3MH4A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
343
structure length
301
Chain Sequence
b'QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 57
structure length 301
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A01
5T6GA 2FI3E 1DFPA 1DT2A 5ESBA 2LPRA 5H4IB 2D8IA 2DB5A 2BD5A 1GJDB 2GV6A 4ABBA 1C5LH 2C8WB 3QDOA 1WQVH 4OS1A 4Q7YA 1K32A 4UFDH 2YT8A 1O5EH 1LDTT 1ANBA 1PPFE 1TRYA 2VGCB 3TLOA 1ZPBA 1JIMA 3TGJE 1UTOA 1YPMH 1UCYH 2BXUH 4D76A 1AU8A 3TK9A 1C1RA 1PQ5A 3FP6E 2ZTZA 2L4SA 4IBLH 4A5TS 3NKKA 2QXIA 1OYTH 3SV8A 2STAE 4Y10E 1V2QT 1CVWH 3BIUH 3EE0B 1ZOKA 1BQYA 2BYGA 1F2SE 4I8LA 2VIPA 1WHDA 3KL6A 4K72A 2Q1JA 1O3HA 3GDSA 1HAOH 3FZZA 1Y59T 5JPMH 2P3TB 1WAYB 2VVUA 3QWCH 5SGAE 4WYUA 1O3IA 1IU2A 2H3LA 1QQUA 1BTWA 1HNEE 1KDQA 4INKA 3GSLA 2V3OH 1HJ9A 1ELFA 3RXFA 4R0IA 3SBKA 3VFEA 2P8OB 5E0GA 1AE5A 3CBXA 3UTUH 1P2MA 3LGTA 1FLEE 1FY8E 4DOQA 4MPAA 2YNAA 1LHGH 3AW0A 2ULLA 2ODPA 3GISB 1GDUA 1KDQB 2OD3B 3DFJA 4B74A 1BRBE 4LMMA 4RSPA 3RXTA 2WPJS 4YOIA 2BDAA 1Z7KA 1BBRE 3AAVA 1X45A 1OWIA 1WF8A 1TPPA 2BQ6B 2FEQH 2QXGA 3O8BA 5E22A 2F5YA 1CGHA 1K22H 2AWWA 1C5TA 3TSZA 2GDDA 1O2PA 2HWLB 3EGGC 3TVJB 3QZQA 5GPIB 4X8SH 3SJKA 3TK5A 1TOCB 3BTFE 2KOJA 2STBE 1QJ6B 4Q7ZA 3ZZ4A 2ZGJA 2OMJA 1P04A 1LHCH 1TPSA 3GDUA 2OP9A 3GY8A 1ELCA 4Y7AA 2F9VA 5K7RA 5A8XA 3PYHA 2GMTC 1HXFH 2IWQA 1ZUBA 2R4HA 2ZDAH 4FUBA 1HAHH 2ZC9H 8GCHF 3BN9A 4ZHLU 3UR9A 2QN5T 2DE8A 1G32B 4CRDA 5C2ZA 1AWFH 1YF4A 2DLUA 1MKXK 2BQWB 1U3BA 1QRWA 4DIHH 1IQIA 2HNTF 4I33A 2YTWA 5JBTA 1QLCA 4JOKA 3LGVA 3E0PB 1QY6A 1MTUA 1A4WH 5TCCA 1G3EA 2BX4A 2FMJA 3F68H 2VU8E 5EW1H 3Q3KA 2G8TA 3SU6A 3RDZA 5A2MH 3Q00A 3AAUA 4OS5A 5J4QA 1UMAH 4ZXYH 2EDZA 1CQQA 1HDTH 2SNVA 1O2WA 3SHUA 1WFGA 1TALA 1BBRH 3GOVB 4D7FA 1NZQH 1CHOG 2FI4E 4U2WA 1MAYA 2GT7A 4MPWA 2XNIA 4YLQH 2BD4A 4DT7B 4JK6A 3MFJA 2UWLA 5AFYH 2O8WA 1TPOA 3BTHE 1T8MA 6GCHF 1EPTC 1NY22 4Y0ZE 1TX6A 3RP2A 3HK6B 4XFQA 4AFZA 2ZHQH 3H5CB 1ELAA 1UHBA 4NWKA 4X0WU 4OS2A 2M5TA 2VIOA 3E6PH 2ZDVH 2I6SA 1BJUA 2A7CA 8LPRA 1TBRH 3OTJE 3M7QA 4MNYA 3SQEE 1MQ6A 1NESE 3ATLA 1UVSH 1E35B 1D4PB 4D7GA 1C5OH 2HGTH 2PUQH 3RC4A 8ESTE 2AIQA 1Z8GA 1EPTA 3ZVAA 4B71A 3LDXH 1BTZA 5D13A 1SGRE 2NU3E 2XTTB 4DIIH 1EKBB 2VSVA 1YPEH 1TBZH 2BM2A 4FUHA 4K1TA 1B5GH 1QBOA 4ABHA 3UR6A 1O2KA 4F8KA 3VPKA 3O8RA 1D3DB 3O5NA 1AB9B 2BD7A 1GI0A 1FNIA 2FOBA 7KMEH 2VWRA 3FVFB 5TJXA 1HJAB 2ZHEH 3PWCA 1KSNA 2ZFQH 4O06A 4P2AB 5EXMA 2CF8H 2RCZA 4NA9H 1GVKB 1K1JA 1O3NA 2R2MB 3T2NA 1SOTA 2W7UA 3HKJB 4K8YA 1YPKH 3CENA 3PMHB 1S82A 2BDGA 2OBQA 3BSQA 4XE4A 1DXWA 1F0TA 1ZHRA 3I29A 2OLGA 3FY5A 4ZMAH 2XYAA 2Y5FA 1KLJH 4CH2B 1MD8A 1A61H 1P0SH 2Y81A 3RLYH 5FB8C 2W26A 3RLWH 3SU1A 3QLPH 2ZWLH 2ILNA 2PKAB 1QURH 1V2TT 1WV7H 3T26A 1UTQA 1ZSJA 1QJ7B 2P3FH 1GBKA 1O3CA 1J9CH 1BJVA 2WV4A 5EXNA 1H8IH 3M36A 2C8ZB 4ISNA 7LPRA 2CSSA 3KGPA 1VB7A 3T29A 3GCNA 2I1NA 1FI8A 6LPRA 1YLDA 1FC9A 2FI5E 3MNXA 2OGPA 4VGCC 4I7YH 1GBFA 1EAUA 4WYTA 2J95A 1NC6A 3A8BA 5HFBA 1TMTH 2O8LA 2F9NA 2BY9X 1MMJN 2Y6TA 1U39A 5LPFA 1IHJA 1OPHB 8KME2 4LK4A 5HMAA 1C2IA 2FPZA 1PQ8A 2OZFA 3D49H 2KA9A 1KEFA 4ZKNU 4U01A 5G4BA 4Q2KA 2DLSA 2FOAA 1FY3A 3T25A 2ZCLP 3F1SB 1C2LA 1MKWK 2BXTH 1FY1A 3PDVA 4WH6A 2BD8A 2X7ZA 4FUJA 1O30A 2BLOA 4CREA 2W5EA 3O8DA 1QGFA 2B0FA 3UQVA 4BAMB 1DX5M 4B1TA 4E34A 5A8YA 2EI8A 1EAWA 4Q7XA 5ESTE 4ABAA 1QA7A 2XWAA 1VITG 4JOEA 1Q31A 1O3MA 3JZ2B 2KPKA 1FJSA 4GLYA 4AYVB 2GZVA 2GZ7A 1ZJKA 4AORA 2DC2A 3UOPA 5I25A 2REYA 1YBOA 2FIRH 2EEKA 3DHKH 1A3BH 2Z9IA 1ANDA 2ZP0H 1HBTH 1O2RA 7GCHG 1GGDC 1T4UH 1G9IE 1RGQA 2LUIA 3P92A 4NA7A 5DJ7A 5A0AE 2BY7X 2AGGX 3Q3XA 1W13U 1P12E 4I32A 2VIQA 2IJOB 1J17T 3K82A 2OQSA 3RMNH 1K1IA 1O2HA 1XUFA 1N6YA 1Y5BT 2SNWA 2JXOA 1XMNB 3LGWA 3OY5U 1N7EA 1TX7A 4E06H 4UU5A 2PGBB 2ZO3H 5C20A 1Z6JH 4NMRA 5HF1A 4ISOA 3LGIA 2BVXH 2VH0A 4BAHB 1YYY1 5HEYA 1B0EA 2V1WA 1GJ9B 1ZR0A 1HYLA 3K6YA 1JWTA 2A32A 2ODYB 1C5VA 1BRCE 3MO9A 1SLUB 6CHAC 1GDNA 3SJ9A 1DY8A 1A5IA 1P2NA 3U9AH 2J92A 2WYGA 5AFZH 3RU4E 5EPNA 2C3SA 2XC0A 2W7SA 1NO9H 1QB6A 3A80A 1CBWB 2I0LA 3A8DA 4K5ZA 4ABDA 2TBSA 1JXPA 3U8TH 1HB0B 1AZ8A 3BG4B 4IS5A 3PM3A 3SUDA 1TLDA 2BHGA 2MHOA 1XVMA 2A0QB 2JH5D 1A0LA 5FAHA 2EEIA 1NRSH 4WXIA 4ZKOU 4NWLA 4GHTA 2OC1A 1V6DA 1BE9A 3PV5A 1YCPH 5L2ZH 4AFSA 1A2CH 5T3HA 1A46H 2ALPA 2B7DH 2NU4E 3A8AA 5EZ0A 3VB7A 5GJ4B 3P8GA 1UF1A 2QC2A 3SOSA 3L33A 4JOHA 1DSTA 2HRVA 5JBBS 3HPMA 1YM0A 3QUMP 3ZVGA 3BTKE 3E91A 3BV9B 4DURA 2ZKSA 4KFVA 1NU9A 1UTMA 2FOEA 1YBWA 3CH8A 1V2KT 1QBNA 3F9GA 1RTFB 4NA8A 2AGEX 2FX6A 5HF4A 2G4TA 1O35A 1KLIH 1UVPA 2H2BA 2M3MA 4Y0YE 5C5NA 1GHBG 1GI2A 3Q76A 4NNMA 3HGNA 1RIWB 1UTNA 1QL7A 2FOHA 1UEZA 2XBVA 5JB8S 1N7TA 3A89A 4N6XA 4JYUH 1M9UA 2GVFA 1J8AA 4OEOA 4ZKRU 1FIWA 1GBDA 2BDYA 1H4WA 1IOEA 4Z0KA 4YM9A 3CS0A 3PV4A 1OSSA 5EPYA 1OS8A 1RXPA 1OWJA 4HFPB 1BMLA 3P70B 4XBBA 1OWEA 2XCNA 1GG6C 4IMZA 1LQEA 1DLEA 3O46A 1LVBA 1XZ9A 5I46H 4NMPA 4B73A 4IMQA 1UM7A 4AYYB 2QKUA 1YLCA 5DO4H 1DWBH 1SLWB 1WTHD 3R3GB 4AG2A 1GI3A 1WIFA 3PMBB 1XVOA 2BVRH 5FPTA 2A5AA 1HAIH 3S7HB 3SW2B 1L0ZA 5C1UA 2BB4A 1C5ZB 