3MH4A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
343
structure length
301
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease do
total genus 57
structure length 301
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A01
1B8QA 1DX5M 1SGRE 1GGDB 3D62A 2UUKB 2SGDE 2ODPA 2Y5HA 3F68H 3LOXA 4KTCA 5G4BA 1K28D 3M5MA 4X8VH 2BQWB 2EDZA 1MTWA 3PV4A 1P1DA 5HFFA 2EXGA 1NS3A 3KQDA 1UJVA 1HRTH 1O3PB 4PROA 2HPPH 2NWNA 5EW2H 2BYAX 1BDAA 2J38A 3ID3A 4GHTA 2BY5X 2HWLB 3KIDU 3Q3KA 2ZNKH 3F6UH 1QB6A 1YBWA 4XE4A 1SFIA 1TNKA 2RCZA 1SGFA 1HPGA 1TPSA 2FODA 4F49A 1PPZA 4BAKB 2C8WB 5F8TA 1QJ6B 3E0NB 1QRWA 3T29A 1WI4A 3E17A 1UTQA 1NFXA 1ZSKA 3SW2B 1TA2A 2OBOA 4U32A 2PKUA 1SGYE 4NWLA 1O2WA 2K20A 3ZVCA 1MKWK 3SNEA 2KOJA 4WYTA 2ANWA 1TLDA 4CBOA 1NFUA 1EAWA 5EW1H 1C5YB 1C5WB 3U9AH 1C1VH 4GCHF 4UE7H 2ZCLP 1QA0A 3RXGA 5C67A 2G5NA 2OQSA 1C2JA 4WF8A 1UF1A 1FAXA 1MKWH 2EJYA 3A7VA 2FXRA 1GDNA 3AAVA 4JZDH 2OXSA 3AW0A 2STAE 3PMBB 5AFZH 2G81E 1GI4A 1O2JA 2C8ZB 1UJ1A 1FQ3A 2E7KA 4ISLA 3A8DA 5FCKA 2BY6X 1ZYOA 4Q7YA 1Z8RA 3P8NA 3RUOA 1P01A 1XKAC 2TPIZ 2LOBA 1ELBA 2D8WA 1QIXB 3BTFE 4Z0KA 2BTCE 3MNBA 2BDHA 4K72A 2GDEH 4LOYH 3BTEE 3GICB 5FPYA 4B75A 1O3LA 5C3NA 4X8TH 4XDEA 7GCHF 1FV9A 1AKSA 2NU4E 1SFQB 2GV6A 2FNEA 1LKBA 2H2CA 4XBCA 1FY5A 1B0EA 3U1IB 2J2UA 5DP8A 1IU2A 3BSQA 2FE5A 1BRUP 2WPKS 1HJAB 4ABDA 1AMHA 1ELGA 3BTQE 3RXMA 1AWFH 2OC8A 1VCPA 5LGOA 4A6LA 1QB9A 1TNJA 1NO9H 3SQHE 1BT7A 2RA3A 2O8LA 1WIFA 1MCTA 2V0BA 5DPAA 4R2ZA 1TFXA 4Y79A 2SNWA 1N6EA 1VCWA 2ESTE 3SUEA 2WL7A 1GBKA 1XVMA 1O3MA 2M10A 3KQBA 1TALA 2YNBA 4NGAH 2HE2A 4B76A 3MWIU 1N8OB 1XUHA 2ODQA 4A1XA 3P8OA 1YCPK 2ZU4A 3VB4A 1Y59T 3GY2A 4ZUHA 3A8AA 2FYQA 3K6ZA 2AMPA 4A5TS 4FU7A 1CHOG 2FI4E 3V12A 4NMQA 1EAIA 2M0ZA 3HK3B 1EP6A 1BUIA 1HAVA 3HPMA 4WH6A 4NSYA 1Z8IB 4Y8XA 1OXGA 1LQEA 3DD2H 2PTNA 1OP8A 4JORA 2A2QH 2G8TA 1K1MA 1YCPH 1TGSZ 4D9RA 4NMPA 1WF7A 1WV7H 3ATMA 1TPAE 3QLPH 2UZCA 1L1NA 2KRGA 1JMOH 5HYOA 1O3OA 2C3SA 2CJIA 1ELVA 4JYVH 1T8OA 4AGKA 1P3CA 1ELCA 1QA7A 5EYZA 3UWIA 5FB8C 4NMRA 1O2UA 4FUJA 1XUGA 4IS5A 1HAOH 2ZFSA 2CV3A 2G00A 1K1LA 1ZGVA 1TAWA 5F03A 2AWXA 2LA8A 3E3TA 1ZRKA 4NNLA 1YKTA 1A2CH 3MTYA 4B2BA 1CGIE 1WTGH 4DIHH 2ZC9H 4E7NA 2KL1A 1Q31A 1ZPCA 3QIKA 4ABGA 2A7CA 3LH3A 5ETXA 5A09A 2EEKA 2L4TA 1WHDA 1YBOA 3V3MA 3ZV8A 1UTMA 1TE0A 2HGTH 2FM2A 1U39A 2XBXA 2CSSA 3SV7A 2ZO3H 3MYWA 3EGKH 4MNVA 4OEOA 2VWNA 1FIZA 2BMGB 2R0KA 1GI5A 1OBZA 2BDAA 3L6PA 1HB0B 1KTTB 4ZAEA 4XSKU 1O3BA 3PM3A 2PR3A 1JIRA 1OOKB 3QJNA 2Z3CA 4DCDA 1AKSB 1TGCA 1C5MD 2B0FA 4AN7A 3LU9B 1V2PT 2C90B 2ZCHP 3G01A 2R2WU 4ABJA 1M9UA 3U98H 3BTME 1BMNH 3A87A 4K6YA 2GV7A 4AX9H 3LJJA 1SQOA 4AG1A 5EQSA 3HPTB 4WMDA 1T8LA 3TSZA 1MZAA 1NN6A 3TNSA 3MH7A 1HFDA 1KIGH 3UOPA 3BG4B 2OC7A 2VH0A 2CGAA 2WPMS 2PDZA 4OS7A 2A4QA 3LGYA 4IMZA 2VGCB 1UHBA 3ZYEA 2GCHG 2OC1A 3QDZB 2Q6FA 4I31A 5HJ1A 3RDZA 1DWBH 4K1SA 2PGQB 1BTUA 3PV2A 1HAPH 2A7HA 1U3BA 2P59A 3MO3A 6LPRA 1AY6H 1HAYB 2ZG0H 1UTPA 1MTNB 3GISB 3NWUA 2ZDAH 1AVXA 1K1PA 1HAVB 1GI6A 2FP7B 4O03A 3O46A 1ZJDA 2PKAB 2XC5A 1O2HA 1WQSA 3EA8A 1A5IA 1C1NA 1EZSC 2W7SA 4RKJB 1THPB 2H2ZA 2BD9A 2ZDMA 3ID2A 5ESBA 4X2VA 2BD7A 1V2UT 1JWTA 1OPHB 3SHUA 3MO6A 2I0IA 1O0DH 2WV4A 4VGCB 1QR3E 3TH3H 1EAUA 3V7TA 3EDXB 1OYQA 1UTJA 4I8LA 1UFXA 1H9IE 1ZZZA 3A7XA 1ZOMA 2P16A 4Q2OA 4X2XA 1GVZA 4BAMB 1JIMA 2JKHA 1S83A 1LVBA 2DM8A 4JOPA 9LPRA 3GGEA 1O31A 1XUIA 4KKDA 3UIRA 3UQOA 1GBLA 2EI7A 1F92A 1ZPZA 2ZEBA 1B7XB 2GTBA 1D4PB 1VGCC 4FUGA 5FXLA 3PMJA 2OQ5A 1ID5H 1CSOE 3BTKE 1YPHC 1Q3PA 1C1OA 1EJMA 1S81A 1W7GH 4ZHAA 1ZSLA 1HUTH 5LPFA 2ZFRH 4TPIZ 3P8GA 3S69A 1QAVB 3GY6A 1GHWH 4X1QU 1ZPBA 3UY9A 3SI4H 5LH8A 2EEIA 1NTEA 1SMFE 2OP9A 3M7QA 3SNAA 1OKXA 3P92A 3S7HB 3MU4A 3UNRA 1SGFG 3E16B 1WYKA 3VPKA 1O5AB 2F9VA 2JWEA 4UFDH 2FO9A 2DKRA 1SC8U 2JH0D 3FP8E 5F8XA 3EGGC 4YT7H 3ZVAA 3OYPA 2VIQA 2QN5T 3RC6A 1FDPA 4BTIB 2Z3DA 1C1SA 1HJ9A 2ZFQH 4WY3A 2GT7A 2PLXA 5IDKA 3PO1C 1QJ7B 2GZVA 2ZU2A 4GVDA 3EYDA 3QWCH 1CA8B 3NXPA 1SLWB 3KZEA 4X8SH 3JZ2B 1N99A 2DUCA 2EEGA 1QAVA 1X5RA 3MU1A 1VITH 2GMTC 3TNTA 3D49H 1MH0A 1LHDH 3IITA 2ZCKP 4NA7A 2EGKA 2AIQA 1QGFA 4NA9H 3BV9B 1DXWA 2Y5FA 5ABWA 1DLEA 3SN8A 5K0HA 4ZKSU 1G37A 1Y5BT 1DXPA 4IMQA 1JBUH 3NPSA 1WTHD 1UK4A 3NCLA 3PMHB 1K1IA 2CS5A 2G52A 1S82A 9ESTA 3SJ9A 3RLEA 1THSH 4K75A 1W7XH 2AGEX 2PKAA 3UWJH 1F0TA 1OSSA 1V5QA 1BOQA 1CE5A 5A8XA 1GI8B 2QY0B 1T32A 2V1WA 3K65B 3WY8A 1VA8A 1P0SH 1BBRK 1YLDA 2FOFA 2QG1A 3QZRA 3I1EA 3BIVH 4AGJA 3PLKA 1WAYB 4YLQH 7GCHG 1HDTH 3SV2H 1V5LA 3GCHC 5H3JA 1TOCB 1Y5UT 3PLBA 3F9EA 4MTBA 1KLTA 4Q6SA 1PQAA 2RDLA 1C2HA 5EQRA 2FOCA 3E90B 2AERH 1YPLH 3B23B 3N7OA 1HXEH 1P2NA 1Y3XA 5EZ0A 4WJG2 2OQUA 2WPLS 5FBEA 3C1KA 1PQ7A 1BMMH 2CXVA 2FIRH 3BTTE 1SLVB 5A0BA 1A3BH 1GBHA 3DJAA 1P2JA 1SGCA 3RXSA 1KSNA 4MPWA 2XNIA 4JZ1A 3ATLA 3A7YA 4NIWA 2ZI2H 3F9GA 5CHAB 3GDVA 1JXPA 3GDUA 1S6FA 1T4UH 6CHAC 3SJIA 1MAYA 1G3DA 2WUCA 2ALPA 3HKIB 3RM2H 3ELAH 4I8GA 1IQHA 3ODFA 1Y3VA 2W7UA 1MTUA 4X1RU 2H9TH 1SGEE 4MNWA 1DY8A 4TWWA 3SOSA 4Y8YA 3UPEA 4ZXYH 1O2SA 4YTAA 3TJVA 3ID1A 3GCHB 