3MH4A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
343
structure length
301
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 57
structure length 301
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A01
1O5DH 3RP2A 1PPGE 1T4VH 1V2WT 1K21H 4B75A 2FO9A 2WPIS 5HFDA 4AB8A 1RJXB 4K8BA 4YDPA 4YOGA 1CVWH 1UFXA 3MO3A 4D7GA 3AASA 2CJIA 2O2TA 2FESH 3QWCH 1VR1H 2SFAA 2PHBA 2PTCE 1V2ST 1QQ4A 3SGQE 1NZQH 1AGJA 1HBTH 1TPAE 1MUEB 3QX5H 3UNQA 3PDZA 2ODQA 1ELDE 2A7HA 1C4U2 3M5OA 2GMTB 2KBSA 4Y7AA 1WG6A 1RS0A 1XVMA 1FZZA 3NZIA 2M0VA 4JOFA 4K60A 2VPHA 1MQ5A 3SGBE 2G4TA 5TCCA 1BHXB 2P59A 1C1WH 4IN1A 2OZFA 2ZDAH 3RXGA 2R0LA 3Q3YA 2PKAA 1A5HA 3BF6H 1S85A 5E0GA 1UVTH 1YCPH 1O2RA 2C93B 2HALA 4KFWA 1O2TA 1X5NA 2P8OB 3SJ9A 3CC0A 2C8XB 2IPHA 1O2SA 1OWKA 3T2NA 1GMCG 1W0ZU 1W7GH 2EJYA 3PTNA 4MNVA 1IQGA 1NRRH 4WF8A 4K75A 3ZZ3A 3ZVFA 3DA9B 2CF9H 1A1RA 1TA6A 1NFXA 3SJIA 4TWYA 4CR9A 5A8ZA 1TA2A 1AE8H 4LK4A 2PNTA 1TQ7B 3PV4A 2P3WA 1QBOA 1N8OB 4K2YA 2J95A 2JREA 1NRSH 3UY9A 1X5RA 1GI1A 1O3DA 3QN7A 3S0NA 3RDZA 3DFLA 4FUCA 1KXDA 2BYGA 1O3OA 5E22A 2XWBI 2BD5A 2QAAA 2B5TB 2DAZA 1D5GA 2Y5GA 1BITA 1E38B 1ETSH 2QXHA 1C1RA 2ZHQH 4INKA 2OC7A 1CA0B 3PWCA 4WY3A 5E1YA 3SNAA 2AMDA 4J2YB 3NK8A 4PQWA 4AB9A 3I78A 1TNGA 2V0BA 5C5NA 1LKAA 3A89A 3LONA 1YKTA 4HGCA 4A5TS 2ZP0H 1EZSC 2OINA 5GLJA 4FUGA 1D3DB 1ORFA 1CE5A 2A4RA 2D26C 1C2JA 1SFIA 1UVPA 1ZMNA 2HRVA 2VIVA 3MOCA 1FMGA 1L1GA 1THPB 3A86A 3A80A 3RXTA 2OTVA 3BN9A 1NF3C 2J9NA 2F83A 4NA8A 2KAIB 3RUOA 4NXRA 2KPLA 4Y6DA 1QJ1B 1W7XH 1G9OA 1C5UA 1HAOH 1TPOA 2PA1A 1C5XB 3FANA 1L4DA 3C27B 2BM2A 3RXBA 1DITH 5EW2H 4E7NA 2GCHG 1AB9B 2FOEA 4X6MA 3SFJA 3VB6A 5J4SA 