4KFWA 2HGAA 5E21A 1TPAE 1GCTC 3A7VA 1QA0A 1SGNE 2H5CA 2Y5HA 2ZF0H 1PYTD 2K1QA 2FE5A 3VB4A 4X6OA 1KXCA 2IPHA 2WV5A 1BCUH 5F8ZA 5F8TA 1JOUB 2GP9B 1PJPA 1LVOA 3TJVA 1C1SA 1O34A 1T31A 3UNQA 2ZTXA 2LC7A 2G4UA 5F03A 1FMGA 2OBOA 3MH4A 5H3JA 1WYKA 3SOEA 1TB6H 3KZEA 1W8BH 1SR5C 3ID1A 4IN1A 1O0DH 5FCRA 1AI8H 1Q2WA 2EEHA 1V2WT 2ZCKP 3ZV8A 2F9UA 4NIXA 1SOZA 2JETB 3MNBA 5B6LA 2WPLS 1FAXA 1CU1A 3ZZ5A 1BITA 2ZFPH 1P10A 1O3DA 1ZRKA 1N1LA 3LNYA 3PLBA 3MWIU 1GBEA 4YT7H 1AQ7A 1XX9A 1O5BB 1ZZZA 2CV3A 3RC6A 1Y3XA 1INCA 2XRCA 5CHAB 1K2I1 3ZV9A 2VWMA 4ZH8A 3S69A 1AVGH 2FS8A 1O32A 5LGOA 5GLJA 3PTNA 5DP7A 1P06A 3NWUA 1AZZA 1YPGH 1LHEH 3K50A 1P2QA 4SGBE 2ZPSA 1CGJE 2P16A 3HKIB 1DS2E 1C5QA 1DICA 2V3HH 2Z9JA 3RC5A 3SNAA 3KQCA 2VWNA 1C4V2 4ISHH 3SU5A 1DWDH 3URDA 1Z71A 1WHAA 1O37A 1TABE 1EB1H 4U30A 1YPJH 1BRAA 2H9TH 3OY6U 1X8SA 4A1VA 2FM2A 1TQ7B 3W94A 5GDSH 3STIA 2R0KA 2SFAA 3C27B 1DXPA 1X6DA 1F5LA 4X8UH 4O97A 2J94A 4X1RU 1ELGA 4DCDA 1LHDH 2B5TB 1GM1A 3TJOA 3BG8A 3LOXA 3SV9A 4FU7A 2GCHG 2ZPRA 1PYTC 3O8CA 3A7XA 3UIRA 1PQ7A 4OAJA 4ISIH 3DJ1A 3SNDA 2H5DA 1YPHE 1ZPZA 1O2VA 1T2MA 2P95A 1XKBC 2Z9GA 1ZOMA 1G9OA 1E36B 2D26C 5IYTA 4Y11E 2HPQH 3FFGA 5DP3A 3VGCB 1J14A 1WG6A 2F3CE 4AZ2B 2AMDA 2ZGXH 3MU8A 2FX4A 1AFQB 2C8XB 4Q2QA 2JH6D 3UFAA 1TNKA 1DE7H 1Y3UA 2P94A 4MLFB 1L1NA 1EOJA 4MNVA 1C2JA 2R9PA 5IDKA 3UNSA 2BLWA 1K9OE 3KIDU 3TPIZ 4JORA 1BHXB 2EHRA 3RXHA 4NMSA 5C1XA 1C4U2 1TWXB 5T6FA 3I18A 1MU6B 3KCGH 5DP5A 2PKUA 5A8ZA 4FGMA 1LHFH 4HZHA 5DP4A 2TPIZ 5HFDA 3QGNB 2W7RA 1CA8B 4JZFH 1L1GA 1C1NA 5A2PA 1SQAA 4X8TH 2EI7A 2BOKA 1SLXB 1F5RA 1K1PA 1BT7A 5AF9H 1C1OA 1ARBA 1TNLA 4WH8A 1TFXA 2FODA 3MU4A 4EDJA 1GQ5A 1HPGA 5E2PA 2ZFRH 2A31A 2GT8A 4ZHAA 2YT7A 4Q6SA 1GHWH 1O3GA 1ZTKA 2C93B 1WF7A 3MOCA 2CSJA 2ZGHA 3K1RA 1TQ0B 3LC5A 4BAQB 3GY3A 1O2OA 4YDPA 4LXBH 3PDZA 3QZRA 4WWYA 2ZGCA 4AMHA 3FAOA 1GMDG 3TJNA 1QFKH 1BFEA 1DDJA 4UFEH 1L1JA 1X5RA 1QRXA 2ZHFH 1CT4E 3ID2A 1ZMLA 3MNCA 1ZMNA 1WU1A 4KKDA 4MPUA 4X1SU 1X5QA 2QCYA 4BTIB 1AHTH 2PTCE 4E05H 4IW4E 1G3CA 3RXKA 1KXEA 1XUJA 4MNXA 2I4SA 3ATWA 2P93A 2DMZA 5GCHF 1O3JA 1XM1A 3U69H 3GGEA 1T32A 5LPRA 3CBZA 2HOBA 1C4Y2 1ZLRA 4H4FA 2WUBA 1V2MT 1ELBA 1GMHF 1VGCC 1FIZA 1UTLM 1HAVA 2ZA5A 3LC3A 4CRGA 5LPEA 1THRH 2BTCE 5EQQA 2KYLA 3Q3YA 3RMLH 1EJNA 1SFQB 3R0FA 4NNLA 1N7FA 2FS9A 3H7OA 1MBQA 4K1SA 1UVUH 1TNJA 1ABIH 1UEPA 1E38B 2G2LA 2ZDNA 2EEJA 4THNH 2D2DA 4B76A 1FC6A 4E35A 5EOKA 1DOJA 2PSYA 4TY6A 1B7XB 1P09A 3EA9A 3WKLA 2P59A 3QTOH 1LKBA 4K3JA 4X6PA 3CBYA 1UHPA 5HJ1A 1L4ZA 2QXJA 3LONA 3NUMA 2KAWA 3ID3A 1U37A 1LO6A 4F49A 1PPHE 3SU4A 3C1KA 2GMTB 1IQNA 1O39A 1EP6A 1DANH 1Z6EA 1TGCA 1C1QA 4JL7A 2ZIQH 1ANCA 2PUXB 2BQ7B 1FDPA 1GJ7B 4TPYA 5CE1A 1O5FH 1EX3A 3KZDA 2BY6X 5F6MA 4NXQA 1SQTA 4NZLA 2ZU3A 2PA1A 1GPZA 3PLPA 3LJOA 1ETRH 1SFIA 1ZYOA 1A0HB 1PQAA 1TMBH 3A87A 3GCHC 3P8FA 1K21H 2UUYA 3LH1A 4Q80A 2HE4A 4J2YB 4PQWA 2PWXA 3EGKH 4O9VA 4AFQA 1A3EH 2BDHA 1GJ6A 1P2JA 1VA8A 3KEEA 3ODFA 2JKHA 3PMJA 3M5NA 4JOFA 1UHBB 1ZMJA 1GVLA 4A1XA 1O3OA 3CS7A 1IU0A 1Z8JB 2XXLA 2KOHA 2XW9A 1BA8B 3BIVH 2BX3A 1QAVA 2L4TA 1WI4A 3HGPA 3UREA 3DT0H 1THSH 2J38A 1EPTB 1V2UT 3RMMH 4RKOB 2F9BH 4JYTA 1C9PA 1MBMA 2CXVA 1Z86A 4JOPA 1KLTA 2EC9H 3SV6A 4B2CA 1UFXA 2Z3CA 2KBSA 3PTBA 1P3EA 2GZ9A 2PV9B 2V35A 1QJ1B 2ANKH 3M5LA 4Q2PA 5HGGA 3RXAA 1W12U 3V0XA 4ZROA 1YCPM 4CR5A 3R0HA 2BD9A 1Q3XA 5JBCS 1Z1JA 1N6FA 5HEDA 4J1YA 1A0JA 2YOLA 3V13A 1BB0B 4K76A 5HETA 2P3UB 8GCHG 1SLVB 1DPOA 1GHYH 5CMXH 2R3UA 2J4IA 1UCYK 3ZVBA 2TRMA 3FANA 4Q2NA 1EJAA 2A45B 1KWAA 4D8NA 3GYMA 4GVUA 2OCSA 1IQHA 2EAQA 1TGSZ 1RS0A 1V62A 1GBHA 1KTSB 1AD8H 4I8GA 1K1MA 3RXIA 1GMCF 1FQ3A 1F92A 2GGVB 3SNBA 2LOBA 1H9IE 3UY9A 1AY6H 1WBGB 2HALA 1OOKB 2JINA 1E0FD 3M3SA 1OBXA 2ENOA 1Z87A 4I31A 3SHCH 4DGJA 1P02A 4CR9A 1QHRB 3ZZBA 1ZRBA 1C5SA 1RGRA 1SGPE 1SPJA 2VIVA 2MX6A 1F0SA 2FOMB 4ZXXH 4XHVA 1W0YH 3TNTA 3GDVA 1AUTC 4BANB 2L97A 1P11E 1L4DA 1O2YA 1BMNH 1EZUC 1O36A 6GCHG 3QGLA 4OS7A 3S7KB 3SUZA 1S84A 2BOHB 1TIOA 2CHAC 4DY7B 1ZSKA 3VXFH 4BNRA 1VCWA 4UU6A 2I0IA 4TY7A 5BPEA 2M0ZA 1PPGE 1GI6A 1F7ZA 3CP7A 2WPIS 4ABIA 3PS4A 1Y3WA 2THFB 1KIGH 4FUEA 4FUCA 3U1IB 2SGFE 4MVNA 4Z6AH 3ZZ6A 4VGCB 1GBLA 2H1UA 1N6DA 2FN5A 2ZZUH 2O8TA 3NXPA 2QG1A 1DLKB 1BTYA 3GCTF 2PNTA 3ZVFA 1PPEE 2CF9H 2EI6A 3E16B 3G01A 1L6OA 2V0BA 2XC5A 1GHBF 1L2EA 2GZ8A 4RN6A 4LZ4B 5B6OA 3GY7A 2XC4A 3GICB 1UTJA 1NFXA 2C8YB 2QXHA 2ZFTA 4KGAA 3UWIA 5HYOA 4IC5A 5JB9S 1I16A 1E37B 4U32A 2M0VA 1BOQA 1AN1E 2BDIA 2VNTA 4I8KA 2FZZA 3PLKA 2UWOA 1QTFA 3S9BA 3PO1C 1WCZA 5C1YA 2QV1A 3MI4A 4GCHF 1IQGA 1HCGA 5E1YA 2AFQB 4R2ZA 5HDYA 4TWWA 2QF0A 4GAWA 1XXDA 3QGJA 1SBWA 3PROA 2B8OH 4HOPA 2KJDA 2GD4B 3QIKA 1XKAC 1Y7NA 5G1EA 1V2NT 1XXFA 3TH3H 4WXVA 3U1JB 4ABEA 1OYQA 2ZQ1A 1FN8A 4SGAE 1SG8B 2FTLE 2NWNA 1ANEA 2PKSC 3IWMA 3TSWA 1C1VH 2GX4A 1TP5A 2VIWA 2GTBA 1GGDB 1UJ1A 1VITH 4WF8A 4RI0A 3HPTB 1HAYB 1JRSA 2ZHDA 5E0HA 4WJG2 2A7HA 3ZZ9A 1O2NA 3BTGE 3SJIA 4D9RA 4PROA 2JREA 2DKRA 3HVQC 1NFYA 4GPGA 1DUAA 1EXFA 1W10U 4M7GA 1DITH 1AUJA 2H2ZA 2LA8A 1N99A 1C2EA 2VWLA 4JOJA 3RXUA 