 B;  4H9R A;  5B2J A;  4H9N A;  4J8U A;  4XZQ C;  1M18 C;  2HIO D;  4WNN B;  3TU4 B;  5DNM A;  1N1J A;  5AV5 D;  4KUD A;  3KXB D;  1WWS A;  4NFT A;  3R45 B;  3X1T D;  5GT3 B;  3NQU A;  4JJN D;  1U35 A;  3KWQ D;  1P3B D;  5JRG D;  3REJ C;  4G91 B;  1P3M D;  4J8X B;  3C1B B;  3AZN A;  2CV5 B;  3B0D C;  4ZUX A;  3UTB D;  3AZL A;  4Z2M H;  5DNN C;  2NQB A;  5BNX B;  3AZG D;  3MNN B;  3B6G B;  3AZK B;  1BH9 A;  5B0Z C;  5KDM B;  3REH C;  3B6F A;  3WKJ D;  3MGR A;  2F8N A;  3WAA A;  5B40 D;  5B32 C;  1P3F B;  3W98 D;  1P3O D;  4QLC C;  3LZ0 D;  3LEL D;  4E44 A;  1M1A C;  3AZF A;  4G92 B;  4WU9 A;  4YS3 D;  3VH6 T;  3WA9 A;  3A6N B;  2BYK B;  5GT0 C;  5B33 C;  5CPI A;  1P3L D;  3MGS D;  4EO5 C;  1TZY C;  1S32 A;  5CPJ A;  5CP6 C;  2FJ7 B;  2F8N H;  5B24 A;  5B2I D;  4AWL C;  1P34 A;  3W96 A;  3REL D;  3AZE D;  3REK C;  2F8N G;  3REI D;  3AZI D;  3AN2 D;  1P3I A;  5GSU C;  1B6W A;  5F99 A;  1AOI A;  2PYO C;  5AV8 A;  3KUY A;  3W99 C;  3TU4 D;  4CSR A;  4XUJ B;  5B2J C;  5GT3 D;  4J8U C;  1Q9C A;  1KX4 B;  2F8N K;  4LD9 B;  5DNM C;  4KUD C;  4J8X D;  1F66 A;  4UUZ B;  3C1B D;  2CV5 D;  1P3G A;  4R8P B;  1H3O B;  4XZQ D;  5AVC A;  1U35 C;  3MGP A;  3MNN D;  3UTA A;  4H9R B;  3LJA C;  3B6G D;  3AZN C;  4J8V B;  3V9R A;  5BNV B;  4KGC B;  3AZK D;  4ZUX C;  3AZL C;  3AYW B;  5GXQ B;  1M18 A;  3AZM B;  3C1C B;  2BYM B;  4Z66 A;  3B6F C;  3REJ A;  3MGR C;  5AV5 B;  3MVD A;  3WAA C;  5BO0 A;  5AV6 B;  5B0Z D;  3A6N D;  3MGQ B;  3AZH A;  2NQB B;  3KWQ B;  1P3B B;  3AZF C;  5B32 D;  4WU9 C;  3WA9 C;  3AV2 B;  4DRA A;  1S32 C;  3UTB B;  5CPJ C;  3NQJ B;  5AV9 B;  1HQ3 A;  5B33 D;  5C3I C;  5B24 C;  3O62 C;  1P34 C;  3W96 C;  3AFA A;  4XUJ D;  3X1U A;  3X1S A;  2LY8 A;  1P3I C;  5CPI B;  3W97 B;  5F99 C;  1P3P B;  5AV8 C;  3KUY C;  1KX4 D;  1BH8 A;  4LD9 D;  1P3K A;  4R8P D;  2NZD A;  5B31 A;  1JFI A;  1P3L B;  3MGS B;  1P3A A;  3WTP A;  1EQZ A;  5B2J D;  3REK A;  1F66 C;  1AOI B;  4J8V D;  4J8U D;  5GSU A;  1P3G C;  2IO5 B;  3AYW D;  5DNM D;  4KUD D;  5GXQ D;  5BS7 A;  3MGP C;  2CWE A;  4H9P B;  5AY8 B;  3UTA C;  3AZE B;  4HGA B;  3AZJ B;  3C1C D;  3VH5 W;  3AV1 A;  3B0C T;  2ARO A;  5AV6 D;  3MGQ D;  5AVC B;  4Z5T A;  4YM6 B;  4Z66 C;  1TAF B;  5B31 G;  5CPK A;  2NQB D;  4NE6 A;  1ZLA A;  5AVB B;  