1SGIB 2SGDE 4AGKA 2V3OH 1C2FA 2PFEA 4WYTA 2EEJA 2M3MA 3NGHA 1MKXK 2YT7A 3DT0H 5HM2A 4XHVA 3ZV8A 1HJ8A 4ZAEA 3DD2H 1QLCA 3QJNA 2LOBA 5HF4A 1MU6B 1C1UH 3D23A 4D7FA 1LVMA 2K20A 2SGQE 4NIXA 1OOKB 2BLOA 2JIKA 4NIVA 4CHAB 2H9HA 1MD7A 5DP5A 1TOCB 3LGVA 1C1QA 3A7VA 1ELCA 2ZHEH 3GDUA 3GY4A 1C1TA 3BTHE 3S69A 1O3IA 2STAE 1C4V2 3OSYA 1GGDB 1EATA 2BDHA 3RXKA 5G1EA 1QA0A 5JPMH 5A09A 2OPGA 1BJUA 1RTKA 2VH0A 1ZJDA 1J16A 3M5MA 4ABEA 3SN8A 1SGCA 4KGAA 2AS9A 1IQEA 1WV7H 1V2RT 1N6EA 1MZDA 2A45B 4MNXA 3SOSA 1CGHA 3VGCB 5HFCA 4BNRA 2SGAA 2G8TA 1P2NA 3E91A 3UOPA 3UQVA 1AZZA 2VVVA 1OYQA 1A5GH 1T4UH 2Y80A 1NC6A 1G9IE 4HOPB 1G36A 1QR3E 1TGCA 4WMEA 3LGIA 3CYYA 1O2GH 1XM1A 1XMNB 2PKTA 1ZHMA 1NS3A 2KV8A 1O2YA 1AY6H 1Z86A 1QRZA 2LUIA 5A8XA 2G4UA 1P03A 1O34A 2EDPA 2KG2A 4JMYA 1Y5BT 1ZGIA 5AHGH 1F7ZA 4UONA 4Q7ZA 3TSWA 1RIWC 5HFEA 1FY8E 1O5EH 2FNEA 1UHBB 2C8WB 4A1VA 1WH1A 1MFGA 3E0NB 3BIUH 5EW1H 3M5NA 2GZVA 3O8BA 2ZIQH 1OP0A 1Z8GA 4ISIH 2BY9X 4X6NA 1XUGA 4K5ZA 4ZROA 1UJ1A 3A8AA 4UU6A 1GL1A 2VIOA 5EZ0A 1KXAA 4ZKRU 2XC4A 1HAHH 2AWWA 5EQRA 1V1TA 2SNVA 2EV8A 1TBZH 1Z1JA 1Q3PA 3TJOA 3DUXH 3NCLA 3ZZ8A 1WTGH 2C4FH 2YUYA 1ESAA 2FEQH 3ZRTA 2VWOA 4MPXA 1O3JA 4Q80A 5EPYA 4UFEH 4GHQA 2WV5A 2QBWA 2O8WA 1BZXE 1MTNB 1T7CA 1KXBA 3A7XA 3SUZA 1OWDA 1IU2A 1G3DA 1QY6A 4Q7YA 3V3MA 2BHGA 1ABJH 3P8GA 4NMVA 1AQ7A 1PFXC 1GG6C 3BTQE 3GY2A 1MTVA 1J15A 2FOCA 2QXGA 1KEFA 1DWCH 1MKWK 1Z7KA 1IHSH 1Y7NA 1WBGB 3FP8E 4FVDA 3IG6B 3RLEA 4MLFB 2WPLS 2FOAA 5B6LA 2VZ5A 1P3CA 1NM6A 5A8YA 3EAJA 4RSPA 1ZPBA 3RU4D 1GJAB 4NGAH 2J4IA 2FOHA 3I1EA 2UWLA 3KL6A 3PWBA 2L97A 2PV9B 3A85A 5EYZA 1IQHA 5EG4A 1PPBH 3GCHB 1EAIA 5ETXA 1ANDA 3EDXB 4PROA 