3MH4A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
343
structure length
301
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 57
structure length 301
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A01
5G1DA 3DFLA 3HVQC 3F9HA 1G3BA 4TPIZ 4Z0KA 1F7ZA 2BZAA 4FU8A 3V12A 4Q7XA 1AZ8A 1ZHRA 1MFGA 2GZ7A 3S9AA 4NIXA 1PQAA 1C9TA 1GM1A 2G52A 3BIVH 2OCVB 1V2NT 1RGQA 2F0AA 1O2XA 1O33A 1WIFA 2BQ6B 2VJ1A 2ZPQA 1NT1A 2SGQE 1AQ7A 1IQIA 3PDVA 1UTKA 1DWDH 1MKXK 2A5KA 3GCHC 4D9RA 4DW2U 2XBXA 4FUFA 2BDIA 2JIKA 4YLUA 2P93A 2QKVA 1OS8A 1AWFH 1O2RA 3GY4A 5EQRA 3M7TA 4Z6AH 2ZDMA 1HIAA 2HPPH 4YOIA 3PS4A 1MKWK 1IQEA 3U1JB 1QLCA 2XRCA 1GI3A 1SHHB 4LZ1H 3M35A 1A7SA 1YBOA 3PV5A 4YESB 2RCEA 4MQAA 2A45B 3BEUA 3B9FH 4IN1A 4MNWA 3TJUA 2EXGA 1UHPA 2Q6GA 3PMAB 1AVXA 2FOEA 1AVWA 5DP8A 4ABIA 1P01A 1AB9C 5JPMH 1B0FA 2ZFRH 3TPIZ 3M61U 3S0NA 1TBRH 3MU0A 1W9OA 2ZU5A 1HIAB 3BTWE 2SGPE 4ZUHA 1GMHG 1XUJA 4RSPA 5FPTA 4INKA 5E0HA 1ESAA 2VPHA 1OZIA 2XBVA 3NZIA 3O5NA 4A92A 2CSJA 4DIIH 4NA9H 3SUEA 1X5NA 1K28D 2XCFA 3HKIB 3RM2H 1HGTH 2QF0A 4UU5A 1BITA 2BD9A 1IQHA 1TIOA 1EATA 2E7KA 2WL7A 4WMDA 3ZZBA 4R2ZA 3M7QA 4Y11E 3E16B 5GNDA 3IITA 3DJAA 5FXLA 4O3UA 4KTSA 1GJBB 5GIBA 3GICB 1ZYOA 3TU7H 1P2OA 4DY7B 4Q7ZA 4D9QA 4O03A 2OP9A 1PQ7A 3SHAH 2Q1JA 3CS7A 2HNTC 3ZVFA 1F0RA 1GJ9B 1VAEA 1YPLH 3ZZ5A 1SQAA 1D4PB 3K82A 5CMXH 4Q2PA 4E7RG 3LONA 1O3KA 1D3TB 3MU8A 3NKKA 3NPSA 4AOQA 2ODYB 1GHAG 1I16A 1S81A 2UUYA 3SNBA 2WYGA 3K9XB 3CS0A 1Z87A 3D49H 3MYWA 1NRNH 5I46H 4A1VA 2PUQH 2XYAA 1LPKB 3ZVBA 3IWMA 1ETTH 1P04A 2JINA 1W10U 2ZHFH 3MNCA 3K6ZA 4WXIA 4B71A 1OBXA 1XUGA 3MH4A 2JETC 1W2KH 2FESH 1GVKB 1O2QA 1V2VT 1QB9A 1C2LA 4IN2A 2D90A 1KEFA 1J15A 3PM3A 1FQ3A 1P10A 1SGFA 1IQMA 1AD8H 1ARCA 2PV9B 5EW2H 2KPLA 4ISIH 3TK5A 3RXUA 1UEWA 3DHKH 1SGYE 1A0LA 1AVGH 3E1XB 3HGNA 4ISNA 5F3XA 4UDWH 2AMQA 7GCHF 1VCPA 1C5ZB 1SC8U 4A1TA 5E6PB 1HAZB 1O31A 2FLBH 2GCTC 4FU9A 4YT7H 2VWRA 1NESE 2JOAA 2F9BH 4YM9A 4WMEA 1MTNB 4LOYH 2L97A 1GBJA 2C93B 5A2MH 3TH3H 3BTEE 1D3PB 4ZHMU 1TOCB 1VGCC 2R3UA 4Q6HA 2WPHS 7ESTE 2UZCA 1EP6A 3A8BA 4ZH8A 5A8XA 1ZTLA 4NSYA 1T8NA 2EEGA 1P8VC 3FVFB 2FI4E 4JZDH 3RMMH 3ZZ3A 2ZU3A 5ABWA 2M0UA 2C3SA 3PDZA 1BFEA 4AFQA 1O5EH 2ZF0H 2SFAA 1WI4A 1QRXA 5HFFA 1SBWA 2FOBA 1FPCH 3T25A 1CT0E 2RRMA 4WJG2 4UONA 2VVCA 3ODDA 4E7NA 2KAIA 3O46A 2RCZA 1S85A 1QGFA 4B2CA 2F91A 3L33A 4JL7A 1E37B 5IYTA 1EPTA 1CQQA 2LPRA 2KJPA 3TIUA 1EZXC 3ZZ8A 1C5OH 1WTGH 3SV8A 1L0ZA 1GBAA 1GL1A 1FPHH 3L4FD 5DP3A 1GBFA 1GVLA 4JOGA 1GQ5A 5GCHF 2QY0B 4BAMB 1BDAA 5C3NA 3Q3XA 3STIA 1KXDA 5JDUB 1FC9A 1HPGA 3CBYA 3PROA 3KHFA 1H9IE 1XUIA 1TX7A 1VB7A 3ZZ6A 3S7KB 2DLUA 1BRAA 1Y3VA 4X8SH 3KZEA 2TIOA 5GWZA 2ULLA 2XWBI 1F5LA 1PYTD 1TNHA 2VH6A 2JREA 4FUJA 3A7VA 1EPTB 2BVSH 4HGCA 1LMWB 2ZECA 4OS7A 2QV1A 2LA8A 2FN5A 1GI9B 1HRTH 2J4IA 3SHCH 5DP4A 4ESTE 1GMCF 5HETA 4CR9A 1PPCE 2R0KA 3K2UA 2CSSA 5FCRA 4BTTB 3RU4E 1O32A 3UWIA 4A5TS 2HALA 4WYTA 2H3MA 3NUMA 2CXVA 1N1LA 1NROH 2KJDA 1BRCE 4ISLA 1S0RA 4N6XA 1UMAH 2UWOA 4FUBA 4F4OC 5DP5A 1GG6C 1GI5A 1C9PA 1UK4A 2HGAA 2BB4A 3F9FA 1KY9A 5C1UA 3VB7A 2VGCB 4Y7BA 1TWXB 2QC2A 4XBCA 4JZFH 1UVTH 1WOFA 1J14A 3ATKA 1Q2WA 2IWOA 1CBWC 1YLCA 4R8TB 2EV8A 5L30H 2TGTA 1S6FA 3WKLA 5H3JA 1EQ9A 1V2RT 3SBKA 1AFQB 3DT0H 1V2JT 1QCPA 2WYJA 4JZ1A 4D8NA 4GLYA 3TVJB 1GGDB 3SV2H 2ZP0H 2ZQ1A 1QJ6B 3DUXH 3KN2A 4ABAA 1V3XA 3SQHE 2ASUB 2XW9A 1ZTKA 1NRQH 2FP7B 3A8CA 4AFUA 4O9VA 2PSYA 3PLPA 2LOBA 1G3DA 1QR3E 1GCDA 2AGGX 1V62A 2FLRH 5K7RA 1O35A 3LT3A 2F9VA 3P8GA 1ELTA 2CF9H 4H6SB 4CRGA 5FBEA 1O2SA 2ZQ2A 4JOHA 2FPZA 1RXPA 5HFBA 3AVZA 3T5FH 2Y5FA 4UU6A 4B76A 3SFJA 2M3MA 1L1GA 1GBDA 1FMGA 1TX6A 2ZDLA 5FPYA 1LO6A 1V2TT 5EQQA 3LPRA 2D1JA 1NN6A 2WPKS 4CRAA 2PTCE 1BTXA 3MH7A 1WQVH 1MAXA 4SGAE 2BVXH 2VWOA 2B8OH 3GCHB 4B74A 1FI8A 4Y76A 2F3CE 3ZRTA 3MHWU 1GJ6A 1GHZA 4UD9H 2P95A 1UJVA 2OC7A 3E0PB 4YZUA 1GL0E 1HBTH 1NF3C 8ESTE 1QB1A 1DUAA 1BTWA 3SNAA 1SMFE 2V3HH 1Z71A 1SGQE 2R4HA 1N6YA 2JKHA 1VCWA 1GI6A 2QN5T 1Y7NA 2BLWA 1QAVA 1BA8B 2BY8X 3O8BA 1HUTH 4U32A 4FGMA 1GMDF 1GCTC 1TPOA 3RXDA 1TNIA 3RXAA 3RXHA 1P05A 1WBGB 2MHOA 3K6YA 3SUFA 3QUMP 2HGTH 1C2MA 3TK9A 5A0AE 2P3WA 2GT8A 1AB9B 1LHEH 3QTVH 1UTJA 2GVFA 2XBYA 3JZ1B 1QNJA 2ZHEH 1O3LA 3M3VA 1QL8A 5EODA 2YT7A 1V2QT 1TRYA 3BF6H 1DT2A 5G4BA 5EXLA 2P3UB 1DOJA 2BD7A 4OS1A 2JWEA 1FY5A 1L4DA 1QAVB 2Q6FA 1EUFA 2KAWA 2XWAA 1F5KU 1OYQA 1T8LA 3R68A 1D3QB 1HXEH 4JOEA 1LKAA 3RXCA 2R3YA 1GBEA 2H9EH 3ZZAA 4DVAU 1GHYH 3A8AA 1K1JA 1V6BA 1BJVA 3A7XA 1UM7A 1FY1A 1ORFA 1EB1H 3PMHB 4GAWA 1P12E 1INCA 4KGAA 1Q3XA 4GHTA 4XFQA 1YBWA 1ZGIA 1NO9H 3SNDA 3SGQE 2Q6DA 2XXLA 3PMBB 1UK2A 1O39A 4I8HA 3RMOH 4CHAC 1AKSA 2H2ZA 2H5DA 2ZFQH 2Y81A 1BE9A 1OWIA 3A7ZA 1Z8RA 2HOBA 4K1SA 1XZ9A 4Q80A 2GDEH 1KWAA 3QK1A 2VSVA 2J94A 5ESTE 1SQOA 1EP5A 1QJ7B 1NS3A 4AFSA 4U30A 1TYNA 1ANCA 2HVXA 2DAZA 5HXFA 2STAE 2EEIA 4YO9A 3SN8A 4K78A 2EDZA 2TGPZ 3B76A 5EPNA 1Z8IB 3U9AH 4I32A 4X6PA 2FOMB 3NCLA 3GY7A 1TBZH 3TJNA 3KNXA 5GPIB 4Z33A 4AB8A 2W3KA 1V1TA 2YOLA 2ZCHP 3UNQA 1G32B 2YT8A 3GSLA 1TAWA 4XE4A 3P8OA 