3MVD C;  3LJA A;  3AV2 D;  1ID3 C;  3AZH C;  4XZQ B;  2F8N D;  3LZ1 A;  5AV9 D;  1M19 A;  4Z2M G;  3REJ B;  1WWI A;  5FUG B;  1HQ3 C;  3W97 D;  5CPI D;  3B0D B;  1P3P D;  4H9Q A;  5JA4 A;  1KX3 A;  5CPJ D;  5DNN B;  4X23 A;  4H9S A;  3AFA C;  2RVQ D;  3X1U C;  3X1S C;  3UT9 A;  2HIO A;  5B0Z B;  3KXB A;  3REH B;  5E5A A;  3X1T A;  1P3K C;  4JJN A;  1AOI D;  5B32 B;  5B0Y A;  5JRG A;  3KUY D;  2NZD C;  1P3M A;  3O62 A;  5B31 C;  4QLC B;  4J8W C;  1M1A B;  1P3A C;  5AY8 D;  3WTP C;  3AZJ D;  1EQZ C;  5GT0 B;  5B33 B;  1KX5 A;  3AZG A;  1BH8 B;  4EO5 B;  1TZY B;  5BS7 C;  5CP6 B;  4H9O A;  4NE3 A;  5G49 A;  3X1V C;  4E45 A;  5AVC D;  4YM6 D;  4AWL B;  3WKJ A;  3AV1 C;  3MGP D;  5B1M C;  3UTA D;  5B40 A;  3REK B;  2ARO C;  5AVB D;  3W98 A;  4ZBJ C;  3LZ0 A;  3LEL A;  2PYO B;  4Z5T C;  1M18 D;  3W99 B;  5CPK C;  4YS3 A;  1ZLA C;  4KHA B;  4WU8 A;  5CHL B;  5B2J B;  4H9N B;  4J8U B;  3REJ D;  5DNM B;  1N1J B;  2L5A A;  4KUD B;  3LZ1 C;  3AZH D;  3REL A;  2YFW A;  1M19 C;  3NQU B;  5B1L C;  4WZS B;  2HUE C;  3REI A;  3AZI A;  1U35 B;  5DNN D;  1KU5 A;  3LJA B;  3AZN B;  4WNN A;  3TU4 A;  4ZUX B;  3AZL B;  1KX3 C;  1ID3 A;  3REH D;  4X23 C;  4H9S C;  5GT3 A;  2YFV A;  4CAY A;  3UT9 C;  2HIO C;  1BH9 B;  4J8X A;  5BT1 C;  3KXB C;  3AFA D;  4QLC D;  3X1U D;  3C1B A;  2CV5 A;  1M1A D;  3B6F B;  5E5A C;  3MGR B;  2F8N B;  3X1T C;  4JJN C;  3WAA B;  5GT0 D;  5B0Y C;  5JRG C;  1P3M C;  1TZY D;  3B6G A;  5CP6 D;  3AZF B;  3AZK A;  4WU9 B;  5KDM A;  3WA9 B;  1KX5 C;  3AZG C;  1P3A D;  1S32 B;  5CPJ B;  3VH6 W;  3REK D;  1P3F A;  5C3I B;  5GSU D;  5B24 B;  3O62 B;  2PYO D;  3WKJ C;  1P34 B;  1ULY A;  3W99 D;  3W96 B;  3A6N A;  4J8W A;  2BYK A;  5B40 C;  3W98 C;  1P3I B;  1P3O C;  5F99 B;  3LZ0 C;  4WV4 B;  3LEL C;  5AV8 B;  3KUY B;  2FJ7 A;  4YS3 C;  4CSR B;  1BFM A;  4WU8 C;  4Z5T D;  3X1V A;  1U35 D;  5B1M A;  1F66 B;  5B2I C;  3LJA D;  3AZN D;  1P3G B;  3REL C;  4XUJ A; 
#chains in the Genus database with same CATH topology
