3MGRA

Binding of rubidium ions to the nucleosome core particle
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbations in nucleosome structure from heavy metal association.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
molecule keywords Histone H3.2
total genus 31
structure length 99
sequence length 99
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3mgrA00
1F66B 3AZLA 1P3MA 1P3BD 3MGRA 2HIOA 5DNNC 2AROB 5GT3C 5AV8D 3WAAB 3X1UD 3R45A 1HQ3B 3AZNB 4J8WB 3RELD 5AVCA 3X1TC 4YM6B 3RELC 3AN2A 1TAFB 4J8XC 1TZYA 5CPKC 3NQJA 4KGCB 4UUZB 3C1CC 3W96D 5GT3A 4DRBA 3B6FD 3MVDA 4Z66A 3AFAA 2NQBB 1P3KC 1S32A 5B2IC 5G49B 4UUZA 4CSRA 3W97A 1AOIA 1P3IC 4LD9C 2HIOB 5B24C 4J8UB 3WKJB 5CPIC 1HQ3A 3MNNC 1WWSA 1AOIB 1BH8B 1P3OC 5AV9D 1P3AC 5JRGC 2BYMB 2YFWA 5B0YC 5JRGA 4KHAA 5AV9C 4WU8B 4J8XD 3REKA 3REHB 4G91C 5DNMD 3C1BD 2NQBD 3X1SB 3MVDB 1JFIA 1EQZC 3W98A 3NQJB 3X1TA 3B0CT 3REIA 2NQBC 3B0BA 3X1UC 1S32B 5B40B 5DNND 1P3MC 3MGSD 5BNVA 4J8WC 4YM6D 3AFAC 1U35B 1TZYB 4J8WA 4R8PA 3AZGA 5CP6D 1P3FC 3A6NA 3KUYA 3W96C 5CPKA 5GSUC 2CV5A 4YS3D 3AZID 3AZLB 5B0ZA 1KX3D 3AZGB 3REHC 3X1VD 4H9PA 3MGQB 3B0DC 1P3LB 1P3OA 3MGPA 3TU4D 5B33A 5DNMC 3C1BC 4H9SA 2IO5B 5FUGA 5GXQA 3WTPA 3AZLC 1M19A 1P3AA 4CSRB 3WKJA 5BNXA 4WNNA 2PYOD 5C3IB 1KU5A 3UTBC 2CWEA 3MGSC 5B24B 4J8UC 4NE6A 1M18C 5F99C 3MGPB 1BH9B 4EO5C 3LJAD 3MGQD 4X23C 5GT0B 3LJAC 5KDMB 5AV6D 1P34B 4ZBJB 4X23A 5AY8A 1P3PB 5CP6C 1P3FD 2BYMA 1P3MB 1U35A 3AZIB 1P3KA 2AROA 5E5AB 3MVDC 3AZHC 3AYWC 3AZNA 1EQZB 3B6FC 1P34C 5B31G 5B40A 2NZDC 4QLCC 5B31C 3KXBA 4WU9B 1P3GC 1P3GA 3NQUB 1HQ3C 4H9NB 3MNNA 4LD9D 5GSUD 1M18B 3REHA 2F8NK 1KX4C 5CPIB 5AVBA 2YFWB 3LELC 4J8VC 5B32G 5F99D 3LZ0B 3A6NC 3KUYC 4WU8A 1B6WA 4WU9C 1P3GB 3C1BB 4Z2MH 5DNMB 4LD9B 4ZUXD 4AWLC 1M18A 4H9PB 4XUJC 4WU9D 3UTBA 4Z5TA 4XUJA 3AV1B 1P3LA 1P3KB 4H9RB 4XZQC 3W99A 3WA9A 5AV8A 5B32D 3REIC 1EQZD 5E5AD 5B2ID 1P3PC 5CPKB 3W99B 2NZDD 2F8NA 5G49A 2FJ7C 1B67A 1M1AB 3AZKD 2RVQD 3LZ1A 3C1CD 1ID3C 3AZNC 3WA9C 4JJNA 5B40C 3B6FA 3AFAD 3AYWD 3AZHD 3AV2A 5CPIA 5B0ZC 5B1LC 2PYOB 1TAFA 1P3ID 3AV1C 3LELA 4J8VA 5JRGB 3MGRB 3UT9D 3AZGC 5B0YB 4XZQD 3AZFB 3WAAA 1F66A 3O62D 3KSYA 1AOIC 1F1EA 1HQ3D 3A6NB 3KUYB 4YS3B 3AZLD 4J8UA 5B0YD 1P3BA 3MGRD 3UT9B 5JRGD 1TZYC 5AV5A 4KUDD 3O62B 5BNVB 5DNMA 5B2JB 3C1BA 5B33C 3X1VC 5AVCD 5AVCC 3AZHB 3AYWB 2L5AA 3W96A 1JFIB 3W98B 3X1SC 5GT3D 5AV8C 3AV2B 3MVDD 4Z66D 3AN2B 4YM6C 3R45B 4DRAA 3X1SD 4R8PD 1M1AD 3O62C 5B2JC 1BFMA 3REJA 1AOID 5CPKD 2JSSA 2F8NB 3AV1A 4WZSB 5AV5B 1KX3A 1KX4D 1ZLAC 4QLCA 3AZFC 1N1JA 4R8PB 1ULYA 4WV4B 4M6BA 5BS7C 2F8NH 5BS7A 2HUEB 2BYKA 5AV5C 5B1MC 3LELB 4J8VB 5AVBB 3AZMD 3W96B 5FUGB 1H3OB 4KGCC 3MGQA 5AV6A 3LZ1B 3UTAD 4X23D 1ID3B 4KGCD 5AV6C 5B2JD 1P3FA 1M1AC 3W99C 3W97C 3AZEC 4KHAB 2YFVA 5B1MA 2AROD 5AV8B 3AV2C 5AY8B 3AZND 3X1UB 3A6ND 3KUYD 4Z66C 5GT0D 3AZFD 4G91B 4XZQB 4H9SC 3KXBD 1P3PD 3KWQC 3VH5A 2FJ7D 3KWQD 5GSUA 2CV5C 5B24A 1P3AB 5B31A 1ZLAA 3UT9C 3LZ0C 3MGPD 3TU4A 3AZJA 4H9QB 1P3BC 4CAYA 4G92C 4YS3C 1P3AD 2PYOA 3MGRC 4WU9A 4HGAC 3AZKB 3V9RA 4Z2MG 3TU4B 1P3LD 1KX3B 3W99D 2NZDB 1KX5A 3WA9D 1BH8A 5B2IB 2LY8A 1EQZA 3W98C 1N1JB 5AY8D 2YFVB 5E5AA 3RELA 1U35D 2NZDA 3B6GA 1P3KD 5CP6B 3W97B 1TZYD 4X23B 1ID3D 1BH9A 3LZ1D 3C1CA 3UTAB 2RVQC 3REKC 1H3OA 3LZ1C 5B40D 5F99B 3LZ0D 3MGPC 4H9QA 5KDMA 3MGSB 4H9OB 3AYWA 3AZHA 1P34A 3WAAC 3VH5W 5CPID 5DNNB 3AZEA 3MNND 1S32D 4LD9A 5CPJD 1Q9CA 1P3IA 3REHD 2IO5C 3WTPB 5GXQB 5AVBD 3AZMB 3LELD 4J8VD 1M19B 2HUEC 4H9OA 4WNNB 5BT1C 4XZQA 5B1LA 5AV9B 2BYKB 3B0DB 4WU8D 4R8PC 4ZUXA 2PYOC 3VH6A 5B0ZB 4Z5TD 3WTPC 5BO0A 5GXQC 1M19C 4J8UD 3WKJD 1HTAA 5AV5D 5AV9A 1KX4B 1P3MD 4KUDA 1P3FB 2HIOD 3AZJC 3X1UA 3REKD 2NQBA 3AN2C 3W98D 3B6FB 3AN2D 3AZKA 4Z66B 5CPJB 3AZIC 4JJND 3REIB 5JA4A 5AVCB 1M1AA 4WU8C 4YM6A 5B33B 4J8WD 3REJD 3RELB 3X1VB 3AZGD 5CP6A 3WTPE 3W97D 2CV5D 3UT9A 1P3OB 1KX4A 4KUDB 5C3IC 3WAAD 1F66D 3UTBB 4G92B 5AVBC 1P3BB 1P3OD 3REJB 5B0YA 2CV5B 5B33D 3KXBC 1P3IB 2F8NG 1ZLAB 4E44A 4J8XA 3VH5T 5B1LB 5E5AC 5JA4B 3B6GC 5AY8C 3LJAA 3X1TD 5B32C 3C1CB 3REID 4JJNB 3AFAB 3UTAA 1U35C 5B2JA 5DNNA 3AZEB 4J8XB 2FJ7B 3VH6T 3MGSA 3REKB 1R4VA 4NFTA 3X1SA 1A7WA 4JJNC 5B32B 5B1MB 3B6GB 5BO0B 3AV1D 4YS3A 4NE3A 3AZIA 4Z5TB 4ZUXB 4XUJB 5B0ZD 4AWLB 3KWQA 3V9RB 1P3GD 1KX3C 4H9RA 4QLCD 5B31D 3X1VA 1KX5B 3MNNB 5GSUB 5GXQD 3WTPD 1M19D 4KUDC 3AZMA 3WKJC 3NQUA 4H9NA 1M18D 4CAYB 4XUJD 1KX5D 5BT1D 5B31B 3UTAC 4QLCB 4KGCA 5B32A 1S32C 5CPJC 3B6GD 5B2IA 5B1MD 2F8ND 1ID3A 3WA9B 5GT0C 4ZBJC 5GT0A 3AZFA 3LJAB 3LZ0A 3TU4C 5AV6B 4HGAB 3AZKC 1P34D 1P3PA 3X1TB 4EO5B 3AZED 2AROC 5CHLB 5GT3B 3AZJB 3AV2D 2FJ7A 5CPJA 5B24D 5BNXB 1ZLAD 1WWIA 3B0CW 4E45A 1F66C 2HIOC 3AZJD 5B1LD 1KX5C 4NE5A 3MGQC 3VH6W 5F99A 1P3LC 3KXBB 3O62A 3KWQB 4Z5TC 3REJC 3AZMC 4ZUXC 3UTBD