3ODFA 1OPHB 2OQUA 2JETB 4BXWA 7GCHG 1N6FA 2PZDA 3A85A 1MBMA 2QA9E 4GVCA 1C1QA 2ANMH 1YPJH 1FAKH 1UF1A 1GDQA 4O06A 3OYPA 3E90B 4D7GA 5FPSA 4BAHB 3EE0B 1N7EA 1OOKB 4FUIA 2X7ZA 3MO6A 4I8LA 2AS9A 5L6NH 1AWHB 3BTTE 1LQEA 5C67A 1N6EA 3MMGA 3SOSA 3S9CA 1VJ6A 2ZGXH 2EJYA 4X1PU 5H4IB 2VVUA 1ZMJA 2GCTB 4SGBE 1O2NA 1DLKB 1SGCA 1SQTA 4E34A 3A7YA 3SU6A 1BTPA 1T32A 1TGSZ 1VGCB 1EAWA 3GCNA 4Q2KA 1CA0C 3BTME 4NMTA 3UWJH 1AE8H 2HWLB 3DIWA 3A7WA 3BG4C 2FTMA 1O5FH 2VIQA 4JZEH 1JIRA 4RI0A 1XXDA 3VGCC 4P2AB 1RY4A 5JYIA 1ZJDA 1C5WB 2G2LA 3WY8A 1MMJN 4ZXYH 4XBBA 5FX5A 1DY9A 1N99A 1GJ7B 1C1TA 4MNVA 2H2CA 1WF8A 2GCHF 2VIOA 3BSQA 5GCHG 5E0GA 1C1OA 3DD2H 1UTMA 1WU1A 2BMGB 2JILA 4BOHA 4NMVA 2M0VA 3A88A 2LNCA 4A1XA 3FANA 2W4FA 4ZAEA 1JXPA 1Z6JH 1V2ST 2O8WA 1WF7A 3TSVA 1H8DH 1SR5C 3G01A 1UHBA 3LGWA 2K1QA 1O0DH 1LKBA 1HYLA 2WPMS 5CHAB 2V6NA 1CA8B 5EZ0A 1FLEE 1KXBA 2GTBA 5DTHA 2NU2E 4U01A 5E8EH 1A2CH 5T6DA 1GMCG 2O8LA 2TGAA 3M5NA 3RC5A 4MPWA 2W7SA 2ALVA 4FUHA 5AF9H 2ZPMA 1GI7B 1ZHPA 2FXRA 3DJ3A 4CH2B 1EZUC 2A1DB 2NU4E 5EW1H 3TMHA 1W8BH 1SHYA 1SL3A 1DSTA 3LGYA 1L4ZA 1YC0A 4M7GA 2FOFA 2EHRA 1IQKA 4OGYA 1C1VH 4CRDA 2PW8H 4YTAA 1FC6A 1O2WA 5HM9A 1U38A 1HCGA 2BDAA 4JZIA 4GCHG 5DO4H 2Q9VA 2J95A 5SGAE 4AORA 1ZTJA 2WPLS 4O3TA 1HAIH 2PUXB 3RU4D 1CT4E 1YPHC 1QAUA 1Y8TA 4FU7A 1TQ0B 1KLTA 2A2QH 1MTUA 2PGBB 1QBVH 1AO5A 4QT8C 1BRUP 1LVMA 3RUOA 2ZDAH 1L6OA 4K8BA 5FB8C 1NFUA 1RTKA 1O2MA 2BQ7B 4K69A 1W3CA 1Q3OA 1WCZA 2ZDVH 1XXFA 4ZXXH 2OSGA 1ELCA 4NSVA 1U6QA 1UFXA 1LHCH 1O2YA 3PV4A 1XUHA 1Y59T 1IAUA 1G9IE 2BDBA 2ZIQH 1HJAB 1TP5A 1DICA 1GJCB 3WKMA 4KTUA 1O2TA 4Y0YE 3ZVCA 3L3TA 4JOFA 2FCFA 1TGNA 1AY6H 1ABJH 3ZYDA 2VH0A 2GMTC 1QIXB 3TNSA 3I78A 1UTQA 4NMPA 3P92A 1O3NA 2DM8A 4OS4A 4XDEA 3GYMA 4X8TH 5ETXA 3EGGC 1V6DA 1QHRB 3GCTF 1U3BA 5G1EA 2A4QA 4ZROA 4AG1A 3UNSA 3MWIU 3E17A 3ZZDA 1YGCH 4HI3A 2NWNA 2DJTA 3D23A 5HDYA 5C5OA 1MAYA 1J17T 1TGCA 5HEBA 3CBZA 3MNBA 1MQ6A 5A0CA 3MU4A 2ZCKP 2R0LA 5C1XA 2NU3E 1TPAE 3LNXA 2H2BA 1SGRE 1VJ9U 3SUGA 1C5UA 3OY5U 3FY5A 3AAVA 3BN9A 3FZZA 1FN8A 1MC7A 2A7HA 3UQOA 1BOQA 3ZV8A 1SOTA 2OPGA 1FONA 2TGDA 2R2MB 1NC6A 2FX4A 2M10A 4HOPA 3Q3KA 3S7HB 2F9OA 1GCTB 2Y5GA 3UREA 3UNRA 3D65E 2A7JA 4MTBA 2OUAA 1ZPZA 1KXFA 1DWCH 2ZHQH 1O2KA 1XMNB 3HK3B 4K8YA 4CRFA 2GV7A 1HAGE 2Z94A 4NNLA 1O34A 1TRNA 4X6NA 4ZHLU 1TGTA 1C1NA 3K65B 1DM4B 1DS2E 1TPSA 2C4FH 2SGAA 4X2YA 3TGJE 4LZ4B 2ODQA 1HXFH 2QT5A 4ABEA 3P70B 1GJ4H 2VRFA 4AGKA 1W9QA 5DJ7A 4HOPB 4KKDA 2GZVA 4NFEA 3UR6A 2FI3E 2PKSB 1XUKA 4I8GA 5HMAA 4XOJA 1G37A 1GJ8B 4E05H 2XNIA 2C8YB 3GDVA 1C2FA 1NY22 2B7DH 2WPJS 1QFKH 4NZLA 2JH5D 2V0BA 3AAUA 1ELBA 3ENSB 4WH6A 3EQ0H 3VPKA 1Z1JA 5J4QA 5EG4A 1THPB 2VWLA 5FAHA 1WFVA 1SSXA 1V2UT 1S5SA 4DGJA 3E6PH 2ZGBH 5HFCA 1YPMH 5L2ZH 3D62A 1EKBB 4HZHA 4ABGA 5TJXA 3EAJA 1UJDA 3RXSA 1ARBA 2A31A 3SNCA 1TE0A 1UEZA 1TP3A 1PYTC 2SGFE 3I29A 3RXFA 2Z9JA 4XHVA 5HFEA 1Z86A 4TY6A 4Q6SA 2OZFA 4ZHAA 2PWXA 2W7UA 1H8IH 1WQSA 2ZU4A 1FC7A 2D92A 2VWNA 4A6LA 2AWUA 2VNTA 3QJMA 5EXNA 3QDOA 1A46H 5E2PA 1A5HA 1MFLA 2GGVB 3W95A 3ZVEA 3F6UH 3SZNA 2EGOA 1LHGH 1SI5H 2ZTYA 1GI4A 2AWXA 1HAHH 4WYUA 3RLEA 1MU6B 1NTPA 2TRMA 4AG2A 4DT7B 2OC8A 1G9OA 4A7IB 2ILNA 1IU2A 3NFKA 3K1RA 5HJ1A 1IQFA 4U2WA 1ZMNA 2ZCLP 3A87A 2HE4A 1MUEB 1DLEA 2YUBA 1A5GH 4PQWA 1M9UA 1ZSKA 3GOVB 4IC5A 2PDZA 4K72A 5GLJA 3GY3A 5FCKA 1E0FD 3M5MA 3HKJB 1AFEH 1QA7A 3GISB 3TITA 1DWBH 2SNVA 1A5IA 4B2BA 1Q3PA 3UOUA 2VU8E 3SHUA 1O5CB 5CE1A 4MPVA 2R2WU 1DDJA 1UK3A 4X6MA 1P0SH 1DWEH 1HJ8A 2BDHA 2GCHG 3BTQE 1EAIA 1YKTA 2KOJA 1CA0B 1EX3A 1LPZB 1ZJKA 1O30A 1O36A 3U8TH 1E34B 3BG4B 3CBXA 3VGCB 1VCQA 1BQYA 1C1UH 3ID1A 1AHTH 5AFYH 3TH4H 1IQJA 2EC9H 4RKOB 1CSOE 1P2KA 2KAIB 2P3TB 5C5NA 4DURA 3DJ1A 1O3BA 3KQCA 2G81E 4DJZB 2BHGA 2B5TB 1U37A 4LMMA 3SJIA 3ZYEA 3SI3H 1DFPA 1UTNA 2FM2A 1F0TA 4JK5A 1P3CA 2LC6A 4EDJA 3FP8E 3LJOA 1OXGA 2HE2A 1P3EA 5LPFA 4WVPE 3UIRA 3ATMA 2CN0H 1RGRA 5FX6A 4ZKSU 4IMZA 3QX5H 1FY3A 4NFFA 6GCHG 2VWMA 5DPAA 1C5TA 2KL1A 2G5MB 1O2OA 1YCPM 2A5AA 2J34A 2I04A 2K20A 2SNWA 3SQEE 3HPMA 5HEDA 2RG3A 1X45A 3CC0A 1V2WT 4UFFH 4X1NU 4JYTA 3S9BA 5T6FA 4MPXA 5AHGH 3LNYA 1GWAA 1ELDE 1SFIA 3QWCH 4NMQA 1GI0A 2PKAA 3SU1A 1O3DA 1AGJA 4BAOB 2M5TA 3URCA 1GHBF 3GJ9A 1SLVB 3VQGA 1F5RA 1PFXC 5GXPA 1SLUB 1TNKA 2F5YA 1FY4A 2BD2A 4ZKRU 3UOPA 1K1IA 2OC1A 4MPUA 3T62A 3Q3YA 5E11A 1GBTA 2H3LA 3GGEA 1B8QA 4E3BA 1F0SA 1EAUA 4ISOA 1K1NA 5I25A 2ZGHA 2AIQA 4X8VH 4BTUB 1YCPH 1YP9A 1IHSH 4I33A 1G3EA 4AYVB 4JOKA 1FJSA 2BY9X 2PKAB 2KQFA 1RJXB 1O3FA 4WY3A 2PKTA 1WJLA 1HDTH 2JXOA 1C5PA 3GDUA 1UITA 2PSXA 3F68H 5FHTA 4KP0A 2OXSA 5E1YA 2EI7A 1FNIA 5LPRA 3PLBA 3KF2A 4OGXA 3RXEA 1YPKH 3SV9A 3A8DA 1DE7H 2FS8A 3V13A 1K1MA 1UTPA 3QO6A 1XKBC 3A82A 1V2OT 1Y3UA 2BTCE 3TK6A 2B9LA 1IQLA 1HAVA 1L1JA 2BM2A 1Z6EA 2G8TA 4KFWA 3GCTG 4OS6A 5DP7A 3SJKA 1RTLA 4OEOA 2UWPA 1P9SA 1K1LA 2KG2A 3HATH 1N7FA 1VA8A 1A0HB 1UEQA 2HPQH 1JRTA 1YPGH 4Q2OA 2Y80A 5DP6A 1F0UA 2GMTB 2ANYA 3A89A 1GI1A 1LHFH 3R0HA 3O8DA 2KV8A 2KOMA 3U8OH 4KFVA 1TBQH 2HLCA 3B23B 3EDXB 2DE9A 2D8WA 2IWQA 1MCVA 1TABE 