 4ZUX D;  3AZL D;  3REI C;  3AZI C;  3AN2 C;  3MGP B;  3KFU G;  3UTA B;  1KX4 A;  3V9R B;  3TU4 C;  4LD9 A;  4UUZ A;  3B6F D;  1M18 B;  4R8P A;  3MGR D;  1H3O A;  3VH6 A;  5GT3 C;  3WAA D;  4Z66 B;  4G91 C;  4J8X C;  4X23 D;  5B1L A;  3C1B C;  2CV5 C;  1B67 A;  1A7W A;  4J8V A;  5BNV A;  3AZF D;  4KGC A;  4WU9 D;  3UT9 D;  3AYW A;  3MVD B;  3WA9 D;  5BO0 B;  5GXQ A;  5BT1 D;  4UPK A;  1ID3 B;  3AZH B;  3MNN C;  1S32 D;  5E5A D;  3AZM A;  3B6G C;  3C1C A;  2BYM A;  2YFV B;  4CAY B;  5B0Y D;  3AZK C;  5B24 D;  3O62 D;  1Z2C B;  1P34 D;  5AV5 A;  3W96 D;  3VH5 A;  5AV6 A;  3MGQ A;  1P3F C;  1HQ3 B;  1P3I D;  1KX5 D;  5F99 D;  3KWQ A;  1P3B A;  3EPL A;  5AV8 D;  4G92 C;  2G5H C;  3AFA B;  3A6N C;  3X1U B;  3AV2 A;  3X1S B;  3UTB A;  3NQJ A;  5AV9 A;  2FJ7 C;  1P3K B;  1F66 D;  1P3G D;  2NZD B;  5B31 B;  4J8W B;  1JFI B;  3W97 A;  1P3A B;  4WU8 D;  1P3P A;  3WTP B;  1EQZ B;  5GSU B;  1P3O A;  4XUJ C;  3X1V B;  1P3L A;  1KX4 C;  3MGS A;  4Z66 D;  4LD9 C;  3AV1 B;  5B1M B;  2ARO B;  4R8P C;  4ZBJ B;  5B2I A;  3MVD D;  3VH5 T;  1T3U A;  1ID3 D;  4Z5T B;  2JSS A;  3B0C W;  4H9P A;  5AY8 A;  3AZE A;  3AZJ A;  5CPK B;  4J8V C;  3AN2 A;  1ZLA B;  4KGC C;  3AYW C;  3FDD A;  5GXQ C;  4M6B A;  3AZM C;  3C1C C;  3LZ1 B;  3R45 A;  4YM6 A;  1HQ3 D;  1TAF A;  1M19 B;  5B1L B;  2HUE B;  5AVB A;  5AV5 C;  5AV6 C;  2DQN C;  3MGQ C;  3X1S D;  4XZQ A;  2NQB C;  2Y2J A;  4H9Q B;  3KWQ C;  1P3B C;  5JA4 B;  1KX3 B;  5BNX A;  1P3F D;  4X23 B;  3MNN A;  2VQR A;  1P3K D;  3AV2 C;  1HTA A;  3UT9 B;  2HIO B;  3B0B A;  3UTB C;  2NZD D;  5FUG A;  3KXB B;  5AV9 C;  5B31 D;  4J8W D;  5E5A B;  3X1T B;  2XD5 A;  3WTP D;  1EQZ D;  4JJN B;  2ZY3 A;  5B0Y B;  5JRG B;  5DNN A;  2FJ7 D;  1P3M B;  3W97 C;  5CPI C;  1P3P C;  5B0Z A;  3X1V D;  3REH A;  1KX5 B;  3AV1 D;  2RVQ C;  3AZG B;  5B1M D;  4H9O B;  2ARO D;  5B32 A;  1R4V A;  5G49 B;  4QLC A;  1P3L C;  3WTP E;  1M1A A;  2Y2K A;  3MGS C;  3WKJ B;  3KSY A;  5CPK D;  1AOI C;  5GT0 A;  5B33 A;  5B40 B;  3EG5 B;  2IO5 C;  1ZLA D;  3W98 B;  1P3O B;  1TZY A;  3LZ0 B;  3LEL B;  5CP6 A;  3F6T A;  3AZE C;  5AY8 C;  3AZJ C;  4HGA C;  4YS3 B;  3LZ1 D;  4WU8 B;  1M19 D;  5B1L D;  1F1E A;  5B32 G;  4KGC D;  4NE5 A;  5B2I B;  4DRB A;  5AVC C;  4YM6 C;  2PYO A;  3W99 A;  3AL0 C;  3REL B;  2YFW B;  3AZM D;  1KX3 D;  3REI B;  3AZI B;  4KHA A;  5AVB C;  3AN2 B;  4H9R A;  5B2J A;  4H9N A;  4J8U A;  4XZQ C;  1M18 C;  2HIO D;  4WNN B;  3TU4 B;  5DNM A;  1N1J A;  5AV5 D;  4KUD A;  3KXB D;  1WWS A;  4NFT A;  3R45 B;  3X1T D;  5GT3 B;  3NQU A;  4JJN D;  1U35 A;  3KWQ D;  1P3B D;  5JRG D;  3REJ C;  4G91 B;  1P3M D;  3A1K A;  4J8X B;  3C1B B;  3AZN A;  2CV5 B;  3B0D C;  4ZUX A;  3UTB D;  3AZL A;  1W2E A;  4Z2M H;  5DNN C;  2NQB A;  5BNX B;  3AZG D;  3MNN B;  3B6G B;  3AZK B;  1BH9 A;  5B0Z C;  5KDM B;  3H0R C;  3REH C;  3B6F A;  3WKJ D;  3MGR A;  2JE5 A;  2F8N A;  3WAA A;  5B40 D;  5B32 C;  1P3F B;  2W8S A;  3W98 D;  1P3O D;  4QLC C;  3LZ0 D;  3LEL D;  4E44 A;  2DF4 C;  3AZF A;  1M1A C;  4G92 B;  2FFF B;  4WU9 A;  4YS3 D;  3VH6 T;  3WA9 A;  3H0L C;  3A6N B;  2BYK B;  5GT0 C;  5B33 C;  5CPI A;  1P3L D;  3MGS D;  4EO5 C;  1TZY C;  1S32 A;  5CPJ A;  5CP6 C;  2FJ7 B;  2F8N H;  5B24 A;  5B2I D;  4AWL C;  1P34 A;  3W96 A;  3REL D;  3AZE D;  3REK C;  2F8N G;  3REI D;  3AZI D;  3AN2 D;  1P3I A;  5GSU C;  1B6W A;  5F99 A;  1AOI A;  2J8P A;  2PYO C;  5AV8 A;  3KUY A;  3W99 C;  3TU4 D;  4CSR A;  2Y2Q A;  4XUJ B;  5B2J C;  5GT3 D;  4J8U C;  1Q9C A;  1KX4 B;  2F8N K;  4LD9 B;  5DNM C;  4KUD C;  4J8X D;  1F66 A;  4UUZ B;  3C1B D;  2CV5 D;  1P3G A;  4R8P B;  1H3O B;  4XZQ D;  2Y2H A;  5AVC A;  1U35 C;  3MGP A;  2Y2O A;  3MNN D;  3UTA A;  4H9R B;  3LJA C;  3B6G D;  3AZN C;  4J8V B;  3V9R A;  5BNV B;  4KGC B;  3AZK D;  4ZUX C;  3AZL C;  3AYW B;  5GXQ B;  1M18 A;  3AZM B;  3C1C B;  2BYM B;  4Z66 A;  3P5J B;  3B6F C;  3REJ A;  3MGR C;  5AV5 B;  3MVD A;  3WAA C;  5BO0 A;  5AV6 B;  5B0Z D;  3A6N D;  3MGQ B;  4WJ3 C;  3AZH A;  2NQB B;  3KWQ B;  1P3B B;  3AZF C;  5B32 D;  4WU9 C;  3WA9 C;  3AV2 B;  2Y2I A;  2Y2L A;  4DRA A;  1S32 C;  3UTB B;  5CPJ C;  3NQJ B;  5AV9 B;  1HQ3 A;  2ZY5 A;  5B33 D;  5C3I C;  5B24 C;  3O62 C;  1P34 C;  3W96 C;  3AFA A;  4XUJ D;  3X1U A;  3X1S A;  2LY8 A;  1P3I C;  5CPI B;  3W97 B;  5F99 C;  1P3P B;  5AV8 C;  3KUY C;  2BG1 A;  1KX4 D;  2Y2P A;  1BH8 A;  2ZY2 A;  4LD9 D;  1P3K A;  2F2A C;  4R8P D;  2NZD A;  5B31 A;  1JFI A;  1P3L B;  1PZR A;  3MGS B;  1P3A A;  3A1I A;  3WTP A;  1EQZ A;  5B2J D;  3REK A;  1F66 C;  1AOI B;  4J8V D;  4J8U D;  5GSU A;  1P3G C;  2IO5 B;  2JCH A;  3AYW D;  5DNM D;  4KUD D;  5GXQ D;  5BS7 A;  3MGP C;  2CWE A;  4H9P B;  5AY8 B;  3UTA C;  3AZE B;  4HGA B;  3AZJ B;  3C1C D;  3VH5 W;  3AV1 A;  3B0C T;  2ARO A;  5AV6 D;  3MGQ D;  5AVC B;  4Z5T A;  4YM6 B;  4Z66 C;  1TAF B;  5B31 G;  5CPK A;  2NQB D;  2G5I C;  4NE6 A;  5AVB