chains in the Genus database with same CATH superfamily
1F66B 3AZLA 1P3MA 1P3BD 3MGRA 2HIOA 5DNNC 2AROB 5GT3C 2Y2GA 5AV8D 3WAAB 3X1UD 3R45A 1HQ3B 3AZNB 4J8WB 3RELD 5AVCA 3X1TC 4YM6B 3RELC 3AN2A 1TAFB 3EG5B 4J8XC 1TZYA 5CPKC 3NQJA 4KGCB 4UUZB 3C1CC 3W96D 5GT3A 4DRBA 3B6FD 3MVDA 4Z66A 3AFAA 2NQBB 1P3KC 1S32A 5B2IC 5G49B 4UUZA 4CSRA 3W97A 1AOIA 1P3IC 4LD9C 2HIOB 5B24C 4J8UB 3WKJB 5CPIC 1HQ3A 3MNNC 1WWSA 3UTBD 1BH8B 1AOIB 1P3OC 5AV9D 1P3AC 3H0MC 5JRGC 2BYMB 2YFWA 5B0YC 5JRGA 4KHAA 5AV9C 4WU8B 4J8XD 3REKA 3REHB 4G91C 5DNMD 3C1BD 2NQBD 3X1SB 3MVDB 1JFIA 1EQZC 3W98A 3NQJB 3X1TA 3B0CT 3REIA 2NQBC 3B0BA 3X1UC 1S32B 5B40B 5DNND 3AL0C 1P3MC 3MGSD 5BNVA 4J8WC 4YM6D 3AFAC 1U35B 1TZYB 4J8WA 4R8PA 2Y2IA 3H0RC 3AZGA 5CP6D 1P3FC 3A6NA 3KUYA 3W96C 5CPKA 5GSUC 2CV5A 4YS3D 3AZID 3AZLB 5B0ZA 1KX3D 3AZGB 3REHC 3X1VD 4H9PA 3MGQB 3B0DC 1P3LB 1P3OA 3MGPA 3TU4D 5B33A 5DNMC 3C1BC 4H9SA 2IO5B 5FUGA 5GXQA 3WTPA 3AZLC 1M19A 1P3AA 3A1KA 4CSRB 3WKJA 5BNXA 4WNNA 2PYOD 5C3IB 1KU5A 3UTBC 2CWEA 3MGSC 2DQNC 5B24B 4NE6A 4J8UC 5F99C 3MGPB 1BH9B 1M18C 4EO5C 3LJAD 3MGQD 3IP4C 4X23C 5GT0B 3LJAC 5KDMB 5AV6D 1P34B 4ZBJB 4X23A 5AY8A 1P3PB 5CP6C 1P3FD 2VQRA 2BYMA 1P3MB 1U35A 3AZIB 1P3KA 2AROA 5E5AB 3MVDC 3AZHC 3AYWC 3AZNA 1EQZB 3B6FC 1P34C 5B31G 5B40A 2NZDC 4QLCC 5B31C 3KXBA 4WU9B 1P3GC 1P3GA 3NQUB 1HQ3C 4H9NB 3MNNA 4LD9D 5GSUD 1M18B 3REHA 2F8NK 1KX4C 5CPIB 5AVBA 2YFWB 3LELC 4J8VC 5B32G 5F99D 3LZ0B 3A6NC 3KUYC 4WU8A 1B6WA 4WU9C 1P3GB 3C1BB 4Z2MH 5DNMB 4LD9B 4ZUXD 2JCHA 4AWLC 1M18A 4H9PB 4XUJC 4WU9D 3UTBA 4Z5TA 4XUJA 3H0LC 3AV1B 1P3LA 1P3KB 4H9RB 4XZQC 3W99A 2BG1A 2Y2QA 3WA9A 5AV8A 5B32D 3REIC 1EQZD 5E5AD 2XD1A 5B2ID 1P3PC 5CPKB 3W99B 2NZDD 2F8NA 5G49A 2FJ7C 1B67A 1M1AB 3AZKD 2RVQD 3LZ1A 3C1CD 1ID3C 3AZNC 3F6TA 4JJNA 3WA9C 5B40C 3B6FA 3AFAD 3AYWD 3AZHD 3AV2A 5CPIA 5B0ZC 5B1LC 2PYOB 1TAFA 1P3ID 3AV1C 3LELA 4J8VA 5JRGB 3MGRB 3UT9D 3AZGC 5B0YB 2Y2HA 4XZQD 3AZFB 3WAAA 1F66A 3O62D 3KSYA 1AOIC 1F1EA 1HQ3D 3A6NB 3KUYB 4YS3B 3AZLD 4J8UA 5B0YD 1P3BA 3MGRD 3UT9B 5JRGD 1TZYC 5AV5A 4KUDD 3O62B 5BNVB 2ZY2A 5DNMA 5B2JB 3C1BA 5B33C 2DF4C 3X1VC 5AVCD 1T3UA 5AVCC 3AZHB 3AYWB 2Y2NA 2L5AA 3W96A 1JFIB 3W98B 3X1SC 5GT3D 5AV8C 3AV2B 3MVDD 4Z66D 3AN2B 4YM6C 3R45B 4DRAA 3X1SD 4R8PD 1M1AD 3O62C 5B2JC 1BFMA 3REJA 1AOID 5CPKD 2JSSA 2F8NB 3AV1A 4WZSB 5AV5B 1KX3A 1KX4D 2ZM5A 1ZLAC 4QLCA 3AZFC 1N1JA 4R8PB 1ULYA 4WV4B 4M6BA 5BS7C 2F8NH 5BS7A 2HUEB 2BYKA 5AV5C 5B1MC 3LELB 4J8VB 5AVBB 3AZMD 3W96B 5FUGB 1H3OB 4UPKA 4KGCC 3MGQA 5AV6A 3LZ1B 3UTAD 4X23D 1ID3B 4KGCD 5AV6C 5B2JD 1P3FA 1W2EA 1M1AC 3W99C 3W97C 3AZEC 4KHAB 2YFVA 5B1MA 2AROD 5AV8B 3AV2C 5AY8B 3AZND 3X1UB 3A6ND 3KUYD 4Z66C 5GT0D 3AZFD 4G91B 3KFUG 4XZQB 4H9SC 3KXBD 1P3PD 3KWQC 3VH5A 2FJ7D 2F2AC 3KWQD 2UWXA 5GSUA 2CV5C 3EPHA 5B24A 1P3AB 5B31A 1ZLAA 3UT9C 3LZ0C 3MGPD 3TU4A 3AZJA 4H9QB 1P3BC 2ZY4A 4CAYA 4G92C 4YS3C 1P3AD 2PYOA 3MGRC 4WU9A 4HGAC 3AZKB 3V9RA 4Z2MG 3TU4B 1P3LD 2FFFB 1KX3B 3W99D 2NZDB 1KX5A 3WA9D 2Y2LA 1BH8A 5B2IB 2LY8A 1EQZA 3W98C 1N1JB 5AY8D 2YFVB 5E5AA 3EPLA 3P5JB 3RELA 1U35D 2NZDA 3B6GA 1P3KD 5CP6B 3W97B 1TZYD 4X23B 1ID3D 1BH9A 3LZ1D 3C1CA 3UTAB 2RVQC 3REKC 1H3OA 3A1IA 3LZ1C 5B40D 5F99B 3LZ0D 3MGPC 4H9QA 5KDMA 3MGSB 4H9OB 3AYWA 3AZHA 1P34A 2G5HC 3WAAC 3VH5W 5CPID 5DNNB 3AZEA 3MNND 1S32D 4LD9A 5CPJD 1Q9CA 1P3IA 3REHD 2IO5C 3WTPB 5GXQB 5AVBD 3AZMB 3LELD 4J8VD 1M19B 2HUEC 4H9OA 4WNNB 5BT1C 4XZQA 5B1LA 5AV9B 3EPKA 2BYKB 2RIQA 3B0DB 4WU8D 4R8PC 4ZUXA 2PYOC 3VH6A 5B0ZB 4Z5TD 5BO0A 5GXQC 3WTPC 1M19C 4J8UD 3WKJD 1HTAA 5AV5D 5AV9A 1KX4B 1P3MD 4KUDA 2JE5A 1P3FB 2HIOD 3AZJC 3X1UA 3REKD 2NQBA 3AN2C 3W98D 3B6FB 3AN2D 3AZKA 4Z66B 5CPJB 3AZIC 4JJND 3REIB 5JA4A 5AVCB 1M1AA 4WU8C 4YM6A 5B33B 4J8WD 3REJD 2Y2JA 3RELB 3X1VB 1PZRA 3AZGD 5CP6A 1Z2CB 3WTPE 3W97D 3FDDA 2CV5D 3UT9A 1P3OB 1KX4A 4KUDB 5C3IC 3WAAD 1F66D 3UTBB 4G92B 5AVBC 1P3BB 2Y2PA 1P3OD 3REJB 5B0YA 2CV5B 5B33D 3KXBC 1P3IB 2F8NG 2ZY3A 1ZLAB 4E44A 4J8XA 3VH5T 5B1LB 5E5AC 5JA4B 3B6GC 5AY8C 3LJAA 3X1TD 5B32C 3C1CB 3REID 4JJNB 3AFAB 3UTAA 1U35C 5B2JA 5DNNA 3EPJA 