4K78A 4BXSA 4NMTA 3U1JB 2BD8A 4CH8B 1U37A 5HFBA 1QURH 2AYWA 1ELFA 1EASA 1UVOA 1E0FD 1VB7A 2TGDA 4AGJA 3B76A 2WPMS 4VGCC 3LJOA 3QIKA 4NMRA 1ZHPA 1RFNA 3FP7E 2HGAA 3EYDA 1LMWB 4JK6A 1C2EA 1HLTH 1S6FA 4XDEA 2GZ7A 3MMGA 3RC5A 1UITA 1DVAH 1DLKB 4REYA 2JH0D 1BTXA 2OCVB 2Y7ZA 3LNXA 2A31A 3SW2B 2XXLA 1H9HE 1TALA 3QZQA 1KYNA 3BEIB 3EE0B 4Y71A 1VITH 2G5MB 1O2XA 4Y10E 2BLWA 1BBRH 2BXUH 5K7RA 1OKXA 5LPEA 3OYPA 1X7AC 1QJ6B 3K6ZA 1UMAH 4I8KA 3ZZDA 2VWNA 3RMOH 1UEZA 3T27A 1IQJA 3RXMA 5GDSH 1QJ7B 1DY8A 1O3NA 2A2XH 3KQBA 3TK6A 4I7YH 2FYQA 2GDDA 4ABHA 1IU0A 1O2WA 3S7HB 2B9LA 2A4QA 4X8TH 2GKVE 2W26A 3RC6A 1F0UA 2ZFPH 3E0PB 3GY3A 1L1NA 3O46A 2KOMA 1F5KU 1O31A 4FUBA 3MU0A 1QNJA 1UTJA 4NCYA 3TGIE 3W95A 2ZF0H 1C5ZB 1OYTH 2EXGA 3RXFA 1LVOA 1O2NA 1NRNH 4Y8XA 2QYIA 5J4QA 4NIYA 4F8KA 1DICA 1X8SA 1WI4A 1BTUA 3ZZ9A 1W13U 1MTWA 3UREA 1DDJA 2FS9A 3KCGH 3ITIA 2ZHDA 4X1NU 1L0ZA 2QIQA 5C1UA 6LPRA 6GCHF 1QBNA 3JZ1B 1SGQE 2V6NA 1PPFE 3BTDE 5LPRA 2VSVA 5IYTA 4XE4A 2D1JA 1G30B 1VJAU 3BTGE 2DKRA 1JIRA 3T62A 1MTUA 5HEBA 1ARCA 2EA3A 4B74A 2OUAA 5C20A 4NA7A 2Y5HA 3BG8A 5EQSA 2Q1JA 1ZZZA 2ZCKP 2ZDLA 2STBE 1K1IA 4KP0A 1IQIA 1FXYA 1MBQA 2DUCA 3EQ0H 3I4WA 3RXDA 5L2YH 2MHOA 1CO7E 3GCTF 2YOLA 1OBXA 1C5OH 2ZI2H 2JWEA 1QL8A 3QUMP 4GVDA 1G2MA 3RXSA 1KXEA 6CHAC 1GQ4A 3A7TA 3ATMA 3K1RA 1TONA 2HNTF 1CQQA 4GPGA 2K1ZA 2G00A 4AFSA 2ESTE 1F5LA 2ODYB 3AXAA 1B0FA 3E6PH 2EI7A 1E35B 1GI5A 4K1SA 1O3KA 1YP9A 2FOBA 2ZPRA 2FYRA 1HDTH 2WPHS 4KTCA 2I6QA 2VGCC 2ZA5A 2W5EA 1VA8A 2UUJB 1BBRE 4R8TB 3TMHA 2M10A 3E8LA 2BD9A 5T6GA 4MG3A 3UOUA 1GI8B 1HB0B 1ZRBA 2XYAA 4ABBA 3GDVA 1DWDH 5F6MA 4RI0A 4Q6SA 4AG2A 3SBKA 1RGQA 1AUTC 2H1UA 4OS4A 1DY9A 