1V3XA 2FLBH 1FC7A 3TH4H 2ESTE 3P95A 1TQ3A 3ATMA 1EJMA 4GHQA 3AXAA 3N7OA 4BOHA 1WOFA 4I8JA 6CHAB 2ZPQA 5DG6A 3SU0A 2V90A 1CGIE 3RXRA 1N6XA 2G5NA 1QNJA 1RFNA 1MZDA 2WPMS 2A4QA 3TGKE 2A4OA 3P6ZB 3P8NA 1YP9A 2WYJA 5FXLA 3UWJH 1A7SA 2XBXA 2ZFFH 1NF3C 1FCFA 1BTXA 4UONA 2AH4X 2D90A 2Y5GA 4INHA 3A84A 1AE8H 1TYNA 4CRFA 5E0JA 2Z94A 2QAAA 3WY8A 1VAEA 2KRGA 5JYIA 1BTPA 2AYWA 1C2GA 4QT8C 4UEHH 1IHTH 2A1DB 1H9LB 2W3IA 5EODA 2LNCA 1WFVA 1UTKA 1UEQA 2KQFA 1ORFA 1OWDA 2OQUA 3ZYEA 1BMAA 1MTVA 2O2TA 1O2MA 1S0RA 1CA0C 3SU3A 3M5OA 1GQ4A 1EAXA 3D62A 1ESTA 4GSOA 2Q3GA 1ELEE 3PWBA 2OPGA 3ELAH 2FP7B 1UVOA 3SNEA 2PTNA 3RU4T 2ZNKH 1IQLA 1C5NH 2I6VA 1O5CB 4Z33A 1C5YB 4X6MA 4AFUA 1ZGVA 2Z3DA 3VXEH 1IQKA 1RTLA 1THPB 1G2LA 1TA2A 3SZNA 4NZQA 4JMYA 1WTGH 3ATKA 2GCTC 2IWNA 1KYNA 2OCVB 5GXPA 2FOGA 5JDUB 9LPRA 2C4FH 1EB2A 2JOAA 4ZHMU 1N6EA 1P57B 2QYIA 3M7UA 1C5PA 1A1RA 4AGJA 1UJDA 1NU7B 1MTNC 4K2YA 1S6HA 4ISLA 3V3MA 1AVXA 2ASUB 3GY2A 5GIBA 3ZVDA 1TRMA 1C1WH 1WSSH 4AOQA 4K1EA 1JRTA 2Y7ZA 1O2SA 2AWUA 3B23B 3FZDA 4OS4A 1GG6B 1KXBA 5A0BA 5A09A 2FYRA 4LZ1H 3MTYA 3EAJA 1GBMA 1NTPA 1ARCA 1NN6A 2A2QH 3UPEA 2PFEA 1VR1H 1C5UA 3Q77A 2KPLA 4TPIZ 4ABFA 5FBIA 1MKXH 2Z6BD 2BDCA 4I8HA 4WVPE 1UJUA 3LGUA 1O2TA 1GVZA 4X2VA 3SUEA 3IITA 3L4FD 1MZAA 1TNGA 1FPHH 3NPSA 4FUDA 4K60A 3RMOH 2I6QA 1GCTB 1MTWA 3M35A 1AO5A 1GHZA 2O8MA 1QIXB 4JCNA 3ODDA 4FU8A 1AVWA 2YUBA 1ELDE 2QY0B 2O9QA 2ODQA 1V2VT 2QKTA 3MHWU 1O31A 1GCDA 4MDSA 4P0CA 3B8JA 2F0AA 5HM9A 2ZQ2A 4GVDA 2SGAA 5FX5A 1G30B 1MH0A 2AINA 1V2LT 1KXFA 2ALVA 1CSOE 3ENSB 4E7NA 1GBTA 2F9OA 5JXBA 1LKAA 1HAXB 1K1NA 3F9FA 3SGQE 1N8OC 1Y5UT 5EQSA 4AG1A 1XUIA 5ETXA 1TAWA 1KXDA 2KOMA 1DVAH 1ESAA 1TE0A 1GMDF 4YYXA 3OYPA 1QQ4A 3QO6A 4NMTA 3EQ0H 1MQ5A 2H3MA 2D8WA 2H9HA 1GL0E 2BDBA 1C5WB 4NIWA 1Z8RA 4CHAC 3RXJA 1TA6A 2SGQE 3RXBA 2EGOA 3QE1A 3ZYDA 1O3LA 1HXEH 2CN0H 2JILA 2FWWA 5PTPA 2JH0D 5FPSA 2OINA 1SI5H 1P01A 3GY4A 1SGIB 3DORA 3NZIA 2VGCC 2ZPMA 2BY5X 1W0ZU 4FU9A 1TNIA 5E8EH 1ZTLA 2KAIA 2VZ5A 4CRCA 9ESTA 1NT1A 5FBEA 4YESB 3RXEA 3T5FH 2WL7A 4NFFA 4YT6H 1C2DA 1T8NA 4YZUA 3L6PA 3GCOA 4JOGA 2B9LA 5EYZA 1OKXA 2G51A 2VRFA 2IWPA 4HGCA 4OS6A 5C3NA 2A2XH 1C5RA 2ZTYA 4O03A 4GHNA 1DWCH 3BEIB 1YGCH 2CGAA 1GBCA 2KAIB 2OTVA 3RU4D 3PMAB 1AMHA 1AFEH 5E11A 2AIPA 1YCPK 2Q9VA 3RXCA 4KTCA 2ANWA 2HLCA 1SB1H 4XBCA 2KJKA 1GHAG 1P05A 3TH2H 4B2BA 2BLQA 2EDVA 1A5GH 2P8OC 2CS5A 2XBYA 2AWXA 1EP5A 1RZXA 1CHOF 2DM8A 4JZIA 4AB8A 4OEPA 3DUXH 1W2KH 2D92A 3SNCA 5ABWA 4YOGA 5EU8A 1RGWA 4MPXA 3M3TA 4ABGA 5HFCA 1O3PB 1BDAA 4CH8B 3KHFA 1ZHPA 3ZVEA 3QN7A 2ZU5A 3VQFA 1O3FA 3SN8A 1JMOH 1SGQE 1GL1A 3RXMA 4TYDA 1CT2E 2SGEE 1O3KA 4JZDH 3I1EA 4REYA 1GBIA 1W14U 2WUCA 4UE7H 1BMMH 1QL9A 3I4WA 3GY6A 1FPCH 4WMFA 2CJIA 1EAIA 1NFUA 1SGFA 4IN2A 1D3PB 3SU2A 3BTDE 3ZZ7A 1QBVH 1W7GH 1P9UA 1O2LA 1IQJA 1T7CA 3W95A 4XSKU 1QB1A 4E7RG 2BD3A 3M5MA 2FOFA 1K28D 1TOMH 2OXSA 3DD2H 1VJ6A 3SI3H 1MKWH 2DUCA 1P2OA 3MYWA 4Y71A 1NRNH 2TGPZ 2QF3A 2A5IA 1SC8U 5DP9A 3RXOA 3VB3A 1DUEA 1G37A 3D65E 4CRBA 3LT3A 3BTTE 1O3BA 2SGPE 3UUZA 3A83A 1O5DH 1NM6A 1ETTH 4X1QU 1F5KU 1S83A 1V2PT 1PDRA 5I7ZA 3FP7E 3E3TA 2GDEH 3SHAH 2JIKA 1K1OA 1ZTJA 4LOYH 4BTUB 5F3XA 2EGNA 2EDPA 1F0UA 2G00A 2VB0A 3A88A 3A7ZA 5FX6A 1OX1A 1LPZB 1MUEB 2C90B 2R0LA 1HAVB 2FNEA 3SHWA 3HATH 2VVVA 2IWOA 1S85A 1ZJDA 3K6ZA 3KNXA 2EV8A 1LCYA 4X1NU 4YTAA 5DTHA 3TIUA 3GY5A 1NRRH 2Q6FA 4XBDA 3A7TA 4L8NA 4K8BA 1UK2A 1ABJH 1G2MA 1FONA 1FY4A 2RDLA 3BEFB 3CYYA 3PV2A 1TBQH 1LMWB 5L2YH 4IC6A 3LU9B 3SV2H 1VGCB 3ZZAA 1OBYA 2EEGA 2F9PA 3QTVH 1RD3B 2E7KA 1G36A 4CBOA 3R69A 1BHXF 2M0TA 4AN7A 1MCTA 2V6NA 2Z7FE 2Z9KA 3UQOA 1GWAA 3V7TA 7ESTE 1VCQA 1E34B 4R8TB 1H1BA 1OZIA 3TGIE 1ELVA 3E17A 1GI4A 2OS6A 1O2UA 3E1XB 5L30H 2TGTA 1EUFA 2UUKB 3PB1E 3MH7A 4Q6HA 3SFJA 2H9EH 2ZCHP 4RKJB 1NTEA 1S81A 3A8CA 3UOUA 1VJAU 1W11U 5DGJA 2HE2A 1Y5AT 1D6RA 1AB9C 1GBAA 1V6BA 3LPRA 3EDXB 1O33A 1O2XA 1HAPH 1HJAC 1GI5A 2TGDA 1MCVA 1HIAA 1UK3A 4D9QA 2QT5A 4NXPA 1V5QA 2AERH 1V5LA 1GI9B 4FUFA 1GHXH 2UUJB 4NXRA 1MD7A 1GBBA 3M7TA 3E0NB 1WUNH 2ZG0H 5AVDA 2Q6DA 3OSYA 3MU1A 1UITA 2Y82A 3CC0A 2Z3EA 1VITF 3U98H 3DJAA 1HIAB 3DA9B 1V2ST 4OGXA 4DJZB 3RXVA 2R2WU 2VVCA 3RL7A 1SMFE 4MNWA 2ZDMA 2QGRA 1O2IA 2FDAA 4B2AA 3MNSA 1TGNA 1EATA 5C5OA 1FV9A 7GCHF 1V2RT 2A5KA 5GCHG 5T6DA 1QAVB 3GCHB 1P1DA 1FAKH 3RXLA 4OGYA 2VINA 3SI4H 1GMHG 1LVYA 2Z17A 4BXSA 2SGDE 1S6FA 1X5NA 3VB5A 1T4VH 3ZZ3A 2JWEA 3I78A 5DK1A 5EQRA 2VPHA 5HFFA 1MC7A 1HRTH 1TGTA 3ITIA 4Y79A 2ZU4A 4A7IB 2HNTE 1IHSH 3TK6A 1BUIA 2W3KA 1CE5A 3RXQA 2PKAA 1GJCB 2BVSH 1Q3OA 5FPYA 3SV7A 1EOLA 5GNDA 2A7JA 2ZPLA 3MH5A 1C1TA 3F6UH 5HEBA 1IQFA 3D23A 1V2OT 3LKWA 2J2UA 2BZ6H 1C1MA 4JYVH 2PDZA 1VZQH 3TSVA 1CHGA 3KF2A 3M61U 2UUFB 1D3QB 1U6QA 5L6NH 1XUKA 1HJ8A 3QDZB 2IOTA 1FUJA 3MO6A 1NRQH 2ZDKA 3A81A 1LPGB 1HGTH 4K69A 4ESTE 1LVMA 3LH3A 1SHYA 2BY8X 1SQOA 5HM2A 3H7TA 3RM2H 2VJ1A 3AVZA 4Z8JA 3RUOA 1TONA 1GJ8B 3KQEA 1GJAB 4HI3A 4ZUHA 3TJUA 2J34A 3K2UA 1ESBA 1I92A 1ACBE 1XUGA 3BF6H 1QB9A 1ZGIA 4UD9H 5EGMA 4DVAU 1QL8A 2EXGA 2W4FA 1BZXE 1F0RA 2YUYA 4H6SB 