3AZEB 4J8XB 2FJ7B 3VH6T 3MGSA 3REKB 1R4VA 4NFTA 3X1SA 1A7WA 4JJNC 5B32B 5B1MB 3B6GB 5BO0B 3AV1D 4YS3A 4NE3A 3AZIA 4Z5TB 4ZUXB 4XUJB 5B0ZD 4AWLB 3KWQA 3V9RB 1P3GD 1KX3C 4H9RA 4QLCD 5B31D 3X1VA 1KX5B 3MNNB 5GSUB 5GXQD 3WTPD 1M19D 4KUDC 3AZMA 3WKJC 3NQUA 4H9NA 1M18D 2Y2MA 4CAYB 4XUJD 2XD5A 4DQYB 1KX5D 2W8SA 5BT1D 5B31B 3UTAC 4QLCB 4KGCA 5B32A 2ZY5A 1S32C 5CPJC 3B6GD 5B2IA 5B1MD 2F8ND 1ID3A 3WA9B 4WJ3C 5GT0C 4ZBJC 5GT0A 3AZFA 3LJAB 3LZ0A 3TU4C 5AV6B 4HGAB 2G5IC 3AZKC 1P34D 3X1TB 1P3PA 2J8PA 4EO5B 3AZED 2AROC 5CHLB 5GT3B 3AZJB 3AV2D 2FJ7A 5CPJA 5B24D 5BNXB 1ZLAD 1WWIA 3B0CW 4E45A 1F66C 2HIOC 3AZJD 2Y2OA 5B1LD 1KX5C 4NE5A 3MGQC 3VH6W 5F99A 1P3LC 3KXBB 3O62A 3KWQB 4Z5TC 3REJC 3AZMC 4ZUXC 2Y2KA
chains in the Genus database with same CATH topology
1F66B 3AZLA 1P3MA 1P3BD 3MGRA 2HIOA 5DNNC 2AROB 5GT3C 2Y2GA 5AV8D 3WAAB 3X1UD 3R45A 1HQ3B 3AZNB 4J8WB 3RELD 5AVCA 3X1TC 4YM6B 3RELC 3AN2A 1TAFB 3EG5B 4J8XC 1TZYA 5CPKC 3NQJA 4KGCB 4UUZB 3C1CC 3W96D 5GT3A 4DRBA 3B6FD 3MVDA 4Z66A 3AFAA 2NQBB 1P3KC 1S32A 5B2IC 5G49B 4UUZA 4CSRA 3W97A 1AOIA 1P3IC 4LD9C 2HIOB 5B24C 4J8UB 3WKJB 5CPIC 1HQ3A 3MNNC 1WWSA 3UTBD 1BH8B 1AOIB 1P3OC 5AV9D 1P3AC 3H0MC 5JRGC 2BYMB 2YFWA 5B0YC 5JRGA 4KHAA 5AV9C 4WU8B 4J8XD 3REKA 3REHB 4G91C 5DNMD 3C1BD 2NQBD 3X1SB 3MVDB 1JFIA 1EQZC 3W98A 3NQJB 3X1TA 3B0CT 3REIA 2NQBC 3B0BA 3X1UC 1S32B 5B40B 5DNND 3AL0C 1P3MC 3MGSD 5BNVA 4J8WC 4YM6D 3AFAC 1U35B 1TZYB 4J8WA 4R8PA 2Y2IA 3H0RC 3AZGA 5CP6D 1P3FC 3A6NA 3KUYA 3W96C 5CPKA 5GSUC 2CV5A 4YS3D 3AZID 3AZLB 5B0ZA 1KX3D 3AZGB 3REHC 3X1VD 4H9PA 3MGQB 3B0DC 1P3LB 1P3OA 3MGPA 3TU4D 5B33A 5DNMC 3C1BC 4H9SA 2IO5B 5FUGA 5GXQA 3WTPA 3AZLC 1M19A 1P3AA 3A1KA 4CSRB 3WKJA 5BNXA 4WNNA 2PYOD 5C3IB 1KU5A 3UTBC 2CWEA 3MGSC 2DQNC 5B24B 4NE6A 4J8UC 5F99C 3MGPB 1BH9B 1M18C 4EO5C 3LJAD 3MGQD 3IP4C 4X23C 5GT0B 3LJAC 5KDMB 5AV6D 1P34B 4ZBJB 4X23A 5AY8A 1P3PB 5CP6C 1P3FD 2VQRA 2BYMA 1P3MB 1U35A 3AZIB 1P3KA 2AROA 5E5AB 3MVDC 3AZHC 3AYWC 3AZNA 1EQZB 3B6FC 1P34C 5B31G 5B40A 2NZDC 4QLCC 5B31C 3KXBA 4WU9B 1P3GC 1P3GA 3NQUB 1HQ3C 4H9NB 3MNNA 4LD9D 5GSUD 1M18B 3REHA 2F8NK 1KX4C 5CPIB 5AVBA 2YFWB 3LELC 4J8VC 5B32G 5F99D 3LZ0B 3A6NC 3KUYC 4WU8A 1B6WA 4WU9C 1P3GB 3C1BB 4Z2MH 5DNMB 4LD9B 4ZUXD 2JCHA 4AWLC 1M18A 4H9PB 4XUJC 4WU9D 3UTBA 4Z5TA 4XUJA 3H0LC 3AV1B 1P3LA 1P3KB 4H9RB 4XZQC 3W99A 2BG1A 2Y2QA 3WA9A 5AV8A 5B32D 3REIC 1EQZD 5E5AD 2XD1A 5B2ID 1P3PC 5CPKB 3W99B 2NZDD 2F8NA 5G49A 2FJ7C 1B67A 1M1AB 3AZKD 2RVQD 3LZ1A 3C1CD 1ID3C 3AZNC 3F6TA 4JJNA 3WA9C 5B40C 3B6FA 3AFAD 3AYWD 3AZHD 3AV2A 5CPIA 5B0ZC 5B1LC 2PYOB 1TAFA 1P3ID 3AV1C 3LELA 4J8VA 5JRGB 3MGRB 3UT9D 3AZGC 5B0YB 2Y2HA 4XZQD 3AZFB 3WAAA 1F66A 3O62D 3KSYA 1AOIC 1F1EA 1HQ3D 3A6NB 3KUYB 4YS3B 3AZLD 4J8UA 5B0YD 1P3BA 3MGRD 3UT9B 5JRGD 1TZYC 5AV5A 4KUDD 3O62B 5BNVB 2ZY2A 5DNMA 5B2JB 3C1BA 5B33C 2DF4C 3X1VC 5AVCD 1T3UA 5AVCC 3AZHB 3AYWB 2Y2NA 2L5AA 3W96A 1JFIB 3W98B 3X1SC 5GT3D 5AV8C 3AV2B 3MVDD 4Z66D 3AN2B 4YM6C 3R45B 4DRAA 3X1SD 4R8PD 1M1AD 3O62C 5B2JC 1BFMA 3REJA 1AOID 5CPKD 2JSSA 2F8NB 3AV1A 4WZSB 5AV5B 1KX3A 1KX4D 2ZM5A 1ZLAC 4QLCA 3AZFC 1N1JA 4R8PB 1ULYA 4WV4B 4M6BA 5BS7C 2F8NH 5BS7A 2HUEB 2BYKA 5AV5C 5B1MC 3LELB 4J8VB 5AVBB 3AZMD 3W96B 5FUGB 1H3OB 4UPKA 4KGCC 3MGQA 5AV6A 3LZ1B 3UTAD 4X23D 1ID3B 4KGCD 5AV6C 5B2JD 1P3FA 1W2EA 1M1AC 3W99C 3W97C 3AZEC 4KHAB 2YFVA 5B1MA 2AROD 5AV8B 3AV2C 5AY8B 3AZND 3X1UB 3A6ND 3KUYD 4Z66C 5GT0D 3AZFD 4G91B 3KFUG 4XZQB 4H9SC 3KXBD 1P3PD 3KWQC 3VH5A 2FJ7D 2F2AC 3KWQD 2UWXA 5GSUA 2CV5C 3EPHA 5B24A 1P3AB 5B31A 1ZLAA 3UT9C 3LZ0C 3MGPD 3TU4A 3AZJA 4H9QB 1P3BC 2ZY4A 4CAYA 4G92C 4YS3C 1P3AD 2PYOA 3MGRC 4WU9A 4HGAC 3AZKB 3V9RA 4Z2MG 3TU4B 1P3LD 2FFFB 1KX3B 3W99D 2NZDB 1KX5A 3WA9D 2Y2LA 1BH8A 5B2IB 2LY8A 1EQZA 3W98C 1N1JB 5AY8D 2YFVB 5E5AA 3EPLA 3P5JB 3RELA 1U35D 2NZDA 3B6GA 1P3KD 5CP6B 3W97B 1TZYD 4X23B 1ID3D 1BH9A 3LZ1D 3C1CA 3UTAB 2RVQC 3REKC 1H3OA 3A1IA 3LZ1C 5B40D 5F99B 3LZ0D 3MGPC 4H9QA 5KDMA 3MGSB 4H9OB 3AYWA 3AZHA 1P34A 2G5HC 3WAAC 3VH5W 5CPID 5DNNB 3AZEA 3MNND 1S32D 4LD9A 5CPJD 1Q9CA 1P3IA 3REHD 2IO5C 3WTPB 5GXQB 5AVBD 3AZMB 3LELD 4J8VD 1M19B 2HUEC 4H9OA 4WNNB 5BT1C 4XZQA 5B1LA 5AV9B 3EPKA 2BYKB 2RIQA 3B0DB 4WU8D 4R8PC 4ZUXA 2PYOC 3VH6A 5B0ZB 4Z5TD 5BO0A 5GXQC 3WTPC 1M19C 4J8UD 3WKJD 1HTAA 5AV5D 5AV9A 1KX4B 1P3MD 4KUDA 2JE5A 1P3FB 2HIOD 3AZJC 3X1UA 3REKD 2NQBA 3AN2C 3W98D 3B6FB 3AN2D 3AZKA 4Z66B 5CPJB 3AZIC 4JJND 3REIB 5JA4A 5AVCB 1M1AA 4WU8C 4YM6A 5B33B 4J8WD 3REJD 2Y2JA 3RELB 3X1VB 1PZRA 3AZGD 5CP6A 1Z2CB 3WTPE 3W97D 3FDDA 2CV5D 3UT9A 1P3OB 1KX4A 4KUDB 5C3IC 3WAAD 1F66D 3UTBB 4G92B 5AVBC 1P3BB 2Y2PA 1P3OD 3REJB 5B0YA 2CV5B 5B33D 3KXBC 1P3IB 2F8NG 2ZY3A 1ZLAB 4E44A 4J8XA 3VH5T 5B1LB 5E5AC 5JA4B 3B6GC 5AY8C 3LJAA 3X1TD 5B32C 3C1CB 3REID 4JJNB 3AFAB 3UTAA 1U35C 5B2JA 5DNNA 3EPJA 3AZEB 4J8XB 2FJ7B 3VH6T 3MGSA 3REKB 1R4VA 4NFTA 3X1SA 1A7WA 4JJNC 5B32B 5B1MB 3B6GB 5BO0B 3AV1D 4YS3A 4NE3A 3AZIA 4Z5TB 4ZUXB 4XUJB 5B0ZD 4AWLB 3KWQA 3V9RB 1P3GD 1KX3C 4H9RA 4QLCD 5B31D 3X1VA 1KX5B 3MNNB 5GSUB 5GXQD 3WTPD 1M19D 4KUDC 3AZMA 3WKJC 3NQUA 4H9NA 1M18D 2Y2MA 4CAYB 4XUJD 2XD5A 4DQYB 1KX5D 2W8SA 5BT1D 5B31B 3UTAC 4QLCB 4KGCA 5B32A 2ZY5A 1S32C 5CPJC 3B6GD 5B2IA 5B1MD 2F8ND 1ID3A 3WA9B 4WJ3C 5GT0C 4ZBJC 5GT0A 3AZFA 3LJAB 3LZ0A 3TU4C 5AV6B 4HGAB 2G5IC 3AZKC 1P34D 3X1TB 1P3PA 2J8PA 4EO5B 3AZED 2AROC 5CHLB 5GT3B 3AZJB 3AV2D 2FJ7A 5CPJA 5B24D 5BNXB 1ZLAD 1WWIA 3B0CW 4E45A 1F66C 2HIOC 3AZJD 2Y2OA 5B1LD 1KX5C 4NE5A 3MGQC 3VH6W 5F99A 1P3LC 3KXBB 3O62A 3KWQB 4Z5TC 3REJC 3AZMC 4ZUXC 2Y2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F66 B;  3AZL A;  1P3M A;  1P3B D;  3MGR A;  2HIO A;  5DNN C;  2ARO B;  5GT3 C;  5AV8 D;  3WAA B;  3X1U D;  3R45 A;  1HQ3 B;  3AZN B;  4J8W B;  3REL D;  5AVC A;  3X1T C;  4YM6 B;  3REL C;  3AN2 A;  1TAF B;  4J8X C;  1TZY A;  5CPK C;  3NQJ A;  4KGC B;  4UUZ B;  3C1C C;  3W96 D;  5GT3 A;  4DRB A;  3B6F D;  3MVD A;  4Z66 A;  3AFA A;  2NQB B;  1P3K C;  1S32 A;  5B2I C;  5G49 B;  4UUZ A;  4CSR A;  3W97 A;  1AOI A;  1P3I C;  4LD9 C;  2HIO B;  5B24 C;  4J8U B;  3WKJ B;  5CPI C;  1HQ3 A;  3MNN C;  1WWS A;  1AOI B;  1BH8 B;  1P3O C;  5AV9 D;  1P3A C;  5JRG C;  2BYM B;  2YFW A;  5B0Y C;  5JRG A;  4KHA A;  5AV9 C;  4WU8 B;  4J8X D;  3REK A;  3REH B;  4G91 C;  5DNM D;  3C1B D;  2NQB D;  3X1S B;  3MVD B;  1JFI A;  1EQZ C;  3W98 A;  3NQJ B;  3X1T A;  3B0C T;  3REI A;  2NQB C;  3B0B A;  3X1U C;  1S32 B;  5B40 B;  5DNN D;  1P3M C;  3MGS D;  5BNV A;  4J8W C;  4YM6 D;  3AFA C;  1U35 B;  1TZY B;  4J8W A;  4R8P A;  3AZG A;  5CP6 D;  1P3F C;  3A6N A;  3KUY A;  3W96 C;  5CPK A;  5GSU C;  2CV5 A;  4YS3 D;  3AZI D;  3AZL B;  5B0Z A;  1KX3 D;  3AZG B;  3REH C;  3X1V D;  4H9P A;  3MGQ B;  3B0D C;  1P3L B;  1P3O A;  3MGP A;  3TU4 D;  5B33 A;  5DNM C;  3C1B C;  4H9S A;  2IO5 B;  5FUG A;  5GXQ A;  3WTP A;  3AZL C;  1M19 A;  1P3A A;  4CSR B;  3WKJ A;  5BNX A;  4WNN A;  2PYO D;  5C3I B;  1KU5 A;  3UTB C;  2CWE A;  3MGS C;  5B24 B;  4J8U C;  4NE6 A;  1M18 C;  5F99 C;  3MGP B;  1BH9 B;  4EO5 C;  3LJA D;  3MGQ D;  4X23 C;  5GT0 B;  3LJA C;  5KDM B;  5AV6 D;  1P34 B;  4ZBJ B;  4X23 A;  5AY8 A;  1P3P B;  5CP6 C;  1P3F D;  2BYM A;  1P3M B;  1U35 A;  3AZI B;  1P3K A;  2ARO A;  5E5A B;  3MVD C;  3AZH C;  3AYW C;  3AZN A;  1EQZ B;  3B6F C;  1P34 C;  5B31 G;  5B40 A;  2NZD C;  4QLC C;  5B31 C;  3KXB A;  4WU9 B;  1P3G C;  1P3G A;  3NQU B;  1HQ3 C;  4H9N B;  3MNN A;  4LD9 D;  5GSU D;  1M18 B;  3REH A;  2F8N K;  1KX4 C;  5CPI B;  5AVB A;  2YFW B;  3LEL C;  4J8V C;  5B32 G;  5F99 D;  3LZ0 B;  3A6N C;  3KUY C;  4WU8 A;  1B6W A;  4WU9 C;  1P3G B;  3C1B B;  4Z2M H;  5DNM B;  4LD9 B;  4ZUX D;  4AWL C;  1M18 A;  4H9P B;  4XUJ C;  4WU9 D;  3UTB A;  4Z5T A;  4XUJ A;  3AV1 B;  1P3L A;  1P3K B;  4H9R B;  4XZQ C;  3W99 A;  3WA9 A;  5AV8 A;  5B32 D;  3REI C;  1EQZ D;  5E5A D;  5B2I D;  1P3P C;  5CPK B;  3W99 B;  2NZD D;  2F8N A;  5G49 A;  2FJ7 C;  1B67 A;  1M1A B;  3AZK D;  2RVQ D;  3LZ1 A;  3C1C D;  1ID3 C;  3AZN C;  3WA9 C;  4JJN A;  5B40 C;  3B6F A;  3AFA D;  3AYW D;  3AZH D;  3AV2 A;  5CPI A;  5B0Z C;  5B1L C;  2PYO B;  1TAF A;  1P3I D;  3AV1 C;  3LEL A;  4J8V A;  5JRG B;  3MGR B;  3UT9 D;  3AZG C;  5B0Y B;  4XZQ D;  3AZF B;  3WAA A;  1F66 A;  3O62 D;  3KSY A;  1AOI C;  1F1E A;  1HQ3 D;  3A6N B;  3KUY B;  4YS3 B;  3AZL D;  4J8U A;  5B0Y D;  1P3B A;  3MGR D;  3UT9 B;  5JRG D;  1TZY C;  5AV5 A;  4KUD D;  3O62 B;  5BNV B;  5DNM A;  5B2J B;  3C1B A;  5B33 C;  3X1V C;  5AVC D;  5AVC C;  3AZH B;  3AYW B;  2L5A A;  3W96 A;  1JFI B;  3W98 B;  3X1S C;  5GT3 D;  5AV8 C;  3AV2 B;  3MVD D;  4Z66 D;  3AN2 B;  4YM6 C;  3R45 B;  4DRA A;  3X1S D;  4R8P D;  1M1A D;  3O62 C;  5B2J C;  1BFM A;  3REJ A;  1AOI D;  5CPK D;  2JSS A;  2F8N B;  3AV1 A;  4WZS B;  5AV5 B;  1KX3 A;  1KX4 D;  1ZLA C;  4QLC A;  3AZF C;  1N1J A;  