1E35B 1P2IA 3OSYA 1S83A 4YOGA 3KIDU 3RXBA 4NXRA 1N6DA 2W7RA 1T2MA 3MU1A 1BMNH 2I6QA 2THFB 1GJDB 3EA9A 6ESTA 1O3OA 1X8SA 2PHBA 1AU8A 1H9HE 1CE5A 1FIZA 3ZVAA 1P06A 1ZRKA 4NA8A 2M0ZA 3B8JA 4MLFB 5T3HA 1C5NH 2IPHA 2GD4B 1Y3WA 4NIYA 3SI4H 2JH6D 1P11E 1SFQB 1ZPBA 3U8RH 4ABHA 2F9UA 2G55A 2YTWA 3PTBA 1UM1A 2KBSA 2BOKA 2BY7X 2BVRH 2KYLA 3Q00A 3QZQA 3VB6A 4CRBA 4ZKNU 1I92A 3TGIE 1T8OA 2P59A 1KXCA 1IHJA 1P03A 2H5CA 3RXKA 3LH1A 3I4WA 4AN7A 3RP2A 3MU5A 2EEJA 3VB3A 1JRSA 1TMBH 3SORA 2AMPA 1A3BH 3EGHC 1FXYA 1QL7A 1O3HA 4H42U 3F9GA 4JK6A 1KXEA 1KSNA 4NIVA 2Y5HA 3RXLA 1WUNH 1YCPK 3GY2A 4XBDA 3SU0A 1O5AB 1K32A 1ANDA 3I77A 1P02A 2ZDNA 2VIVA 3I18A 3ESTA 2QXJA 4Y8XA 1WI2A 2I1NA 4ZMAH 2FODA 1TNGA 4I7YH 4Y6DA 3M36A 4AB9A 2EDPA 2XC4A 4X6OA 1BHXB 5LPEA 8KME2 4ZKOU 2AGIX 4I8KA 1GHAF 2L4SA 8GCHF 1THSH 4NWLA 1AKSB 2DMZA 3QDZB 2EDVA 2ZTZA 2M0TA 2IN2A 1D9IA 3VXEH 3RXIA 4IS5A 2A0QB 4Y0ZE 4NZQA 4BAQB 2FYRA 2G51A 4BNRA 4YOJA 3ELAH 1T4UH 2BY5X 1H9LB 1ZOKA 4MG3A 2STBE 1LVOA 1V2LT 2QKUA 1Q31A 1MTSA 2VVVA 2C90B 1W7XH 4LK4A 2Y82A 4MDSA 4Y10E 1K21H 2G5NA 1TALA 4AX9H 1GBHA 4I8JA 1P2QA 1WG6A 2QYIA 2BDCA 2Z3EA 2ZGCA 4BAKB 1F2SE 2O8MA 3W94A 2LUIA 1SGNE 1FCFA 1MTNC 2W26A 2A5IA 2DLSA 1SGDE 2XBWA 3KZDA 1ID5H 1NM6A 1D5GA 2WV5A 1O3GA 2VSPA 1O2HA 2A4GA 1IQGA 4OS2A 1C1RA 1C5SA 4HTCH 4IW4E 1OSSA 1P09A 3E91A 1TGBA 1BBRE 1OBYA 1K22H 1VZQH 1O2ZA 2OD3B 2HNTE 2AERH 3RC6A 1CHOF 1J8AA 1WTHD 1GI8B 5A8YA 2BLQA 2Z3CA 1TMTH 2D2DA 1A0JA 1NFYA 2K1ZA 1D6RA 3H7OA 2UUKB 4VGCC 4D76A 2EEHA 1VR1H 4NWKA 4NCYA 2VIPA 3RC4A 2YNAA 1PPEE 4H6TA 1ZGVA 2ZHDA 2AINA 2QAAA 1ANBA 1UO6A 2G00A 2OQ5A 4NGAH 1OP2A 1RGWA 2NU1E 3V0XA 2F9NA 1BMMH 2ANKH 4OAJA 3P8FA 1GI2A 5HFDA 1HAPH 2A7CA 3KQBA 2PA1A 1EJNA 2ZA5A 1CHGA 2PNTA 1BTHH 1GJ5H 2AIPA 2PFEA 2EGKA 2H9TH 3R69A 4THNH 3U1IB 1ELAA 3TJVA 2A32A 3E0NB 2R9PA 1L2EA 1A3EH 3ATWA 2V1WA 5HYOA 1C5MD 4ISHH 1C4U2 1MU8B 1PPFE 2FDAA 4MNYA 1GBCA 4NIWA 2FS9A 5LGOA 4AGJA 2O8UA 4IBLH 1HLTH 4MNXA 1WAYB 2GZ9A 1BJUA 2QXGA 4NMRA 1RZXA 1SGTA 1VITH 2VINA 1WH1A 2NU0E 1P9UA 3MH5A 5BPEA 3EA7A 1BMAA 1CGHA 2ZFPH 1TA6A 3BEFB 3KEEA 2ENOA 1X7AC 4KELA 4TWYA 1D6WA 1UHBB 3MI4A 2Z3DA 1O2UA 1NRRH 4TYDA 1TMUH 4NMSA 1LVBA 5F03A 1QY6A 1UVPA 1DXPA 1O37A 5DG6A 1UJUA 4CRCA 4IC6A 2C8WB 1WHDA 3U98H 1Y5UT 5J4SA 2KJKA 3RL7A 2VGCC 3R0FA 3F9EA 1O2LA 3FP6E 2CMYA 1DXWA 2BD5A 3S69A 4AFZA 1ACBE 1XKAC 2Z17A 5F8ZA 3RDZA 2EGNA 1BMLA 1EJMA 1GHBG 1ZZZA 1GVZA 1GG6B 3K50A 1DANH 5T6GA 2VB0A 3SU3A 2XCNA 1AFQC 5JXBA 2WUBA 3PTNA 2SGEE 3VEQB 5JB9S 1LDTT 4Y71A 2CV3A 2PTNA 1GGDC 2DE8A 1OWKA 3T2NA 3M3SA 1LVYA 1RTFB 3ZVDA 1CBWB 7KMEH 1IOEA 5F8TA 1X5RA 1Y5AT 2IJOB 9ESTA 1O5BB 2BDGA 3O8RA 2PLXA 3RXRA 2ZWLH 4YLQH 5F6MA 4INLA 3GYLB 4YDPA 2BX4A 4L8NA 3AASA 3RXGA 1CVWH 2BYGA 3IG6B 3LOXA 2BOHB 4IGDA 4ABFA 3MO3A 5E0JA 3PYHA 3UY9A 3ZZ4A 3SU2A 4GHNA 6CHAC 2XC0A 3FP7E 2GX4A 3SV6A 3SW2B 1YF4A 1B0EA 9LPRA 2GDDA 1DITH 1MBQA 2I6SA 5EYZA 2RA3A 1K1OA 1D3DB 4GUXA 4Y8ZA 1LTOA 2UUJB 2QXIA 2WV4A 2IWPA 2J2UA 1UCYE 2ZTXA 3AW0A 3TGKE 4B2AA 1QBOA 1QA0A 1MD8A 2D8IA 1T31A 2BZ6H 4Y79A 2GKVE 4AMHA 4NXPA 2FX6A 2O8TA 3AXAA 2ZO3H 4GVUA 2F9PA 4K75A 2DUCA 1ZHMA 1KYNA 3QGLA 1MQ5A 5DK1A 4FUDA 3RU4T 1GMDG 1MD7A 2Z7FE 1EASA 3LGTA 3BTFE 4B75A 3Q76A 3T26A 1RFNA 4ABDA 1NFWA 2AWWA 1OBZA 3ID4A 5ESBA 4D7FA 1CGIE 1MH0A 1W7GH 3TNTA 1OWDA 2ZG0H 1WYKA 1X6DA 1O2VA 2W3IA 1XVOA 1KXAA 5TCAA 4GSOA 4CBOA 1IQNA 1AE5A 3RXTA 4JOJA 1QQUA 2CHAC 3TLOA 1RS0A 1SGIB 1PPGE 3QZRA 2QBWA 1C2KA 1SG8B 1Z7KA 5HM2A 2I0IA 5AFZH 1NRPH 5F67A 3SUDA 1CO7E 3SUZA 1GBIA 3GY6A 5EPYA 2C8ZB 3JZ2B 1EOLA 1C2IA 3PO1C 1J9CH 1LQDB 2ZC9H 1W11U 4GHQA 1NRSH 1QURH 3F1SB 3SJ8A 1JWTA 3Q77A 5IDKA 1P1DA 3OY6U 1UTOA 2FIRH 1QB6A 1OKXA 1C2JA 2ZI2H 1N8OC 1A61H 1MCTA 3LH3A 1G2MA 1BB0B 3A84A 2EEKA 3UTUH 3ZV9A 4P0CA 1QJ1B 3C1KA 1X5QA 1OWJA 3BV9B 3RXVA 5HF1A 4UE7H 1TQ3A 1XM1A 1ZPCA 3CP7A 4WF8A 2F83A 4I31A 4CHAB 2C8XB 1B7XB 1TX8A 1MZAA 1GBBA 2P3FH 4WMFA 2G4UA 1SVPA 5EQSA 2GT7A 2RDLA 6LPRA 1WHAA 3BTGE 8GCHG 1GHWH 3OU0A 1C1SA 1JIMA 4TY7A 4JCNA 2PKUA 3CH8A 1OP0A 1QRZA 3GY5A 5EGMA 3A86A 4CR5A 2Z9IA 2V3OH 4JMYA 2A2XH 2AMDA 1F92A 1HAYB 3SGAE 3I1EA 2HRVA 1T8MA 1BTZA 3EYDA 1UVSH 4X8UH 3NGHA 1C1PA 4F49A 4KTCA 3U69H 3LJJA 3SNEA 1AZZA 5EU8A 2DB5A 1TA2A 1UJ1A 4JOPA 2QCYA 1ZR0A 2G5VA 4Q2NA 1QTFA 2FOGA 3GCOA 1IU0A 4YYXA 1W0YH 3MNXA 4UFGH 4YT6H 3QLPH 2ZNKH 1Q7XA 3ATIA 3ID2A 3TSZA 3QIKA 1H4WA 4UFDH 4NXQA 2J38A 3DORA 4REYA 1BBRH 1C5VA 1VJAU 1W12U 4Q3HA 1FY8E 3ITIA 3LU9B 3T29A 1SOZA 3RLYH 3C27B 3TSWA 1G30B 1KDQA 1EZQA 3A81A 3LDXH 2ZGJA 1MTVA 1UTLM 4K2YA 2FTLE 3JXTA 1CHOG 1T7CA 1H1BA 2DKRA 5E21A 1NZQH 1C2EA 1EXFA 3BEIB 3VQFA 1V2MT 1BTYA 2PR3A 1P2MA 1S0QA 1ESTA 3RXQA 2XC5A 1C5YB 2ZU2A 3M7UA 2OLGA 1RIWC 3VB4A 4ABBA 2OC0A 2OS6A 2REYA 3MO9A 2OCSA 1IHTH 4E06H 2ODPA 3NK8A 4Q2QA 3P6ZB 5JB8S 3RXPA 2BD8A 1KDQB 2OQSA 1AN1E 3BPUA 1U39A 4AZ2B 2AH4X 4FVBA 2Y6TA 1MTWA 7LPRA 4VGCB 3PB1E 2QG1A 1GDNA 3UQVA 4DCDA 2P8OC 2V35A 3SGBE 1OWHA 4BTIB 3HK6B 2CGAA 2CJIA 1DVAH 1LPGB 1C2HA 1TNLA 2ANWA 1M5ZA 1TB6H 4INHA 4H4FA 1SPJA 2FWWA 5CHAC 