1GBMA 2ZZUH 2KQFA 1GBCA 3SV7A 1GMHF 1OZIA 3SZNA 2A1DB 1BTHH 1O38A 1FAXA 1K28D 2RDLA 5T3HA 2ZU3A 1AKSA 2BD2A 5ESTE 3PV2A 3KQEA 2DJTA 3VB5A 3TLOA 4QT8C 2CHAB 1GJDB 6ESTA 2XBXA 4O9VA 4NMQA 3T29A 1OWHA 1OSSA 4OGXA 4TY6A 2I0IA 1SGRE 2W7SA 1FPCH 2ZU4A 4OGYA 2JETB 1O3BA 2EHRA 2PUXB 1UM7A 3M7TA 1VJ9U 1UTPA 1IOEA 1BMAA 2C8ZB 3JXTA 1TPSA 1CSOE 1Y8TA 3T28A 3LU9B 4ZHAA 2R0KA 3HKIB 1ELEE 1DSTA 3P8FA 1UHPA 4WWYA 1WHDA 1G32B 5T6DA 1GWAA 1SLWB 3SJKA 2I04A 1O3FA 1V2LT 1BHXF 4DURA 4I8LA 2VVCA 2PW8H 4H42U 1E37B 3PS4A 3SU4A 1GI9B 1P2MA 1K1NA 5FPSA 1C5NH 2R3UA 2ASUB 3RXOA 2J94A 1A4WH 1KY9A 1GI6A 1L6OA 2EGKA 4TYDA 2FTMA 4O3TA 2KJPA 5EGMA 2ZEBA 2VRFA 1VZQH 1YCPM 1P2KA 3SU6A 3TK9A 1YPHC 1HNEE 2A5KA 4MPUA 2VIPA 1MAXA 2AGEX 4YOJA 1KIGH 4JOHA 1S83A 5DJ7A 5HEDA 1LTOA 1SGPE 1HV7A 3BEFB 1AN1E 1OXGA 1N1LA 2A0QB 1LHGH 4WYUA 1BIOA 4KKDA 1C4Y2 1MQ6A 4AMHA 2E7KA 2QXJA 2C90B 2H2ZA 9ESTA 2F9NA 1GBFA 1R6JA 1KLTA 5FAHA 1HUTH 1GJ5H 4LMMA 4NZLA 2MX6A 4TY7A 5DGJA 4HTCH 3CP7A 3TNTA 1EPTB 1WYKA 4I32A 3P95A 3F9GA 3O5NA 4X2XA 4CRGA 1IQFA 1GI4A 4Q6HA 1SFQB 2GX4A 2ANMH 4NWLA 1MU8B 1S0QA 1SLXB 2SNWA 4CRCA 1ZLRA 4ZXXH 2BVSH 2YTWA 1Y5UT 1YPHE 2AMPA 3RMMH 2Z9IA 4MTBA 1C5MD 1RTFB 1EUFA 3IITA 3U98H 4INLA 3P8OA 4BTUB 5FCRA 4B76A 4E7RG 2QC2A 1NFYA 4JZ1A 1SGFA 4YT6H 3ZV9A 3NWUA 3MU1A 2Z3DA 3L33A 1C2KA 1VCPA 3UWIA 1WOFA 1KXCA 2CGAA 1UEPA 1C5VA 2PLXA 3FP6E 4NWKA 3SNEA 2PKSC 2ZQ2A 1BTWA 1OBZA 1GCTC 1S81A 1EJNA 1SG8B 2DE8A 2QY0B 2KRGA 4AZ2B 4IBLH 1P2QA 3ZZ6A 2A7CA 1ABIH 5L6NH 3FZZA 3Q00A 1ARBA 3M35A 1PPEE 2AGGX 1SGEE 1DX5M 1C5TA 3F9EA 1TMBH 1P1EA 4MPVA 1O5FH 1V2VT 3BG4C 2BVXH 1GBBA 3K9XB 2HVXA 2OMJA 2GZ8A 3U1IB 1ZMLA 2ZTXA 