5AHGH 1EQ9A 1BTPA 1QQUA 3S9AA 3F1SB 3M3VA 1KXEA 2VWLA 2DLUA 1GCDA 4TYDA 1UVTH 5F6MA 1YP9A 5ESTE 1PPFE 4NNMA 3KF2A 4BTTB 1G3BA 2W3KA 3QO6A 5FBIA 3KEEA 4JOKA 1AN1E 1O2OA 1IQIA 3OX7U 1FCFA 2AWUA 1O30A 2KPKA 4Q2QA 1QY6A 1O2NA 3QK1A 4K1EA 1KXDA 2LPRA 4FXGH 3TK6A 2A45B 3ZZ3A 4X2WA 5HF1A 4MVNA 2P3TB 1HAXB 2Y7ZA 3CS0A 4GHNA 1FC6A 4INHA 2VH6A 2B8OH 2IJOB 4Q2KA 1EJNA 1O2KA 1AUTC 1OS8A 1GBMA 1KWAA 5E21A 1INCA 1MBQA 1C5LH 1V6DA 1B5GH 3ZVGA 3A84A 4B1TA 5HEYA 4Y6DA 2B7DH 2WYJA 1HNEE 1LDTT 1Y7NA 2A4OA 1ZTKA 1MC7A 2HRVA 2BM2A 1SGTA 2VJ1A 3ID4A 5A0AE 3H7OA 3TSWA 1UVSH 3TIUA 4Y71A 2WYGA 3QTOH 1ETTH 1NM6A 4XBBA 1YPEH 1KLJH 3A7ZA 4HZHA 2HOBA 1O2QA 4ZROA 2AWWA 1Z8GA 2VPHA 3PLPA 4CR9A 1FNIA 1HXFH 3I78A 3ZV9A 5CMXH 2H3LA 3GCNA 1UITA 2Z9KA 4MPAA 8KME2 2Y81A 2QF0A 1C1TA 5EOKA 4AG2A 3ZVEA 2KQFA 1P05A 1C1QA 3KQCA 5EGMA 4REYA 1C5TA 1GBIA 1NRSH 3KZDA 1B0FA 1X5NA 1GMCF 1CGHA 1J17T 1FI8A 5L6NH 2ZPQA 3TK9A 4BNRA 1C4U2 3PWCA 5B6OA 4KTSA 2O8WA 2IOTA 3ESTA 4MLFB 4IBLH 1UO6A 7KMEH 3MH6A 2F0AA 1N6YA 2NU1E 2Z7FE 1A5GH 2GCHF 4JCNA 4WXVA 1DY9A 1F5LA 1SB1H 4Z8JA 3FVFB 3AAUA 3T5FH 2VGCC 2O8UA 1GJ6A 4GLYA 4K76A 3BN9A 1NRQH 1TX8A 3FP7E 3U8TH 1GG6B 1EZQA 1ZOKA 1DWEH 4NA8A 5DP6A 3EA7A 1LHEH 5T6FA 2ZF0H 3TGJE 4CRAA 1VJAU 2ODYB 4BAHB 3W94A 4UFFH 1ZMJA 1V2MT 1ZMNA 3D23A 2P94A 3IG6B 4CHAC 1QRXA 1V2OT 3OY6U 1T8MA 1O35A 4NIYA 1OP0A 4ZH8A 1HIAA 1ELAA 4NWKA 4X1PU 3QE1A 1HLTH 2QKTA 2OCVB 4U2WA 3HGNA 1P06A 5HEBA 3ITIA 7LPRA 3BG8A 1J14A 2KAIB 2UUFB 3A88A 1Z86A 4AFSA 2ZGJA 3CBYA 1XZ9A 2XC4A 5DP5A 4AB9A 1G9OA 5I46H 3NZIA 5GLJA 4FUCA 4OAJA 2MHOA 1GWAA 4YLUA 5T3HA 1TGBA 1GBFA 1ZMLA 4X6NA 2ZDNA 3LJOA 3ODDA 2VWMA 1O3GA 2QGRA 4BTUB 1HJAC 1O3DA 4MNYA 1ELEE 2YT7A 5L2YH 1C5SA 1GHAF 1QCPA 2GKVE 1PPCE 2FX6A 2FLBH 3P8FA 5EXNA 3RXEA 1Y3YA 4JZIA 3B76A 1TMBH 1TPOA 1UK3A 2P95A 2V3HH 1NT1A 1RXPA 2XWAA 3DFLA 5D13A 3Q3XA 1RY4A 4FUBA 1FC7A 4O06A 1BHXF 4NXRA 3HVQC 2HLCA 1SSXA 1YCPM 1TB6H 3STJA 1GHZA 1GDQA 1XUKA 1NPMA 2XCNA 4X8UH 1U37A 4Z6AH 3R3GB 1C4V2 5EXMA 2ENOA 3MMGA 1OBYA 3BEIB 1Z71A 2K1ZA 2HVXA 4X6PA 4TY7A 3I18A 2D8IA 2FOBA 4OS4A 3ZVDA 4AYVB 1PFXC 4OGYA 3RL8A 2ZHWH 5IYTA 1D6WA 1TBRH 1IQKA 1C2IA 4H11A 4Y0YE 2H5DA 2VWOA 3QGNB 2PV9B 2XYAA 1C5UA 1YYY1 3RXTA 2PUQH 1N6FA 3SU2A 2XTTB 3RXDA 1UVPA 1HAHH 1TPPA 3FAOA 2LC7A 1UCYE 4AOQA 4D76A 3OSYA 1O36A 1BBRE 2A7JA 1ZR0A 2V6NA 3PTBA 4YOIA 4GUXA 3ZZCA 2A1DB 1SBWA 4UDWH 2KJKA 3L4FD 3KNXA 4FUFA 2TGTA 3RU4T 1RRKA 2ZQ1A 3KHFA 2A31A 2J34A 5A2MH 5DKMA 1N6DA 3RC5A 3M5LA 2F9NA 1C5XB 1H8IH 2I04A 2G51A 1O39A 1MKXH 4H4FA 2D90A 1FPHH 2NU2E 3SNBA 4MQAA 3M7UA 5TJXA 3A80A 2KOMA 2D1JA 1YPMH 4JOGA 5JB9S 1O2GH 3KN2A 4UONA 1GJ8B 4K3JA 2RRMA 3GDSA 4NMOA 3MU5A 2XBWA 3TSVA 4ABFA 2M0UA 4YO9A 2EI8A 2QCYA 3LGIA 1AQ7A 5EQQA 1H4WA 4CRBA 3Q00A 5L2ZH 4K2YA 1HIAB 2ZU3A 2BY8X 2PGBB 1QHRB 4GVCA 2HNTE 2VVUA 2FI3E 3RXKA 1DUEA 3SHWA 2P3UB 1UCYK 3RXIA 1BQYA 2UWOA 2XXLA 2QF3A 1UK2A 3T26A 3H5CB 2FTMA 1Z6JH 2ZGHA 1MBMA 1W3CA 2VU8E 1TP5A 2Z9LA 5FAHA 2Z17A 1V2KT 3CH8A 3M3TA 3O8RA 1A3EH 1LVYA 2MX6A 4NFEA 3SV6A 4MNXA 1E38B 3ZZBA 1GJAB 2GD4B 3DHKH 2VIVA 1C9PA 2DE8A 1P9SA 4UEHH 1JRSA 1WQVH 4K5ZA 1F0SA 2XW9A 2ZTXA 2XCFA 1DWDH 1K1NA 2BDIA 1L6OA 1G3CA 3PYHA 1CGJE 1IQGA 5C2ZA 1O5FH 1SLUB 3R69A 3SI3H 5E2PA 1MUEB 1P2IA 2BVSH 3A8BA 1DT2A 1Q7XA 5I7ZA 1CA0B 5HEDA 1NFWA 1DUAA 1C5RA 1MFLA 1WH1A 1DE7H 1A1RA 2EDPA 2AINA 1FZZA 1P09A 4I32A 3CS7A 3E1XB 2FDAA 3GSLA 1KEFA 3TMHA 2Z9IA 1L4DA 5E0GA 1SOZA 4E05H 1BMLA 2R0LA 1IQJA 1YPHE 3QN7A 1RTLA 4THNH 2PZDA 1TX6A 2OBQA 3BEUA 4ZHMU 1FN8A 4A1VA 6ESTA 1RFNA 1YGCH 1Y3WA 3KL6A 3GYLB 3AW1A 2QXGA 4X6OA 4BAQB 1ZHRA 3LC5A 1T2MA 4FUIA 2Q6DA 1MQ6A 3M5NA 4NZQA 3BPUA 4N6XA 2ZHDA 2B9LA 3TPIZ 4K69A 2HGAA 1MD8A 1G2LA 2QA9E 2TGPZ 3M61U 5EODA 2FCFA 4PQWA 3V13A 1IQEA 5J4SA 3M35A 1E36B 1NROH 1L1GA 2O8TA 1WU1A 2LNCA 4IN2A 2B5TB 1VJ6A 2C4FH 2DJTA 2YUYA 1EB2A 4QT8C 1UJDA 1CQQA 3SORA 4ASHA 1HAZB 3RU4D 3UTUH 4B71A 4INLA 3D65E 1P10A 1V2ST 2ZPLA 2JH5D 4ABAA 1FAKH 4X2YA 1UTNA 2BZAA 1S0RA 3PV5A 4NFFA 1F0UA 4Q80A 2CHAB 5H4IB 3RXOA 3RXCA 5HGGA 3VQGA 1QBOA 1QBVH 2Z9JA 3K2UA 1EZUC 4MPXA 1V2QT 4IC6A 1T31A 1QTFA 1WJLA 3SUDA 1MQ5A 1VJ9U 5JYIA 2BLQA 8ESTE 2ZDVH 1MCVA 2RA0A 5JB8S 3OTPA 1WFGA 1TBQH 1EKBB 2EA3A 3L33A 3QGJA 2TGAA 1TYNA 1MAXA 4EDJA 1QLCA 2H3MA 4D9QA 1UHPA 1AGJA 3BTHE 2IWQA 1O2RA 1D3DB 4OS6A 1AVWA 2Z6BD 2D2DA 1PYTD 1M5ZA 4FUHA 4DIIH 3M36A 1D6RA 4HOPB 3U69H 5E11A 1O3CA 5HM9A 1G3EA 2KJPA 3URCA 1X45A 1DS2E 1GHYH 3U8OH 2VIPA 1O3JA 4DURA 5HFEA 1QNJA 4YT6H 3A8CA 1W9EA 4NXQA 2HNTF 3SOEA 4XFQA 1NU7B 3MI4A 3EE0B 3Q3YA 1D3PB 4X6MA 6GCHF 2G4TA 1BHXB 1T8NA 2JETB 2ZU5A 1UEQA 3ATWA 1GJCB 1QB1A 1NRRH 1LQDB 1ORFA 2ZIQH 1U38A 1P8VC 1EPTC 2PKSB 3CENA 1GBBA 3RXVA 2QAAA 1OWDA 1PPHE 4ABBA 1V2LT 3MU8A 3SU1A 1O38A 4I7YH 3MNXA 1LVOA 1SR5C 4RN6A 3ZZ9A 4HTCH 2BD5A 4OS2A 1N6XA 2YOLA 5C5NA 4ESTE 3URDA 4LXBH 2LUIA 3UNSA 5AFYH 5GJ4B 1P03A 3DIWA 1EPTB 4FU8A 3B8JA 3HGPA 4YOJA 3NKKA 1O3EA 1O2MA 1LO6A 4CHAB 3GJ9A 1EJAA 2XBVA 3RP2A 1SGDE 2QYIA 2WUBA 4OS1A 3TVJB 1H9LB 3SU6A 4MPVA 2ZECA 5EXLA 2ZPMA 