2UUFB 1OYTH 1O3JA 1OWEA 5A2PA 2TBSA 2AYWA 5GDSH 1ZSLA 1XUFA 1ZSJA 3OX7U 3EA8A 1O2GH 3SOEA 4WXVA 3A7TA 2Z9KA 1O38A 1QQ4A 2BYAX 4NA7A 2BY6X 2CS5A 2XTTB 1KIGH 3LGUA 4TWWA 2Z6BD 4NG9H 1ETRH 3HPKA 1BZXE 1TONA 1ZUBA 2OBQA 2OGPA 3L6PA 1O3IA 5AVDA 2Q3GA 3BIUH 1FN6A 2QXHA 4JYUH 5HF4A 3STJA 1NU9A 4Y8YA 1GBKA 1P2NA 1N6XA 1VITF 1O3CA 2Y7XA 4GVDA 3VB5A 1EOJA 2FOAA 3CENA 1Y5BT 5I7ZA 1SGPE 1V2KT 1BBRK 2OBOA 1TPPA 2RA0A 5D13A 2QKTA 4OEPA 3V3MA 1PQ8A 4K1EA 4IMQA 4ASHA 1SB1H 1PPBH 3M5LA 1K1PA 1TQ7B 4GCHF 1GBMA 3T28A 1O5GH 4NMOA 1P57B 3MH6A 2BD3A 4Y7AA 3BG8A 1Y3XA 2ZFFH 4K5ZA 5HEYA 5EOKA 4UFEH 3RMLH 1XX9A 1J16A 2ZPSA 3GDSA 1W9EA 4MPAA 1PPZA 1C5XB 1HJAC 1S84A 4OS5A 5C2ZA 2H6MA 3ZZ9A 2QF3A 2DC2A 2IOTA 1UCYH 1G36A 2FEQH 1PQ5A 1QRWA 2QIQA 3KGPA 1BRBE 1V5QA 2FYQA 4K1TA 3UFAA 2A4RA 3HPTB 3P95A 2BLVA 2AEIH 3BTDE 3SV7A 3N7OA 6CHAB 1K2I1 3LGIA 2BDYA 3QGNB 4FUGA 4B1TA 2FZZA 5JBTA 1AUJA 4RN6A 4TPYA 2CF8H 1SLXB 2GP9B 3SJOA 4H11A 1ELVA 2WINI 4G69A 2VZ5A 1S82A 1KTTB 3ZVGA 4ABJA 3PWCA 2AFQB 1YM0A 5TCCA 2LC7A 1E38B 3OTJE 1GDUA 1HJ9A 1SLWB 1GHVH 1WSSH 3RLWH 3QGJA 2KOHA 2Y7ZA 3UPEA 3LIWA 2ZPLA 1O5DH 3MTYA 4UEHH 1HAVB 4F8KA 2P16A 2QGRA 1TNJA 1YPHE 4K60A 5GJ4B 1UVOA 1ELEE 3PMJA 4PROA 1P1EA 1OX1A 1FDPA 3LGVA 3HGPA 4WWYA 5C20A 3ZZCA 1FZZA 1NPMA 1OP8A 1ZOMA 3KQDA 2Z9GA 1GMHF 2ZHWH 3QN7A 2I4SA 2TPIZ 1NFXA 1YYY1 3VFEA 1C5LH 1K9OE 4DOQA 1B5GH 5DGJA 5A09A 5BRRE 3ID3A 1C1MA 3URDA 2WUCA 3ZZ7A 1AIXH 3M37A 1FUJA 1WFGA 1EB2A 1Z8JB 3BTHE 3ATLA 2L4TA 5F8XA 4X0WU 3TH2H 1UVUH 3QJNA 1BTUA 2D26C 1BCUH 5K0HA 1ESBA 2CHAB 3LC5A 1FAXA 1TLDA 1Z1IA 2PKSC 5DKMA 4Z8JA 1ANEA 2A4OA 2ZFTA 2ZKSA 2V90A 2B0FA 1G3CA 2W5EA 3V7TA 1E36B 1G2LA 3TJOA 2VIDA 3UUZA 1GHXH 1W14U 4R0IA 3RMNH 1Y3YA 2MX6A 1RD3B 5B6OA 3PO1B 2UWLA 1ZMLA 1ELGA 4X2WA 2OINA 4O97A 1PJPA 3PV2A 2O2TA 2J9NA 3E3TA 4FXGH 4JYVH 4DG4A 5JBCS 4BANB 1UCYK 1HAXB 3A80A 3FAOA 5JBAS 4K3JA 5E2OA 1N8OB 3RXJA 2YUYA 4X2VA 1BIOA 5HGGA 1R6JA 2ESTE 2BD4A 1ELFA 3O8CA 4WH8A 2EI6A 4X1QU 1GQ4A 1S6HA 1AI8H 1QL9A 5DP9A 2H9HA 5FBIA 1THRH 3H7TA 5EXMA 2H1UA 1C5RA 1PPHE 2KRGA 3KCGH 4X1RU 4Q7YA 1W13U 2EA3A 1O2PA 1MZDA 2Z9LA 4K6YA 2I0LA 1EAXA 2KPKA 1JMOH 1O3AA 1DY8A 3SU5A 4NNMA 2GZ8A 3FFGA 3CYYA 3MFJA 1EJAA 3MOCA 2BLOA 4X2XA 1KLIH 2G4TA 1BUIA 2ZFSA 3P17H 1ABIH 2BXTH 2O9QA 1JOUB 2JH0D 3RXOA 3PLKA 3EGKH 2I6VA 1DSUA 2BXUH 2IWNA 3NFLA 4MVNA 3M5OA 1AUTC 4XSKU 1V2PT 1DX5M 2YNBA 4JORA 1GBLA 2SGDE 3LKWA 1NTEA 1AMHA 4CBNA 2EAQA 2BX3A 2ZDKA 3UR9A 4FUCA 3R3GB 1EZSC 3T27A 1C4V2 1RRKA 3AW1A 5E22A 1NU7B 1FIWA 2ZEBA 2J92A 2HNTF 8LPRA 1ZRBA 1C2GA 1FV9A 2FMJA 2GV6A 1GPZA 5JBBS 2FO9A 4X1SU 2PGQB 4RKJB 3RXMA 5LH8A 1TFXA 1C4Y2 5PTPA 3LC3A 1BHXF 4FUEA 1CGJE 2ZU1A 2ZZUH 1MKXH 4J2YB 1RIWB 2VIWA 3VXFH 1ZLRA 1XVMA 5B6LA 3DFJA 3SO3A 2ZPRA 1CU1A 3PWBA 3KQEA 3OTPA 1ETSH 3KHVA 1Z8GA 1GJAB 1YPEH 1MKWH 3QTOH 4J1YA 4B73A 1CT2E 1O3EA 4GPGA 1C5QA 2OMJA 4LXBH 1O2JA 1EPTC 1JBUH 1BT7A 2P8OB 1HB0B 5C1YA 2KA9A 1L1NA 2FOCA 4AYYB 3GY8A 2EI8A 4CH8B 1N7TA 3H5CB 3SHWA 3RM0H 3E8LA 1V5LA 1SGFG 2WPIS 2FI5E 2P94A 3NWUA 1A4WH 1O2IA 1TOMH 3M3TA 3A83A 1LCYA 1UEPA 2BQWB 3FZDA 3NXPA 1YLDA 2FNEA 1VITG 4CREA 3MNSA 4FVDA 1W0ZU 1TRMA 3DA9B 1C1WH 5L2YH 6GCHF 2ALPA 4HFPB 1KLJH 1KTSB 1O3MA 4BXSA 1PDRA 3BTKE 4DIHH 2OTVA 5A8ZA 1HV7A 1HFDA 1LHDH 3SJ9A 5A0BA 3SU4A 3QE1A 1DUEA 1QBNA 1T4VH 1C2DA 1SGEE 1HNEE 3KL6A 1WV7H 1HAOH 3RL8A 4E35A 1O3PB 4K76A 2FE5A 1A1RA 1DPOA 3P8NA 2FOHA 1P2JA 2AGEX
chains in the Genus database with same CATH superfamily
5G1DA 3DFLA 3HVQC 3F9HA 1G3BA 4TPIZ 4Z0KA 1F7ZA 2BZAA 4FU8A 3V12A 4Q7XA 1AZ8A 1ZHRA 1MFGA 2GZ7A 3S9AA 4NIXA 3SYJA 1PQAA 1C9TA 1GM1A 2G52A 3BIVH 2OCVB 1V2NT 4YXWD 1RGQA 2F0AA 1O2XA 1O33A 1WIFA 2BQ6B 2VJ1A 2ZPQA 1NT1A 2SGQE 1AQ7A 1IQIA 3PDVA 1UTKA 1DWDH 1MKXK 2A5KA 3GCHC 4RT0A 4D9RA 4DW2U 2XBXA 4FUFA 2BDIA 2JIKA 4YLUA 2P93A 2QKVA 1OS8A 1AWFH 1O2RA 3GY4A 5EQRA 3M7TA 4Z6AH 2ZDMA 1HIAA 2HPPH 4YOIA 3PS4A 1MKWK 1IQEA 3U1JB 1QLCA 2XRCA 1GI3A 1SHHB 4LZ1H 3M35A 1A7SA 1YBOA 3PV5A 4YESB 2RCEA 4MQAA 2A45B 3BEUA 3B9FH 4IN1A 4MNWA 3TJUA 2EXGA 1UHPA 2Q6GA 3PMAB 1AVXA 2FOEA 1AVWA 5DP8A 3GS9A 4ABIA 1P01A 1AB9C 5JPMH 1B0FA 2ZFRH 3TPIZ 3M61U 3S0NA 1TBRH 3MU0A 1W9OA 2ZU5A 1HIAB 3BTWE 2SGPE 4ZUHA 1GMHG 1XUJA 4RSPA 5FPTA 4INKA 5E0HA 1ESAA 2VPHA 1OZIA 2XBVA 3NZIA 3O5NA 4A92A 2CSJA 4DIIH 4NA9H 5DN6D 3SUEA 1X5NA 1K28D 2XCFA 3HKIB 3RM2H 1HGTH 2QF0A 4UU5A 1BITA 2BD9A 1IQHA 1TIOA 1EATA 2E7KA 2WL7A 4WMDA 3ZZBA 4R2ZA 3M7QA 4Y11E 3E16B 5GNDA 3IITA 3DJAA 5FXLA 4O3UA 4KTSA 5C0UA 1GJBB 5GIBA 3GICB 1ZYOA 3TU7H 1P2OA 4DY7B 4Q7ZA 4D9QA 4O03A 2OP9A 1PQ7A 3SHAH 2Q1JA 3CS7A 2HNTC 3ZVFA 1F0RA 1GJ9B 1VAEA 1YPLH 3ZZ5A 1SQAA 1D4PB 3K82A 5CMXH 4Q2PA 3SZEA 4E7RG 3LONA 1O3KA 1D3TB 3MU8A 3NKKA 3NPSA 4AOQA 2ODYB 2V3MA 1GHAG 1I16A 1S81A 2UUYA 3SNBA 2WYGA 3K9XB 3CS0A 1Z87A 3D49H 3MYWA 1NRNH 5I46H 4A1VA 2PUQH 2XYAA 1LPKB 3ZVBA 3IWMA 5IK2D 1ETTH 1P04A 2JINA 2KX4A 1W10U 2ZHFH 3MNCA 3K6ZA 4WXIA 4B71A 1OBXA 1XUGA 3MH4A 2JETC 1W2KH 2FESH 1GVKB 2F4LA 1O2QA 1V2VT 1QB9A 1C2LA 4IN2A 2D90A 1KEFA 1J15A 3PM3A 