B;  1ZLA A;  3EPH A;  3MVD C;  3LJA A;  3AV2 D;  1ID3 C;  3AZH C;  4XZQ B;  2F8N D;  3LZ1 A;  5AV9 D;  1M19 A;  4Z2M G;  3REJ B;  1WWI A;  5FUG B;  1HQ3 C;  3W97 D;  5CPI D;  3B0D B;  1P3P D;  4H9Q A;  5JA4 A;  1KX3 A;  5CPJ D;  5DNN B;  4X23 A;  4H9S A;  3AFA C;  2RVQ D;  3X1U C;  3H0M C;  3X1S C;  3UT9 A;  2HIO A;  2Y2G A;  5B0Z B;  3KXB A;  3REH B;  5E5A A;  3X1T A;  1P3K C;  4JJN A;  1AOI D;  5B32 B;  5B0Y A;  5JRG A;  3KUY D;  2NZD C;  1P3M A;  3O62 A;  5B31 C;  4QLC B;  4J8W C;  1M1A B;  1P3A C;  5AY8 D;  3WTP C;  3AZJ D;  1EQZ C;  2ZM5 A;  5GT0 B;  5B33 B;  3EPK A;  1KX5 A;  3AZG A;  1BH8 B;  4EO5 B;  1TZY B;  5BS7 C;  2UWX A;  5CP6 B;  4H9O A;  4NE3 A;  5G49 A;  2Y2M A;  3X1V C;  4E45 A;  5AVC D;  4YM6 D;  4AWL B;  3WKJ A;  3AV1 C;  3MGP D;  5B1M C;  2Y2N A;  3UTA D;  5B40 A;  3REK B;  2ARO C;  5AVB D;  3W98 A;  4ZBJ C;  3LZ0 A;  3LEL A;  2PYO B;  4Z5T C;  1M18 D;  3W99 B;  5CPK C;  4YS3 A;  1ZLA C;  4KHA B;  4WU8 A;  5CHL B;  5B2J B;  4H9N B;  4J8U B;  3REJ D;  5DNM B;  1N1J B;  2L5A A;  4KUD B;  3LZ1 C;  3IP4 C;  3AZH D;  3REL A;  2YFW A;  1M19 C;  3NQU B;  5B1L C;  4WZS B;  2HUE C;  3REI A;  3AZI A;  1U35 B;  5DNN D;  1KU5 A;  3LJA B;  3AZN B;  4WNN A;  3TU4 A;  2XD1 A;  4ZUX B;  3AZL B;  1KX3 C;  1ID3 A;  3REH D;  4X23 C;  4H9S C;  5GT3 A;  2YFV A;  4CAY A;  3UT9 C;  2HIO C;  1BH9 B;  4J8X A;  5BT1 C;  3KXB C;  3AFA D;  4QLC D;  3X1U D;  3C1B A;  2CV5 A;  1M1A D;  3B6F B;  5E5A C;  3MGR B;  2F8N B;  3X1T C;  4JJN C;  3WAA B;  5GT0 D;  5B0Y C;  5JRG C;  1P3M C;  1TZY D;  3B6G A;  5CP6 D;  3AZF B;  3AZK A;  4WU9 B;  5KDM A;  3WA9 B;  1KX5 C;  3AZG C;  1P3A D;  1S32 B;  5CPJ B;  3VH6 W;  3REK D;  1P3F A;  5C3I B;  5GSU D;  3EPJ A;  5B24 B;  3O62 B;  2PYO D;  3WKJ C;  1P34 B;  1ULY A;  2RIQ A;  3W99 D;  2ZY4 A;  3W96 B;  3A6N A;  4J8W A;  2BYK A;  5B40 C;  3W98 C;  1P3I B;  1P3O C;  5F99 B;  4DQY B;  3LZ0 C;  4WV4 B;  3LEL C;  5AV8 B;  3KUY B;  2FJ7 A;  4YS3 C;  4CSR B;  1BFM A;  4WU8 C;  4Z5T D;  3X1V A;  1U35 D;  5B1M A;  1F66 B;  5B2I C;  3LJA D;  3AZN D;  1P3G B;  3REL C;  4XUJ A; 
#chains in the Genus database with same CATH homology