4R8P B;  1ULY A;  4WV4 B;  4M6B A;  5BS7 C;  2F8N H;  5BS7 A;  2HUE B;  2BYK A;  5AV5 C;  5B1M C;  3LEL B;  4J8V B;  5AVB B;  3AZM D;  3W96 B;  5FUG B;  1H3O B;  4KGC C;  3MGQ A;  5AV6 A;  3LZ1 B;  3UTA D;  4X23 D;  1ID3 B;  4KGC D;  5AV6 C;  5B2J D;  1P3F A;  1M1A C;  3W99 C;  3W97 C;  3AZE C;  4KHA B;  2YFV A;  5B1M A;  2ARO D;  5AV8 B;  3AV2 C;  5AY8 B;  3AZN D;  3X1U B;  3A6N D;  3KUY D;  4Z66 C;  5GT0 D;  3AZF D;  4G91 B;  4XZQ B;  4H9S C;  3KXB D;  1P3P D;  3KWQ C;  3VH5 A;  2FJ7 D;  3KWQ D;  5GSU A;  2CV5 C;  5B24 A;  1P3A B;  5B31 A;  1ZLA A;  3UT9 C;  3LZ0 C;  3MGP D;  3TU4 A;  3AZJ A;  4H9Q B;  1P3B C;  4CAY A;  4G92 C;  4YS3 C;  1P3A D;  2PYO A;  3MGR C;  4WU9 A;  4HGA C;  3AZK B;  3V9R A;  4Z2M G;  3TU4 B;  1P3L D;  1KX3 B;  3W99 D;  2NZD B;  1KX5 A;  3WA9 D;  1BH8 A;  5B2I B;  2LY8 A;  1EQZ A;  3W98 C;  1N1J B;  5AY8 D;  2YFV B;  5E5A A;  3REL A;  1U35 D;  2NZD A;  3B6G A;  1P3K D;  5CP6 B;  3W97 B;  1TZY D;  4X23 B;  1ID3 D;  1BH9 A;  3LZ1 D;  3C1C A;  3UTA B;  2RVQ C;  3REK C;  1H3O A;  3LZ1 C;  5B40 D;  5F99 B;  3LZ0 D;  3MGP C;  4H9Q A;  5KDM A;  3MGS B;  4H9O B;  3AYW A;  3AZH A;  1P34 A;  3WAA C;  3VH5 W;  5CPI D;  5DNN B;  3AZE A;  3MNN D;  1S32 D;  4LD9 A;  5CPJ D;  1Q9C A;  1P3I A;  3REH D;  2IO5 C;  3WTP B;  5GXQ B;  5AVB D;  3AZM B;  3LEL D;  4J8V D;  1M19 B;  2HUE C;  4H9O A;  4WNN B;  5BT1 C;  4XZQ A;  5B1L A;  5AV9 B;  2BYK B;  3B0D B;  4WU8 D;  4R8P C;  4ZUX A;  2PYO C;  3VH6 A;  5B0Z B;  4Z5T D;  3WTP C;  5BO0 A;  5GXQ C;  1M19 C;  4J8U D;  3WKJ D;  1HTA A;  5AV5 D;  5AV9 A;  1KX4 B;  1P3M D;  4KUD A;  1P3F B;  2HIO D;  3AZJ C;  3X1U A;  3REK D;  2NQB A;  3AN2 C;  3W98 D;  3B6F B;  3AN2 D;  3AZK A;  4Z66 B;  5CPJ B;  3AZI C;  4JJN D;  3REI B;  5JA4 A;  5AVC B;  1M1A A;  4WU8 C;  4YM6 A;  5B33 B;  4J8W D;  3REJ D;  3REL B;  3X1V B;  3AZG D;  5CP6 A;  3WTP E;  3W97 D;  2CV5 D;  3UT9 A;  1P3O B;  1KX4 A;  4KUD B;  5C3I C;  3WAA D;  1F66 D;  3UTB B;  4G92 B;  5AVB C;  1P3B B;  1P3O D;  3REJ B;  5B0Y A;  2CV5 B;  5B33 D;  3KXB C;  1P3I B;  2F8N G;  1ZLA B;  4E44 A;  4J8X A;  3VH5 T;  5B1L B;  5E5A C;  5JA4 B;  3B6G C;  5AY8 C;  3LJA A;  3X1T D;  5B32 C;  3C1C B;  3REI D;  4JJN B;  3AFA B;  3UTA A;  1U35 C;  5B2J A;  5DNN A;  3AZE B;  4J8X B;  2FJ7 B;  3VH6 T;  3MGS A;  3REK B;  1R4V A;  4NFT A;  3X1S A;  1A7W A;  4JJN C;  5B32 B;  5B1M B;  3B6G B;  5BO0 B;  3AV1 D;  4YS3 A;  4NE3 A;  3AZI A;  4Z5T B;  4ZUX B;  4XUJ B;  5B0Z D;  4AWL B;  3KWQ A;  3V9R B;  1P3G D;  1KX3 C;  4H9R A;  4QLC D;  5B31 D;  3X1V A;  1KX5 B;  3MNN B;  5GSU B;  5GXQ D;  3WTP D;  1M19 D;  4KUD C;  3AZM A;  3WKJ C;  3NQU A;  4H9N A;  1M18 D;  4CAY B;  4XUJ D;  1KX5 D;  5BT1 D;  5B31 B;  3UTA C;  4QLC B;  4KGC A;  5B32 A;  1S32 C;  5CPJ C;  3B6G D;  5B2I A;  5B1M D;  2F8N D;  1ID3 A;  3WA9 B;  5GT0 C;  4ZBJ C;  5GT0 A;  3AZF A;  3LJA B;  3LZ0 A;  3TU4 C;  5AV6 B;  4HGA B;  3AZK C;  1P34 D;  1P3P A;  3X1T B;  4EO5 B;  3AZE D;  2ARO C;  5CHL B;  5GT3 B;  3AZJ B;  3AV2 D;  2FJ7 A;  5CPJ A;  5B24 D;  5BNX B;  1ZLA D;  1WWI A;  3B0C W;  4E45 A;  1F66 C;  2HIO C;  3AZJ D;  5B1L D;  1KX5 C;  4NE5 A;  3MGQ C;  3VH6 W;  5F99 A;  1P3L C;  3KXB B;  3O62 A;  3KWQ B;  4Z5T C;  3REJ C;  3AZM C;  4ZUX C;  3UTB D; 
#chains in the Genus database with same CATH topology
 1F66 B;  3AZL A;  1P3M A;  1P3B D;  3MGR A;  2HIO A;  5DNN C;  2ARO B;  5GT3 C;  2Y2G A;  5AV8 D;  3WAA B;  3X1U D;  3R45 A;  1HQ3 B;  3AZN B;  4J8W B;  3REL D;  5AVC A;  3X1T C;  4YM6 B;  3REL C;  3AN2 A;  1TAF B;  3EG5 B;  4J8X C;  1TZY A;  5CPK C;  3NQJ A;  4KGC B;  4UUZ B;  3C1C C;  3W96 D;  5GT3 A;  4DRB A;  3B6F D;  3MVD A;  4Z66 A;  3AFA A;  2NQB B;  1P3K C;  1S32 A;  5B2I C;  5G49 B;  4UUZ A;  4CSR A;  3W97 A;  1AOI A;  1P3I C;  4LD9 C;  2HIO B;  5B24 C;  4J8U B;  3WKJ B;  5CPI C;  1HQ3 A;  3MNN C;  1WWS A;  3UTB D;  1BH8 B;  1AOI B;  1P3O C;  5AV9 D;  1P3A C;  3H0M C;  5JRG C;  2BYM B;  2YFW A;  5B0Y C;  5JRG A;  4KHA A;  5AV9 C;  4WU8 B;  4J8X D;  3REK A;  3REH B;  4G91 C;  5DNM D;  3C1B D;  2NQB D;  3X1S B;  3MVD B;  1JFI A;  1EQZ C;  3W98 A;  3NQJ B;  3X1T A;  3B0C T;  3REI A;  2NQB C;  3B0B A;  3X1U C;  1S32 B;  5B40 B;  5DNN D;  3AL0 C;  1P3M C;  3MGS D;  5BNV A;  4J8W C;  4YM6 D;  3AFA C;  1U35 B;  1TZY B;  4J8W A;  4R8P A;  2Y2I A;  3H0R C;  3AZG A;  5CP6 D;  1P3F C;  