3HKJB 3UTUH 1N99A 1SVPA 2GCTC 5HGGA 3I29A 5I25A 3F9FA 3QTOH 1RGRA 2AWXA 1JRSA 2FODA 1TOMH 1TP3A 3DJ3A 1DFPA 3LJJA 2VINA 5L2ZH 4WJG2 2R4HA 1V2QT 4YYXA 3NXPA 4UD9H 2WPKS 4CRAA 1GI0A 1ETRH 3SU3A 1FN8A 4G69A 3MWIU 3GCOA 1VGCC 4GSOA 1CHOF 2ZO3H 5CHAC 4GHTA 3LNYA 1GI2A 1OX1A 2BD4A 4TPYA 3GJ9A 4OS6A 2A5IA 1V2KT 4D9RA 4WVPE 1BTYA 1O37A 5GPIB 4A92A 2WINI 2VJ1A 3UIRA 1O2VA 1TNLA 3RXAA 3TGKE 3I77A 3PMAB 4Z8JA 2BLQA 1BA8B 1N6DA 3R3GB 1ZMJA 2OQ5A 4CRBA 2H3LA 3PO1C 2A4GA 2F9OA 2H9EH 2QA9E 4Q2KA 1C2GA 1ZTLA 1O36A 1HAVB 4JOEA 2AEIH 5F8TA 1ACBE 4BOHA 5CE1A 1QAVA 5L30H 2XW9A 1QRXA 4NFFA 2QT5A 3P92A 3AAVA 4RN6A 2BDIA 3PLPA 3HGPA 4AYVB 1SR5C 1CBWC 1QRWA 1WUNH 3LGWA 3TJUA 2I1NA 3MU8A 4WH6A 4A1TA 5PTPA 2ZFRH 1W11U 5EPNA 1EZXC 2ZHWH 1W9EA 1IHTH 2QF0A 3GY8A 1FLEE 1MZAA 5F8ZA 2OQSA 4WMFA 3TH4H 4XOJA 3ID2A 1P02A 6GCHG 1SPJA 1VAEA 1K1LA 2FZZA 2KL1A 2TGTA 5GNDA 2P3UB 5ABWA 1TMTH 1Z8IB 3MNXA 4F49A 4DVAU 1UM1A 1ZPZA 3M36A 1YM0A 2ZECA 1Q2WA 1VJ6A 4M7GA 5SGAE 2KAWA 2OC8A 1BBRK 3MU4A 1HJAC 5C67A 4AN7A 1KTSB 1QCPA 2ZDNA 5DO4H 4ZKSU 3VFEA 1NTPA 3ENSB 1A2CH 2NU4E 1O2KA 2GZ9A 3HATH 3B9FH 3MO9A 2RRMA 4ABAA 1UTNA 4WXVA 1LPGB 2ZTZA 2IOTA 4Q2QA 1BE9A 1CA8B 4JOGA 2BQ6B 3V0XA 1N7TA 2F9PA 1GBHA 1EB2A 2CXVA 1GBIA 1MCVA 1Z8JB 2H5DA 1EPTA 4A7IB 1DUEA 1XUFA 3SUDA 1FQ3A 1GJ4H 1C2LA 1UTQA 5EQQA 3DIWA 2PSYA 4OEOA 1F0SA 3A7ZA 4XBDA 2Q9VA 3KF2A 1O2JA 3OY5U 1GQ5A 3M61U 3RXPA 3RLYH 2UUYA 3GY6A 3UUZA 4K1EA 1C5YB 1OP2A 1GMHG 1NN6A 2GD4B 5JBAS 1ANBA 1XUHA 1O2ZA 1P12E 2OCSA 4IMZA 5GJ4B 1EP5A 2FPZA 1K9OE 3L3TA 4XFQA 4DJZB 1PJPA 1I16A 1GJBB 2PWXA 1X6DA 3QE1A 2JH5D 3LIWA 3EA7A 1MBMA 3U8TH 1MMJN 5CMXH 2K1QA 1O2PA 2EEGA 2L4SA 1ELVA 