5A0CA 1OBZA 1C9TA 1O5GH 1GBJA 4X1PU 3QJNA 3K65B 3S0NA 4K78A 1XUHA 2PKTA 4Y8XA 2M10A 5DKMA 1J15A 1DSUA 4GUXA 1GI7B 2WPKS 4NIVA 1P3CA 2ANYA 5E6PB 1FXYA 1ID5H 2WPHS 3M3VA 4BTTB 4H6TA 2H2CA 1P8VC 1SL3A 1BRUP 1MFLA 1UJVA 1O2ZA 1AGJA 3U8RH 2QKVA 4NCYA 5C67A 3ZZ8A 1SGFG 2AS9A 2ZU2A 4K75A 1D9IA 2BMGB 5HFEA 3EA8A 1RRKA 4FUIA 2OUAA 1TNHA 2KL1A 1YKTA 1LPKB 1YPHC 2CHAB 2FXRA 3V12A 5FCKA 4ASHA 3QX5H 3EA7A 2A4GA 3T28A 4H11A 2O8UA 1P1EA 2FTMA 4MG3A 4NFEA 4CRAA 3LNXA 1VJ9U 2D1JA 2NU2E 2QIQA 2FCFA 1KY9A 4Y6DA 2M0UA 3NFKA 4NMQA 3MH6A 2ZU1A 1EZXC 2J9NA 1FY5A 1CBWC 1SGCA 2BLVA 1KTTB 3L3TA 3F9EA 1HV7A 1A5HA 1HAGE 1BBRK 5E2OA 3AASA 3BG4C 4IGDA 3TNSA 3SJ8A 3P17H 4X2YA 1Z8IB 4HOPB 1Y3YA 2G55A 3WKMA 4MPVA 2FO9A 1V2JT 4WMDA 1MU8B 1GHVH 3TITA 4NMVA 3NFLA 2G52A 3S9AA 3SJOA 1W9QA 2G81E 4JZEH 4INLA 4UDWH 3RM0H 3OU0A 1FN6A 4YOJA 3PO1B 3QK1A 2RA3A 1MTSA 1GJ4H 1GMCG 1HFDA 4BAOB 3TU7H 4NGAH 1QCPA 4KTUA 6ESTA 2AMPA 3AW1A 2RCEA 4Y7BA 2NU0E 3RXGA 1S5SA 3QJMA 1YPLH 1PPBH 1B8QA 2Q6GA 4NIYA 2HPPH 1YC0A 4KELA 3A7WA 2FYQA 1SGTA 1BIOA 1C5XB 1ELTA 4NSYA 3DFLA 5EXLA 1RIWC 3MO3A 1V1TA 4FXGH 2H6MA 4A1TA 4E3BA 2GKVE 3DJ3A 2PKSB 3BTEE 4FVBA 5F67A 1LTOA 2DE9A 4X2XA 1C5MD 2XCFA 2F91A 3OTPA 4Q2OA 1O38A 3VEQB 1UVTH 1W3CA 5TCAA 1H8DH 1IQMA 1EZSC 4KP0A 4TWYA 4A6LA 4BXWA 1RY4A 4O3UA 1G3BA 1GJ5H 1P2IA 4H42U 2UZCA 4X8VH 1CT0E 5LH8A 2Z9LA 3S9CA 1RTKA 3SGBE 1TGBA 3ATIA 1C2FA 3RLEA 3FP8E 2FLRH 1T8OA 2AGIX 1HAZB 3GCTG 1WH1A 1DM4B 2PZDA 1O2JA 1KXAA 2PR3A 3E8LA 4AB9A 2IN2A 1VCPA 5HXFA 4JK5A 3ZZDA 3RL8A 1W9OA 1EZQA 2PGQB 1ZHMA 3K9XB 2R3YA 1Q3PA 1K1LA 1QRZA 1W7XH 3SGAE 3BPUA 2VIDA 5DP8A 1TRNA 2FESH 1P2KA 3U8OH 1Y8TA 3R68A 2HVXA 1P9SA 2ZGBH 2FOCA 1DY9A 1PPCE 3IG6B 1GI1A 1BTHH 4GCHG 3NK8A 1OWKA 3SORA 2EA3A 3SQHE 2VWOA 3GYLB 3M37A 4HTCH 3ZZCA 1AKSA 2TGAA 1J16A 3OX7U 1MAXA 4XDEA 2ZDLA 2LC6A 4NG9H 1GDQA 5FHTA 2GCHF 4X6NA 4G69A 2P3WA 3VQGA 1D6WA 1PPZA 3UNRA 3SUFA 1HUTH 3HK3B 3MMGA 4YLUA 2RG3A 2PHBA 1AKSB 1WQSA 4ZAEA 1HLTH 3HPKA 3KQBA 1GI8B 3LGYA 3BTWE 2K20A 2JETC 2G5VA 1NFWA 1CA0B 1SGEE 3EYDA 1BTUA 1C1PA 1O3EA 2BD2A 4UFFH 5J4SA 1UO6A 2Y80A 1OP2A 2ZI2H 2AEIH 3GJ9A 4FVDA 2AMQA 5EG4A 4NMOA 4AX9H 4A92A 4ABJA 5CHAC 2VSPA 4Y8YA 1GJBB 3ID4A 1G3DA 1ZSLA 1SSXA 1TP3A 1UEWA 3STJA 1JBUH 4X2WA 5EW2H 3T62A 2ZECA 1O5AB 2GCTB 4KTSA 1W9EA 1Q7XA 1OP0A 1NPMA 1GHAF 3JXTA 1X7AC 2A4RA 2UWPA 1UM1A 1NRPH 3A82A 4CBNA 1O3AA 1QAUA 3RXPA 4BAKB 5F8XA 3F9HA 2RRMA 2OC8A 4Q3HA 1MTNB 2TIOA 1SHHB 3E90B 4AGKA 3ESTA 5JBAS 4MTBA 1C2HA 2ANMH 1OXGA 1MFGA 4WMEA 2QA9E 2KV8A 4XOJA 1TX8A 2GV7A 1SGDE 4DW2U 2KJPA 3LJJA 4YO9A 1LQDB 2VH6A 2DJTA 4NSVA 1RJXB 3EGHC 1WJLA 2OSGA 1EASA 1U38A 3P8OA 1WI2A 3NCLA 3URCA 3KHVA 3T27A 2XBWA 1C2MA 2PLXA 1ZPCA 5K0HA 1C1UH 3TMHA 4ZKSU 4K6YA 2Y7XA 3BTQE 3ZVCA 1EQ9A 2OC0A 2BYAX 1UK4A 2CMYA 4JZ1A 3DIWA 3NGHA 3JZ1B 4Y76A 2ZHWH 3SO3A 1UCYE 1C2KA 3VGCC 5BRRE 1OP8A 2WINI 2QBWA 1NS3A 1PFXC 2BZAA 2PSXA 1M5ZA 2HNTC 3B9FH 1AFQC 1Y3VA 3ZRTA 1QR3E 1B0FA 1NROH 1SGYE 2OQ5A 2F83A 3MU0A 1D3TB 3A86A 4FUGA 2YNBA 5AHGH 4GVCA 2I04A 4B75A 1O2GH 2K1ZA 1O2QA 4MQAA 5G1DA 3BEUA 5GWZA 4WY3A 2EGKA 4UFGH 2ZEBA 2KG2A 4O3TA 1S0QA 1Z1IA 1N8OB 3I77A 3MU5A 4Y8ZA 1ETSH 3B76A 2OC7A 2XWBI 2RA0A 4F4OC 1SVPA 2EJYA 3KQDA 1AIXH 2DAZA 3RXDA 1AWHB 1R6JA 3BTME 3LIWA 5DPAA 2G5MB 1P03A 3KN2A 1H9HE 1CO7E 4DG4A 1DWEH 1IAUA 1TMUH 1IQEA 3A7YA 1JIRA 1T8LA 2NU1E 1OWHA 2ZFSA 4CHAB 1FZZA 5DP6A 3RXSA 3SUGA 2PW8H 3A85A 1UTPA 3VB6A 1D5GA
chains in the Genus database with same CATH superfamily
5T6GA 2FI3E 1DFPA 1DT2A 5ESBA 2LPRA 5H4IB 2D8IA 2DB5A 2BD5A 1GJDB 2GV6A 4ABBA 1C5LH 2C8WB 3QDOA 1WQVH 4OS1A 4Q7YA 1K32A 4UFDH 4XD7D 2YT8A 1O5EH 1LDTT 1ANBA 1PPFE 1TRYA 2VGCB 2WHXA 3TLOA 1ZPBA 1JIMA 3TGJE 1UTOA 1YPMH 1UCYH 2BXUH 4D76A 1AU8A 3TK9A 1C1RA 1PQ5A 3FP6E 2ZTZA 2L4SA 4IBLH 4A5TS 3NKKA 2QXIA 3PRDA 1OYTH 3OEHD 3SV8A 2STAE 4Y10E 1V2QT 1CVWH 3BIUH 3EE0B 1ZOKA 1BQYA 2BYGA 1F2SE 4I8LA 2VIPA 5C17A 1WHDA 3KL6A 4K72A 2Q1JA 1O3HA 3GDSA 1HAOH 3FZZA 1Y59T 5JPMH 2P3TB 1WAYB 2VVUA 3QWCH 5SGAE 4WYUA 1O3IA 1IU2A 2H3LA 1QQUA 1BTWA 1HNEE 1KDQA 4INKA 1YWUA 3GSLA 2V3OH 1HJ9A 1ELFA 3RXFA 4R0IA 3SBKA 3VFEA 2P8OB 5E0GA 1AE5A 3CBXA 3UTUH 1P2MA 3LGTA 1FLEE 1FY8E 4DOQA 4MPAA 2YNAA 1LHGH 3AW0A 4ACBA 2ULLA 2ODPA 3GISB 1GDUA 1KDQB 2OD3B 3DFJA 4B74A 1BRBE 3FN8A 4LMMA 4RSPA 3RXTA 2WPJS 1WXRA 4YOIA 2BDAA 1Z7KA 1BBRE 3AAVA 1X45A 1OWIA 1WF8A 1TPPA 2BQ6B 2FEQH 2QXGA 3O8BA 5E22A 2F5YA 5EJLA 1CGHA 1K22H 2AWWA 1C5TA 3TSZA 2GDDA 1O2PA 2HWLB 3EGGC 2IJD1 3TVJB 3QZQA 5GPIB 4X8SH 3SJKA 3TK5A 3WW7A 4OM9A 1TOCB 3BTFE 2KOJA 2STBE 1QJ6B 4Q7ZA 3ZZ4A 2ZGJA 2OMJA 1P04A 1LHCH 1TPSA 3GDUA 2OP9A 3GY8A 1ELCA 4Y7AA 2F9VA 5K7RA 5A8XA 3PYHA 2GMTC 2WV9A 1HXFH 2IWQA 1ZUBA 2R4HA 2ZDAH 4FUBA 1HAHH 2ZC9H 8GCHF 3BN9A 4ZHLU 3UR9A 2QN5T 2DE8A 1G32B 4CRDA 5C2ZA 1AWFH 1YF4A 2DLUA 1MKXK 2BQWB 1U3BA 1QRWA 4DIHH 1IQIA 2HNTF 2V3MA 4I33A 2YTWA 5JBTA 1QLCA 4JOKA 2JDID 3E0PB 1QY6A 1MTUA 1A4WH 3LGVA 5TCCA 1G3EA 2BX4A 2FMJA 3F68H 2VU8E 5EW1H 3Q3KA 2G8TA 3SU6A 3RDZA 5A2MH 3Q00A 3AAUA 4OS5A 1BMFD 5J4QA 