1Z6EA 1V2NT 1O3IA 2OZFA 1C1RA 2AGGX 1PPEE 1O5CB 1C5OH 1LPKB 1GJ7B 1XUJA 4WYUA 1THRH 1CVWH 4A7IB 1TABE 3AASA 2F91A 1AI8H 2ALVA 4FUEA 1TA6A 3K82A 1VR1H 4UD9H 4YZUA 2ZP0H 1BA8B 4ZKOU 1GM1A 2QT5A 2BOKA 2ZFFH 1FLEE 2M0TA 4Q3HA 2FOMB 3RC4A 3ZZ6A 2KYLA 1NESE 5AF9H 1EOJA 1GBEA 4CH8B 2GGVB 4LZ4B 2CF9H 3T27A 2FS8A 2AYWA 2KBSA 1DICA 2WV5A 2F83A 2GZ9A 5DP7A 3LT3A 4KELA 4I8HA 1O33A 1YF4A 3SNCA 1D9IA 4O9VA 1AB9B 1SLXB 2IWNA 1RGWA 3GYMA 3A7TA 2TIOA 3M7TA 1C5ZB 3O8BA 1XVOA 1L1JA 1ETSH 3I29A 2DC2A 4F4OC 2OMJA 5GWZA 1PQ8A 3SU3A 1GI0A 5FX5A 4IC5A 3ZVFA 2PA1A 2ZA5A 1WG6A 2VINA 2CHAC 1P02A 1ZUBA 4JK5A 2G4UA 2XWBI 1DDJA 5DGJA 4MPUA 1BTXA 1W9OA 1DPOA 5BRRE 4L8NA 3RXLA 3GY4A 2SNVA 5DP4A 4NMTA 1TQ0B 2F9PA 2F5YA 2VIOA 1OWKA 2BLVA 4K60A 3VEQB 4HOPA 2KPLA 3RM0H 3P17H 4Q7ZA 1MTSA 1LHCH 3WKLA 1LHGH 1S6HA 1VCQA 3CP7A 2PKTA 1O2VA 3DUXH 2YT8A 2VNTA 1BRAA 2OINA 1GL1A 1BCUH 2FOEA 2J94A 1IQMA 2R9PA 1MMJN 1UHBB 3FZDA 3S9CA 4TY6A 1SHHB 1W2KH 1QAUA 5DG6A 4A1TA 1V2TT 3STIA 1XM1A 5GDSH 2BY7X 1FUJA 1TWXB 3QTVH 4JOHA 1AD8H 3P95A 3PROA 1ANCA 1MU6B 1TGNA 2I6SA 1Z7KA 1OP2A 2SGFE 3ZRTA 3GY8A 5EPYA 1IHTH 4H6TA 3MU0A 5HDYA 1LHFH 3A85A 2RCEA 1O2TA 4ZKRU 1NC6A 1X6DA 1P3EA 1K1JA 1Q3OA 1GI1A 4OEPA 2VVCA 4JZFH 5LPEA 4X1NU 1NU9A 2BX4A 2BX3A 4D8NA 5T6GA 2W4FA 2Z94A 5EU8A 4JYTA 2A32A 1LKAA 1LPZB 1W12U 2D26C 1Z8JB 4CRGA 4XBDA 4CBNA 4GHQA 3SO3A 1AFQC 2OC0A 3R0FA 5HF4A 1P11E 1V6BA 3SU5A 1IU0A 2YUBA 1GVLA 5A8ZA 1P57B 5C1YA 1AVGH 4ZXXH 4GVUA 3M3SA 6CHAB 2HE4A 4Q2NA 2NU0E 1GJ5H 1SG8B 1WUNH 2UUJB 1QL7A 1OYTH 1UVUH 1FY1A 1TONA 2BQ6B 2BY9X 2XBYA 1P04A 5DJ7A 5CE1A 1TMUH 4F8KA 1E34B 4DGJA 1ANDA 2ANKH 1BE9A 1AWHB 4DOQA 2BD2A 1AE5A 1ARBA 3VB3A 3CBXA 1HJ8A 1SGIB 2JXOA 5E2OA 2DE9A 3K1RA 5FX6A 1UM1A 1LVMA 1RIWC 3E8LA 1RS0A 3SU0A 1I16A 2ZU1A 4O97A 2H6MA 2ZTZA 4M7GA 1IQFA 3ATIA 3KQEA 2J92A 1GL0E 1UVOA 1WSSH 1XXDA 4O3TA 2WINI 4WH8A 1QL9A 3Q76A 1NFYA 2F9BH 5HFBA 1E37B 1QURH 2BDCA 5HETA 3K9XB 5E0HA 1WCZA 2H5CA 3WKMA 4B74A 5DO4H 1UM7A 2VSPA 2YNAA 1AUJA 1GMHF 5HM2A 4AB8A 4LZ1H 3UR9A 2GZ7A 1LCYA 1K22H 2ULLA 3NGHA 3FANA 4KP0A 3UOUA 1FJSA 3QZQA 5C1UA 1DSTA 1YM0A 2V3OH 3MNSA 2QKVA 3TITA 2PSXA 1BJVA 1J15A 3UNQA 4KFWA 1P1EA 2FN5A 1PPBH 2OGPA 3FY5A 1CBWB 2FTLE 2UWLA 1C5PA 2G2LA 2F9UA 3RXUA 4RI0A 1GCTC 1W0ZU 2ZHEH 1O3FA 4X0WU 3RXJA 1ZTJA 1W13U 5FPTA 1C2EA 2H1UA 3DFJA 3CYYA 3R68A 2A5KA 4ISNA 2OS6A 4MG3A 1GJBB 1H1BA 4Y11E 1DOJA 1K9OE 1WOFA 2R2MB 4Y10E 2HPQH 2HALA 3T25A 3O8CA 3RMOH 1BTHH 4JOEA 1O37A 2FOHA 3HATH 4WWYA 1CHOF 1UTKA 3VB5A 2EC9H 5GPIB 3UQVA 3RLYH 1A0LA 3OY5U 1Q2WA 3SGQE 1LTOA 5PTPA 1KXBA 3ZVBA 1HGTH 5J4QA 2A2XH 1A4WH 1H8DH 1S0QA 1UTLM 2SGQE 1FONA 4FU9A 5K7RA 5G1EA 4NCYA 1BB0B 1V3XA 1RD3B 8LPRA 4Q6HA 4OGXA 1YPJH 2CMYA 4LK4A 2VVVA 4NIXA 5SGAE 1F5RA 2PHBA 4H6SB 4Q2PA 3A7WA 4K8BA 2KOHA 4A92A 2GZ8A 2JILA 1G32B 2DB5A 1O2ZA 4JOFA 1A61H 2OPGA 2EGOA 2JIKA 2HNTC 4OS5A 2ANYA 2A5IA 2ZQ2A 1GPZA 1A46H 2FPZA 4RSPA 5GIBA 2VWRA 3P70B 2ZGBH 1CU1A 1TRMA 3MFJA 3TH2H 4JZEH 6GCHG 4XHVA 1BZXE 1MTNC 5I25A 4FGMA 1PYTC 1JOUB 4JK6A 3OTJE 3RLWH 2OSGA 3VB6A 1O5BB 1VGCB 1W10U 1D3QB 2P93A 3UUZA 5A0CA 1W0YH 2ZDLA 4DT7B 1NRNH 3SV9A 1ZGIA 1GHXH 2STBE 1O5GH 1ANEA 2QIQA 3O5NA 4ISIH 5A8YA 3LNXA 3SNDA 1ESTA 1QQ4A 4K78A 1Z1IA 1YC0A 1VAEA 2XC0A 5A2PA 1K32A 1A5HA 1ZJKA 1K2I1 4X1SU 4VGCC 4BANB 1GG6C 2ZPRA 4ABHA 2FS9A 2SFAA 1TX7A 2GMTB 1TIOA 2SGAA 1C1PA 2P8OC 2QC2A 2V35A 1Q3XA 1TMTH 2FZZA 2ZTYA 4I8KA 5HFDA 4E3BA 2FOGA 1GBDA 1HBTH 3MHWU 4CRDA 4WMEA 1QL8A 2GX4A 2O9QA 3M5OA 1V2RT 4WMFA 3GCTF 3ZZ4A 3M37A 5HXFA 1Y8TA 1BBRH 1UEZA 1C5NH 2R3YA 3E91A 3F9FA 1F5KU 1TNLA 1T4VH 4R8TB 3DT0H 3DJ1A 3TK5A 1GJ9B 2O8MA 3GY7A 4DJZB 1TRNA 1BRCE 4AZ2B 2R3UA 1C2KA 3RMNH 2GDDA 1ZHMA 1ETRH 3CBZA 3MOCA 1BFEA 4R0IA 1A0JA 1AZZA 5F3XA 4Y7BA 1MFGA 1FY4A 1DLKB 1Z87A 2Y6TA 3SGAE 4ABEA 3RXAA 2EAQA 1O2YA 1AB9C 1OWIA 2VB0A 3BG4C 3HK6B 3A89A 1EUFA 1GJ4H 3LC3A 5JBAS 1SHYA 3PWBA 3Q77A 1G30B 1SVPA 2RG3A 3ENSB 2OCSA 3TGIE 3QDOA 5E0JA 4Y7AA 3OU0A 1XMNB 1ESBA 1FXYA 4ISHH 4WXIA 1C2MA 1KXCA 2BXTH 3SU4A 1BJUA 2J9NA 2C8YB 2FI5E 2AEIH 2PUXB 2YTWA 3EA9A 4K8YA 2FMJA 2I6QA 5FPSA 1K21H 1DWCH 2X7ZA 1C1MA 1EZXC 1E35B 1IAUA 3EQ0H 3MH4A 2D92A 3SGBE 3A82A 4J2YB 1LPGB 4UU5A 1KDQB 3TJUA 5DK1A 1C5QA 4ISOA 3SHCH 4INKA 3VXFH 1QJ1B 2L4SA 2AH4X 1K1OA 4D7FA 5E22A 1GJDB 1HAGE 2ZWLH 1O3HA 1G2MA 3ZZAA 1IHJA 2AS9A 1TNHA 5EG4A 3BEFB 1CHGA 1KTSB 1W8BH 2FLRH 1N8OC 1GHAG 1EXFA 4NMVA 1FY8E 2ZDKA 2DMZA 2L97A 3QJMA 4CRFA 2ZGXH 4FUDA 3KCGH 1EATA 2BDYA 1WI2A 4SGAE 1GHBF 5EPNA 2H9HA 1V62A 2KA9A 2BLOA 1GBTA 1BIOA 2THFB 5DP3A 3RXBA 1Y3UA 3LONA 2P8OB 1A7SA 3HKJB 1V1TA 1KYNA 2QKUA 3JXTA 2ZHQH 3QUMP 2ZZUH 3GY3A 1ARCA 2PSYA 3LGVA 2F9OA 4Y0ZE 1RGRA 1BTYA 4GSOA 1VITG 1GBJA 2Q9VA 1ELDE 1AIXH 1F2SE 5CHAC 5FCRA 2Q1JA 1AFEH 1O2IA 2AGIX 3PB1E 2FX4A 3T2NA 1BTWA 1FIWA 2KAIA 3NFKA 4CH2B 2IPHA 2GVFA 4NMSA 2BHGA 4U30A 4I8JA 2BD3A 2BLWA 2NU3E 1O5EH 1V2JT 1X8SA 2QV1A 3NFLA 3KHVA 3O8DA 5HMAA 2BOHB 2ZGCA 4B73A 1FPCH 4O3UA 4BOHA 2LC6A 2BD8A 1CO7E 4H42U 3LGUA 5AVDA 2VSVA 1GCTB 2VIWA 3CC0A 3ZZ7A 4Y8ZA 1YLCA 