1FQ3A 1P10A 1SGFA 1IQMA 1AD8H 1ARCA 1COWD 2PV9B 2KPLA 4XD7D 5EW2H 4ISIH 3TK5A 3RXUA 1UEWA 3DHKH 1SGYE 1A0LA 1AVGH 3E1XB 3HGNA 4ISNA 5F3XA 4UDWH 2AMQA 7GCHF 3PRBA 1VCPA 1C5ZB 1SC8U 4A1TA 5E6PB 1HAZB 1O31A 2FLBH 2GCTC 4FU9A 4YT7H 2VWRA 1NESE 2JOAA 2F9BH 4YM9A 4WMEA 1MTNB 4LOYH 2L97A 1GBJA 2C93B 5A2MH 3TH3H 3BTEE 1D3PB 4ZHMU 1TOCB 1VGCC 2R3UA 3NRLA 4Q6HA 2WPHS 7ESTE 2UZCA 1EP6A 3A8BA 4ZH8A 4CRBA 1ZTLA 4NSYA 5A8XA 1T8NA 2EEGA 1P8VC 3FVFB 2FI4E 4JZDH 3RMMH 3ZZ3A 2ZU3A 5ABWA 2M0UA 1NBMD 2C3SA 3PDZA 1BFEA 4AFQA 1O5EH 2ZF0H 2SFAA 1WI4A 1QRXA 5HFFA 1SBWA 2FOBA 1FPCH 3T25A 1CT0E 2RRMA 4WJG2 4UONA 2VVCA 3ODDA 4E7NA 2KAIA 3O46A 2RCZA 1S85A 3F2HA 1QGFA 4B2CA 2F91A 3L33A 4JL7A 1E37B 5IYTA 1EPTA 1CQQA 2LPRA 4DT4A 2KJPA 3TIUA 1EZXC 3ZZ8A 1C5OH 1WTGH 3SV8A 1L0ZA 1GBAA 1GL1A 1FPHH 3L4FD 5DP3A 1GBFA 1GVLA 4JOGA 1GQ5A 5GCHF 2QY0B 4BAMB 1BDAA 5C3NA 3Q3XA 4Q4LA 3STIA 1KXDA 5JDUB 1FC9A 1HPGA 3CBYA 3PROA 3KHFA 1H9IE 1XUIA 1TX7A 1VB7A 3ZZ6A 3S7KB 2DLUA 1BRAA 1Y3VA 4X8SH 3KZEA 2TIOA 5GWZA 2ULLA 2XWBI 1F5LA 1PYTD 1TNHA 2VH6A 2JREA 4FUJA 3A7VA 1EPTB 2BVSH 4HGCA 1LMWB 2ZECA 4OS7A 2QV1A 2LA8A 2FN5A 1GI9B 1HRTH 2J4IA 3SHCH 5DP4A 4ESTE 1GMCF 5HETA 4CR9A 1PPCE 2R0KA 3K2UA 2CSSA 5FCRA 4BTTB 3RU4E 1O32A 3UWIA 4A5TS 3AK5A 2HALA 4WYTA 2H3MA 3NUMA 2CXVA 1N1LA 1NROH 2KZ4A 2KJDA 1BRCE 4ISLA 1S0RA 4N6XA 1UMAH 2UWOA 4FUBA 4F4OC 5DP5A 1GG6C 1GI5A 1C9PA 1UK4A 2HGAA 2BB4A 3F9FA 1KY9A 5C1UA 3VB7A 2YMSB 2VGCB 4Y7BA 1TWXB 2QC2A 4XBCA 4FOUC 4JZFH 4M9FA 1UVTH 1WOFA 1J14A 3ATKA 1Q2WA 2IWOA 1CBWC 1YLCA 4R8TB 2EV8A 5L30H 2J5UA 2TGTA 1S6FA 3WKLA 5H3JA 1EQ9A 1V2RT 3SBKA 1AFQB 3DT0H 1V2JT 1QCPA 2WYJA 4JZ1A 4D8NA 4GLYA 3TVJB 1GGDB 3SV2H 2ZP0H 2ZQ1A 1QJ6B 3DUXH 3KN2A 4ABAA 1V3XA 3SQHE 2ASUB 2XW9A 1ZTKA 1NRQH 2FP7B 3A8CA 4AFUA 4O9VA 2PSYA 3PLPA 2LOBA 1G3DA 1QR3E 1GCDA 2AGGX 1V62A 2FLRH 5K7RA 1O35A 3LT3A 2F9VA 2WSSD 3P8GA 1ELTA 2CF9H 4H6SB 4CRGA 5FBEA 1O2SA 1W0JD 4JOHA 2ZQ2A 2FPZA 1RXPA 5HFBA 3AVZA 5HIYA 3T5FH 2Y5FA 4UU6A 4B76A 3SFJA 3DCLA 2M3MA 1L1GA 1MABB 1GBDA 1FMGA 1TX6A 2ZDLA 5FPYA 1LO6A 1V2TT 5EQQA 3LPRA 2D1JA 1NN6A 2WPKS 4CRAA 2PTCE 1BTXA 3MH7A 1WQVH 1MAXA 4SGAE 2BVXH 2VWOA 2B8OH 3GCHB 4B74A 1FI8A 2L6OA 4Y76A 2F3CE 3ZRTA 3MHWU 1GJ6A 1GHZA 4UD9H 2P95A 1UJVA 2OC7A 3E0PB 4YZUA 1GL0E 1HBTH 1NF3C 8ESTE 1QB1A 1DUAA 1BTWA 3SNAA 3ZIAD 1SMFE 2V3HH 1Z71A 1SGQE 2R4HA 1N6YA 2JKHA 1VCWA 1GI6A 2QN5T 1Y7NA 2BLWA 1QAVA 1BA8B 2BY8X 3O8BA 1HUTH 4U32A 4FGMA 1GMDF 1GCTC 1TPOA 3RXDA 1TNIA 3RXAA 3RXHA 1P05A 1WBGB 2MHOA 3K6YA 3SUFA 3QUMP 2HGTH 1C2MA 3TK9A 5A0AE 2P3WA 2GT8A 1AB9B 1LHEH 3QTVH 1UTJA 2GVFA 2XBYA 3JZ1B 1QNJA 2ZHEH 1O3LA 3M3VA 1QL8A 5EODA 2YT7A 1V2QT 1TRYA 3OEED 3BF6H 1DT2A 5G4BA 5EXLA 2P3UB 1DOJA 2BD7A 4OS1A 2JWEA 1FY5A 1L4DA 1QAVB 2Q6FA 1EUFA 2KAWA 2XWAA 3UB0A 1F5KU 1OYQA 1T8LA 3R68A 1D3QB 1HXEH 4JOEA 1LKAA 3RXCA 2R3YA 1GBEA 2H9EH 3ZZAA 4DVAU 1GHYH 3A8AA 1K1JA 1V6BA 1BJVA 3A7XA 1UM7A 1FY1A 1ORFA 1EB1H 3PMHB 4GAWA 1P12E 1INCA 4KGAA 1Q3XA 4GHTA 4XFQA 1YBWA 1ZGIA 1NO9H 3SNDA 3SGQE 3F2FA 2Q6DA 2XXLA 3PMBB 1UK2A 1O39A 4I8HA 3RMOH 4CHAC 1AKSA 2H2ZA 2H5DA 2ZFQH 2Y81A 1BE9A 1OWIA 3A7ZA 1Z8RA 2HOBA 4K1SA 1XZ9A 4Q80A 2GDEH 1KWAA 3QK1A 2VSVA 2J94A 5ESTE 1SQOA 1EP5A 1QJ7B 1NS3A 4AFSA 4U30A 1TYNA 1ANCA 2HVXA 2DAZA 5HXFA 2STAE 2EEIA 2KCYA 4YO9A 3SN8A 4K78A 2EDZA 2TGPZ 3B76A 5EPNA 1WXRA 1Z8IB 3U9AH 4I32A 3MQKC 4X6PA 2FOMB 3NCLA 3GY7A 1TBZH 3TJNA 3KNXA 5GPIB 4Z33A 4AB8A 2W3KA 1V1TA 2YOLA 2ZCHP 3UNQA 1G32B 2YT8A 3GSLA 1TAWA 4XE4A 3P8OA 3ODFA 1OPHB 2OQUA 2JETB 4BXWA 7GCHG 1N6FA 2PZDA 3A85A 2JIZD 1MBMA 2QA9E 4GVCA 1C1QA 2ANMH 1YPJH 1FAKH 1UF1A 1GDQA 4O06A 3OYPA 3E90B 4D7GA 5FPSA 4BAHB 3EE0B 1N7EA 1OOKB 4FUIA 1SKYE 2X7ZA 3MO6A 4I8LA 2AS9A 5L6NH 1AWHB 3BTTE 1LQEA 5C67A 1N6EA 3MMGA 2M2AA 3SOSA 3S9CA 1VJ6A 2ZGXH 2EJYA 4X1PU 5H4IB 2VVUA 1ZMJA 2GCTB 4SGBE 1O2NA 1DLKB 1SGCA 1SQTA 4E34A 3A7YA 3SU6A 1BTPA 1T32A 1TGSZ 1VGCB 1EAWA 3GCNA 1KMHB 4Q2KA 1CA0C 3FOAA 3BTME 4NMTA 3UWJH 1AE8H 2HWLB 3DIWA 3A7WA 3BG4C 2FTMA 1O5FH 2VIQA 4JZEH 1JIRA 4RI0A 1XXDA 4P02A 3VGCC 4P2AB 1RY4A 5JYIA 1ZJDA 1C5WB 2G2LA 3WY8A 2KCAA 1MMJN 4ZXYH 4XBBA 5FX5A 1DY9A 1N99A 1GJ7B 1C1TA 4MNVA 2H2CA 1WF8A 2GCHF 2VIOA 3BSQA 3DSPA 5GCHG 2XOKD 5E0GA 1C1OA 3DD2H 1UTMA 1WU1A 2BMGB 2JILA 4BOHA 4NMVA 2M0VA 2J98B 3A88A 2LNCA 4A1XA 3FANA 4JJ0A 2W4FA 4ZAEA 3F0OA 1JXPA 1Z6JH 1V2ST 2O8WA 1WF7A 3TSVA 1H8DH 1SR5C 3FO8D 3G01A 1UHBA 3LGWA 2K1QA 1O0DH 1LKBA 1HYLA 2WPMS 5CHAB 2V6NA 1CA8B 5EZ0A 2JDID 1FLEE 1KXBA 2GTBA 5DTHA 2NU2E 4U01A 5E8EH 1A2CH 5T6DA 1GMCG 2O8LA 2TGAA 3M5NA 3RC5A 4MPWA 2W7SA 2ALVA 4FUHA 5AF9H 2ZPMA 1GI7B 1ZHPA 2FXRA 3DJ3A 4CH2B 1EZUC 2A1DB 2NU4E 5EW1H 3TMHA 1W8BH 1SHYA 1SL3A 1DSTA 3LGYA 1L4ZA 3N7DA 1YC0A 4M7GA 2FOFA 2EHRA 2RDEA 1IQKA 4OGYA 1C1VH 4CRDA 2PW8H 4YTAA 1FC6A 1O2WA 5HM9A 1U38A 1HCGA 2BDAA 4JZIA 4GCHG 5DO4H 2Q9VA 2J95A 5SGAE 4AORA 1ZTJA 2WPLS 3PRDA 4O3TA 1HAIH 2PUXB 3RU4D 1CT4E 1YPHC 1QAUA 1Y8TA 4FU7A 1TQ0B 1KLTA 2A2QH 1MTUA 2PGBB 1QBVH 1AO5A 4QT8C 1BRUP 1LVMA 3RUOA 2ZDAH 1L6OA 4K8BA 5FB8C 1NFUA 1RTKA 