1UMAH 4ZXYH 2EDZA 1CQQA 1HDTH 2SNVA 1O2WA 3SHUA 1WFGA 1TALA 1BBRH 3GOVB 4D7FA 1NZQH 1CHOG 2FI4E 4U2WA 1MAYA 2GT7A 4MPWA 2XNIA 4YLQH 2BD4A 4DT7B 4JK6A 3MFJA 2UWLA 5AFYH 2O8WA 1TPOA 3BTHE 1T8MA 2QF5A 6GCHF 3OE7D 1EPTC 1NY22 4Y0ZE 1TX6A 3RP2A 3HK6B 4XFQA 2J97A 4AFZA 2ZHQH 3H5CB 1ELAA 1UHBA 4NWKA 4X0WU 4OS2A 2KCPA 2M5TA 2VIOA 3E6PH 2ZDVH 2I6SA 1BJUA 2A7CA 3WWFA 8LPRA 1TBRH 3OTJE 3M7QA 4MNYA 3SQEE 1MQ6A 1NESE 3ATLA 1UVSH 1E35B 4I86A 1D4PB 4D7GA 1C5OH 2HGTH 2PUQH 3RC4A 8ESTE 2AIQA 1Z8GA 1EPTA 3ZVAA 4B71A 3LDXH 1BTZA 5D13A 2V7QD 1SGRE 2NU3E 2XTTB 4DIIH 1EKBB 2VSVA 1YPEH 1TBZH 2BM2A 4FUHA 4K1TA 1B5GH 1QBOA 4ABHA 3UR6A 1O2KA 4F8KA 3VPKA 3O8RA 1D3DB 2L74A 3O5NA 1AB9B 2BD7A 1GI0A 1FNIA 2FOBA 7KMEH 2VWRA 3FVFB 5TJXA 1HJAB 2ZHEH 3PWCA 1KSNA 2ZFQH 4O06A 4P2AB 5EXMA 2CF8H 2RCZA 4NA9H 1GVKB 1K1JA 1O3NA 2R2MB 3T2NA 1SOTA 2W7UA 3HKJB 2GJGA 4K8YA 1YPKH 3CENA 3PMHB 1S82A 2BDGA 2OBQA 3BSQA 4XE4A 5C0UA 1DXWA 1F0TA 1ZHRA 3I29A 3PRBA 2OLGA 3FY5A 4ZMAH 2XYAA 2Y5FA 1KLJH 4CH2B 1MD8A 1A61H 1P0SH 2Y81A 3RLYH 5FB8C 2W26A 3RLWH 3SU1A 3QLPH 1QZ8A 2ZWLH 2ILNA 2PKAB 1QURH 2QE7D 1V2TT 1WV7H 3F0PA 3T26A 1UTQA 1ZSJA 1QJ7B 2P3FH 1GBKA 3OFND 1O3CA 1J9CH 1BJVA 4HG6A 2WV4A 5EXNA 1H8IH 4Z1MD 3M36A 2C8ZB 4ISNA 7LPRA 2CSSA 5DN6D 3KGPA 1VB7A 3T29A 3GCNA 2I1NA 1FI8A 6LPRA 2HLDD 1YLDA 1FC9A 2FI5E 5C0TA 3MNXA 2OGPA 4VGCC 4I7YH 1GBFA 1EAUA 4WYTA 2J95A 1NC6A 3A8BA 5HFBA 1TMTH 2O8LA 2F9NA 2BY9X 1MMJN 2Y6TA 1U39A 5LPFA 1IHJA 1OPHB 8KME2 4LK4A 5HMAA 1C2IA 2FPZA 1PQ8A 2OZFA 3D49H 2KA9A 1KEFA 4ZKNU 4U01A 5G4BA 4Q2KA 2DLSA 2FOAA 1FY3A 3T25A 2ZCLP 3F1SB 1C2LA 2JIZD 1MKWK 2BXTH 1FY1A 1E1QD 3PDVA 4WH6A 2BD8A 2X7ZA 4FUJA 1O30A 2BLOA 4CREA 2W5EA 3O8DA 1QGFA 2B0FA 3UQVA 4BAMB 1DX5M 4B1TA 4E34A 5A8YA 2EI8A 1EAWA 4Q7XA 3F2FA 5ESTE 4ABAA 1QA7A 2XWAA 1VITG 4JOEA 1Q31A 1O3MA 2F4LA 3JZ2B 2VBCA 2KPKA 1FJSA 4GLYA 4AYVB 2GZVA 2GZ7A 1ZJKA 4AORA 2DC2A 3UOPA 5I25A 2REYA 1YBOA 2FIRH 2EEKA 3DHKH 1A3BH 2Z9IA 1ANDA 2ZP0H 1HBTH 1O2RA 2OK5A 3FOAA 7GCHG 1GGDC 1T4UH 1G9IE 1RGQA 2LUIA 3P92A 4NA7A 4DT4A 5DJ7A 3SYJA 5A0AE 1E1RD 2BY7X 2AGGX 3Q3XA 1W13U 1P12E 4I32A 2VIQA 2IJOB 1J17T 3K82A 2OQSA 1VKYA 3RMNH 1K1IA 1O2HA 1XUFA 1N6YA 1Y5BT 2LELA 2JXOA 1XMNB 2SNWA 3LGWA 3OY5U 1N7EA 1TX7A 4E06H 4UU5A 2PGBB 2ZO3H 5C20A 1Z6JH 4NMRA 5HF1A 4ISOA 3LGIA 2BVXH 2VH0A 4BAHB 1YYY1 5HEYA 1B0EA 2V1WA 1GJ9B 1ZR0A 1HYLA 3K6YA 1JWTA 2A32A 2ODYB 1C5VA 1BRCE 3MO9A 1SLUB 6CHAC 1GDNA 3SJ9A 1DY8A 1A5IA 1P2NA 3U9AH 2J92A 2WYGA 5AFZH 3RU4E 5EPNA 2C3SA 2XC0A 3NRLA 2W7SA 1NO9H 1QB6A 3A80A 1CBWB 2I0LA 3A8DA 4K5ZA 4ABDA 2TBSA 1JXPA 3U8TH 1HB0B 1AZ8A 3BG4B 4IS5A 3PM3A 3SUDA 1TLDA 2BHGA 2MHOA 1XVMA 2A0QB 2JH5D 1A0LA 5FAHA 2EEIA 2JJ2D 1NRSH 4WXIA 4ZKOU 4NWLA 4GHTA 1KMHB 2OC1A 1V6DA 3KYFA 1BE9A 3PV5A 1YCPH 5L2ZH 4AFSA 1A2CH 5T3HA 1A46H 2ALPA 2B7DH 2NU4E 3A8AA 5EZ0A 3VB7A 3OAAD 5GJ4B 3P8GA 1UF1A 2QC2A 3SOSA 3L33A 4JOHA 1DSTA 2HRVA 5JBBS 3HPMA 1YM0A 3QUMP 3ZVGA 3BTKE 3E91A 3BV9B 4DURA 2ZKSA 4KFVA 1NU9A 1UTMA 2FOEA 1YBWA 3CH8A 1V2KT 1QBNA 3F9GA 1RTFB 4NA8A 2AGEX 2FX6A 5HF4A 2G4TA 4RT0A 1O35A 1KLIH 1UVPA 2H2BA 2M3MA 4Y0YE 5C5NA 1GHBG 1GI2A 3Q76A 4NNMA 3HGNA 1RIWB 1UTNA 1QL7A 2FOHA 1UEZA 2XBVA 5JB8S 1N7TA 3A89A 4N6XA 4JYUH 1M9UA 2GVFA 1J8AA 4OEOA 4ZKRU 1FIWA 1GBDA 2BDYA 1H4WA 1IOEA 4Z0KA 4YM9A 3CS0A 3PV4A 1OSSA 5EPYA 1OS8A 1RXPA 1OWJA 4HFPB 1W0KD 1BMLA 3P70B 4XBBA 1OWEA 2XCNA 1GG6C 4IMZA 1LQEA 1DLEA 3SZEA 3O46A 1LVBA 1XZ9A 5I46H 4NMPA 4B73A 4IMQA 1UM7A 4AYYB 2QKUA 3F2HA 5C94A 1YLCA 5DO4H 1DWBH 1SLWB 1WTHD 3R3GB 4AG2A 1GI3A 1WIFA 3PMBB 1XVOA 3FKSD 2BVRH 5FPTA 2A5AA 1HAIH 3S7HB 3SW2B 1L0ZA 5C1UA 2BB4A 1C5ZB 4KFWA 2HGAA 2J98A 5E21A 1TPAE 1GCTC 3A7VA 1QA0A 1SGNE 2H5CA 2Y5HA 2ZF0H 3WWBA 1PYTD 2K1QA 2FE5A 3VB4A 4X6OA 1KXCA 2IPHA 2WV5A 1BCUH 5F8ZA 1COWD 5F8TA 1JOUB 2GP9B 1PJPA 1LVOA 2IPQX 1C1SA 1O34A 1T31A 3TJVA 3UNQA 2ZTXA 2LC7A 2G4UA 5F03A 1FMGA 2OBOA 3MH4A 5H3JA 1WDIA 1WYKA 3SOEA 1TB6H 3KZEA 1W8BH 1SR5C 3ID1A 4IN1A 1O0DH 5FCRA 1AI8H 1Q2WA 2EEHA 1V2WT 2ZCKP 3ZV8A 2F9UA 4NIXA 1SOZA 2JETB 3MNBA 5B6LA 2WPLS 1FAXA 1CU1A 3ZZ5A 1BITA 2ZFPH 1P10A 1O3DA 1ZRKA 1N1LA 3LNYA 3PLBA 5HIYA 3MWIU 1GBEA 4YT7H 1AQ7A 1XX9A 1O5BB 1ZZZA 2CV3A 3RC6A 1Y3XA 1INCA 2XRCA 5CHAB 1K2I1 3ZV9A 2VWMA 4ZH8A 3S69A 1AVGH 2FS8A 4ZCNA 1O32A 5LGOA 5GLJA 3PTNA 5DP7A 1P06A 3NWUA 1AZZA 1YPGH 1LHEH 3K50A 1P2QA 4SGBE 2ZPSA 1CGJE 2P16A 3HKIB 1DS2E 5ILBA 1C5QA 1DICA 2V3HH 2Z9JA 3RC5A 3SNAA 1SKYE 3KQCA 2VWNA 2KZ4A 1C4V2 4ISHH 3SU5A 1DWDH 3URDA 1Z71A 1WHAA 1O37A 1TABE 1EB1H 4U30A 1YPJH 1BRAA 2H9TH 3OY6U 1X8SA 4A1VA 2FM2A 1TQ7B 3W94A 5GDSH 3STIA 2R0KA 2SFAA 3C27B 1DXPA 1X6DA 1F5LA 4X8UH 1S6LA 4O97A 2J94A 4X1RU 1ELGA 4DCDA 1LHDH 2B5TB 2F43B 1GM1A 3GABA 3TJOA 3BG8A 3LOXA 3SV9A 4FU7A 2GCHG 2ZPRA 1PYTC 3O8CA 3A7XA 3UIRA 1PQ7A 4OAJA 4ISIH 3DJ1A 3SNDA 2H5DA 1YPHE 4JJ0A 1ZPZA 1O2VA 1T2MA 2P95A 1XKBC 2Z9GA 1ZOMA 1G9OA 1E36B 2D26C 5IYTA 4Y11E 2HPQH 3FFGA 5DP3A 3VGCB 1J14A 1WG6A 2F3CE 4AZ2B 2AMDA 2ZGXH 3MU8A 2FX4A 1AFQB 2C8XB 4Q2QA 2JH6D 3UFAA 1TNKA 1DE7H 1Y3UA 2P94A 4MLFB 