1W9QA 1IQLA 1Z1JA 4YDPA 1CBWC 1NRPH 2CF8H 4GPGA 1TBZH 2H9EH 2G5MB 3DA9B 4GCHG 1TQ3A 2G55A 1DFPA 1ANBA 1ESAA 3A81A 2OTVA 1NTPA 1SQAA 2I0LA 1RGQA 1G9IE 2QXJA 3C27B 1DM4B 4LMMA 1XXFA 2ZFPH 4J1YA 3U1JB 3RXRA 4GAWA 3DJ3A 1BMAA 2BXUH 2TRMA 3SBKA 3EGHC 3E0PB 2BZ6H 2FESH 1Y5AT 1YPGH 2FEQH 1S84A 4BXWA 3SJ8A 1MZDA 1PQ5A 3FFGA 3ZZ5A 3TJNA 3UR6A 2M3MA 3RL7A 3EAJA 1KLIH 1GMHG 1J9CH 1C1WH 4I33A 5JDUB 3AXAA 2Y5GA 5E8EH 5DP9A 1C2LA 1ZLRA 4P0CA 2KG2A 1UMAH 5JPMH 1KDQA 1WF8A 1XUFA 4YYXA 1W14U 1P2QA 2WPHS 4ZHLU 3R0HA 3ATKA 1ABJH 1IOEA 1PDRA 2BDBA 1N7EA 1UCYH 1TNIA 1P2KA 1O2XA 1SI5H 1GGDC 1QBNA 1AE8H 3I77A 2Z3EA 3GCTG 1GHVH 1IHSH 3BIUH 1C2GA 5TCAA 5DTHA 1V2VT 2P3WA 3UFAA 1UJUA 1X5QA 3PO1B 2EEJA 1P2OA 1SGNE 1RJXB 3VGCB 1O2PA 5GXPA 3SV8A 3VB7A 1TNGA 1FY3A 3BTWE 4CREA 1EX3A 4YOGA 1G36A 1GMDF 1N7FA 1CA0C 5JBTA 1SOTA 2KV8A 2KAWA 2UWPA 1DITH 8GCHF 4HI3A 3NK8A 1WFVA 1ACBE 2BVRH 2Z9GA 4E06H 3BF6H 1CT0E 3LGTA 3W95A 4Y76A 1TRYA 2CSJA 1O3KA 1BITA 1MU8B 3MNCA 1SPJA 1L4ZA 1KXFA 1RIWB 1WBGB 4TPYA 1JRTA 3SUGA 1CT2E 2CN0H 3SJOA 2BVXH 3QX5H 3SJKA 2AIPA 4DG4A 2V90A 4UFGH 2C8XB 2OUAA 4DW2U 3IWMA 2PW8H 1NF3C 2ZPSA 1V2WT 3PTNA 2W5EA 1QRZA 1OWJA 1TOMH 3VFEA 1SGQE 1GQ5A 1EP5A 3LNYA 5FHTA 2ZFTA 3VXEH 5LPRA 2FWWA 1EPTA 1GMDG 1EAXA 3LGWA 2TBSA 1O5DH 2UUYA 1HCGA 4B2CA 2JH6D 1AFQB 4CR5A 2K1QA 1VB7A 5JXBA 4Z33A 3AVZA 2ILNA 1GI2A 2QXIA 2JINA 3K50A 2JOAA 4E35A 2BB4A 2BQ7B 1HYLA 1E0FD 4JYUH 1L2EA 1P12E 3SUZA 5C20A 1GBAA 2R4HA 1R6JA 4ABIA 2IWOA 2DLSA 1C4Y2 3SZNA 1MKXK 1TP3A 5F67A 3LH1A 1P9UA 3VQFA 1KXAA 4SGBE 2BYGA 4DY7B 4YM9A 4NG9H 2FOAA 2H2BA 3RXPA 2JREA 2GP9B 1GQ4A 2BDGA 5G1DA 1MTVA 1AU8A 4AORA 1SQTA 3SQEE 2EEHA 1RTFB 2A5AA 1OWEA 1MD7A 1PJPA 2PFEA 1C9TA 3SFJA 3QGLA 2GCTB 3MO9A 5T6DA 1O34A 1D3TB 5C5OA 4E7RG 5E1YA 5GNDA 4JOJA 2J4IA 3L3TA 1XKBC 1VITF 3SHAH 3HPKA 1I92A 2Y80A 4KFVA 3MH5A 3BTGE 1OWHA 2FYRA 3TGKE 2W3IA 1UEWA 4NXPA 2C93B 4P2AB 1TQ7B 1W11U 1D5GA 3RXFA 3LDXH 1ABIH 4IGDA 1NZQH 2ASUB 3U8RH 3SUFA 1RTKA 1OX1A 2P3FH 2ZHFH 2ANMH 4ZKNU 4UU6A 3PS4A 2VIDA 1UTOA 3TH4H 4NSVA 3GCOA 1H9HE 4IW4E 2IN2A 1ELFA 3RMMH 1ZRBA 2I4SA 1BRBE 1VZQH 1O3AA 3RXQA 5L30H 4JMYA 4AYYB 1CT4E 2GCTC 5JBBS 3DORA 1EOLA 2TGDA 1C1UH 4FVDA 4IN1A 2VRFA 4MDSA 2QXHA 3FZZA 2EV8A 1O3NA 5JBCS 1F7ZA 2Q6GA 4NZLA 3V0XA 1GI3A 3T28A 1GMCG 4KTUA 5HFCA 2VZ5A 3KGPA 4FVBA 1J8AA 1XX9A 1GBCA 2SGPE 1T7CA 3PDVA 2PNTA 4AFQA 1ZSJA 3PDZA 4UFEH 2Q3GA 1X7AC 2WPIS 4AMHA 2KJDA 3UREA 2PKSC 2PTCE 2QBWA 3K6YA 2XRCA 1GVKB 1IQNA 2WPJS 4AFUA 2I1NA 5TCCA 1SGPE 2EHRA 3RMLH 2IWPA 1J16A 4JL7A 2GT8A 4WVPE 5F8ZA 2A4GA 2I6VA 3JZ1B 1N7TA 1ZTLA 4HGCA 1ZHPA 2OD3B 4D7GA 2BD4A 3LPRA 3LKWA 1NY22 2AMDA 3T62A 1BTZA 1C5VA 1LMWB 3TLOA 3ZZ8A 1GI9B 5E6PB 1KY9A 2ZKSA 3FP6E 3TU7H 1HAIH 2W7RA 2AFQB 1A0HB 2Y82A 2DAZA 1O2LA 1C2DA 1FMGA 3S9BA 4B2AA 2OLGA 3I4WA 2EI6A 3NUMA 1OZIA 3PMAB 1GHBG 1SL3A 5B6LA 2SGEE 2Y7XA 5C1XA 3A86A 1OBXA 3GOVB 8GCHG 4BAOB 1ELTA 1GI7B 4CRCA 1WHAA 1PPGE 2A0QB 1FN6A 1AZ8A 2PWXA 5GCHG 1C2FA 1O32A 5BPEA 3RU4E 2W26A 4Q7XA 2REYA 4KGAA 1DVAH 4TWYA 3GY5A 3LIWA 3H7TA 1S5SA 4YESB 4RKOB 3F9HA 1HV7A 1U6QA 4G69A 4NIVA 1UEPA 1TGTA 2F3CE 1QFKH 4HFPB 5GCHF 4DVAU 2JETC 2J95A 3ZZDA 4U01A 4XOJA 7ESTE 2AMQA 3E6PH 2O2TA 1DANH 1P2MA 3BTDE 3RXHA 1AHTH 1GDUA 4AFZA 3B9FH 3S0NA 3S7KB 1S85A 1FC9A 4ZMAH 4K1TA 4BXSA 1RZXA 1L0ZA 3A83A 2A4RA 2G5VA 1F0RA 2M5TA 2EGNA 3VGCC 1EB1H 1YPKH 1DSUA 4E34A 2EDVA 3TJOA 3P6ZB 2M0VA 1N1LA 1EASA 3ZYDA 1AO5A
chains in the Genus database with same CATH superfamily
1B8QA 1DX5M 1SGRE 1GGDB 3D62A 2UUKB 2SGDE 2ODPA 2Y5HA 3F68H 3LOXA 4KTCA 5G4BA 1K28D 3M5MA 4X8VH 2BQWB 2EDZA 1KMHB 1MTWA 3PV4A 1P1DA 5HFFA 2EXGA 1NS3A 3KQDA 1UJVA 1HRTH 1O3PB 4PROA 2HPPH 2NWNA 5EW2H 2BYAX 1BDAA 2J38A 3ID3A 4GHTA 2BY5X 2HWLB 3KIDU 3Q3KA 2ZNKH 3F6UH 1QB6A 1YBWA 4XE4A 1SFIA 1TNKA 2RCZA 1SGFA 1HPGA 1TPSA 2FODA 4F49A 1PPZA 4BAKB 2C8WB 5F8TA 1QJ6B 3E0NB 1QRWA 3T29A 1WI4A 3E17A 1UTQA 1NFXA 1ZSKA 3SW2B 1TA2A 2OBOA 4U32A 2PKUA 1SGYE 4NWLA 1O2WA 2K20A 3ZVCA 1MKWK 3SNEA 2KOJA 2LELA 4WYTA 2ANWA 1TLDA 4CBOA 1NFUA 1EAWA 3F2HA 5EW1H 1C5YB 1C5WB 3U9AH 1C1VH 4GCHF 4UE7H 2ZCLP 1QA0A 3RXGA 4ASUD 5C67A 2G5NA 2OQSA 1C2JA 4WF8A 1UF1A 1FAXA 1MKWH 2EJYA 3A7VA 2FXRA 1GDNA 3AAVA 4JZDH 2OXSA 3AW0A 4B6EA 2STAE 3PMBB 5AFZH 2G81E 1GI4A 1O2JA 2C8ZB 1UJ1A 1FQ3A 2E7KA 4ISLA 3A8DA 5FCKA 2BY6X 1ZYOA 4Q7YA 1Z8RA 3P8NA 3OEHD 3RUOA 1P01A 1XKAC 2TPIZ 2LOBA 1ELBA 3UAIC 2D8WA 1QIXB 3BTFE 4Z0KA 2BTCE 3MNBA 2BDHA 4K72A 2GDEH 4LOYH 3BTEE 3GICB 5IK2D 5FPYA 4B75A 1O3LA 5C3NA 4X8TH 4XDEA 7GCHF 3MQKC 1FV9A 1AKSA 2NU4E 1SFQB 2GV6A 2FNEA 1LKBA 2H2CA 4XBCA 1FY5A 1B0EA 3U1IB 2J2UA 5DP8A 1IU2A 3BSQA 2FE5A 1BRUP 2WPKS 1HJAB 4ABDA 1AMHA 1ELGA 3BTQE 3RXMA 1AWFH 2OC8A 1VCPA 5LGOA 2QE7D 4A6LA 1QB9A 1TNJA 1NO9H 3SQHE 1BT7A 2RA3A 2O8LA 1WIFA 1MCTA 2V0BA 5DPAA 4R2ZA 1TFXA 4Y79A 2SNWA 1N6EA 1VCWA 2ESTE 2V7QD 2WL7A 1GBKA 3SUEA 1XVMA 1O3MA 2M10A 3KQBA 1TALA 2YNBA 1YWUA 4NGAH 2HE2A 4B76A 3MWIU 2V3MA 1N8OB 1XUHA 2ODQA 4A1XA 3P8OA 1YCPK 2K8IA 2ZU4A 3VB4A 1Y59T 3GY2A 4ZUHA 2JDID 3A8AA 2FYQA 