1O2MA 2BQ7B 4K69A 1W3CA 1Q3OA 1WCZA 2ZDVH 1XXFA 4ZXXH 2OSGA 1ELCA 4NSVA 1U6QA 1UFXA 1LHCH 1O2YA 3PV4A 1XUHA 1Y59T 1IAUA 1G9IE 2BDBA 2ZIQH 1HJAB 1TP5A 1DICA 1GJCB 3WKMA 4KTUA 1O2TA 4Y0YE 3ZVCA 3L3TA 4JOFA 2FCFA 1AY6H 1TGNA 1ABJH 3ZYDA 2VH0A 2GMTC 1QIXB 3TNSA 3I78A 1UTQA 4NMPA 3P92A 1O3NA 2DM8A 4OS4A 4XDEA 3GYMA 4X8TH 5ETXA 3EGGC 3F3BA 1V6DA 1QHRB 3GCTF 1U3BA 5G1EA 2A4QA 4ZROA 4AG1A 3UNSA 2KM0A 3MWIU 5C0TA 3E17A 3ZZDA 1YGCH 4HI3A 2NWNA 2DJTA 3D23A 5HDYA 5C5OA 1MAYA 1J17T 1TGCA 5HEBA 3CBZA 3MNBA 1MQ6A 5A0CA 3MU4A 2ZCKP 2R0LA 5C1XA 2NU3E 1TPAE 3LNXA 2H2BA 1SGRE 1VJ9U 3SUGA 1C5UA 3OY5U 3FY5A 3AAVA 3BN9A 3FZZA 1FN8A 1MC7A 4JJ3A 2A7HA 3UQOA 1BOQA 3ZV8A 1SOTA 2OPGA 1FONA 2TGDA 2R2MB 1NC6A 2FX4A 4FETA 2M10A 4HOPA 3Q3KA 3S7HB 2F9OA 1GCTB 2Y5GA 3UREA 3UNRA 3D65E 2A7JA 4MTBA 2OUAA 1ZPZA 4ZCNA 1KXFA 1DWCH 2ZHQH 1O2KA 1XMNB 3HK3B 4K8YA 4CRFA 2GV7A 1HAGE 2Z94A 4NNLA 1O34A 1TRNA 4X6NA 4ZHLU 1TGTA 1C1NA 3K65B 2W6ID 1DM4B 1DS2E 1TPSA 2C4FH 2SGAA 4X2YA 3TGJE 4LZ4B 1K0HA 2ODQA 1HXFH 2QT5A 4ABEA 3P70B 1GJ4H 2VRFA 4AGKA 1W9QA 1YY3A 4HOPB 4KKDA 5DJ7A 2GZVA 4NFEA 3UR6A 2FI3E 4RT1A 2PKSB 1XUKA 4I8GA 5HMAA 2QF4A 4XOJA 1G37A 1GJ8B 4E05H 2XNIA 2C8YB 3GDVA 1C2FA 1NY22 2B7DH 2WPJS 1QFKH 4NZLA 2JH5D 2V0BA 3AAUA 1ELBA 3ENSB 4WH6A 3EQ0H 3VPKA 1Z1JA 5J4QA 5EG4A 1THPB 2VWLA 5FAHA 1WFVA 1SSXA 4FLNA 1V2UT 1S5SA 4DGJA 3E6PH 2ZGBH 1X9ZA 5HFCA 1YPMH 5L2ZH 2KFWA 3D62A 1EKBB 4HZHA 4ABGA 5TJXA 3EAJA 1UJDA 3RXSA 1ARBA 2A31A 3SNCA 1TE0A 1UEZA 1TP3A 1PYTC 2SGFE 3I29A 3RXFA 2GEFA 2Z9JA 4XHVA 5HFEA 1Z86A 4TY6A 4Q6SA 2OZFA 2J97A 4ZHAA 2PWXA 2W7UA 1H8IH 1WQSA 2ZU4A 1FC7A 2D92A 2VWNA 4A6LA 2AWUA 3KQ5A 2VNTA 3QJMA 5EXNA 3QDOA 3KDGA 1A46H 5E2PA 1A5HA 1MFLA 2GGVB 3W95A 3ZVEA 3F6UH 3SZNA 2EGOA 1LHGH 1SI5H 3KYGA 2ZTYA 1GI4A 2AWXA 1HAHH 4WYUA 3RLEA 1MU6B 1NTPA 2TRMA 4AG2A 4DT7B 2OC8A 1G9OA 4A7IB 2ILNA 1IU2A 3NFKA 3K1RA 5HJ1A 1IQFA 5EJ1A 4U2WA 1ZMNA 2ZCLP 2OK5A 3A87A 2HE4A 1MUEB 1DLEA 2YUBA 3FN8A 1A5GH 4PQWA 1M9UA 1ZSKA 3GOVB 4IC5A 2PDZA 4K72A 5GLJA 3GY3A 5FCKA 1E0FD 3M5MA 3HKJB 1AFEH 1QA7A 3GISB 3TITA 1DWBH 2SNVA 1A5IA 4B2BA 1QZ8A 1Q3PA 3UOUA 2VU8E 3SHUA 1O5CB 5CE1A 4MPVA 2R2WU 1DDJA 1UK3A 2WHXA 4X6MA 1P0SH 1DWEH 1HJ8A 2BDHA 2GCHG 3BTQE 1EAIA 2JJ2D 1YKTA 2KOJA 1CA0B 2XNDD 1EX3A 4B6EA 1LPZB 1ZJKA 1O30A 1O36A 3U8TH 1E34B 3BG4B 3CBXA 3VGCB 1VCQA 1BQYA 1C1UH 3ID1A 1AHTH 5AFYH 3TH4H 1IQJA 2EC9H 4RKOB 1CSOE 1P2KA 2KAIB 2P3TB 5C5NA 4DURA 3DJ1A 1O3BA 3KQCA 2G81E 4DJZB 2BHGA 2B5TB 1U37A 4LMMA 3SJIA 3ZYEA 3SI3H 1DFPA 1UTNA 2FM2A 1F0TA 4JK5A 1P3CA 2LC6A 4EDJA 3FP8E 3LJOA 1OXGA 2HE2A 2VBCA 1P3EA 5LPFA 4WVPE 3UIRA 3ATMA 2CN0H 1RGRA 2PP6A 3DSOA 3H09A 5FX6A 4ZKSU 4IMZA 3QX5H 1FY3A 4NFFA 6GCHG 2VWMA 2QF5A 5DPAA 4P00A 1C5TA 2KL1A 2G5MB 1O2OA 1YCPM 2A5AA 2J34A 2I04A 2K20A 2SNWA 3SQEE 3HPMA 5HEDA 2RG3A 1X45A 3CC0A 1V2WT 4UFFH 4X1NU 4JYTA 3S9BA 5T6FA 4MPXA 5AHGH 3LNYA 1GWAA 1ELDE 1SFIA 3QWCH 4NMQA 1GI0A 2PKAA 3SU1A 1O3DA 1AGJA 4BAOB 2M5TA 3URCA 1GHBF 3GJ9A 1SLVB 3VQGA 1F5RA 1PFXC 5GXPA 1SLUB 1TNKA 2F5YA 1FY4A 2BD2A 4ZKRU 3UOPA 1K1IA 2OC1A 4MPUA 3T62A 3Q3YA 5E11A 1GBTA 2H3LA 3GGEA 1B8QA 4E3BA 1F0SA 1EAUA 4ISOA 1K1NA 5I25A 2ZGHA 2AIQA 4X8VH 4BTUB 1YCPH 1YP9A 1IHSH 4I33A 4OM9A 1G3EA 4AYVB 4JOKA 1FJSA 2BY9X 2PKAB 2KQFA 1RJXB 1O3FA 4WY3A 2PKTA 1WJLA 1HDTH 2JXOA 1C5PA 3GDUA 1UITA 2PSXA 3F68H 5FHTA 4KP0A 2OXSA 5E1YA 2EI7A 1FNIA 2L74A 5LPRA 2LELA 3PLBA 3KF2A 4OGXA 3RXEA 1YPKH 3SV9A 3A8DA 1DE7H 2FS8A 5KECA 3V13A 1K1MA 1UTPA 3QO6A 1XKBC 3A82A 1V2OT 1Y3UA 2BTCE 3TK6A 2B9LA 1IQLA 1HAVA 1L1JA 2BM2A 1Z6EA 2G8TA 4KFWA 3GCTG 4OS6A 5DP7A 3SJKA 1RTLA 4OEOA 2UWPA 1P9SA 5C94A 1K1LA 5EIYA 2KG2A 3HATH 1N7FA 1VA8A 1A0HB 1UEQA 2HPQH 1JRTA 1YPGH 4Q2OA 2Y80A 5DP6A 1F0UA 2GMTB 2ANYA 3A89A 1GI1A 1LHFH 3R0HA 3O8DA 2KV8A 2KOMA 3U8OH 4KFVA 1TBQH 2HLCA 3B23B 3EDXB 3OFND 2DE9A 2D8WA 2IWQA 3WW7A 1MCVA 1TABE 1E35B 1P2IA 3OSYA 1S83A 4YOGA 3KIDU 5EJZA 3RXBA 4NXRA 1N6DA 2W7RA 1T2MA 3MU1A 1BMNH 2I6QA 2THFB 1GJDB 3EA9A 6ESTA 1O3OA 1X8SA 2PHBA 1AU8A 1H9HE 1CE5A 1FIZA 2EQNA 3ZVAA 1P06A 1ZRKA 4NA8A 5C17A 2M0ZA 3B8JA 4MLFB 5T3HA 1C5NH 2IPHA 2GD4B 1Y3WA 4NIYA 3N99A 3SI4H 2JH6D 1P11E 1SFQB 1ZPBA 3U8RH 4ABHA 2F9UA 2G55A 2YTWA 1H8ED 3PTBA 1UM1A 2KBSA 2BOKA 2BY7X 2BVRH 2KYLA 3Q00A 3QZQA 5T1VA 3VB6A 4ZKNU 1I92A 3TGIE 1T8OA 2P59A 1KXCA 1IHJA 1P03A 2H5CA 3RXKA 3LH1A 3I4WA 4AN7A 3F2GA 3MU5A 2EEJA 3RP2A 3VB3A 1JRSA 1TMBH 3SORA 2AMPA 1A3BH 3EGHC 1FXYA 1QL7A 1O3HA 4H42U 3F9GA 4JK6A 1KXEA 1KSNA 4NIVA 2Y5HA 3RXLA 1WUNH 1YCPK 3GY2A 4XBDA 3SU0A 1O5AB 1K32A 1ANDA 3I77A 1P02A 2ZDNA 2VIVA 3I18A 3ESTA 2QXJA 4Y8XA 1WI2A 2I1NA 4ZMAH 2FODA 1TNGA 4I7YH 4Y6DA 3M36A 4AB9A 2EDPA 2XC4A 4X6OA 1BHXB 5LPEA 8KME2 4ZKOU 2AGIX 4I8KA 1GHAF 2L4SA 2HVYB 8GCHF 1THSH 4NWLA 2RFKC 1AKSB 2DMZA 3QDZB 2EDVA 2ZTZA 2M0TA 2IN2A 1D9IA 3VXEH 3RXIA 4IS5A 2A0QB 4Y0ZE 4NZQA 4BAQB 2FYRA 2G51A 4BNRA 1YWUA 4YOJA 3ELAH 1T4UH 2BY5X 1H9LB 1ZOKA 1YLNA 2STBE 4MG3A 1LVOA 1V2LT 2QKUA 1Q31A 1MTSA 2VVVA 2C90B 1W7XH 4LK4A 2Y82A 4MDSA 4Y10E 1K21H 2G5NA 1TALA 4AX9H 1GBHA 