3A6N A;  3KUY A;  3W96 C;  5CPK A;  5GSU C;  2CV5 A;  4YS3 D;  3AZI D;  3AZL B;  5B0Z A;  1KX3 D;  3AZG B;  3REH C;  3X1V D;  4H9P A;  3MGQ B;  3B0D C;  1P3L B;  1P3O A;  3MGP A;  3TU4 D;  5B33 A;  5DNM C;  3C1B C;  4H9S A;  2IO5 B;  5FUG A;  5GXQ A;  3WTP A;  3AZL C;  1M19 A;  1P3A A;  3A1K A;  4CSR B;  3WKJ A;  5BNX A;  4WNN A;  2PYO D;  5C3I B;  1KU5 A;  3UTB C;  2CWE A;  3MGS C;  2DQN C;  5B24 B;  4NE6 A;  4J8U C;  5F99 C;  3MGP B;  1BH9 B;  1M18 C;  4EO5 C;  3LJA D;  3MGQ D;  3IP4 C;  4X23 C;  5GT0 B;  3LJA C;  5KDM B;  5AV6 D;  1P34 B;  4ZBJ B;  4X23 A;  5AY8 A;  1P3P B;  5CP6 C;  1P3F D;  2VQR A;  2BYM A;  1P3M B;  1U35 A;  3AZI B;  1P3K A;  2ARO A;  5E5A B;  3MVD C;  3AZH C;  3AYW C;  3AZN A;  1EQZ B;  3B6F C;  1P34 C;  5B31 G;  5B40 A;  2NZD C;  4QLC C;  5B31 C;  3KXB A;  4WU9 B;  1P3G C;  1P3G A;  3NQU B;  1HQ3 C;  4H9N B;  3MNN A;  4LD9 D;  5GSU D;  1M18 B;  3REH A;  2F8N K;  1KX4 C;  5CPI B;  5AVB A;  2YFW B;  3LEL C;  4J8V C;  5B32 G;  5F99 D;  3LZ0 B;  3A6N C;  3KUY C;  4WU8 A;  1B6W A;  4WU9 C;  1P3G B;  3C1B B;  4Z2M H;  5DNM B;  4LD9 B;  4ZUX D;  2JCH A;  4AWL C;  1M18 A;  4H9P B;  4XUJ C;  4WU9 D;  3UTB A;  4Z5T A;  4XUJ A;  3H0L C;  3AV1 B;  1P3L A;  1P3K B;  4H9R B;  4XZQ C;  3W99 A;  2BG1 A;  2Y2Q A;  3WA9 A;  5AV8 A;  5B32 D;  3REI C;  1EQZ D;  5E5A D;  2XD1 A;  5B2I D;  1P3P C;  5CPK B;  3W99 B;  2NZD D;  2F8N A;  5G49 A;  2FJ7 C;  1B67 A;  1M1A B;  3AZK D;  2RVQ D;  3LZ1 A;  3C1C D;  1ID3 C;  3AZN C;  3F6T A;  4JJN A;  3WA9 C;  5B40 C;  3B6F A;  3AFA D;  3AYW D;  3AZH D;  3AV2 A;  5CPI A;  5B0Z C;  5B1L C;  2PYO B;  1TAF A;  1P3I D;  3AV1 C;  3LEL A;  4J8V A;  5JRG B;  3MGR B;  3UT9 D;  3AZG C;  5B0Y B;  2Y2H A;  4XZQ D;  3AZF B;  3WAA A;  1F66 A;  3O62 D;  3KSY A;  1AOI C;  1F1E A;  1HQ3 D;  3A6N B;  3KUY B;  4YS3 B;  3AZL D;  4J8U A;  5B0Y D;  1P3B A;  3MGR D;  3UT9 B;  5JRG D;  1TZY C;  5AV5 A;  4KUD D;  3O62 B;  5BNV B;  2ZY2 A;  5DNM A;  5B2J B;  3C1B A;  5B33 C;  2DF4 C;  3X1V C;  5AVC D;  1T3U A;  5AVC C;  3AZH B;  3AYW B;  2Y2N A;  2L5A A;  3W96 A;  1JFI B;  3W98 B;  3X1S C;  5GT3 D;  5AV8 C;  3AV2 B;  3MVD D;  4Z66 D;  3AN2 B;  4YM6 C;  3R45 B;  4DRA A;  3X1S D;  4R8P D;  1M1A D;  3O62 C;  5B2J C;  1BFM A;  3REJ A;  1AOI D;  5CPK D;  2JSS A;  2F8N B;  3AV1 A;  4WZS B;  5AV5 B;  1KX3 A;  1KX4 D;  2ZM5 A;  1ZLA C;  4QLC A;  3AZF C;  1N1J A;  4R8P B;  1ULY A;  4WV4 B;  4M6B A;  5BS7 C;  2F8N H;  5BS7 A;  2HUE B;  2BYK A;  5AV5 C;  5B1M C;  3LEL B;  4J8V B;  5AVB B;  3AZM D;  3W96 B;  5FUG B;  1H3O B;  4UPK A;  4KGC C;  3MGQ A;  5AV6 A;  3LZ1 B;  3UTA D;  4X23 D;  1ID3 B;  4KGC D;  5AV6 C;  5B2J D;  1P3F A;  1W2E A;  1M1A C;  3W99 C;  3W97 C;  3AZE C;  4KHA B;  2YFV A;  5B1M A;  2ARO D;  5AV8 B;  3AV2 C;  5AY8 B;  3AZN D;  3X1U B;  3A6N D;  3KUY D;  4Z66 C;  5GT0 D;  3AZF D;  4G91 B;  3KFU G;  4XZQ B;  4H9S C;  3KXB D;  1P3P D;  3KWQ C;  3VH5 A;  2FJ7 D;  2F2A C;  3KWQ D;  2UWX A;  5GSU A;  2CV5 C;  3EPH A;  5B24 A;  1P3A B;  5B31 A;  1ZLA A;  3UT9 C;  3LZ0 C;  3MGP D;  3TU4 A;  3AZJ A;  4H9Q B;  1P3B C;  2ZY4 A;  4CAY A;  4G92 C;  4YS3 C;  1P3A D;  2PYO A;  3MGR C;  4WU9 A;  4HGA C;  3AZK B;  3V9R A;  4Z2M G;  3TU4 B;  1P3L D;  2FFF B;  1KX3 B;  3W99 D;  2NZD B;  1KX5 A;  3WA9 D;  2Y2L A;  1BH8 A;  5B2I B;  2LY8 A;  1EQZ A;  3W98 C;  1N1J B;  5AY8 D;  2YFV B;  5E5A A;  3EPL A;  3P5J B;  3REL A;  1U35 D;  2NZD A;  3B6G A;  1P3K D;  5CP6 B;  3W97 B;  1TZY D;  4X23 B;  1ID3 D;  1BH9 A;  3LZ1 D;  3C1C A;  3UTA B;  2RVQ C;  3REK C;  1H3O A;  3A1I A;  3LZ1 C;  5B40 D;  5F99 B;  3LZ0 D;  3MGP C;  4H9Q A;  5KDM A;  3MGS B;  4H9O B;  3AYW A;  3AZH A;  1P34 A;  2G5H C;  3WAA C;  3VH5 W;  5CPI D;  5DNN B;  3AZE A;  3MNN D;  1S32 D;  4LD9 A;  5CPJ D;  1Q9C A;  1P3I A;  3REH D;  2IO5 C;  3WTP B;  5GXQ B;  5AVB D;  3AZM B;  3LEL D;  4J8V D;  1M19 B;  2HUE C;  4H9O A;  4WNN B;  5BT1 C;  4XZQ A;  5B1L A;  5AV9 B;  3EPK A;  2BYK B;  2RIQ A;  3B0D B;  4WU8 D;  4R8P C;  4ZUX A;  2PYO C;  3VH6 A;  5B0Z B;  4Z5T D;  5BO0 A;  5GXQ C;  3WTP C;  1M19 C;  4J8U D;  3WKJ D;  1HTA A;  5AV5 D;  5AV9 A;  1KX4 B;  1P3M D;  4KUD A;  2JE5 A;  1P3F B;  2HIO D;  3AZJ C;  3X1U A;  3REK D;  2NQB A;  3AN2 C;  3W98 D;  3B6F B;  3AN2 D;  3AZK A;  4Z66 B;  5CPJ B;  3AZI C;  4JJN D;  3REI B;  5JA4 A;  5AVC B;  1M1A A;  4WU8 C;  4YM6 