3K6ZA 2AMPA 4A5TS 4FU7A 1CHOG 2FI4E 3V12A 4NMQA 1EAIA 2M0ZA 3HK3B 1EP6A 3WW7A 1BUIA 1HAVA 3HPMA 4WH6A 4NSYA 1Z8IB 4Y8XA 5ILBA 1OXGA 1LQEA 3DD2H 2PTNA 2IPQX 1OP8A 4JORA 2A2QH 2G8TA 1K1MA 1TGSZ 1YCPH 4D9RA 4NMPA 1WF7A 1WV7H 3ATMA 2M2AA 1TPAE 3QLPH 2UZCA 1L1NA 2KRGA 1JMOH 4XD7D 5HYOA 1O3OA 2C3SA 2CJIA 1ELVA 4JYVH 1T8OA 4AGKA 1P3CA 1ELCA 1QA7A 5EYZA 3UWIA 5FB8C 4NMRA 1O2UA 4FUJA 1XUGA 4IS5A 1HAOH 2ZFSA 2CV3A 2G00A 1K1LA 1ZGVA 1TAWA 2W6ID 5F03A 2AWXA 2LA8A 3E3TA 1ZRKA 4NNLA 1YKTA 1A2CH 3MTYA 4B2BA 1CGIE 1WTGH 4DIHH 2ZC9H 4E7NA 2KL1A 1Q31A 1ZPCA 3QIKA 4ABGA 2A7CA 3LH3A 5ETXA 5A09A 2EEKA 1BMFD 2L4TA 1WHDA 1YBOA 3V3MA 3ZV8A 1UTMA 1TE0A 2HGTH 2FM2A 1U39A 3PRBA 2XBXA 2CSSA 3SV7A 2ZO3H 3MYWA 3EGKH 4MNVA 4OEOA 2VWNA 1FIZA 2BMGB 2R0KA 1GI5A 1OBZA 2BDAA 3L6PA 1HB0B 1KTTB 4ZAEA 4XSKU 1O3BA 3PM3A 2PR3A 1JIRA 1OOKB 3QJNA 2Z3CA 4DCDA 1AKSB 1TGCA 1C5MD 2B0FA 4AN7A 3LU9B 1V2PT 2C90B 2ZCHP 3G01A 2R2WU 4ABJA 1M9UA 3U98H 3BTME 1BMNH 3A87A 4K6YA 2GV7A 4AX9H 3LJJA 1SQOA 4AG1A 5EQSA 3HPTB 4WMDA 1T8LA 3TSZA 1MZAA 1NN6A 3TNSA 3MH7A 1HFDA 1KIGH 3UOPA 3BG4B 2OC7A 2VH0A 2CGAA 2WPMS 2PDZA 4OS7A 4ACAA 2A4QA 3LGYA 4IMZA 2VGCB 1UHBA 3ZYEA 2GCHG 2OC1A 3QDZB 2Q6FA 4I31A 5HJ1A 3RDZA 1DWBH 3KYFA 2PGQB 4K1SA 1BTUA 3PV2A 1HAPH 2A7HA 1U3BA 2P59A 3MO3A 6LPRA 1AY6H 1HAYB 2ZG0H 1UTPA 1MTNB 3GISB 3NWUA 2ZDAH 2QF4A 1VKYA 1AVXA 1K1PA 1HAVB 1GI6A 2FP7B 4O03A 3O46A 2LP6A 1ZJDA 2PKAB 2XC5A 1O2HA 1WQSA 3EA8A 1A5IA 5EIYA 1C1NA 1EZSC 2W7SA 4RKJB 1THPB 2H2ZA 2BD9A 2ZDMA 3ID2A 5ESBA 4X2VA 2BD7A 2JJ2D 1V2UT 1JWTA 1OPHB 3SHUA 3MO6A 2I0IA 1O0DH 3NRLA 4HG6A 2WV4A 4VGCB 1QR3E 3TH3H 1EAUA 3V7TA 3EDXB 1OYQA 1UTJA 4I8LA 2J5UA 1UFXA 1H9IE 1ZZZA 3A7XA 1ZOMA 2P16A 4Q2OA 4X2XA 1GVZA 4BAMB 1JIMA 2JKHA 1S83A 1LVBA 2DM8A 4JOPA 9LPRA 3GGEA 1O31A 1XUIA 4KKDA 3UIRA 3UQOA 1GBLA 2EI7A 1F92A 1ZPZA 2ZEBA 1B7XB 2GTBA 1D4PB 1VGCC 4FUGA 5FXLA 3PMJA 2OQ5A 3ZIAD 1ID5H 1CSOE 3BTKE 1YPHC 1Q3PA 1C1OA 1EJMA 1S81A 1W7GH 4ZHAA 1ZSLA 1HUTH 5LPFA 2W6JD 2ZFRH 4TPIZ 3P8GA 3S69A 1QAVB 3GY6A 1GHWH 4X1QU 1ZPBA 3UY9A 3SI4H 5LH8A 2EEIA 1NTEA 1SMFE 2OP9A 3M7QA 3SNAA 1OKXA 3P92A 3S7HB 1H8ED 3MU4A 3UNRA 1SGFG 3E16B 1WYKA 3VPKA 1O5AB 2F9VA 2JWEA 4UFDH 2FO9A 2DKRA 1SC8U 2JH0D 3FP8E 5F8XA 3EGGC 4YT7H 3ZVAA 3OYPA 2VIQA 3F0OA 2QN5T 3RC6A 1FDPA 4BTIB 2Z3DA 2KR7A 1C1SA 1HJ9A 2ZFQH 4WY3A 2GT7A 2PLXA 5IDKA 3PO1C 1QJ7B 2GZVA 2ZU2A 4GVDA 3WWFA 3EYDA 3QWCH 1CA8B 5DSFA 3NXPA 4P02A 1SLWB 3KZEA 4X8SH 3JZ2B 3SYJA 1N99A 2DUCA 2EEGA 1QAVA 1X5RA 3MU1A 1VITH 2GMTC 3TNTA 3D49H 1MH0A 1LHDH 3IITA 3FO8D 2ZCKP 4NA7A 2EGKA 2AIQA 1QGFA 4NA9H 3BV9B 4F48B 1DXWA 2Y5FA 5ABWA 1DLEA 3SN8A 5K0HA 4ZKSU 1G37A 1Y5BT 1DXPA 4IMQA 1JBUH 3NPSA 1WTHD 5FL7D 1UK4A 3NCLA 3PMHB 1K1IA 2CS5A 2G52A 1S82A 9ESTA 3SJ9A 3RLEA 1THSH 4K75A 1W7XH 2AGEX 2PKAA 3UWJH 1F0TA 1OSSA 1V5QA 1BOQA 1CE5A 5A8XA 1GI8B 2QY0B 1T32A 2V1WA 3K65B 3WY8A 1VA8A 1P0SH 1BBRK 1YLDA 2FOFA 2QG1A 3QZRA 3I1EA 3BIVH 4AGJA 3PLKA 1WAYB 4YLQH 7GCHG 1HDTH 3SV2H 1V5LA 3GCHC 5H3JA 1TOCB 1Y5UT 3PLBA 3F9EA 4MTBA 1KLTA 4Q6SA 1PQAA 2RDLA 1C2HA 5EQRA 2FOCA 3E90B 2AERH 1YPLH 3B23B 3N7OA 1HXEH 1P2NA 1Y3XA 5EZ0A 4WJG2 2OQUA 2WPLS 5FBEA 3C1KA 1PQ7A 1BMMH 2CXVA 2FIRH 3BTTE 1SLVB 5A0BA 1A3BH 1GBHA 3DJAA 1P2JA 1SGCA 3RXSA 1KSNA 4MPWA 2XNIA 2VBCA 5C94A 4JZ1A 3ATLA 3A7YA 4NIWA 1E79D 1WXRA 2ZI2H 3F9GA 5CHAB 3GDVA 1JXPA 3GDUA 1S6FA 1T4UH 6CHAC 3SJIA 1MAYA 1G3DA 2WUCA 2ALPA 3HKIB 3RM2H 3ELAH 4I8GA 1IQHA 3ODFA 1Y3VA 2W7UA 1MTUA 4X1RU 2KCYA 2H9TH 1SGEE 4MNWA 1DY8A 4TWWA 3SOSA 4Y8YA 3UPEA 4ZXYH 1O2SA 4YTAA 3TJVA 4TSFD 3ID1A 3GCHB 5AHGH 1EQ9A 1BTPA 1QQUA 3S9AA 5KEDA 3F1SB 3M3VA 1KXEA 2VWLA 2DLUA 1GCDA 4TYDA 1UVTH 5F6MA 1YP9A 5ESTE 1PPFE 4NNMA 3KF2A 4BTTB 1G3BA 2W3KA 3QO6A 3EE7A 5FBIA 3KEEA 4JOKA 1AN1E 1O2OA 1IQIA 3OX7U 1FCFA 2AWUA 1O30A 2KPKA 4Q2QA 1QY6A 1O2NA 3QK1A 4K1EA 1KXDA 2LPRA 4FXGH 3TK6A 2A45B 3ZZ3A 4X2WA 5HF1A 4MVNA 2P3TB 1HAXB 2Y7ZA 3CS0A 4GHNA 1FC6A 4INHA 2VH6A 2B8OH 2IJOB 4Q2KA 1EJNA 1O2KA 1AUTC 1OS8A 1GBMA 1KWAA 5E21A 1INCA 1MBQA 1C5LH 1V6DA 1B5GH 3ZVGA 3A84A 4B1TA 5HEYA 4Y6DA 2B7DH 2WYJA 1HNEE 1LDTT 4FLNA 1Y7NA 2A4OA 1ZTKA 1MC7A 2HRVA 2BM2A 1OHHD 1SGTA 2VJ1A 3ID4A 5A0AE 3H7OA 3TSWA 1UVSH 3F2FA 3TIUA 4Y71A 2WYGA 3QTOH 1ETTH 1NM6A 4XBBA 1YPEH 1KLJH 3A7ZA 4HZHA 2HOBA 1O2QA 4ZROA 2AWWA 1Z8GA 2VPHA 3PLPA 4CR9A 1FNIA 1HXFH 3I78A 3ZV9A 5CMXH 2H3LA 3GCNA 1UITA 2Z9KA 4MPAA 8KME2 2Y81A 2QF0A 1C1TA 5EOKA 4AG2A 3ZVEA 2KQFA 1P05A 1C1QA 3KQCA 5EGMA 4REYA 1C5TA 1GBIA 1NRSH 3KZDA 1B0FA 1X5NA 1GMCF 1CGHA 1J17T 1FI8A 5L6NH 2ZPQA 3TK9A 4BNRA 1C4U2 3PWCA 5B6OA 4KTSA 2O8WA 2IOTA 3ESTA 4MLFB 4IBLH 1UO6A 7KMEH 3MH6A 2F0AA 1N6YA 2NU1E 2Z7FE 1A5GH 2GCHF 4JCNA 4F55A 4WXVA 1DY9A 1F5LA 1SB1H 4YXWD 4Z8JA 3FVFB 3AAUA 3T5FH 2VGCC 2O8UA 1GJ6A 4GLYA 3U28C 4K76A 3BN9A 1NRQH 1TX8A 3FP7E 3U8TH 1GG6B 1EZQA 1ZOKA 1DWEH 4NA8A 5DP6A 3EA7A 1LHEH 1E1RD 5T6FA 2ZF0H 3TGJE 4CRAA 1VJAU 2ODYB 4BAHB 3W94A 4UFFH 1ZMJA 1V2MT 1ZMNA 3D23A 2P94A 3IG6B 4CHAC 1QRXA 1V2OT 3OY6U 1T8MA 1O35A 4NIYA 1OP0A 4ZH8A 1HIAA 1ELAA 4NWKA 4X1PU 3QE1A 