 4ZUX D;  3AZL D;  3REI C;  3AZI C;  3AN2 C;  3MGP B;  3KFU G;  3UTA B;  1KX4 A;  3V9R B;  3TU4 C;  4LD9 A;  4UUZ A;  3B6F D;  1M18 B;  4R8P A;  3MGR D;  1H3O A;  3VH6 A;  5GT3 C;  3WAA D;  4Z66 B;  4G91 C;  4J8X C;  4X23 D;  5B1L A;  3C1B C;  2CV5 C;  1B67 A;  1A7W A;  4J8V A;  5BNV A;  3AZF D;  4KGC A;  4WU9 D;  3UT9 D;  3AYW A;  3MVD B;  3WA9 D;  5BO0 B;  5GXQ A;  5BT1 D;  4UPK A;  1ID3 B;  3AZH B;  3MNN C;  1S32 D;  5E5A D;  3AZM A;  3B6G C;  3C1C A;  2BYM A;  2YFV B;  4CAY B;  5B0Y D;  3AZK C;  5B24 D;  3O62 D;  1Z2C B;  1P34 D;  5AV5 A;  3W96 D;  3VH5 A;  5AV6 A;  3MGQ A;  1P3F C;  1HQ3 B;  1P3I D;  1KX5 D;  5F99 D;  3KWQ A;  1P3B A;  3EPL A;  5AV8 D;  4G92 C;  2G5H C;  3AFA B;  3A6N C;  3X1U B;  3AV2 A;  3X1S B;  3UTB A;  3NQJ A;  5AV9 A;  2FJ7 C;  1P3K B;  1F66 D;  1P3G D;  2NZD B;  5B31 B;  4J8W B;  1JFI B;  3W97 A;  1P3A B;  4WU8 D;  1P3P A;  3WTP B;  1EQZ B;  5GSU B;  1P3O A;  4XUJ C;  3X1V B;  1P3L A;  1KX4 C;  3MGS A;  4Z66 D;  4LD9 C;  3AV1 B;  5B1M B;  2ARO B;  4R8P C;  4ZBJ B;  5B2I A;  3MVD D;  3VH5 T;  1T3U A;  1ID3 D;  4Z5T B;  2JSS A;  3B0C W;  4H9P A;  5AY8 A;  3AZE A;  3AZJ A;  5CPK B;  4J8V C;  3AN2 A;  1ZLA B;  4KGC C;  3AYW C;  3FDD A;  5GXQ C;  4M6B A;  3AZM C;  3C1C C;  3LZ1 B;  3R45 A;  4YM6 A;  1HQ3 D;  1TAF A;  1M19 B;  5B1L B;  2HUE B;  5AVB A;  5AV5 C;  5AV6 C;  2DQN C;  3MGQ C;  3X1S D;  4XZQ A;  2NQB C;  2Y2J A;  4H9Q B;  3KWQ C;  1P3B C;  5JA4 B;  1KX3 B;  5BNX A;  1P3F D;  4X23 B;  3MNN A;  2VQR A;  1P3K D;  3AV2 C;  1HTA A;  3UT9 B;  2HIO B;  3B0B A;  3UTB C;  2NZD D;  5FUG A;  3KXB B;  5AV9 C;  5B31 D;  4J8W D;  5E5A B;  3X1T B;  2XD5 A;  3WTP D;  1EQZ D;  4JJN B;  2ZY3 A;  5B0Y B;  5JRG B;  5DNN A;  2FJ7 D;  1P3M B;  3W97 C;  5CPI C;  1P3P C;  5B0Z A;  3X1V D;  3REH A;  1KX5 B;  3AV1 D;  2RVQ C;  3AZG B;  5B1M D;  4H9O B;  2ARO D;  5B32 A;  1R4V A;  5G49 B;  4QLC A;  1P3L C;  3WTP E;  1M1A A;  2Y2K A;  3MGS C;  3WKJ B;  3KSY A;  5CPK D;  1AOI C;  5GT0 A;  5B33 A;  5B40 B;  3EG5 B;  2IO5 C;  1ZLA D;  3W98 B;  1P3O B;  1TZY A;  3LZ0 B;  3LEL B;  5CP6 A;  3F6T A;  3AZE C;  5AY8 C;  3AZJ C;  4HGA C;  4YS3 B;  3LZ1 D;  4WU8 B;  1M19 D;  5B1L D;  1F1E A;  5B32 G;  4KGC D;  4NE5 A;  5B2I B;  4DRB A;  5AVC C;  4YM6 C;  2PYO A;  3W99 A;  3AL0 C;  3REL B;  2YFW B;  3AZM D;  1KX3 D;  3REI B;  3AZI B;  4KHA A;  5AVB C;  3AN2 B;  4H9R A;  5B2J A;  4H9N A;  4J8U A;  4XZQ C;  1M18 C;  2HIO D;  