A;  5B33 B;  4J8W D;  3REJ D;  2Y2J A;  3REL B;  3X1V B;  1PZR A;  3AZG D;  5CP6 A;  1Z2C B;  3WTP E;  3W97 D;  3FDD A;  2CV5 D;  3UT9 A;  1P3O B;  1KX4 A;  4KUD B;  5C3I C;  3WAA D;  1F66 D;  3UTB B;  4G92 B;  5AVB C;  1P3B B;  2Y2P A;  1P3O D;  3REJ B;  5B0Y A;  2CV5 B;  5B33 D;  3KXB C;  1P3I B;  2F8N G;  2ZY3 A;  1ZLA B;  4E44 A;  4J8X A;  3VH5 T;  5B1L B;  5E5A C;  5JA4 B;  3B6G C;  5AY8 C;  3LJA A;  3X1T D;  5B32 C;  3C1C B;  3REI D;  4JJN B;  3AFA B;  3UTA A;  1U35 C;  5B2J A;  5DNN A;  3EPJ A;  3AZE B;  4J8X B;  2FJ7 B;  3VH6 T;  3MGS A;  3REK B;  1R4V A;  4NFT A;  3X1S A;  1A7W A;  4JJN C;  5B32 B;  5B1M B;  3B6G B;  5BO0 B;  3AV1 D;  4YS3 A;  4NE3 A;  3AZI A;  4Z5T B;  4ZUX B;  4XUJ B;  5B0Z D;  4AWL B;  3KWQ A;  3V9R B;  1P3G D;  1KX3 C;  4H9R A;  4QLC D;  5B31 D;  3X1V A;  1KX5 B;  3MNN B;  5GSU B;  5GXQ D;  3WTP D;  1M19 D;  4KUD C;  3AZM A;  3WKJ C;  3NQU A;  4H9N A;  1M18 D;  2Y2M A;  4CAY B;  4XUJ D;  2XD5 A;  4DQY B;  1KX5 D;  2W8S A;  5BT1 D;  5B31 B;  3UTA C;  4QLC B;  4KGC A;  5B32 A;  2ZY5 A;  1S32 C;  5CPJ C;  3B6G D;  5B2I A;  5B1M D;  2F8N D;  1ID3 A;  3WA9 B;  4WJ3 C;  5GT0 C;  4ZBJ C;  5GT0 A;  3AZF A;  3LJA B;  3LZ0 A;  3TU4 C;  5AV6 B;  4HGA B;  2G5I C;  3AZK C;  1P34 D;  3X1T B;  1P3P A;  2J8P A;  4EO5 B;  3AZE D;  2ARO C;  5CHL B;  5GT3 B;  3AZJ B;  3AV2 D;  2FJ7 A;  5CPJ A;  5B24 D;  5BNX B;  1ZLA D;  1WWI A;  3B0C W;  4E45 A;  1F66 C;  2HIO C;  3AZJ D;  2Y2O A;  5B1L D;  1KX5 C;  4NE5 A;  3MGQ C;  3VH6 W;  5F99 A;  1P3L C;  3KXB B;  3O62 A;  3KWQ B;  4Z5T C;  3REJ C;  3AZM C;  4ZUX C;  2Y2K A; 
#chains in the Genus database with same CATH homology
 1F66 B;  3AZL A;  1P3M A;  1P3B D;  3MGR A;  2HIO A;  5DNN C;  2ARO B;  5GT3 C;  2Y2G A;  5AV8 D;  3WAA B;  3X1U D;  3R45 A;  1HQ3 B;  3AZN B;  4J8W B;  3REL D;  5AVC A;  3X1T C;  4YM6 B;  3REL C;  3AN2 A;  1TAF B;  3EG5 B;  4J8X C;  1TZY A;  5CPK C;  3NQJ A;  4KGC B;  4UUZ B;  3C1C C;  3W96 D;  5GT3 A;  4DRB A;  3B6F D;  3MVD A;  4Z66 A;  3AFA A;  2NQB B;  1P3K C;  1S32 A;  5B2I C;  5G49 B;  4UUZ A;  4CSR A;  3W97 A;  1AOI A;  1P3I C;  4LD9 C;  2HIO B;  5B24 C;  4J8U B;  3WKJ B;  5CPI C;  1HQ3 A;  3MNN C;  1WWS A;  3UTB D;  1BH8 B;  1AOI B;  1P3O C;  5AV9 D;  1P3A C;  3H0M C;  5JRG C;  2BYM B;  2YFW A;  5B0Y C;  5JRG A;  4KHA A;  5AV9 C;  4WU8 B;  4J8X D;  3REK A;  3REH B;  4G91 C;  5DNM D;  3C1B D;  2NQB D;  3X1S B;  3MVD B;  1JFI A;  1EQZ C;  3W98 A;  3NQJ B;  3X1T A;  3B0C T;  3REI A;  2NQB C;  3B0B A;  3X1U C;  1S32 B;  5B40 B;  5DNN D;  3AL0 C;  1P3M C;  3MGS D;  5BNV A;  4J8W C;  4YM6 D;  3AFA C;  1U35 B;  1TZY B;  4J8W A;  4R8P A;  2Y2I A;  3H0R C;  3AZG A;  5CP6 D;  1P3F C;  3A6N A;  3KUY A;  3W96 C;  5CPK A;  5GSU C;  2CV5 A;  4YS3 D;  3AZI D;  3AZL B;  5B0Z A;  1KX3 D;  3AZG B;  3REH C;  3X1V D;  4H9P A;  3MGQ B;  3B0D C;  1P3L B;  1P3O A;  3MGP A;  3TU4 D;  5B33 A;  5DNM C;  3C1B C;  4H9S A;  2IO5 B;  5FUG A;  5GXQ A;  3WTP A;  3AZL C;  1M19 A;  1P3A A;  3A1K A;  4CSR B;  3WKJ A;  5BNX A;  4WNN A;  2PYO D;  5C3I B;  1KU5 A;  3UTB C;  2CWE A;  3MGS C;  2DQN C;  5B24 B;  4NE6 A;  4J8U C;  5F99 C;  3MGP B;  1BH9 B;  1M18 C;  4EO5 C;  3LJA D;  3MGQ D;  3IP4 C;  4X23 C;  5GT0 B;  3LJA C;  5KDM B;  5AV6 D;  1P34 B;  4ZBJ B;  4X23 A;  5AY8 A;  1P3P B;  5CP6 C;  1P3F D;  2VQR A;  2BYM A;  1P3M B;  1U35 A;  3AZI B;  1P3K A;  2ARO A;  5E5A B;  3MVD C;  3AZH C;  3AYW C;  3AZN A;  1EQZ B;  3B6F C;  1P34 C;  5B31 G;  5B40 A;  2NZD C;  4QLC C;  5B31 C;  3KXB A;  4WU9 B;  1P3G C;  1P3G A;  3NQU B;  1HQ3 C;  4H9N B;  3MNN A;  4LD9 D;  5GSU D;  1M18 B;  3REH A;  2F8N K;  1KX4 C;  5CPI B;  5AVB A;  2YFW B;  3LEL C;  4J8V C;  5B32 G;  5F99 D;  3LZ0 B;  3A6N C;  3KUY C;  4WU8 A;  1B6W A;  4WU9 C;  1P3G B;  3C1B B;  4Z2M H;  5DNM B;  4LD9 B;  4ZUX D;  2JCH A;  4AWL C;  1M18 A;  4H9P B;  4XUJ C;  4WU9 D;  3UTB A;  4Z5T A;  4XUJ A;  3H0L C;  3AV1 B;  1P3L A;  1P3K B;  4H9R B;  4XZQ C;  3W99 A;  2BG1 A;  2Y2Q A;  3WA9 A;  5AV8 A;  5B32 D;  3REI C;  1EQZ D;  5E5A D;  2XD1 A;  5B2I D;  1P3P C;  5CPK B;  3W99 B;  2NZD D;  2F8N A;  5G49 A;  2FJ7 C;  1B67 A;  1M1A B;  3AZK D;  2RVQ D;  3LZ1 A;  3C1C D;  1ID3 C;  3AZN C;  3F6T A;  4JJN A;  3WA9 C;  5B40 C;  3B6F A;  3AFA D;  3AYW D;  3AZH D;  3AV2 A;  5CPI A;  5B0Z C;  5B1L C;  2PYO B;  1TAF A;  1P3I D;  3AV1 C;  3LEL