1HLTH 2QKTA 2OCVB 4U2WA 3HGNA 1P06A 5HEBA 3ITIA 1SKYE 7LPRA 3BG8A 1J14A 2KAIB 2UUFB 3A88A 1Z86A 4AFSA 2ZGJA 3CBYA 1XZ9A 2XC4A 5DP5A 4AB9A 1G9OA 5I46H 3NZIA 5GLJA 4FUCA 4OAJA 2MHOA 1GWAA 4YLUA 5T3HA 4JJ0A 1TGBA 1GBFA 1ZMLA 4X6NA 2ZDNA 3LJOA 3ODDA 4M9FA 2VWMA 1O3GA 2QGRA 4BTUB 1HJAC 1O3DA 4MNYA 1ELEE 2YT7A 5L2YH 1C5SA 1GHAF 1QCPA 2GKVE 1PPCE 2JSNA 2FX6A 2FLBH 3P8FA 5EXNA 3RXEA 1Y3YA 1QZ8A 4JZIA 3B76A 1TMBH 1TPOA 1UK3A 2P95A 2V3HH 1NT1A 1RXPA 2XWAA 3DFLA 5D13A 3Q3XA 1RY4A 4FUBA 1FC7A 4O06A 1BHXF 4NXRA 3HVQC 2HLCA 1SSXA 1YCPM 1TB6H 3STJA 1GHZA 1GDQA 1NPMA 1XUKA 2XCNA 4X8UH 1U37A 4Z6AH 3R3GB 2CK3D 1C4V2 5EXMA 2ENOA 3MMGA 1OBYA 3VG8A 3BEIB 1Z71A 2K1ZA 1YY3A 2HVXA 4X6PA 4TY7A 3I18A 2D8IA 2FOBA 4OS4A 3ZVDA 4AYVB 1PFXC 4OGYA 3RL8A 3FOAA 2ZHWH 5IYTA 1D6WA 1TBRH 1IQKA 1C2IA 4H11A 3F0PA 4Y0YE 2H5DA 2VWOA 3QGNB 2PV9B 2XYAA 1C5UA 1YYY1 2KCAA 3RXTA 2PUQH 1N6FA 3SU2A 2XTTB 3RXDA 1UVPA 1HAHH 1TPPA 3FAOA 2LC7A 1UCYE 4AOQA 4D76A 3OSYA 2K0QA 1O36A 1BBRE 2A7JA 1ZR0A 2V6NA 3PTBA 4YOIA 1NBME 4GUXA 3ZZCA 2A1DB 1SBWA 4UDWH 2KJKA 3L4FD 3KNXA 4FUFA 2TGTA 1FX0B 3RU4T 1RRKA 2ZQ1A 3KHFA 2A31A 2J34A 5A2MH 5DKMA 1N6DA 3RC5A 3M5LA 2F9NA 1C5XB 1H8IH 2I04A 1COWD 2G51A 1O39A 1MKXH 4H4FA 2D90A 1FPHH 2NU2E 3SNBA 4MQAA 3M7UA 5TJXA 3A80A 2KOMA 2D1JA 1YPMH 4JOGA 5JB9S 1O2GH 3KN2A 4UONA 1GJ8B 4K3JA 2RRMA 3GDSA 4NMOA 3MU5A 2XBWA 3TSVA 4ABFA 2M0UA 4YO9A 5EJ1A 2EI8A 2QCYA 3LGIA 1AQ7A 5EQQA 1H4WA 4CRBA 3Q00A 5L2ZH 4K2YA 1HIAB 2ZU3A 2BY8X 2PGBB 1QHRB 4GVCA 2HNTE 2VVUA 2FI3E 3RXKA 1DUEA 3SHWA 2P3UB 1UCYK 3RXIA 1BQYA 2L74A 2UWOA 2XXLA 2QF3A 1UK2A 3T26A 3H5CB 2FTMA 1Z6JH 2ZGHA 1MBMA 1W3CA 2VU8E 1TP5A 2Z9LA 5FAHA 2Z17A 1V2KT 3CH8A 3M3TA 3O8RA 1A3EH 1LVYA 2MX6A 4NFEA 3SV6A 4MNXA 3FKSD 1E38B 3ZZBA 1GJAB 2GD4B 3DHKH 2VIVA 1C9PA 2DE8A 1P9SA 4UEHH 1JRSA 1WQVH 4K5ZA 1F0SA 2XW9A 2ZTXA 2XCFA 1DWDH 1K1NA 2BDIA 1L6OA 1G3CA 3PYHA 1CGJE 1IQGA 5C2ZA 1O5FH 1SLUB 3R69A 3SI3H 5E2PA 1MUEB 1P2IA 2BVSH 3A8BA 1DT2A 1Q7XA 5I7ZA 1CA0B 5HEDA 1NFWA 1DUAA 1C5RA 1MFLA 1WH1A 1DE7H 1A1RA 2JJ1D 2EDPA 2AINA 1FZZA 1P09A 4I32A 3CS7A 3E1XB 2FDAA 3GSLA 1KEFA 3TMHA 2Z9IA 1L4DA 5E0GA 1SOZA 4E05H 1BMLA 2R0LA 1IQJA 1YPHE 3QN7A 1RTLA 4THNH 2PZDA 1TX6A 2OBQA 3BEUA 2RDEA 4ZHMU 1FN8A 4A1VA 6ESTA 1RFNA 1YGCH 1Y3WA 3KL6A 3GYLB 2JIZD 2QXGA 3AW1A 4X6OA 4BAQB 1ZHRA 3LC5A 1T2MA 4FUIA 3H09A 2Q6DA 1MQ6A 3M5NA 4NZQA 3BPUA 4N6XA 2ZHDA 2B9LA 3TPIZ 4K69A 2HGAA 1MD8A 1G2LA 2QA9E 2TGPZ 3M61U 5EODA 2FCFA 4PQWA 3V13A 1IQEA 5J4SA 3M35A 1E36B 1NROH 1L1GA 2O8TA 3F3BA 1WU1A 2LNCA 4IN2A 2B5TB 1VJ6A 2C4FH 2DJTA 2YUYA 5CHBA 1EB2A 4QT8C 1UJDA 1CQQA 3SORA 4ASHA 1HAZB 3RU4D 3UTUH 4B71A 4INLA 3D65E 1P10A 1V2ST 2ZPLA 2JH5D 4ABAA 1FAKH 4X2YA 1UTNA 2BZAA 1S0RA 3PV5A 4NFFA 1F0UA 4Q80A 2CHAB 5H4IB 3RXOA 3RXCA 5HGGA 3VQGA 1QBOA 1QBVH 1NBMD 2Z9JA 3K2UA 1EZUC 4MPXA 1V2QT 4IC6A 1T31A 1QTFA 1WJLA 3SUDA 1MQ5A 1VJ9U 5JYIA 2BLQA 8ESTE 2ZDVH 1MCVA 2RA0A 5JB8S 3OTPA 1WFGA 1TBQH 1EKBB 2EA3A 3L33A 3OAAD 3QGJA 2TGAA 1TYNA 1MAXA 4EDJA 1QLCA 2H3MA 4D9QA 1UHPA 1AGJA 3BTHE 2IWQA 1O2RA 3PRDA 1D3DB 4OS6A 1AVWA 2Z6BD 2D2DA 1PYTD 1M5ZA 1EFRD 4FUHA 4DIIH 3M36A 1D6RA 4HOPB 3U69H 5E11A 1O3CA 5HM9A 1G3EA 2KJPA 3URCA 1X45A 1DS2E 1GHYH 3U8OH 2VIPA 1O3JA 4DURA 5HFEA 1QNJA 4YT6H 3A8CA 1W9EA 4NXQA 2HNTF 3SOEA 4XFQA 1NU7B 3MI4A 3EE0B 3Q3YA 4RT1A 1D3PB 4X6MA 6GCHF 2G4TA 1BHXB 1T8NA 2JETB 2ZU5A 1UEQA 3ATWA 5CDFE 1GJCB 1QB1A 1NRRH 1LQDB 1ORFA 2ZIQH 1U38A 1P8VC 1EPTC 2PKSB 3CENA 1GBBA 3RXVA 2QAAA 1OWDA 1PPHE 4ABBA 1V2LT 3MU8A 3SU1A 1O38A 4I7YH 3MNXA 1LVOA 1SR5C 4RN6A 3ZZ9A 4HTCH 2WSSD 2BD5A 4OS2A 1N6XA 2YOLA 5C5NA 4ESTE 3URDA 4LXBH 5T1VA 2LUIA 3UNSA 5AFYH 5GJ4B 1P03A 3DIWA 1EPTB 4FU8A 3B8JA 3HGPA 4YOJA 3NKKA 1O3EA 1O2MA 1LO6A 2EY4C 4CHAB 2J98A 3GJ9A 1EJAA 2XBVA 3RP2A 1X9ZA 1SGDE 2QYIA 2WUBA 4OS1A 3TVJB 1H9LB 3SU6A 4MPVA 2ZECA 5EXLA 2ZPMA 1Z6EA 1V2NT 1O3IA 2OZFA 1C1RA 2AGGX 1PPEE 1O5CB 1C5OH 1LPKB 1GJ7B 1S6LA 4I86A 1XUJA 4WYUA 1THRH 1CVWH 4A7IB 1TABE 3AASA 2F91A 1AI8H 2ALVA 4FUEA 1TA6A 3K82A 1VR1H 4UD9H 4YZUA 2ZP0H 1BA8B 4ZKOU 1GM1A 2QT5A 2BOKA 2ZFFH 1FLEE 2M0TA 4Q3HA 2FOMB 3RC4A 3ZZ6A 2KYLA 1NESE 5AF9H 1W0JD 1EOJA 1GBEA 4CH8B 2GGVB 4LZ4B 2CF9H 3T27A 2FS8A 2AYWA 2KBSA 1DICA 2WV5A 2L6OA 2F83A 2GZ9A 5DP7A 3UB0A 3LT3A 4KELA 4I8HA 1O33A 1YF4A 3SNCA 1D9IA 4O9VA 1AB9B 1SLXB 2IWNA 1RGWA 3GYMA 3A7TA 2TIOA 3M7TA 1C5ZB 3O8BA 1XVOA 1L1JA 1ETSH 3I29A 2DC2A 4F4OC 2OMJA 2F4LA 5GWZA 1PQ8A 3SU3A 1GI0A 5FX5A 4IC5A 3ZVFA 2PA1A 2ZA5A 1WG6A 2VINA 2CHAC 1P02A 1ZUBA 4JK5A 2G4UA 2XWBI 1DDJA 5DGJA 4MPUA 1BTXA 1W9OA 1DPOA 5BRRE 4L8NA 3RXLA 3GY4A 2SNVA 5DP4A 4NMTA 1TQ0B 2F9PA 2F5YA 2VIOA 1OWKA 2BLVA 4K60A 3VEQB 4HOPA 2KPLA 3RM0H 3P17H 4Q7ZA 1MTSA 1LHCH 3WKLA 1LHGH 1S6HA 1VCQA 3CP7A 2PKTA 1O2VA 3DUXH 2YT8A 2VNTA 1BRAA 1WDIA 2OINA 1GL1A 1BCUH 2FOEA 2J94A 1IQMA 2R9PA 1MMJN 1UHBB 5KGOA 3FZDA 3FN8A 3S9CA 4TY6A 1SHHB 1W2KH 1QAUA 5DG6A 4A1TA 1V2TT 3STIA 1XM1A 5GDSH 2BY7X 1FUJA 1TWXB 3QTVH 4JOHA 5EJLA 1AD8H 3GABA 3P95A 3N7EA 3PROA 4AC9A 4JJ3A 1ANCA 1MU6B 1TGNA 2I6SA 1Z7KA 1OP2A 