3A82A 3TH2H 2ZTYA 4WMDA 2Q6GA 2PR3A 2OSGA 2OS6A 3S9AA 2EDVA 1HIAB 2PGBB 3QO6A 4FUDA 2P3FH 1PYTC 1IHJA 3AW0A 2ZC9H 5FPTA 2Z9GA 2ZGBH 2ZPSA 3M3SA 1HAIH 1OWIA 1ZSKA 4GVUA 4I8JA 1TYNA 3UPEA 4ISLA 2QKUA 3TIUA 2DMZA 2G2LA 3EGKH 1V5QA 1UJDA 3BIVH 3RXRA 5H3JA 2VB0A 1ANCA 2ZFFH 1MFLA 1C9PA 1C5LH 5HM9A 1LKBA 1A46H 4K1TA 3RXCA 1UCYE 2DC2A 1W2KH 1FY5A 4BAOB 1FV9A 1P9UA 1O3MA 2H6MA 4YOIA 3HPKA 3QGNB 1G3CA 1RTLA 1Z1IA 3F6UH 2G51A 1P2IA 5HETA 2OLGA 2BZ6H 3BTME 1F2SE 3TPIZ 1LPKB 1NRPH 4ESTE 1O5AB 3DHKH 4H6TA 2P95A 2R9PA 1HRTH 1SL3A 1AKSB 3AAUA 2ZFSA 1GDUA 2VWLA 4O97A 1AFQC 4U2WA 1TABE 4IGDA 3ZZCA 4CRDA 1WF8A 2AH4X 5BPEA 2ZFTA 4Y7BA 2OC0A 1H8IH 1AMHA 3GICB 1PQAA 3P8NA 2LC7A 4X1PU 3R0HA 1GJ8B 2F9VA 4BXWA 2BTCE 2OXSA 4BTIB 1DUAA 4UFDH 4RKJB 1GBLA 1Y5AT 2NU1E 5F3XA 1AHTH 1SI5H 4KTSA 1F5RA 2Z9KA 2YUBA 3D62A 1HAVA 1EAUA 3MI4A 3WKMA 4FUJA 1FUJA 4YLUA 1ZSLA 2THFB 3BTKE 3CS7A 1TPPA 1A7SA 1TQ3A 2ZCLP 1O3AA 4OS1A 4Y76A 2WUBA 2OBOA 3K6YA 1CT2E 2CV3A 1AI8H 1KWAA 1IQKA 4X1RU 3ODFA 1GI7B 2BMGB 2OD3B 1SHHB 3RXQA 8LPRA 4AFUA 1V2PT 2GMTC 4NFEA 1Y3YA 2A7JA 4JZDH 3E17A 2R2WU 1UK3A 3KGPA 3SJOA 1BRBE 4Z33A 4ABGA 2Z17A 4R2ZA 3QTVH 4B2AA 1MC7A 2REYA 1UO6A 4ASHA 1OBYA 1A3EH 3SV9A 5DP6A 1DLEA 2RCEA 1TBQH 1A3BH 2G52A 3ZVCA 3MH5A 2P8OC 2HPPH 3VQGA 1O3CA 1DSUA 1FCFA 4Q3HA 1EAXA 2FOGA 2QG1A 4X2WA 5HJ1A 1YGCH 2V3HH 2BY5X 4MVNA 3U8RH 1NU9A 2ALVA 2XC5A 1CGIE 3SU2A 3OX7U 1E36B 3QJMA 1K22H 4BAKB 3DFJA 3ODDA 3URCA 3A8CA 4DT7B 1O39A 1G3EA 1G3BA 2PZDA 2ZGCA 3FAOA 3LH1A 3NPSA 2R3YA 1CHOG 1KDQB 2ZG0H 4NMPA 3A83A 1CGJE 1N8OC 1VCQA 3LH3A 1A5IA 1O30A 5JBBS 3VB7A 2QXIA 1BRUP 1UJUA 3Q3XA 1L4ZA 3BV9B 5E6PB 4B2CA 5FHTA 2HOBA 