1L1NA 1EOJA 4MNVA 1C2JA 2R9PA 5IDKA 2AHME 3UNSA 2BLWA 1K9OE 3KIDU 5KGOA 3TPIZ 4JORA 3N99A 1BHXB 2EHRA 3RXHA 4NMSA 5C1XA 1C4U2 1TWXB 5T6FA 3I18A 1MU6B 3KCGH 3KYGA 5DP5A 2PKUA 5A8ZA 4FGMA 1LHFH 4HZHA 5DP4A 2TPIZ 5HFDA 3QGNB 2W7RA 1CA8B 4JZFH 1L1GA 4FLNA 1C1NA 5A2PA 1SQAA 4X8TH 2EI7A 2BOKA 1SLXB 1F5RA 1K1PA 1BT7A 5AF9H 1C1OA 1ARBA 1TNLA 4WH8A 1TFXA 2FODA 3MU4A 4EDJA 1GQ5A 1HPGA 5E2PA 2ZFRH 2A31A 2GT8A 4ZHAA 2YT7A 4Q6SA 1GHWH 1O3GA 1ZTKA 2C93B 1WF7A 3MOCA 2CSJA 2ZGHA 3K1RA 1TQ0B 3LC5A 4BAQB 3GY3A 1O2OA 4YDPA 4LXBH 1NBME 3PDZA 3QZRA 4WWYA 2ZGCA 4AMHA 3FAOA 1GMDG 3TJNA 1QFKH 1BFEA 1DDJA 4UFEH 1L1JA 1X5RA 1QRXA 2ZHFH 1CT4E 3ID2A 1ZMLA 3MNCA 1ZMNA 1WU1A 1OHHD 4KKDA 4MPUA 1X5QA 2QCYA 4X1SU 4BTIB 1AHTH 2PTCE 4E05H 4IW4E 1G3CA 3RXKA 1KXEA 1XUJA 4MNXA 2I4SA 3ATWA 2P93A 2DMZA 5GCHF 4B6EA 1O3JA 1XM1A 3U69H 3GGEA 2W6JD 1T32A 5LPRA 3CBZA 2HOBA 1C4Y2 1ZLRA 4H4FA 2WUBA 1V2MT 1ELBA 1GMHF 1VGCC 1FIZA 1UTLM 1HAVA 2ZA5A 3LC3A 4CRGA 5LPEA 1THRH 2BTCE 5EQQA 2KYLA 3Q3YA 3RMLH 1EJNA 1SFQB 3R0FA 4P00A 4NNLA 1N7FA 2FS9A 3H7OA 1MBQA 4K1SA 1UVUH 1TNJA 1ABIH 1UEPA 1E38B 2G2LA 2ZDNA 2EEJA 4THNH 2D2DA 4B76A 1FC6A 4E35A 5EOKA 1DOJA 2PSYA 4TY6A 1B7XB 1P09A 3EA9A 3WKLA 2P59A 3QTOH 1LKBA 4K3JA 4X6PA 1FX0B 3CBYA 1UHPA 5HJ1A 1L4ZA 2QXJA 3LONA 3NUMA 2KAWA 3ID3A 1U37A 2L6OA 1LO6A 4F49A 1PPHE 3SU4A 3C1KA 2GMTB 1IQNA 1O39A 1EP6A 1DANH 1Z6EA 1TGCA 1C1QA 4JL7A 2ZIQH 1ANCA 2PUXB 2BQ7B 1FDPA 1GJ7B 4TPYA 5CE1A 1O5FH 1EX3A 3KZDA 2BY6X 5F6MA 4NXQA 1SQTA 4NZLA 2ZU3A 2PA1A 1GPZA 3PLPA 3LJOA 1ETRH 1SFIA 1ZYOA 1A0HB 1PQAA 1TMBH 3A87A 3GCHC 3P8FA 1K21H 2UUYA 3LH1A 4Q80A 2HE4A 4J2YB 4PQWA 2PWXA 5EIYA 3EGKH 4O9VA 4AFQA 1A3EH 2BDHA 1GJ6A 1P2JA 1VA8A 3KEEA 3ODFA 2JKHA 3PMJA 3M5NA 4JOFA 1UHBB 1ZMJA 1GVLA 4A1XA 1O3OA 3CS7A 1IU0A 1Z8JB 2XXLA 2KOHA 2XW9A 1BA8B 3BIVH 5FL7D 2LP6A 2BX3A 1QAVA 2L4TA 1WI4A 3HGPA 3UREA 3DT0H 1THSH 2J38A 1EPTB 5T1VA 3U28C 1V2UT 3RMMH 4RKOB 2F9BH 2YMSC 4JYTA 1C9PA 1MBMA 3VG8A 2CXVA 1Z86A 4JOPA 1KLTA 2EC9H 3SV6A 4B2CA 1UFXA 3KDGA 2Z3CA 2KBSA 3PTBA 1P3EA 2GZ9A 2PV9B 2V35A 1QJ1B 2ANKH 3M5LA 4Q2PA 5HGGA 3RXAA 1W12U 3V0XA 4ZROA 1YCPM 4CR5A 3R0HA 2BD9A 1Q3XA 5JBCS 1Z1JA 1N6FA 5HEDA 4J1YA 1A0JA 2YOLA 3V13A 1BB0B 4K76A 5HETA 2P3UB 8GCHG 1SLVB 1DPOA 1GHYH 5CMXH 2R3UA 2J4IA 1UCYK 3ZVBA 2TRMA 4F48B 3FANA 4Q2NA 1EJAA 2A45B 1KWAA 4D8NA 5B42A 3GYMA 4GVUA 2OCSA 1IQHA 2EAQA 1TGSZ 1RS0A 1V62A 1GBHA 1KTSB 1AD8H 4I8GA 1K1MA 3RXIA 1GMCF 1FQ3A 1F92A 2GGVB 3SNBA 2LOBA 1H9IE 3UY9A 1AY6H 1WBGB 2HALA 1OOKB 2JINA 1E0FD 3M3SA 1OBXA 2ENOA 1Z87A 4I31A 3SHCH 4DGJA 1P02A 4CR9A 5IL9A 1QHRB 3ZZBA 1ZRBA 1C5SA 1RGRA 1SGPE 1SPJA 2VIVA 2MX6A 1F0SA 2FOMB 1UW7A 4XHVA 1W0YH 4ZXXH 3TNTA 3GDVA 1AUTC 4BANB 2L97A 1P11E 1L4DA 1O2YA 1BMNH 1EZUC 1O36A 6GCHG 3QGLA 4OS7A 3S7KB 3SUZA 1S84A 2BOHB 1TIOA 2CHAC 4DY7B 1ZSKA 2EQNA 3VXFH 4BNRA 1VCWA 4UU6A 2I0IA 4TY7A 5BPEA 2M0ZA 1PPGE 1GI6A 1F7ZA 3CP7A 2WPIS 4ABIA 3PS4A 1Y3WA 2THFB 1KIGH 4FUEA 4FUCA 3U1IB 2SGFE 4MVNA 4Z6AH 3ZZ6A 4VGCB 1GBLA 2H1UA 1N6DA 2FN5A 1NBMD 2O8TA 2ZZUH 3NXPA 2QG1A 1DLKB 1BTYA 3GCTF 2PNTA 3ZVFA 1PPEE 2CF9H 2EI6A 3E16B 3G01A 1L6OA 2V0BA 2XC5A 2XNDD 1GHBF 1L2EA 2GZ8A 4RT1A 4RN6A 4LZ4B 5B6OA 3GY7A 2XC4A 3GICB 1UTJA 1NFXA 2C8YB 2QXHA 2ZFTA 4KGAA 3UWIA 5HYOA 5KECA 4IC5A 5JB9S 1I16A 1E37B 4U32A 2M0VA 1BOQA 1AN1E 2BDIA 2VNTA 4I8KA 2FZZA 3PLKA 2UWOA 1QTFA 5F53A 3S9BA 3PO1C 1WCZA 5C1YA 2QV1A 3MI4A 1X9ZA 4GCHF 1IQGA 1HCGA 5E1YA 2AFQB 4R2ZA 5HDYA 4TWWA 2QF0A 4GAWA 1XXDA 3N7EA 3QGJA 1SBWA 3PROA 2B8OH 4HOPA 2KJDA 2GEFA 2GD4B 3QIKA 1XKAC 1Y7NA 5G1EA 1V2NT 1XXFA 3TH3H 4WXVA 3U1JB 4ABEA 1OYQA 2ZQ1A 1FN8A 4SGAE 1SG8B 2FTLE 2NWNA 4XRNA 1ANEA 2PKSC 3IWMA 3TSWA 1C1VH 2GX4A 1TP5A 2VIWA 2GTBA 1GGDB 1UJ1A 1VITH 4WF8A 4RI0A 3HPTB 1HAYB 1JRSA 2ZHDA 5E0HA 4WJG2 2A7HA 3ZZ9A 1O2NA 3BTGE 3SJIA 4D9RA 4PROA 2JREA 2DKRA 3HVQC 1NFYA 4GPGA 1DUAA 1EXFA 1W10U 4M7GA 3ZIAD 1DITH 1AUJA 2H2ZA 2LA8A 1N99A 1C2EA 2VWLA 4JOJA 3RXUA 1V3XA 2FLBH 1FC7A 3TH4H 2ESTE 3P95A 1TQ3A 3ATMA 1EJMA 4GHQA 3AXAA 3N7OA 4BOHA 1WOFA 5KEDA 4I8JA 6CHAB 2ZPQA 5DG6A 3SU0A 2V90A 1CGIE 3RXRA 1N6XA 2G5NA 1QNJA 1RFNA 1MZDA 2WPMS 2A4QA 3TGKE 2A4OA 3P6ZB 3P8NA 1YP9A 2WYJA 5FXLA 4FETA 3UWJH 1A7SA 2XBXA 2ZFFH 3GS9A 1NF3C 1FCFA 1BTXA 4UONA 2AH4X 4P02A 2D90A 2Y5GA 4INHA 3A84A 1AE8H 1TYNA 4CRFA 5E0JA 2Z94A 2QAAA 3WY8A 1VAEA 2KRGA 5JYIA 1BTPA 2AYWA 1C2GA 4QT8C 4UEHH 1IHTH 3DSOA 2A1DB 1H9LB 2W3IA 5EODA 2LNCA 1WFVA 1UTKA 1UEQA 2KQFA 1ORFA 1OWDA 1YLNA 2OQUA 3ZYEA 1BMAA 1MTVA 2O2TA 1O2MA 1S0RA 1CA0C 3SU3A 3M5OA 1GQ4A 1EAXA 3D62A 1ESTA 3AK5A 4GSOA 2Q3GA 1YY3A 1ELEE 3PWBA 2OPGA 3ELAH 2FP7B 1UVOA 3SNEA 2PTNA 3RU4T 2ZNKH 1IQLA 1C5NH 2I6VA 1O5CB 4Z33A 1C5YB 4X6MA 4AFUA 1ZGVA 2Z3DA 3VXEH 1IQKA 1RTLA 1THPB 4AC9A 1G2LA 1TA2A 3SZNA 4NZQA 4JMYA 1WTGH 3ATKA 2GCTC 2IWNA 1KYNA 2OCVB 5GXPA 2FOGA 2XOKD 5JDUB 9LPRA 2C4FH 1EB2A 4TT3D 2JOAA 4ZHMU 1N6EA 1P57B 2QYIA 3M7UA 1C5PA 1A1RA 4AGJA 1UJDA 1NU7B 1MTNC 4K2YA 1S6HA 4ISLA 3V3MA 1AVXA 2ASUB 3GY2A 5GIBA 3ZVDA 1TRMA 1C1WH 1WSSH 4AOQA 4K1EA 1JRTA 2Y7ZA 2W6ID 1O2SA 