4I8JA 1P2QA 1WG6A 2QYIA 2BDCA 2Z3EA 2ZGCA 4BAKB 1F2SE 2O8MA 3W94A 2LUIA 1SGNE 1FCFA 1MTNC 2W26A 2A5IA 2DLSA 1SGDE 2XBWA 3KZDA 1ID5H 3VG8A 1NM6A 1D5GA 2WV5A 1O3GA 2VSPA 1O2HA 1NBME 2A4GA 1IQGA 4OS2A 1C1RA 1C5SA 2IJD1 4HTCH 1OSSA 1P09A 3E91A 4IW4E 1TGBA 1BBRE 1OBYA 1K22H 1VZQH 1O2ZA 2OD3B 2HNTE 2AERH 3RC6A 1CHOF 1J8AA 1WTHD 3OAAD 1GI8B 5A8YA 2BLQA 2Z3CA 1TMTH 2D2DA 1A0JA 1NFYA 2K1ZA 1D6RA 3H7OA 2UUKB 4VGCC 4D76A 2EEHA 1VR1H 4NWKA 4NCYA 2VIPA 3RC4A 2YNAA 1PPEE 4H6TA 1ZGVA 2ZHDA 2AINA 2QAAA 1ANBA 1UO6A 2G00A 2OQ5A 4NGAH 1OP2A 1RGWA 2NU1E 3V0XA 2F9NA 1BMMH 2ANKH 4OAJA 3P8FA 1GI2A 5HFDA 1HAPH 5FL7D 2A7CA 3KQBA 2PA1A 1EJNA 2ZA5A 1CHGA 2PNTA 1BTHH 1GJ5H 2AIPA 2PFEA 2EGKA 2H9TH 3R69A 4THNH 3U1IB 1ELAA 2WZQA 3TJVA 2A32A 3E0NB 2R9PA 1L2EA 1A3EH 5F53A 3ATWA 2V1WA 5HYOA 1C5MD 4ISHH 1C4U2 1MU8B 1PPFE 2FDAA 4MNYA 1GBCA 4NIWA 2FS9A 5LGOA 5B42A 4AGJA 2O8UA 4IBLH 1HLTH 4MNXA 1WAYB 2GZ9A 1BJUA 2QXGA 4NMRA 1RZXA 1SGTA 1VITH 2VINA 1WH1A 2NU0E 1P9UA 3MH5A 5BPEA 3EA7A 1UW7A 1BMAA 1CGHA 2ZFPH 1TA6A 3BEFB 3KEEA 2ENOA 1X7AC 4KELA 1E1QD 4ASUD 4TWYA 1D6WA 1UHBB 3MI4A 2Z3DA 1O2UA 1NRRH 4TYDA 1TMUH 4NMSA 1LVBA 5F03A 1QY6A 1UVPA 1DXPA 1O37A 5DG6A 1UJUA 4CRCA 4IC6A 2C8WB 1WHDA 3KDKA 3U98H 1Y5UT 5J4SA 2KJKA 3RL7A 2VGCC 3R0FA 4F55A 3F9EA 1O2LA 3FP6E 2CMYA 1DXWA 2BD5A 3W1EA 3S69A 4AFZA 1ACBE 1XKAC 2Z17A 5F8ZA 3RDZA 2EGNA 1BMLA 1EJMA 1GHBG 1ZZZA 3NCVA 1GVZA 1GG6B 3K50A 1DANH 5T6GA 2VB0A 3SU3A 2XCNA 1AFQC 5JXBA 2WUBA 3PTNA 5CDFE 2SGEE 2WV9A 3VEQB 5JB9S 1LDTT 4Y71A 2CV3A 2KR7A 2PTNA 1GGDC 2DE8A 1OWKA 3T2NA 3M3SA 1LVYA 1RTFB 3ZVDA 1CBWB 7KMEH 1IOEA 5F8TA 1X5RA 1Y5AT 2IJOB 9ESTA 1O5BB 2BDGA 3O8RA 2PLXA 3RXRA 2ZWLH 4YLQH 5F6MA 4INLA 3GYLB 4YDPA 2BX4A 4L8NA 3AASA 3RXGA 1CVWH 2BYGA 3IG6B 3LOXA 2BOHB 4IGDA 4ABFA 3MO3A 5E0JA 3PYHA 3UY9A 3ZZ4A 3SU2A 4GHNA 6CHAC 2XC0A 3FP7E 2GX4A 3SV6A 3SW2B 1YF4A 1B0EA 9LPRA 2GDDA 1DITH 1MBQA 2I6SA 5EYZA 2RA3A 1K1OA 1D3DB 4GUXA 4Y8ZA 1LTOA 2UUJB 2QXIA 2WV4A 2IWPA 2J2UA 1UCYE 2ZTXA 3AW0A 3TGKE 4B2AA 1QBOA 1QA0A 1MD8A 2D8IA 1T31A 2BZ6H 4Y79A 2GKVE 4AMHA 4NXPA 2FX6A 2O8TA 3AXAA 2ZO3H 4GVUA 2F9PA 4K75A 2DUCA 1ZHMA 1KYNA 3QGLA 1MQ5A 5DK1A 4FUDA 3RU4T 1GMDG 1MD7A 2Z7FE 1EASA 3LGTA 3BTFE 4B75A 3Q76A 3T26A 1RFNA 3WWBA 4ABDA 5KGOA 1NFWA 2AWWA 1OBZA 3ID4A 5ESBA 4D7FA 1CGIE 4HG6A 2YMSD 1MH0A 1W7GH 3TNTA 1OWDA 1VKYA 1WYKA 2ZG0H 1X6DA 1O2VA 2W3IA 1XVOA 1KXAA 5TCAA 4GSOA 4CBOA 1IQNA 1AE5A 3RXTA 4JOJA 1QQUA 2CHAC 3TLOA 3U28C 1RS0A 1SGIB 1SQRA 1PPGE 3QZRA 2QBWA 1C2KA 1SG8B 1Z7KA 5HM2A 2I0IA 5AFZH 3WWFA 1NRPH 2IPQX 5F67A 3SUDA 1CO7E 3SUZA 1GBIA 3GY6A 5EPYA 2C8ZB 3JZ2B 1EOLA 1C2IA 3PO1C 1J9CH 1LQDB 2ZC9H 1W11U 4GHQA 1NRSH 1QURH 3F1SB 3SJ8A 1JWTA 3Q77A 5IDKA 1P1DA 3OY6U 1UTOA 2FIRH 1QB6A 1OKXA 1C2JA 2ZI2H 1N8OC 1A61H 2K0QA 1MCTA 3LH3A 1G2MA 1BB0B 3A84A 2EEKA 3UTUH 3ZV9A 4P0CA 1QJ1B 3C1KA 1X5QA 1OWJA 3BV9B 3RXVA 5HF1A 4UE7H 1TQ3A 1XM1A 1ZPCA 3CP7A 4WF8A 2F83A 4I31A 4CHAB 2C8XB 1B7XB 1TX8A 1MZAA 1GBBA 2P3FH 4WMFA 2G4UA 1SVPA 5EQSA 2GT7A 2RDLA 6LPRA 1WHAA 3DSGA 3BTGE 8GCHG 1GHWH 3OU0A 1C1SA 1JIMA 1WDIA 4TY7A 4JCNA 2PKUA 3CH8A 1OP0A 1QRZA 3GY5A 5EGMA 3A86A 4CR5A 2Z9IA 2V3OH 4JMYA 2A2XH 2W6JD 2AMDA 1W0KD 1F92A 1HAYB 3SGAE 3I1EA 2HRVA 1T8MA 1BTZA 3EYDA 1UVSH 4X8UH 3NGHA 1C1PA 4F49A 4KTCA 3U69H 3LJJA 3SNEA 1AZZA 5EU8A 2DB5A 1TA2A 1UJ1A 4JOPA 2QCYA 1ZR0A 2G5VA 4Q2NA 1QTFA 2FOGA 3GCOA 1IU0A 4YYXA 1W0YH 3MNXA 4UFGH 4YT6H 3QLPH 2ZNKH 2HLDD 1Q7XA 3ATIA 3ID2A 3TSZA 3QIKA 1H4WA 4UFDH 4NXQA 2J38A 3DORA 4REYA 1BBRH 1C5VA 1VJAU 1W12U 4Q3HA 1FY8E 3ITIA 3LU9B 3T29A 1SOZA 3RLYH 3C27B 3TSWA 1G30B 1KDQA 1EZQA 2V7QD 3A81A 2ZGJA 3LDXH 4TT3D 1MTVA 1UTLM 4K2YA 2FTLE 4I86A 3JXTA 1CHOG 1T7CA 1H1BA 2DKRA 5E21A 1NZQH 1C2EA 1EXFA 3BEIB 3VQFA 1V2MT 1BTYA 2PR3A 1P2MA 1S0QA 1ESTA 3RXQA 5IL9A 1C5YB 2XC5A 2ZU2A 3KYFA 3M7UA 2OLGA 1RIWC 3VB4A 4ABBA 2OC0A 2OS6A 2REYA 3MO9A 2OCSA 1IHTH 4E06H 2ODPA 3NK8A 5EJLA 4Z1MD 4Q2QA 3P6ZB 5JB8S 3RXPA 2BD8A 1KDQB 2OQSA 1AN1E 3BPUA 1U39A 4AZ2B 2AH4X 4FVBA 2Y6TA 5CHBA 1MTWA 7LPRA 4VGCB 3PB1E 2QG1A 1GDNA 3UQVA 4DCDA 2P8OC 4Q63A 2V35A 3SGBE 1OWHA 4BTIB 3HK6B 2CGAA 2CJIA 1DVAH 1LPGB 1C2HA 1TNLA 2ANWA 1M5ZA 1TB6H 4INHA 4H4FA 1SPJA 2FWWA 5CHAC 2UUFB 1OYTH 1O3JA 1OWEA 5A2PA 2TBSA 2AYWA 5GDSH 1ZSLA 1XUFA 1ZSJA 2LP6A 3OX7U 3EA8A 1O2GH 3SOEA 4WXVA 3A7TA 2Z9KA 1O38A 1QQ4A 2BYAX 4NA7A 2BY6X 2CS5A 2XTTB 1KIGH 3LGUA 4TWWA 2Z6BD 4NG9H 3F0PA 1ETRH 3HPKA 1BZXE 1TONA 1ZUBA 2OBQA 2OGPA 3L6PA 1O3IA 1BMFD 5AVDA 2Q3GA 3BIUH 1FN6A 2QXHA 4JYUH 5HF4A 3CNRA 2F43B 3STJA 1NU9A 4Y8YA 1GBKA 1P2NA 1N6XA 1VITF 1O3CA 2Y7XA 4GVDA 3VB5A 1EOJA 2FOAA 3CENA 1Y5BT 5I7ZA 1SGPE 1V2KT 1BBRK 2OBOA 1TPPA 2RA0A 5D13A 2QKTA 4OEPA 2QE7D 3V3MA 1PQ8A 4K1EA 4IMQA 4ASHA 1SB1H 1PPBH 3M5LA 1K1PA 1TQ7B 4GCHF 1GBMA 3T28A 1O5GH 4NMOA 1P57B 3MH6A 2BD3A 4Y7AA 3BG8A 1Y3XA 2ZFFH 4K5ZA 5HEYA 5EOKA 4UFEH 3RMLH 3UAIC 1XX9A 1J16A 2ZPSA 3GDSA 1W9EA 3OEHD 4MPAA 1PPZA 1C5XB 1HJAC 1S84A 4OS5A 4B6FA 5C2ZA 2H6MA 3ZZ9A 2QF3A 2DC2A 2IOTA 1UCYH 1E1RD 1G36A 4ACBA 2FEQH 1PQ5A 1QRWA 2QIQA 3KGPA 