2SGFE 3ZRTA 3GY8A 5EPYA 1IHTH 4H6TA 3MU0A 3N7DA 5HDYA 1LHFH 3A85A 2RCEA 1O2TA 4ZKRU 1NC6A 1X6DA 1P3EA 1K1JA 1Q3OA 1GI1A 4OEPA 2VVCA 4JZFH 5LPEA 4X1NU 1NU9A 2BX4A 2BX3A 4D8NA 5T6GA 2W4FA 2Z94A 5EU8A 4JYTA 2A32A 1LKAA 1LPZB 1W12U 2D26C 1Z8JB 4CRGA 4XBDA 4CBNA 4GHQA 3SO3A 1AFQC 2OC0A 3R0FA 5HF4A 1P11E 1V6BA 3SU5A 1IU0A 2YUBA 1GVLA 5A8ZA 1P57B 5C1YA 1AVGH 4ZXXH 4GVUA 3M3SA 6CHAB 2HE4A 4Q2NA 2NU0E 1GJ5H 1SG8B 1WUNH 2UUJB 1QL7A 5DN6D 1OYTH 1UVUH 1FY1A 1TONA 2BQ6B 2BY9X 2XBYA 1P04A 5DJ7A 5CE1A 1TMUH 4F8KA 1E34B 4DGJA 1ANDA 2ANKH 1BE9A 1AWHB 4DOQA 2BD2A 1AE5A 1ARBA 3DSOA 3VB3A 3CBXA 1HJ8A 2XOKD 1SGIB 2JXOA 5E2OA 2DE9A 3K1RA 5FX6A 1UM1A 2WPDD 1LVMA 1RIWC 3E8LA 3SZEA 1RS0A 3SU0A 1I16A 2ZU1A 4O97A 2H6MA 2ZTZA 4M7GA 1IQFA 3ATIA 3KQEA 2J92A 1GL0E 4Z1MD 1E1QD 1UVOA 1WSSH 1XXDA 2WINI 4O3TA 4WH8A 5C17A 1QL9A 3Q76A 1NFYA 2F9BH 5HFBA 1E37B 1QURH 2BDCA 5HETA 3K9XB 5E0HA 1WCZA 2H5CA 3WKMA 4B74A 5DO4H 1UM7A 2VSPA 2YNAA 1AUJA 1GMHF 5HM2A 4AB8A 4LZ1H 3UR9A 2GZ7A 3GS9A 1LCYA 1K22H 2ULLA 3NGHA 3FANA 4KP0A 2KM0A 2KX4A 3UOUA 1FJSA 3QZQA 5C1UA 1DSTA 1YM0A 2V3OH 3MNSA 2QKVA 3TITA 2PSXA 1BJVA 1J15A 3UNQA 4KFWA 1P1EA 2FN5A 1PPBH 2OGPA 3FY5A 1CBWB 2FTLE 2UWLA 1C5PA 2G2LA 2F9UA 3RXUA 3AK5A 4RI0A 1GCTC 1W0ZU 2ZHEH 2RFKC 1O3FA 4X0WU 3RXJA 1ZTJA 1W13U 5FPTA 1C2EA 2H1UA 3DFJA 3CYYA 3R68A 2A5KA 4ISNA 2OS6A 4MG3A 1GJBB 1H1BA 4Y11E 1DOJA 1K9OE 1WOFA 2R2MB 4Y10E 2HPQH 2HALA 3NCVA 3T25A 3O8CA 3RMOH 1BTHH 4JOEA 1O37A 2FOHA 3HATH 4WWYA 1CHOF 1UTKA 3VB5A 2EC9H 5GPIB 3UQVA 3RLYH 1A0LA 3OY5U 1Q2WA 3SGQE 1LTOA 5PTPA 1KXBA 3ZVBA 1HGTH 5J4QA 2A2XH 1A4WH 1H8DH 1S0QA 1UTLM 2SGQE 1FONA 4FU9A 5K7RA 5G1EA 4NCYA 1BB0B 1V3XA 1RD3B 5EJZA 8LPRA 4Q6HA 4OGXA 1YPJH 2CMYA 4LK4A 2VVVA 4NIXA 5SGAE 1F5RA 2PHBA 4H6SB 4Q2PA 3A7WA 4K8BA 2KOHA 4A92A 2GZ8A 2JILA 1G32B 2DB5A 1O2ZA 4JOFA 1A61H 2OPGA 2EGOA 2JIKA 2HNTC 4OS5A 2ANYA 2A5IA 2ZQ2A 1GPZA 1A46H 2FPZA 4RSPA 5GIBA 3DCLA 2VWRA 3P70B 2ZGBH 1CU1A 1TRMA 3MFJA 3TH2H 4JZEH 6GCHG 4XHVA 1BZXE 1MTNC 5I25A 4FGMA 1PYTC 2IJD1 1JOUB 4JK6A 3OTJE 3RLWH 2OSGA 3VB6A 1O5BB 1VGCB 2YMSB 1W10U 1D3QB 2P93A 3UUZA 5A0CA 1W0YH 2ZDLA 4DT7B 1NRNH 3SV9A 1ZGIA 1GHXH 2STBE 1O5GH 1ANEA 2QIQA 3O5NA 4ISIH 5A8YA 3LNXA 3SNDA 5HKKD 1ESTA 1QQ4A 4K78A 1Z1IA 1YC0A 1VAEA 2XC0A 2GEFA 5A2PA 1K32A 1A5HA 1ZJKA 1K2I1 4X1SU 4VGCC 4BANB 1GG6C 2ZPRA 4ABHA 2FS9A 2SFAA 1TX7A 2GMTB 1TIOA 2SGAA 1C1PA 2P8OC 2QC2A 2V35A 1Q3XA 1TMTH 2FZZA 2ZTYA 4I8KA 5HFDA 4E3BA 2FOGA 1GBDA 1HBTH 3MHWU 4CRDA 4WMEA 1QL8A 2GX4A 2O9QA 3M5OA 2WHXA 1V2RT 4WMFA 3GCTF 3ZZ4A 3M37A 5HXFA 1Y8TA 1BBRH 1UEZA 1C5NH 2R3YA 1MABB 3E91A 3F9FA 1F5KU 1TNLA 1T4VH 4R8TB 3DT0H 3DJ1A 3TK5A 1GJ9B 2O8MA 3GY7A 4DJZB 4DT4A 1TRNA 1BRCE 4AZ2B 2R3UA 1C2KA 3RMNH 2GDDA 1ZHMA 1ETRH 3CBZA 3MOCA 1BFEA 4R0IA 1A0JA 1AZZA 5F3XA 4Y7BA 1MFGA 1FY4A 1DLKB 1Z87A 2Y6TA 3SGAE 4ABEA 3RXAA 2EAQA 1O2YA 1AB9C 1OWIA 2VB0A 3BG4C 3HK6B 3A89A 1EUFA 1GJ4H 3LC3A 5JBAS 1SHYA 3PWBA 3Q77A 1G30B 1SVPA 2RG3A 3ENSB 2OCSA 3TGIE 3QDOA 5E0JA 4Y7AA 3OU0A 1XMNB 1ESBA 1FXYA 4ISHH 4WXIA 1C2MA 1KXCA 2BXTH 4B6FA 3SU4A 1BJUA 2J9NA 2C8YB 2FI5E 2AEIH 2PUXB 2YTWA 3EA9A 4K8YA 2FMJA 2I6QA 5FPSA 1K21H 1DWCH 2X7ZA 1C1MA 1EZXC 1E35B 1IAUA 3EQ0H 3MH4A 2D92A 3SGBE 3A82A 4J2YB 1LPGB 4UU5A 1KDQB 4ACBA 3TJUA 2HLDD 5DK1A 1C5QA 4ISOA 3SHCH 4INKA 3VXFH 1W0KD 1QJ1B 2L4SA 2AH4X 1K1OA 4D7FA 5E22A 1GJDB 1HAGE 2ZWLH 1O3HA 1G2MA 3ZZAA 1IHJA 2AS9A 1TNHA 5EG4A 3BEFB 1CHGA 1KTSB 1W8BH 2FLRH 1N8OC 1GHAG 1EXFA 4NMVA 1FY8E 5C0TA 2ZDKA 2DMZA 2L97A 3QJMA 4CRFA 2ZGXH 4FUDA 3KCGH 1EATA 2BDYA 1WI2A 4SGAE 4FOUC 1GHBF 5EPNA 2H9HA 1V62A 2KA9A 2BLOA 1GBTA 1BIOA 2THFB 5DP3A 3RXBA 1Y3UA 3LONA 2P8OB 1A7SA 3HKJB 1V1TA 1KYNA 1YLNA 2QKUA 3JXTA 2ZHQH 3QUMP 2ZZUH 3GY3A 1ARCA 2PSYA 3LGVA 2F9OA 4Y0ZE 1RGRA 1BTYA 4GSOA 1VITG 1GBJA 2Q9VA 1ELDE 1AIXH 1F2SE 5CHAC 5FCRA 2Q1JA 2AHME 1AFEH 1O2IA 2AGIX 3PB1E 2FX4A 3T2NA 1BTWA 1FIWA 2KAIA 2YMSC 3NFKA 4CH2B 2IPHA 2GVFA 4NMSA 2BHGA 4U30A 4I8JA 2BD3A 2BLWA 2NU3E 3DSPA 1O5EH 1V2JT 1X8SA 2QV1A 3NFLA 3KHVA 5HIZA 3O8DA 5HMAA 2BOHB 2ZGCA 4B73A 1FPCH 4O3UA 4BOHA 2LC6A 2BD8A 1CO7E 4H42U 3LGUA 5AVDA 2VSVA 1GCTB 2VIWA 3CC0A 3ZZ7A 4Y8ZA 1YLCA 1W9QA 1IQLA 1Z1JA 4YDPA 1CBWC 1NRPH 2CF8H 4GPGA 1TBZH 2H9EH 2G5MB 3DA9B 4GCHG 1TQ3A 2G55A 1DFPA 1ANBA 1ESAA 3A81A 2OTVA 4TT3D 5F53A 1NTPA 1SQAA 2I0LA 1RGQA 1G9IE 2QXJA 3C27B 1DM4B 4LMMA 1XXFA 2ZFPH 4J1YA 3U1JB 3RXRA 4GAWA 3DJ3A 1BMAA 2BXUH 2TRMA 3SBKA 3EGHC 3E0PB 2BZ6H 2FESH 1Y5AT 1YPGH 2FEQH 1S84A 4BXWA 3SJ8A 2GJGA 1MZDA 1PQ5A 3FFGA 5KECA 3ZZ5A 3TJNA 3UR6A 2M3MA 3RL7A 2OK5A 3EAJA 1KLIH 1GMHG 1J9CH 1C1WH 4I33A 5JDUB 3AXAA 2Y5GA 5E8EH 5DP9A 1C2LA 1ZLRA 4P0CA 4Q63A 2KG2A 1UMAH 5JPMH 1KDQA 1WF8A 4YYXA 1XUFA 1W14U 1P2QA 2WPHS 1SQRA 4ZHLU 3R0HA 3ATKA 1ABJH 1IOEA 1PDRA 2BDBA 1N7EA 1UCYH 1TNIA 2F43B 1P2KA 1O2XA 1SI5H 1GGDC 1QBNA 1AE8H 3I77A 2Z3EA 3GCTG 1GHVH 1IHSH 3BIUH 1C2GA 5TCAA 5DTHA 1V2VT 2P3WA 3UFAA 1UJUA 1X5QA 3PO1B 2EEJA 1P2OA 1SGNE 1RJXB 3VGCB 1O2PA 5GXPA 3SV8A 3VB7A 1TNGA 1FY3A 3BTWE 4CREA 1EX3A 4YOGA 1G36A 1GMDF 1N7FA 5B42A 