2AWUA 3B23B 3FZDA 4OS4A 1GG6B 1KXBA 5A0BA 5A09A 2FYRA 4LZ1H 3MTYA 4JJ3A 3W1EA 2J98B 2K8IA 3EAJA 1GBMA 1NTPA 1ARCA 1NN6A 2A2QH 3UPEA 2PFEA 1VR1H 1C5UA 3Q77A 2KPLA 4ASUD 4TPIZ 4ABFA 5FBIA 1MKXH 2Z6BD 2BDCA 4I8HA 4WVPE 1UJUA 3LGUA 1O2TA 1GVZA 4X2VA 3SUEA 3IITA 3L4FD 1MZAA 1TNGA 1FPHH 3NPSA 4FUDA 4K60A 3RMOH 2I6QA 1GCTB 1MTWA 3M35A 1AO5A 1GHZA 2O8MA 1QIXB 4JCNA 3ODDA 4FU8A 1AVWA 2YUBA 1ELDE 2QY0B 2O9QA 2ODQA 1V2VT 2QKTA 3MHWU 1O31A 1GCDA 4MDSA 4P0CA 3B8JA 2F0AA 5HM9A 2ZQ2A 4GVDA 2SGAA 5FX5A 1G30B 1MH0A 2AINA 1V2LT 1KXFA 2ALVA 1CSOE 3ENSB 4E7NA 1GBTA 2F9OA 5JXBA 1LKAA 1HAXB 1K1NA 3F9FA 3SGQE 1N8OC 1Y5UT 5EQSA 4AG1A 1XUIA 5ETXA 1TAWA 1KXDA 2KOMA 1DVAH 1ESAA 1TE0A 1GMDF 4YYXA 3OYPA 1QQ4A 3QO6A 4NMTA 3EQ0H 1MQ5A 2H3MA 2D8WA 2H9HA 1GL0E 2BDBA 1C5WB 4NIWA 1Z8RA 4CHAC 3RXJA 1TA6A 2SGQE 3RXBA 2EGOA 3QE1A 3ZYDA 1O3LA 1HXEH 2CN0H 2JILA 2FWWA 5PTPA 2JH0D 5FPSA 2OINA 1SI5H 1P01A 3GY4A 1SGIB 3DORA 3NZIA 2VGCC 2ZPMA 2BY5X 1W0ZU 4FU9A 1TNIA 5E8EH 1ZTLA 2KAIA 2VZ5A 4CRCA 9ESTA 1NT1A 5FBEA 3OEED 4YESB 3RXEA 3T5FH 2WL7A 4NFFA 4YT6H 1C2DA 1T8NA 4YZUA 3L6PA 3GCOA 4JOGA 2B9LA 5EYZA 1OKXA 2G51A 2VRFA 2IWPA 4HGCA 4OS6A 5C3NA 2A2XH 1C5RA 2ZTYA 4O03A 4GHNA 1DWCH 2JSNA 3BEIB 5HKKD 3CNRA 1YGCH 2CGAA 1GBCA 2KAIB 2OTVA 3RU4D 3PMAB 1AMHA 1AFEH 5E11A 2AIPA 1YCPK 2Q9VA 3RXCA 4KTCA 2ANWA 2HLCA 1SB1H 4XBCA 2KJKA 1GHAG 1P05A 3TH2H 2PP6A 4B2BA 2BLQA 2EDVA 1A5GH 2P8OC 2CS5A 2XBYA 2AWXA 1EP5A 1RZXA 1CHOF 2DM8A 4JZIA 4AB8A 4ACAA 4OEPA 3DUXH 1W2KH 2D92A 3SNCA 5ABWA 4YOGA 5EU8A 1RGWA 4MPXA 3M3TA 4ABGA 5HFCA 1O3PB 1BDAA 2M2AA 4CH8B 3KHFA 1ZHPA 3ZVEA 3QN7A 2ZU5A 3VQFA 1O3FA 3SN8A 1JMOH 1SGQE 1GL1A 3RXMA 4TYDA 1CT2E 2SGEE 3KQ5A 1O3KA 4JZDH 3I1EA 4REYA 1GBIA 1W14U 2WUCA 4UE7H 1BMMH 1QL9A 3I4WA 3GY6A 1FPCH 4WMFA 2CJIA 1EAIA 1NFUA 1SGFA 4IN2A 4YXWD 4Q63A 1D3PB 3SU2A 2K0QA 3BTDE 3ZZ7A 1QBVH 1W7GH 1P9UA 1O2LA 1IQJA 1T7CA 3W95A 4XSKU 1QB1A 4E7RG 2BD3A 3M5MA 2FOFA 2KCOA 1K28D 1TOMH 2OXSA 3DD2H 1VJ6A 3SI3H 1MKWH 2DUCA 1P2OA 3MYWA 4Y71A 1NRNH 2KM0A 1E79D 2TGPZ 2QF3A 2A5IA 1SC8U 5DP9A 3RXOA 3VB3A 1DUEA 1G37A 3D65E 4CRBA 3LT3A 3BTTE 1O3BA 1MABB 2SGPE 3UUZA 3A83A 1O5DH 1NM6A 1ETTH 2KCYA 4X1QU 1F5KU 1S83A 1V2PT 1PDRA 5I7ZA 3FP7E 3E3TA 2GDEH 3SHAH 2JIKA 1K1OA 1ZTJA 2YMSD 4LOYH 4BTUB 5F3XA 2EGNA 2EDPA 1F0UA 2G00A 2VB0A 3A88A 3A7ZA 5FX6A 1OX1A 1LPZB 1MUEB 2C90B 2R0LA 1HAVB 2FNEA 1SQRA 5DSFA 3SHWA 3HATH 2VVVA 2IWOA 1S85A 1ZJDA 3K6ZA 3KNXA 2EV8A 1LCYA 4X1NU 4YTAA 5DTHA 3TIUA 3GY5A 1NRRH 2Q6FA 4XBDA 3A7TA 4L8NA 4K8BA 1UK2A 1ABJH 1G2MA 1FONA 1FY4A 2RDLA 3BEFB 3CYYA 3PV2A 1TBQH 1LMWB 5L2YH 4IC6A 3LU9B 3SV2H 1VGCB 3ZZAA 1OBYA 2EEGA 2F9PA 3QTVH 1RD3B 2E7KA 1G36A 4CBOA 3R69A 1BHXF 2M0TA 4AN7A 1MCTA 2V6NA 2Z7FE 2Z9KA 3UQOA 1GWAA 3V7TA 7ESTE 5CDFE 1VCQA 1E34B 4R8TB 1H1BA 1OZIA 3TGIE 1ELVA 3E17A 1GI4A 2OS6A 1O2UA 3E1XB 5L30H 2TGTA 1EUFA 2UUKB 3PB1E 3MH7A 4Q6HA 3SFJA 2H9EH 3F2GA 2ZCHP 4RKJB 1NTEA 1S81A 3A8CA 3UOUA 1VJAU 1W11U 5DGJA 2HE2A 3EE7A 1Y5AT 1D6RA 1AB9C 1GBAA 1V6BA 3LPRA 3EDXB 1O33A 1O2XA 1HAPH 1HJAC 1GI5A 2TGDA 1MCVA 1HIAA 1UK3A 4D9QA 2QT5A 4NXPA 1V5QA 2JJ1D 2AERH 1V5LA 1GI9B 4FUFA 1GHXH 2UUJB 4NXRA 1MD7A 3DCLA 1GBBA 3M7TA 3E0NB 1WUNH 2ZG0H 5AVDA 2Q6DA 3OSYA 5EJ1A 3MU1A 1UITA 2Y82A 3CC0A 4TSFD 2Z3EA 1VITF 3U98H 3DJAA 1HIAB 3DA9B 1V2ST 4OGXA 4DJZB 3RXVA 2R2WU 2VVCA 3RL7A 1SMFE 4MNWA 2ZDMA 2QGRA 1O2IA 2FDAA 4B2AA 3MNSA 1TGNA 1EATA 5C5OA 1FV9A 7GCHF 1V2RT 2A5KA 5GCHG 5T6DA 1QAVB 3GCHB 1P1DA 1FAKH 3RXLA 2HVYB 4OGYA 2VINA 3SI4H 1GMHG 1LVYA 2Z17A 4BXSA 2SGDE 1S6FA 1X5NA 3VB5A 1T4VH 3ZZ3A 2JWEA 3I78A 5DK1A 5EQRA 2VPHA 5HFFA 1MC7A 1HRTH 1TGTA 3ITIA 4Y79A 2ZU4A 4A7IB 2HNTE 2KX4A 1IHSH 3TK6A 1BUIA 2W3KA 1CE5A 3RXQA 2PKAA 1GJCB 2BVSH 1Q3OA 5FPYA 3SV7A 1EOLA 5GNDA 2A7JA 2ZPLA 3H09A 3MH5A 1C1TA 3F6UH 5HEBA 1IQFA 3D23A 1V2OT 3LKWA 2J2UA 2YMSB 2BZ6H 1C1MA 4JYVH 2PDZA 1VZQH 3TSVA 1CHGA 3KF2A 3M61U 2UUFB 1D3QB 1U6QA 5L6NH 1XUKA 1HJ8A 3QDZB 2IOTA 4Q4LA 1FUJA 3MO6A 1NRQH 2ZDKA 3A81A 1LPGB 1HGTH 4K69A 4ESTE 1LVMA 3LH3A 4M9FA 1SHYA 2BY8X 1SQOA 5HM2A 3H7TA 3RM2H 2VJ1A 3AVZA 4Z8JA 3RUOA 1TONA 1GJ8B 3KQEA 1GJAB 4HI3A 4ZUHA 3TJUA 2J34A 3K2UA 1ESBA 1I92A 1ACBE 1XUGA 3BF6H 1QB9A 1ZGIA 4UD9H 5EGMA 4DVAU 1QL8A 2EXGA 2W4FA 1BZXE 1F0RA 2YUYA 4H6SB 5A0CA 1OBZA 1C9TA 3MQKC 1O5GH 1GBJA 4X1PU 3QJNA 3K65B 2EY4C 3S0NA 4K78A 1XUHA 2PKTA 4Y8XA 2M10A 5DKMA 1J15A 1DSUA 4GUXA 1GI7B 2WPKS 4F55A 4NIVA 1P3CA 2ANYA 5E6PB 1FXYA 1ID5H 2WPHS 3M3VA 4BTTB 4H6TA 2H2CA 1P8VC 2CK3D 1SL3A 1BRUP 1MFLA 1UJVA 1O2ZA 1AGJA 3U8RH 2QKVA 4NCYA 5C67A 3ZZ8A 1SGFG 2AS9A 2ZU2A 4K75A 1D9IA 2BMGB 5HIZA 5HFEA 3EA8A 1RRKA 4FUIA 2OUAA 3UAIC 1TNHA 2KL1A 1YKTA 1LPKB 1YPHC 2CHAB 2FXRA 3V12A 5FCKA 4ASHA 3QX5H 3EA7A 2A4GA 3T28A 4H11A 2O8UA 1P1EA 2FTMA 4MG3A 4NFEA 4CRAA 3LNXA 1VJ9U 2D1JA 2NU2E 2QIQA 2FCFA 1KY9A 4Y6DA 2M0UA 2WPDD 3NFKA 4NMQA 3MH6A 2ZU1A 1EZXC 2J9NA 1FY5A 1CBWC 1SGCA 2BLVA 1KTTB 3L3TA 3F9EA 1HV7A 2KR7A 1A5HA 1HAGE 1BBRK 5E2OA 2QF4A 3AASA 3BG4C 4IGDA 3SJ8A 3TNSA 3P17H 4X2YA 1Z8IB 4HOPB 1Y3YA 1H8ED 2G55A 3WKMA 4MPVA 