1BRBE 1V5QA 2FYQA 4K1TA 3UFAA 2A4RA 4XRNA 3HPTB 3P95A 2BLVA 2AEIH 3BTDE 3SV7A 3N7OA 6CHAB 1K2I1 1H8HD 3LGIA 2BDYA 3QGNB 4FUGA 4B1TA 2FZZA 5JBTA 1AUJA 4RN6A 4TPYA 2CF8H 1SLXB 2GP9B 3SJOA 4H11A 1ELVA 2WINI 1EFRD 4G69A 2KCPA 2VZ5A 2JJ1D 1S82A 1KTTB 3ZVGA 4ABJA 3PWCA 2AFQB 1YM0A 5TCCA 2LC7A 1E38B 3OTJE 1GDUA 1HJ9A 1SLWB 1GHVH 1WSSH 3RLWH 3QGJA 2KOHA 2Y7ZA 3UPEA 3LIWA 2ZPLA 1O5DH 3MTYA 4UEHH 1HAVB 4F8KA 2P16A 2QGRA 1TNJA 1YPHE 4K60A 5GJ4B 1UVOA 1ELEE 3PMJA 4PROA 1P1EA 1OX1A 1FDPA 3LGVA 3HGPA 4WWYA 5C20A 3ZZCA 2EY4C 1FZZA 1NPMA 1OP8A 1ZOMA 2KCOA 2Z9GA 3KQDA 1GMHF 2ZHWH 3QN7A 2I4SA 2TPIZ 1NFXA 1YYY1 3VFEA 1C5LH 1K9OE 4DOQA 1B5GH 5DGJA 5A09A 5BRRE 3ID3A 1C1MA 3URDA 2WUCA 3ZZ7A 1AIXH 3M37A 1FUJA 1WFGA 1EB2A 1Z8JB 3BTHE 3ATLA 2L4TA 5F8XA 4X0WU 3TH2H 1UVUH 3QJNA 1BTUA 2D26C 1BCUH 5K0HA 1ESBA 2CHAB 3LC5A 1FAXA 1TLDA 1Z1IA 2PKSC 5DKMA 4Z8JA 1ANEA 2A4OA 2ZFTA 2ZKSA 2V90A 2B0FA 1G3CA 2W5EA 3GABA 3V7TA 1E36B 1G2LA 3TJOA 2VIDA 3UUZA 1S6LA 1GHXH 1W14U 4R0IA 2GJGA 1Y3YA 3RMNH 2MX6A 1RD3B 5B6OA 3PO1B 2UWLA 1ZMLA 1ELGA 1OHHD 4X2WA 2OINA 4O97A 1PJPA 5DSFA 3PV2A 2O2TA 2J9NA 3E3TA 4FXGH 4JYVH 4DG4A 5JBCS 4BANB 1UCYK 1HAXB 3A80A 3FAOA 5JBAS 4K3JA 5E2OA 1N8OB 3RXJA 2YUYA 2WPDD 4X2VA 1BIOA 5HGGA 1R6JA 2AHME 2ESTE 2BD4A 1ELFA 3O8CA 4WH8A 2EI6A 4X1QU 1GQ4A 1S6HA 1AI8H 3EE7A 1QL9A 5HKKD 5DP9A 2H9HA 5FBIA 1THRH 2JSNA 3H7TA 5EXMA 2H1UA 1C5RA 1PPHE 2KRGA 3KCGH 4X1RU 4Q7YA 1W13U 2EA3A 1O2PA 1MZDA 2Z9LA 4K6YA 2I0LA 1EAXA 2KPKA 1JMOH 1O3AA 1DY8A 3SU5A 4NNMA 2GZ8A 3FFGA 3CYYA 3MFJA 5KEDA 1EJAA 3MOCA 1E79D 2BLOA 1KLIH 4X2XA 2G4TA 1BUIA 2ZFSA 3P17H 1ABIH 2BXTH 2O9QA 1JOUB 4AC9A 2JH0D 3RXOA 3PLKA 3EGKH 2I6VA 1DSUA 2BXUH 3OE7D 2IWNA 3NFLA 4MVNA 3M5OA 1AUTC 4XSKU 1V2PT 1DX5M 2YNBA 4JORA 1GBLA 2SGDE 3LKWA 1NTEA 5HIZA 1AMHA 4CBNA 2EAQA 2BX3A 2ZDKA 3UR9A 4FUCA 3R3GB 1EZSC 3T27A 1C4V2 1RRKA 3AW1A 5E22A 1NU7B 1FIWA 2ZEBA 2J92A 2HNTF 8LPRA 1ZRBA 1C2GA 1FV9A 3N7EA 2FMJA 2GV6A 1GPZA 5JBBS 2CK3D 2FO9A 2J98A 4X1SU 2PGQB 4RKJB 3RXMA 5LH8A 1TFXA 5ILBA 1C4Y2 3LC3A 5PTPA 1BHXF 4FUEA 1CGJE 2ZU1A 2ZZUH 1MKXH 4J2YB 4ACAA 1RIWB 2VIWA 3VXFH 2K8IA 1ZLRA 1XVMA 5B6LA 3DFJA 3SO3A 1FX0B 2ZPRA 1CU1A 3PWBA 3KQEA 3OTPA 1ETSH 3KHVA 1Z8GA 1GJAB 1YPEH 1MKWH 3QTOH 4J1YA 4B73A 1CT2E 1O3EA 4GPGA 1C5QA 2OMJA 4LXBH 1O2JA 1EPTC 1JBUH 1BT7A 2P8OB 1HB0B 5C1YA 2KA9A 1L1NA 2FOCA 4TSFD 4AYYB 3GY8A 2EI8A 4CH8B 1N7TA 3H5CB 3SHWA 3RM0H 3E8LA 1V5LA 1SGFG 2WPIS 2FI5E 2P94A 3NWUA 1A4WH 1O2IA 4F48B 1TOMH 3M3TA 3A83A 1LCYA 1UEPA 2BQWB 3FZDA 3NXPA 2YMSC 1YLDA 2FNEA 1VITG 4CREA 3MNSA 4FVDA 1W0ZU 1TRMA 3DA9B 3FKSD 1C1WH 5L2YH 6GCHF 2ALPA 4HFPB 1KLJH 1KTSB 1O3MA 4BXSA 1PDRA 3BTKE 4DIHH 2OTVA 5A8ZA 1HV7A 1HFDA 1LHDH 3SJ9A 5A0BA 3SU4A 3QE1A 1DUEA 1QBNA 1T4VH 1C2DA 1SGEE 1HNEE 3KL6A 1WV7H 1HAOH 3RL8A 4E35A 1O3PB 4K76A 2FE5A 1A1RA 1DPOA 3P8NA 2FOHA 1P2JA 2AGEX
chains in the Genus database with same CATH topology
5G1DA 3DFLA 3HVQC 3F9HA 1G3BA 4TPIZ 4Z0KA 1F7ZA 2BZAA 4FU8A 3V12A 4Q7XA 1AZ8A 1ZHRA 1MFGA 2GZ7A 3S9AA 4NIXA 1PQAA 1C9TA 1GM1A 2G52A 3BIVH 2OCVB 1V2NT 1RGQA 2F0AA 1O2XA 1O33A 1WIFA 2BQ6B 2VJ1A 2ZPQA 1NT1A 2SGQE 1AQ7A 1IQIA 3PDVA 1UTKA 1DWDH 1MKXK 2A5KA 3GCHC 4D9RA 4DW2U 2XBXA 4FUFA 2BDIA 2JIKA 4YLUA 2P93A 2QKVA 1OS8A 1AWFH 1O2RA 3GY4A 5EQRA 3M7TA 4Z6AH 2ZDMA 1HIAA 2HPPH 4YOIA 3PS4A 1MKWK 1IQEA 3U1JB 1QLCA 2XRCA 1GI3A 1SHHB 4LZ1H 3M35A 1A7SA 1YBOA 3PV5A 4YESB 2RCEA 4MQAA 2A45B 3BEUA 3B9FH 4IN1A 4MNWA 3TJUA 2EXGA 1UHPA 2Q6GA 3PMAB 1AVXA 2FOEA 1AVWA 5DP8A 4ABIA 1P01A 1AB9C 5JPMH 1B0FA 2ZFRH 3TPIZ 3M61U 3S0NA 1TBRH 3MU0A 1W9OA 2ZU5A 1HIAB 3BTWE 2SGPE 4ZUHA 1GMHG 1XUJA 4RSPA 5FPTA 4INKA 5E0HA 1ESAA 2VPHA 1OZIA 2XBVA 3NZIA 3O5NA 4A92A 2CSJA 4DIIH 4NA9H 3SUEA 1X5NA 1K28D 2XCFA 3HKIB 3RM2H 1HGTH 2QF0A 4UU5A 1BITA 2BD9A 1IQHA 1TIOA 1EATA 2E7KA 2WL7A 4WMDA 3ZZBA 4R2ZA 3M7QA 4Y11E 3E16B 5GNDA 3IITA 3DJAA 5FXLA 4O3UA 4KTSA 1GJBB 5GIBA 3GICB 1ZYOA 3TU7H 1P2OA 4DY7B 4Q7ZA 4D9QA 4O03A 2OP9A 1PQ7A 3SHAH 2Q1JA 3CS7A 2HNTC 3ZVFA 1F0RA 1GJ9B 1VAEA 1YPLH 3ZZ5A 1SQAA 1D4PB 3K82A 5CMXH 4Q2PA 4E7RG 3LONA 1O3KA 1D3TB 3MU8A 3NKKA 3NPSA 4AOQA 2ODYB 1GHAG 1I16A 1S81A 2UUYA 3SNBA 2WYGA 3K9XB 3CS0A 1Z87A 3D49H 3MYWA 1NRNH 5I46H 4A1VA 2PUQH 2XYAA 1LPKB 3ZVBA 3IWMA 1ETTH 1P04A 2JINA 1W10U 2ZHFH 3MNCA 3K6ZA 4WXIA 4B71A 1OBXA 1XUGA 3MH4A 2JETC 1W2KH 2FESH 1GVKB 1O2QA 1V2VT 1QB9A 1C2LA 4IN2A 2D90A 1KEFA 1J15A 3PM3A 1FQ3A 1P10A 1SGFA 1IQMA 1AD8H 1ARCA 2PV9B 5EW2H 2KPLA 4ISIH 3TK5A 3RXUA 1UEWA 3DHKH 1SGYE 1A0LA 1AVGH 3E1XB 3HGNA 4ISNA 5F3XA 4UDWH 2AMQA 7GCHF 1VCPA 1C5ZB 1SC8U 4A1TA 5E6PB 1HAZB 1O31A 2FLBH 2GCTC 4FU9A 4YT7H 2VWRA 1NESE 2JOAA 2F9BH 4YM9A 4WMEA 1MTNB 4LOYH 2L97A 1GBJA 2C93B 5A2MH 3TH3H 3BTEE 1D3PB 4ZHMU 1TOCB 1VGCC 2R3UA 4Q6HA 2WPHS 7ESTE 2UZCA 1EP6A 3A8BA 4ZH8A 5A8XA 1ZTLA 4NSYA 1T8NA 2EEGA 1P8VC 3FVFB 2FI4E 4JZDH 3RMMH 3ZZ3A 2ZU3A 5ABWA 2M0UA 2C3SA 3PDZA 1BFEA 4AFQA 1O5EH 2ZF0H 2SFAA 1WI4A 1QRXA 5HFFA 1SBWA 2FOBA 1FPCH 3T25A 1CT0E 2RRMA 4WJG2 4UONA 2VVCA 3ODDA 4E7NA 2KAIA 3O46A 2RCZA 1S85A 1QG