4WNN B;  3TU4 B;  5DNM A;  1N1J A;  5AV5 D;  4KUD A;  3KXB D;  1WWS A;  4NFT A;  3R45 B;  3X1T D;  5GT3 B;  3NQU A;  4JJN D;  1U35 A;  3KWQ D;  1P3B D;  5JRG D;  3REJ C;  4G91 B;  1P3M D;  3A1K A;  4J8X B;  3C1B B;  3AZN A;  2CV5 B;  3B0D C;  4ZUX A;  3UTB D;  3AZL A;  1W2E A;  4Z2M H;  5DNN C;  2NQB A;  5BNX B;  3AZG D;  3MNN B;  3B6G B;  3AZK B;  1BH9 A;  5B0Z C;  5KDM B;  3H0R C;  3REH C;  3B6F A;  3WKJ D;  3MGR A;  2JE5 A;  2F8N A;  3WAA A;  5B40 D;  5B32 C;  1P3F B;  2W8S A;  3W98 D;  1P3O D;  4QLC C;  3LZ0 D;  3LEL D;  4E44 A;  2DF4 C;  3AZF A;  1M1A C;  4G92 B;  2FFF B;  4WU9 A;  4YS3 D;  3VH6 T;  3WA9 A;  3H0L C;  3A6N B;  2BYK B;  5GT0 C;  5B33 C;  5CPI A;  1P3L D;  3MGS D;  4EO5 C;  1TZY C;  1S32 A;  5CPJ A;  5CP6 C;  2FJ7 B;  2F8N H;  5B24 A;  5B2I D;  4AWL C;  1P34 A;  3W96 A;  3REL D;  3AZE D;  3REK C;  2F8N G;  3REI D;  3AZI D;  3AN2 D;  1P3I A;  5GSU C;  1B6W A;  5F99 A;  1AOI A;  2J8P A;  2PYO C;  5AV8 A;  3KUY A;  3W99 C;  3TU4 D;  4CSR A;  2Y2Q A;  4XUJ B;  5B2J C;  5GT3 D;  4J8U C;  1Q9C A;  1KX4 B;  2F8N K;  4LD9 B;  5DNM C;  4KUD C;  4J8X D;  1F66 A;  4UUZ B;  3C1B D;  2CV5 D;  1P3G A;  4R8P B;  1H3O B;  4XZQ D;  2Y2H A;  5AVC A;  1U35 C;  3MGP A;  2Y2O A;  3MNN D;  3UTA A;  4H9R B;  3LJA C;  3B6G D;  3AZN C;  4J8V B;  3V9R A;  5BNV B;  4KGC B;  3AZK D;  4ZUX C;  3AZL C;  3AYW B;  5GXQ B;  1M18 A;  3AZM B;  3C1C B;  2BYM B;  4Z66 A;  3P5J B;  3B6F C;  3REJ A;  3MGR C;  5AV5 B;  3MVD A;  3WAA C;  5BO0 A;  5AV6 B;  5B0Z D;  3A6N D;  3MGQ B;  4WJ3 C;  3AZH A;  2NQB B;  3KWQ B;  1P3B B;  3AZF C;  5B32 D;  4WU9 C;  3WA9 C;  3AV2 B;  2Y2I A;  2Y2L A;  4DRA A;  1S32 C;  3UTB B;  5CPJ C;  3NQJ B;  5AV9 B;  1HQ3 A;  2ZY5 A;  5B33 D;  5C3I C;  5B24 C;  3O62 C;  1P34 C;  3W96 C;  3AFA A;  4XUJ D;  3X1U A;  3X1S A;  2LY8 A;  1P3I C;  5CPI B;  3W97 B;  5F99 C;  1P3P B;  5AV8 C;  3KUY C;  2BG1 A;  1KX4 D;  2Y2P A;  1BH8 A;  2ZY2 A;  4LD9 D;  1P3K A;  2F2A C;  4R8P D;  2NZD A;  5B31 A;  1JFI A;  1P3L B;  1PZR A;  3MGS B;  1P3A A;  3A1I A;  3WTP A;  1EQZ A;  5B2J D;  3REK A;  1F66 C;  1AOI B;  4J8V D;  4J8U D;  5GSU A;  1P3G C;  2IO5 B;  2JCH A;  3AYW D;  5DNM D;  4KUD D;  5GXQ D;  5BS7 A;  3MGP C;  2CWE A;  4H9P B;  5AY8 B;  3UTA C;  3AZE B;  4HGA B;  3AZJ B;  3C1C D;  3VH5 