2FO9A 1V2JT 4WMDA 1MU8B 1GHVH 3TITA 4NMVA 3NFLA 2G52A 3S9AA 3SJOA 1W9QA 2G81E 4JZEH 4INLA 4UDWH 3RM0H 3OU0A 1FN6A 3UB0A 4YOJA 3PO1B 3QK1A 2RA3A 1MTSA 1GJ4H 1GMCG 1HFDA 4BAOB 3TU7H 4NGAH 1QCPA 4KTUA 6ESTA 2AMPA 3AW1A 2RCEA 4Y7BA 2NU0E 3RXGA 1S5SA 3QJMA 1YPLH 1PPBH 1B8QA 2Q6GA 4NIYA 2HPPH 1YC0A 4KELA 2RFKC 2KCAA 3A7WA 2FYQA 1SGTA 1BIOA 1C5XB 1ELTA 4NSYA 3DFLA 5EXLA 1RIWC 2KFWA 3MO3A 1V1TA 4FXGH 2H6MA 4A1TA 4E3BA 2GKVE 3DJ3A 2PKSB 3BTEE 4FVBA 5F67A 1LTOA 2DE9A 4X2XA 1C5MD 2XCFA 2F91A 3OTPA 4Q2OA 1O38A 3VEQB 1UVTH 1W3CA 5TCAA 1H8DH 1IQMA 1EZSC 4KP0A 4TWYA 4A6LA 4BXWA 1RY4A 4O3UA 1G3BA 1GJ5H 1P2IA 4H42U 2UZCA 4X8VH 1CT0E 5LH8A 2Z9LA 4B6FA 3S9CA 1RTKA 3SGBE 1TGBA 3ATIA 1C2FA 3RLEA 3FP8E 2FLRH 1T8OA 2AGIX 1HAZB 3GCTG 1WH1A 3DSPA 1DM4B 2PZDA 5EJZA 1W0JD 1O2JA 1KXAA 2PR3A 3E8LA 4AB9A 2IN2A 1VCPA 5HXFA 4JK5A 3ZZDA 3RL8A 1W9OA 1EZQA 2PGQB 1ZHMA 3K9XB 2R3YA 1Q3PA 1K1LA 3N7DA 1QRZA 1W7XH 3SGAE 3BPUA 2VIDA 5DP8A 1TRNA 2FESH 1P2KA 3U8OH 1Y8TA 3R68A 2HVXA 1P9SA 2ZGBH 2FOCA 1DY9A 1PPCE 3IG6B 1GI1A 1BTHH 4GCHG 3F0OA 3NK8A 1OWKA 3SORA 2EA3A 3SQHE 2J5UA 2VWOA 3GYLB 3M37A 4HTCH 1AKSA 5CHBA 3ZZCA 2TGAA 1J16A 3OX7U 1MAXA 4XDEA 2ZDLA 2LC6A 4NG9H 1GDQA 5FHTA 2GCHF 4X6NA 4G69A 2P3WA 3VQGA 1D6WA 1PPZA 3UNRA 3SUFA 1HUTH 3HK3B 3MMGA 4YLUA 2RG3A 1H8HD 2PHBA 1AKSB 1WQSA 4ZAEA 1HLTH 3HPKA 3KQBA 1GI8B 3LGYA 3BTWE 2K20A 2JETC 2G5VA 1NFWA 1CA0B 1SGEE 3EYDA 1BTUA 1C1PA 1O3EA 2BD2A 4UFFH 5J4SA 1UO6A 2Y80A 1OP2A 2ZI2H 2AEIH 3GJ9A 4FVDA 2AMQA 5EG4A 4NMOA 4AX9H 3F3BA 4A92A 4ABJA 5CHAC 2VSPA 4Y8YA 1GJBB 3ID4A 1G3DA 1ZSLA 1SSXA 1TP3A 1UEWA 3STJA 1JBUH 4X2WA 5EW2H 3T62A 2ZECA 1O5AB 2GCTB 4KTSA 1W9EA 1K0HA 1Q7XA 1OP0A 1NPMA 1GHAF 3JXTA 1X7AC 2A4RA 2UWPA 1UM1A 1NRPH 3A82A 4CBNA 1O3AA 1QAUA 3RXPA 4BAKB 5F8XA 3KDKA 3F9HA 2RRMA 2OC8A 4Q3HA 1MTNB 2TIOA 1SHHB 3E90B 4AGKA 3ESTA 5JBAS 4MTBA 1C2HA 2ANMH 1OXGA 1MFGA 4WMEA 2QA9E 2KV8A 3DSGA 4XOJA 1TX8A 2GV7A 1SGDE 4DW2U 2KJPA 5IK2D 3LJJA 4YO9A 1LQDB 2VH6A 2DJTA 4NSVA 1RJXB 3EGHC 1WJLA 2OSGA 1EASA 1U38A 3P8OA 1WI2A 3NCLA 3URCA 3KHVA 3T27A 2XBWA 1C2MA 2PLXA 1ZPCA 5K0HA 1C1UH 3TMHA 4ZKSU 4K6YA 2Y7XA 3BTQE 3FO8D 3ZVCA 1EQ9A 2OC0A 2BYAX 2WSSD 2WZQA 1UK4A 2CMYA 4JZ1A 3DIWA 3NGHA 3JZ1B 4Y76A 2ZHWH 3SO3A 2RDEA 1UCYE 1C2KA 3VGCC 5BRRE 1OP8A 2WINI 2QBWA 1NS3A 1PFXC 2BZAA 2PSXA 1M5ZA 2HNTC 3B9FH 1AFQC 1Y3VA 3ZRTA 1QR3E 1B0FA 1NROH 1SGYE 2OQ5A 2F83A 3MU0A 1D3TB 3A86A 4FUGA 2YNBA 5AHGH 4GVCA 2I04A 4B75A 1O2GH 2K1ZA 3NCVA 1O2QA 4MQAA 5G1DA 3BEUA 5GWZA 4WY3A 2EGKA 4UFGH 2ZEBA 2KG2A 4O3TA 4FOUC 1S0QA 1Z1IA 1N8OB 3I77A 3MU5A 4Y8ZA 1ETSH 3B76A 2OC7A 2XWBI 2RA0A 4F4OC 1SVPA 2EJYA 3KQDA 1AIXH 2DAZA 3RXDA 1AWHB 1R6JA 3BTME 3LIWA 5DPAA 2G5MB 1P03A 3KN2A 1H9HE 1CO7E 4DG4A 1DWEH 1IAUA 1TMUH 1EFRD 1IQEA 3A7YA 1JIRA 1T8LA 2NU1E 1OWHA 2ZFSA 4CHAB 1FZZA 5DP6A 3RXSA 3SUGA 2PW8H 3A85A 1UTPA 3VB6A 1D5GA
chains in the Genus database with same CATH topology
5T6GA 2FI3E 1DFPA 1DT2A 5ESBA 2LPRA 5H4IB 2D8IA 2DB5A 2BD5A 1GJDB 2GV6A 4ABBA 1C5LH 2C8WB 3QDOA 1WQVH 4OS1A 4Q7YA 1K32A 4UFDH 2YT8A 1O5EH 1LDTT 1ANBA 1PPFE 1TRYA 2VGCB 3TLOA 1ZPBA 1JIMA 3TGJE 1UTOA 1YPMH 1UCYH 2BXUH 4D76A 1AU8A 3TK9A 1C1RA 1PQ5A 3FP6E 2ZTZA 2L4SA 4IBLH 4A5TS 3NKKA 2QXIA 1OYTH 3SV8A 2STAE 4Y10E 1V2QT 1CVWH 3BIUH 3EE0B 1ZOKA 1BQYA 2BYGA 1F2SE 4I8LA 2VIPA 1WHDA 3KL6A 4K72A 2Q1JA 1O3HA 3GDSA 1HAOH 3FZZA 1Y59T 5JPMH 2P3TB 1WAYB 2VVUA 3QWCH 5SGAE 4WYUA 1O3IA 1IU2A 2H3LA 1QQUA 1BTWA 1HNEE 1KDQA 4INKA 3GSLA 2V3OH 1HJ9A 1ELFA 3RXFA 4R0IA 3SBKA 3VFEA 2P8OB 5E0GA 1AE5A 3CBXA 3UTUH 1P2MA 3LGTA 1FLEE 1FY8E 4DOQA 4MPAA 2YNAA 1LHGH 3AW0A 2ULLA 2ODPA 3GISB 1GDUA 1KDQB 2OD3B 3DFJA 4B74A 1BRBE 4LMMA 4RSPA 3RXTA 2WPJS 4YOIA 2BDAA 1Z7KA 1BBRE 3AAVA 1X45A 1OWIA 1WF8A 1TPPA 2BQ6B 2FEQH 2QXGA 3O8BA 5E22A 2F5YA 1CGHA 1K22H 2AWWA 1C5TA 3TSZA 2GDDA 1O2PA 2HWLB 3EGGC 3TVJB 3QZQA 5GPIB 4X8SH 3SJKA 3TK5A 1TOCB 3BTFE 2KOJA 2STBE 1QJ6B 4Q7ZA 3ZZ4A 2ZGJA 2OMJA 1P04A 1LHCH 1TPSA 3GDUA 2OP9A 3GY8A 1ELCA 4Y7AA 2F9VA 5K7RA 5A8XA 3PYHA 2GMTC 1HXFH 2IWQA 1ZUBA 2R4HA 2ZDAH 4FUBA 1HAHH 2ZC9H 8GCHF 3BN9A 4ZHLU 3UR9A 2QN5T 2DE8A 1G32B 4CRDA 5C2ZA 1AWFH 1YF4A 2DLUA 1MKXK 2BQWB 1U3BA 1QRWA 4DIHH 1IQIA 2HNTF 4I33A 2YTWA 5JBTA 1QLCA 4JOKA 3LGVA 3E0PB 1QY6A 1MTUA 1A4WH 5TCCA 1G3EA 2BX4A 2FMJA 3F68H 2VU8E 5EW1H 3Q3KA 2G8TA 3SU6A 3RDZA 5A2MH 3Q00A 3AAUA 4OS5A 5J4QA 1UMAH 4ZXYH 2EDZA 1CQQA 1HDTH 2SNVA 1O2WA 3SHUA 1WFGA 1TALA 1BBRH 3GOVB 4D7FA 1NZQH 1CHOG 2FI4E 4U2WA 1MAYA 2GT7A 4MPWA 2XNIA 4YLQH 2BD4A 4DT7B 4JK6A 3MFJA 2UWLA 5AFYH 2O8WA 1TPOA 3BTHE 1T8MA 6GCHF 1EPTC 1NY22 4Y0ZE 1TX6A 3RP2A 3HK6B 4XFQA 4AFZA 2ZHQH 3H5CB 1ELAA 1UHBA 4NWKA 4X0WU 4OS2A 2M5TA 2VIOA 3E6PH 2ZDVH 2I6SA 1BJUA 2A7CA 8LPRA 1TBRH 3OTJE 3M7QA 4MNYA 3SQEE 1MQ6A 1NESE 3ATLA 1UVSH 1E35B 1D4PB 4D7GA 1C5OH 2HGTH 2PUQH 3RC4A 8ESTE 2AIQA 1Z8GA 1EPTA 3ZVAA 4B71A 3LDXH 1BTZA 5D13A 1SGRE 2NU3E 2XTTB 4DIIH 1EKBB 2VSVA 1YPEH 1TBZH 2BM2A 4FUHA 4K1TA 1B5GH 1QBOA 4ABHA 3UR6A 1O2KA 4F8KA 3VPKA 3O8RA 1D3DB 3O5NA 1AB9B 2BD7A 1GI0A 1FNIA 2FOBA 7KMEH