1CA0C 5JBTA 2KCPA 1UW7A 1SOTA 2KV8A 2KAWA 2UWPA 1DITH 8GCHF 4HI3A 3NK8A 1WFVA 1H8HD 1ACBE 2BVRH 2Z9GA 4E06H 3BF6H 1CT0E 3LGTA 3W95A 4Y76A 1TRYA 4XRNA 2CSJA 1O3KA 1BITA 1MU8B 3MNCA 1SPJA 1L4ZA 1KXFA 1RIWB 1WBGB 4TPYA 1JRTA 3SUGA 1CT2E 2CN0H 2KFWA 3SJOA 2BVXH 3QX5H 3SJKA 2AIPA 4DG4A 2V90A 4UFGH 2C8XB 2OUAA 4DW2U 3IWMA 2PW8H 1NF3C 2ZPSA 1V2WT 3PTNA 3WWBA 2W5EA 1QRZA 1OWJA 1TOMH 3VFEA 1SGQE 1GQ5A 1EP5A 3LNYA 5FHTA 2ZFTA 3VXEH 5LPRA 2FWWA 1EPTA 3KDGA 1GMDG 1EAXA 2QF5A 3LGWA 2TBSA 1O5DH 4ZCNA 2UUYA 1HCGA 4B2CA 2JH6D 1AFQB 4CR5A 2K1QA 2WV9A 1VB7A 5JXBA 4Z33A 3AVZA 2ILNA 1GI2A 5HIYA 2QXIA 2JINA 3K50A 2JOAA 4E35A 2BB4A 2BQ7B 1HYLA 1E0FD 4JYUH 1L2EA 1P12E 3SUZA 5C20A 1GBAA 2R4HA 1R6JA 4ABIA 2IWOA 2DLSA 1C4Y2 3SZNA 1MKXK 3OFND 1TP3A 5F67A 3LH1A 1P9UA 4FETA 3VQFA 1KXAA 4SGBE 2BYGA 4DY7B 4YM9A 4NG9H 2FOAA 2H2BA 3RXPA 2JREA 2GP9B 1GQ4A 2BDGA 5G1DA 1MTVA 1AU8A 4AORA 1SQTA 3SQEE 2EEHA 1RTFB 2A5AA 1OWEA 1MD7A 3N99A 3KDKA 1PJPA 2PFEA 1C9TA 3SFJA 3QGLA 2GCTB 3MO9A 5T6DA 1O34A 1D3TB 5C5OA 4E7RG 5E1YA 5GNDA 4JOJA 2J4IA 3L3TA 1XKBC 1VITF 3SHAH 3HPKA 1I92A 2Y80A 4KFVA 3MH5A 3BTGE 1OWHA 2FYRA 3TGKE 2W3IA 1UEWA 4NXPA 2C93B 4P2AB 1TQ7B 1W11U 1D5GA 3RXFA 3LDXH 1ABIH 4IGDA 1NZQH 3OE7D 2ASUB 3U8RH 3SUFA 1RTKA 1OX1A 2P3FH 2YMSD 2ZHFH 2ANMH 4ZKNU 4UU6A 3PS4A 2VIDA 1UTOA 5IL9A 3TH4H 3F2GA 4NSVA 3GCOA 1H9HE 4IW4E 2IN2A 1ELFA 3RMMH 1ZRBA 2I4SA 1BRBE 1VZQH 1O3AA 3RXQA 5L30H 4JMYA 3DSGA 4AYYB 1CT4E 4P00A 2GCTC 5JBBS 3DORA 2HVYB 1EOLA 2TGDA 1C1UH 4FVDA 2KZ4A 4IN1A 2VRFA 4MDSA 2QXHA 3FZZA 2EV8A 1O3NA 3W1EA 1F7ZA 2Q6GA 4NZLA 5JBCS 3V0XA 1GI3A 3T28A 1GMCG 4KTUA 5HFCA 2VZ5A 3KGPA 4FVBA 1J8AA 1XX9A 2WZQA 1GBCA 2SGPE 1T7CA 3PDVA 2PNTA 4AFQA 1ZSJA 3PDZA 4UFEH 2Q3GA 1X7AC 2WPIS 4AMHA 2KJDA 3UREA 2PKSC 2PTCE 2QBWA 3CNRA 3K6YA 2XRCA 1GVKB 1IQNA 2WPJS 4AFUA 4Q4LA 2I1NA 5TCCA 1SGPE 2EHRA 3RMLH 2IWPA 1J16A 2EQNA 4JL7A 2GT8A 3OEED 4WVPE 5F8ZA 2A4GA 2I6VA 3JZ1B 1N7TA 1ZTLA 4HGCA 1ZHPA 2OD3B 4D7GA 2BD4A 3LPRA 3LKWA 1NY22 2AMDA 3T62A 1BTZA 1C5VA 1LMWB 3TLOA 3ZZ8A 1GI9B 5E6PB 1KY9A 2ZKSA 3FP6E 3TU7H 1HAIH 2W7RA 2AFQB 1A0HB 2Y82A 2DAZA 1O2LA 1C2DA 1FMGA 3S9BA 4B2AA 2J97A 2OLGA 3I4WA 2EI6A 3NUMA 1OZIA 3PMAB 1GHBG 1SL3A 5B6LA 2SGEE 2Y7XA 3KYGA 5C1XA 3A86A 1OBXA 3GOVB 8GCHG 4BAOB 1ELTA 2J98B 1GI7B 4CRCA 1WHAA 1PPGE 2A0QB 1FN6A 1AZ8A 2PWXA 5GCHG 1C2FA 1O32A 5BPEA 3RU4E 2W26A 4Q7XA 2REYA 4KGAA 1DVAH 4TWYA 3GY5A 3LIWA 3H7TA 1S5SA 3KQ5A 4YESB 4RKOB 2KCOA 3F9HA 1HV7A 1U6QA 4G69A 2XNDD 1UEPA 1TGTA 2F3CE 1QFKH 4HFPB 4NIVA 5GCHF 4DVAU 1K0HA 2JETC 4RT0A 2J95A 3ZZDA 4U01A 4XOJA 7ESTE 2AMQA 3E6PH 2O2TA 1DANH 1P2MA 3BTDE 3RXHA 1AHTH 1GDUA 4AFZA 3B9FH 3S0NA 3S7KB 1S85A 1FC9A 4OM9A 4ZMAH 4K1TA 4BXSA 1RZXA 1L0ZA 3A83A 2A4RA 2G5VA 1F0RA 2M5TA 2EGNA 3VGCC 1EB1H 1YPKH 1DSUA 4E34A 2EDVA 3TJOA 5C0UA 3P6ZB 2M0VA 2PP6A 1N1LA 1EASA 3ZYDA 1AO5A
chains in the Genus database with same CATH topology
1B8QA 1DX5M 1SGRE 1GGDB 3D62A 2UUKB 2SGDE 2ODPA 2Y5HA 3F68H 3LOXA 4KTCA 5G4BA 1K28D 3M5MA 4X8VH 2BQWB 2EDZA 1MTWA 3PV4A 1P1DA 5HFFA 2EXGA 1NS3A 3KQDA 1UJVA 1HRTH 1O3PB 4PROA 2HPPH 2NWNA 5EW2H 2BYAX 1BDAA 2J38A 3ID3A 4GHTA 2BY5X 2HWLB 3KIDU 3Q3KA 2ZNKH 3F6UH 1QB6A 1YBWA 4XE4A 1SFIA 1TNKA 2RCZA 1SGFA 1HPGA 1TPSA 2FODA 4F49A 1PPZA 4BAKB 2C8WB 5F8TA 1QJ6B 3E0NB 1QRWA 3T29A 1WI4A 3E17A 1UTQA 1NFXA 1ZSKA 3SW2B 1TA2A 2OBOA 4U32A 2PKUA 1SGYE 4NWLA 1O2WA 2K20A 3ZVCA 1MKWK 3SNEA 2KOJA 4WYTA 2ANWA 1TLDA 4CBOA 1NFUA 1EAWA 5EW1H 1C5YB 1C5WB 3U9AH 1C1VH 4GCHF 4UE7H 2ZCLP 1QA0A 3RXGA 5C67A 2G5NA 2OQSA 1C2JA 4WF8A 1UF1A 1FAXA 1MKWH 2EJYA 3A7VA 2FXRA 1GDNA 3AAVA 4JZDH 2OXSA 3AW0A 2STAE 3PMBB 5AFZH 2G81E 1GI4A 1O2JA 2C8ZB 1UJ1A 1FQ3A 2E7KA 4ISLA 3A8DA 5FCKA 2BY6X 1ZYOA 4Q7YA 1Z8RA 3P8NA 3RUOA 1P01A 1XKAC 2TPIZ 2LOBA 1ELBA 2D8WA 1QIXB 3BTFE 4Z0KA 2BTCE 3MNBA 2BDHA 4K72A 2GDEH 4LOYH 3BTEE 3GICB 5FPYA 4B75A 1O3LA 5C3NA 4X8TH 4XDEA 7GCHF 1FV9A 1AKSA 2NU4E 1SFQB 2GV6A 2FNEA 1LKBA 2H2CA 4XBCA 1FY5A 1B0EA 3U1IB 2J2UA 5DP8A 1IU2A 3BSQA 2FE5A 1BRUP 2WPKS 1HJAB 4ABDA 1AMHA 1ELGA 3BTQE 3RXMA 1AWFH 2OC8A 1VCPA 5LGOA 4A6LA 1QB9A 1TNJA 1NO9H 3SQHE 1BT7A 2RA3A 2O8LA 1WIFA 1MCTA 2V0BA 5DPAA 4R2ZA 1TFXA 4Y79A 2SNWA 1N6EA 1VCWA 2ESTE 3SUEA 2WL7A 1GBKA 1XVMA 1O3MA 2M10A 3KQBA 1TALA 2YNBA 4NGAH 2HE2A 4B76A 3MWIU 1N8OB 1XUHA 2ODQA 4A1XA 3P8OA 1YCPK 2ZU4A 3VB4A 1Y59T 3GY2A 4ZUHA 3A8AA 2FYQA 3K6ZA 2AMPA 4A5TS 4FU7A 1CHOG 2FI4E 3V12A 4NMQA 1EAIA 2M0ZA 3HK3B 1EP6A 1BUIA 1HAVA 3HPMA 4WH6A 4NSYA 1Z8IB 4Y8XA 5ILBA 1OXGA 1LQEA 3DD2H 2PTNA 1OP8A 4JORA 2A2QH 2G8TA 1K1MA 1TGSZ 1YCPH 4D9RA 4NMPA 1WF7A 1WV7H 3ATMA 1TPAE 3QLPH 2UZCA 1L1NA 2KRGA 1JMOH 5HYOA 1O3OA 2C3SA 2CJIA 1ELVA 4JYVH 1T8OA 4AGKA 1P3CA 1ELCA 1QA7A 5EYZA 3UWIA 5FB8C 4NMRA 1O2UA 4FUJA 1XUGA 4IS5A 1HAOH 2ZFSA 2CV3A 2G00A 1K1LA 1ZGVA 1TAWA 5F03A 2AWXA 2LA8A 3E3TA 1ZRKA 4NNLA 1YKTA 1A2CH 3MTYA 4B2BA 1CGIE 1WTGH 4DIHH 2ZC9H 4E7NA 2KL1A 1Q31A 1ZPCA 3QIKA 4ABGA 2A7CA 3LH3A 5ETXA 5A09A 2EEKA 2L4TA 1WHDA 1YBOA 3V3MA 3ZV8A 1UTMA 1TE0A 2HGTH 2FM2A 1U39A 2XBXA 2CSSA 3SV7A <