W;  3AV1 A;  3B0C T;  2ARO A;  5AV6 D;  3MGQ D;  5AVC B;  4Z5T A;  4YM6 B;  4Z66 C;  1TAF B;  5B31 G;  5CPK A;  2NQB D;  2G5I C;  4NE6 A;  5AVB B;  1ZLA A;  3EPH A;  3MVD C;  3LJA A;  3AV2 D;  1ID3 C;  3AZH C;  4XZQ B;  2F8N D;  3LZ1 A;  5AV9 D;  1M19 A;  4Z2M G;  3REJ B;  1WWI A;  5FUG B;  1HQ3 C;  3W97 D;  5CPI D;  3B0D B;  1P3P D;  4H9Q A;  5JA4 A;  1KX3 A;  5CPJ D;  5DNN B;  4X23 A;  4H9S A;  3AFA C;  2RVQ D;  3X1U C;  3H0M C;  3X1S C;  3UT9 A;  2HIO A;  2Y2G A;  5B0Z B;  3KXB A;  3REH B;  5E5A A;  3X1T A;  1P3K C;  4JJN A;  1AOI D;  5B32 B;  5B0Y A;  5JRG A;  3KUY D;  2NZD C;  1P3M A;  3O62 A;  5B31 C;  4QLC B;  4J8W C;  1M1A B;  1P3A C;  5AY8 D;  3WTP C;  3AZJ D;  1EQZ C;  2ZM5 A;  5GT0 B;  5B33 B;  3EPK A;  1KX5 A;  3AZG A;  1BH8 B;  4EO5 B;  1TZY B;  5BS7 C;  2UWX A;  5CP6 B;  4H9O A;  4NE3 A;  5G49 A;  2Y2M A;  3X1V C;  4E45 A;  5AVC D;  4YM6 D;  4AWL B;  3WKJ A;  3AV1 C;  3MGP D;  5B1M C;  2Y2N A;  3UTA D;  5B40 A;  3REK B;  2ARO C;  5AVB D;  3W98 A;  4ZBJ C;  3LZ0 A;  3LEL A;  2PYO B;  4Z5T C;  1M18 D;  3W99 B;  5CPK C;  4YS3 A;  1ZLA C;  4KHA B;  4WU8 A;  5CHL B;  5B2J B;  4H9N B;  4J8U B;  3REJ D;  5DNM B;  1N1J B;  2L5A A;  4KUD B;  3LZ1 C;  3IP4 C;  3AZH D;  3REL A;  2YFW A;  1M19 C;  3NQU B;  5B1L C;  4WZS B;  2HUE C;  3REI A;  3AZI A;  1U35 B;  5DNN D;  1KU5 A;  3LJA B;  3AZN B;  4WNN A;  3TU4 A;  2XD1 A;  4ZUX B;  3AZL B;  1KX3 C;  1ID3 A;  3REH D;  4X23 C;  4H9S C;  5GT3 A;  2YFV A;  4CAY A;  3UT9 C;  2HIO C;  1BH9 B;  4J8X A;  5BT1 C;  3KXB C;  3AFA D;  4QLC D;  3X1U D;  3C1B A;  2CV5 A;  1M1A D;  3B6F B;  5E5A C;  3MGR B;  2F8N B;  3X1T C;  4JJN C;  3WAA B;  5GT0 D;  5B0Y C;  5JRG C;  1P3M C;  1TZY D;  3B6G A;  5CP6 D;  3AZF B;  3AZK A;  4WU9 B;  5KDM A;  3WA9 B;  1KX5 C;  3AZG C;  1P3A D;  1S32 B;  5CPJ B;  3VH6 W;  3REK D;  1P3F A;  5C3I B;  5GSU D;  3EPJ A;  5B24 B;  3O62 B;  2PYO D;  3WKJ C;  1P34 B;  1ULY A;  2RIQ A;  3W99 D;  2ZY4 A;  3W96 B;  3A6N A;  4J8W A;  2BYK A;  5B40 C;  3W98 C;  1P3I B;  1P3O C;  5F99 B;  4DQY B;  3LZ0 C;  4WV4 B;  3LEL C;  5AV8 B;  3KUY B;  2FJ7 A;  4YS3 C;  4CSR B;  1BFM A;  4WU8 C;  4Z5T D;  3X1V A;  1U35 D;  5B1M A;  1F66 B;  5B2I C;  3LJA D;  3AZN D;  1P3G B;  3REL C;  4XUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...