A;  4J8V A;  5JRG B;  3MGR B;  3UT9 D;  3AZG C;  5B0Y B;  2Y2H A;  4XZQ D;  3AZF B;  3WAA A;  1F66 A;  3O62 D;  3KSY A;  1AOI C;  1F1E A;  1HQ3 D;  3A6N B;  3KUY B;  4YS3 B;  3AZL D;  4J8U A;  5B0Y D;  1P3B A;  3MGR D;  3UT9 B;  5JRG D;  1TZY C;  5AV5 A;  4KUD D;  3O62 B;  5BNV B;  2ZY2 A;  5DNM A;  5B2J B;  3C1B A;  5B33 C;  2DF4 C;  3X1V C;  5AVC D;  1T3U A;  5AVC C;  3AZH B;  3AYW B;  2Y2N A;  2L5A A;  3W96 A;  1JFI B;  3W98 B;  3X1S C;  5GT3 D;  5AV8 C;  3AV2 B;  3MVD D;  4Z66 D;  3AN2 B;  4YM6 C;  3R45 B;  4DRA A;  3X1S D;  4R8P D;  1M1A D;  3O62 C;  5B2J C;  1BFM A;  3REJ A;  1AOI D;  5CPK D;  2JSS A;  2F8N B;  3AV1 A;  4WZS B;  5AV5 B;  1KX3 A;  1KX4 D;  2ZM5 A;  1ZLA C;  4QLC A;  3AZF C;  1N1J A;  4R8P B;  1ULY A;  4WV4 B;  4M6B A;  5BS7 C;  2F8N H;  5BS7 A;  2HUE B;  2BYK A;  5AV5 C;  5B1M C;  3LEL B;  4J8V B;  5AVB B;  3AZM D;  3W96 B;  5FUG B;  1H3O B;  4UPK A;  4KGC C;  3MGQ A;  5AV6 A;  3LZ1 B;  3UTA D;  4X23 D;  1ID3 B;  4KGC D;  5AV6 C;  5B2J D;  1P3F A;  1W2E A;  1M1A C;  3W99 C;  3W97 C;  3AZE C;  4KHA B;  2YFV A;  5B1M A;  2ARO D;  5AV8 B;  3AV2 C;  5AY8 B;  3AZN D;  3X1U B;  3A6N D;  3KUY D;  4Z66 C;  5GT0 D;  3AZF D;  4G91 B;  3KFU G;  4XZQ B;  4H9S C;  3KXB D;  1P3P D;  3KWQ C;  3VH5 A;  2FJ7 D;  2F2A C;  3KWQ D;  2UWX A;  5GSU A;  2CV5 C;  3EPH A;  5B24 A;  1P3A B;  5B31 A;  1ZLA A;  3UT9 C;  3LZ0 C;  3MGP D;  3TU4 A;  3AZJ A;  4H9Q B;  1P3B C;  2ZY4 A;  4CAY A;  4G92 C;  4YS3 C;  1P3A D;  2PYO A;  3MGR C;  4WU9 A;  4HGA C;  3AZK B;  3V9R A;  4Z2M G;  3TU4 B;  1P3L D;  2FFF B;  1KX3 B;  3W99 D;  2NZD B;  1KX5 A;  3WA9 D;  2Y2L A;  1BH8 A;  5B2I B;  2LY8 A;  1EQZ A;  3W98 C;  1N1J B;  5AY8 D;  2YFV B;  5E5A A;  3EPL A;  3P5J B;  3REL A;  1U35 D;  2NZD A;  3B6G A;  1P3K D;  5CP6 B;  3W97 B;  1TZY D;  4X23 B;  1ID3 D;  1BH9 A;  3LZ1 D;  3C1C A;  3UTA B;  2RVQ C;  3REK C;  1H3O A;  3A1I A;  3LZ1 C;  5B40 D;  5F99 B;  3LZ0 D;  3MGP C;  4H9Q A;  5KDM A;  3MGS B;  4H9O B;  3AYW A;  3AZH A;  1P34 A;  2G5H C;  3WAA C;  3VH5 W;  5CPI D;  5DNN B;  3AZE A;  3MNN D;  1S32 D;  4LD9 A;  5CPJ D;  1Q9C A;  1P3I A;  3REH D;  2IO5 C;  3WTP B;  5GXQ B;  5AVB D;  3AZM B;  3LEL D;  4J8V D;  1M19 B;  2HUE C;  4H9O A;  4WNN B;  5BT1 C;  4XZQ A;  5B1L A;  5AV9 B;  3EPK A;  2BYK B;  2RIQ A;  3B0D B;  4WU8 D;  4R8P C;  4ZUX A;  2PYO C;  3VH6 A;  5B0Z B;  4Z5T D;  5BO0 A;  5GXQ C;  3WTP C;  1M19 C;  4J8U D;  3WKJ D;  1HTA A;  5AV5 D;  5AV9 A;  1KX4 B;  1P3M D;  4KUD A;  2JE5 A;  1P3F B;  2HIO D;  3AZJ C;  3X1U A;  3REK D;  2NQB A;  3AN2 C;  3W98 D;  3B6F B;  3AN2 D;  3AZK A;  4Z66 B;  5CPJ B;  3AZI C;  4JJN D;  3REI B;  5JA4 A;  5AVC B;  1M1A A;  4WU8 C;  4YM6 A;  5B33 B;  4J8W D;  3REJ D;  2Y2J A;  3REL B;  3X1V B;  1PZR A;  3AZG D;  5CP6 A;  1Z2C B;  3WTP E;  3W97 D;  3FDD A;  2CV5 D;  3UT9 A;  1P3O B;  1KX4 A;  4KUD B;  5C3I C;  3WAA D;  1F66 D;  3UTB B;  4G92 B;  5AVB C;  1P3B B;  2Y2P A;  1P3O D;  3REJ B;  5B0Y A;  2CV5 B;  5B33 D;  3KXB C;  1P3I B;  2F8N G;  2ZY3 A;  1ZLA B;  4E44 A;  4J8X A;  3VH5 T;  5B1L B;  5E5A C;  5JA4 B;  3B6G C;  5AY8 C;  3LJA A;  3X1T D;  5B32 C;  3C1C B;  3REI D;  4JJN B;  3AFA B;  3UTA A;  1U35 C;  5B2J A;  5DNN A;  3EPJ A;  3AZE B;  4J8X B;  2FJ7 B;  3VH6 T;  3MGS A;  3REK B;  1R4V A;  4NFT A;  3X1S A;  1A7W A;  4JJN C;  5B32 B;  5B1M B;  3B6G B;  5BO0 B;  3AV1 D;  4YS3 A;  4NE3 A;  3AZI A;  4Z5T B;  4ZUX B;  4XUJ B;  5B0Z D;  4AWL B;  3KWQ A;  3V9R B;  1P3G D;  1KX3 C;  4H9R A;  4QLC D;  5B31 D;  3X1V A;  1KX5 B;  3MNN B;  5GSU B;  5GXQ D;  3WTP D;  1M19 D;  4KUD C;  3AZM A;  3WKJ C;  3NQU A;  4H9N A;  1M18 D;  2Y2M A;  4CAY B;  4XUJ D;  2XD5 A;  4DQY B;  1KX5 D;  2W8S A;  5BT1 D;  5B31 B;  3UTA C;  4QLC B;  4KGC A;  5B32 A;  2ZY5 A;  1S32 C;  5CPJ C;  3B6G D;  5B2I A;  5B1M D;  2F8N D;  1ID3 A;  3WA9 B;  4WJ3 C;  5GT0 C;  4ZBJ C;  5GT0 A;  3AZF A;  3LJA B;  3LZ0 A;  3TU4 C;  5AV6 B;  4HGA B;  2G5I C;  3AZK C;  1P34 D;  3X1T B;  1P3P A;  2J8P A;  4EO5 B;  3AZE D;  2ARO C;  5CHL B;  5GT3 B;  3AZJ B;  3AV2 D;  2FJ7 A;  5CPJ A;  5B24 D;  5BNX B;  1ZLA D;  1WWI A;  3B0C W;  4E45 A;  1F66 C;  2HIO C;  3AZJ D;  2Y2O A;  5B1L D;  1KX5 C;  4NE5 A;  3MGQ C;  3VH6 W;  5F99 A;  1P3L C;  3KXB B;  3O62 A;  3KWQ B;  4Z5T C;  3REJ C;  3AZM C;  4ZUX C;  2Y2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...