4CRFA 2V1WA 3RMNH 3PLKA 1H9LB 2PGQB 1LQDB 1H8DH 1AU8A 1YPMH 1CA0C 1GJCB 1O33A 4DCDA 4DGJA 4UDWH 3ID3A 5E11A 4ZKOU 5HEYA 4NSYA 5JXBA 1C2DA 4P2AB 1V2TT 3M7QA 1C2HA 2KOJA 4I31A 1K1JA 4GCHF 1D6RA 3ID1A 3TSZA 3KNXA 4O3UA 1LQEA 2ZGXH 3DJAA 5EU8A 3A7YA 3WY8A 1DXWA 1TQ0B 4YO9A 4X2YA 2BOHB 3CENA 2Y6TA 1T31A 4FU9A 4NZQA 1F92A 4SGAE 1N7FA 4CREA 3E1XB 1FDPA 2VSPA 4JYTA 5JB8S 4FUHA 3T5FH 2KYLA 4DW2U 1WAYB 4B71A 1C5SA 1AB9C 1O3LA 5TJXA 3ZVBA 1EP6A 3OY6U 2L4TA 1EOLA 1TWXB 1O2HA 2HLCA 4NIWA 3URDA 1M5ZA 1HIAA 4A6LA 1QFKH 1HAYB 1V62A 2ULLA 2OGPA 1AFEH 2SGEE 1ZR0A 1BJVA 5A2PA 3MO6A 4CHAC 4X0WU 3AVZA 2YNAA 5AFZH 4OAJA 4CBOA 2KA9A 2W3KA 3MU5A 2C3SA 1GI3A 4LXBH 1H4WA 3PYHA 1GGDC 2FM2A 4KELA 3EA8A 2ZU1A 8KME2 4NA9H 1O2QA 3WKLA 4FU8A 2DM8A 2QKVA 4LZ1H 1FC7A 3P17H 3ZYDA 3D65E 1HGTH 4Q2OA 3ZZAA 1UTOA 4JYUH 4YZUA 1GBKA 3RM0H 1KSNA 1HFDA 2FWWA 2VIWA 1QL7A 2HPQH 3MTYA 1XVOA 5HXFA 1D3QB 5C2ZA 2BY7X 3VGCC 2BD3A 2WYGA 4FXGH 1QAVB 1Z6JH 1C1MA 1TAWA 1LCYA 1FNIA 1YPLH 1UEQA 1YBWA 1T8LA 2BDCA 3MNCA 1SB1H 3PV5A 2CS5A 3PMHB 2FMJA 1O5BB 2BYAX 2G55A 2F91A 3H7TA 5IDKA 1MTSA 2BY6X 4X8VH 1KLIH 3FFGA 5AFYH 1V6DA 3RXUA 3TVJB 5AF9H 1MD8A 4B2BA 5I7ZA 5FCKA 2PDZA 2X7ZA 1QA7A 2UUFB 1ZTJA 2WL7A 1O3HA 2Z7FE 1FC9A 1Q3XA 2XBYA 1KXFA 3Q77A 4F4OC 4IC6A 3MYWA 1P1DA 1SGYE 4FVBA 3PM3A 4LZ4B 1TX6A 2B8OH 5DPAA 2NU0E 5EOKA 4MDSA 1LHCH 3A8BA 1UCYK 5EXMA 2BX3A 2FX4A 4OEPA 4P0CA 4B73A 1EB1H 1GDNA 4BAMB 2TBSA 2JINA 4E05H 3AW1A 4BAHB 4K76A 2ZGJA 4JZIA 2OBQA 1UTMA 2F3CE 4FGMA 2I6SA 3HGNA 4MQAA 1BQYA 4GHNA 3GY7A 5JYIA 1TNKA 3UR6A 4ZUHA 2O8TA 2VH6A 3SHUA 2BLVA 3TJNA 1OS8A 1GHZA 2ZNKH 2QN5T 2OP9A 2DB5A 2ZU2A 3W94A 2BQ7B 5A0BA 1MTNC 2UUKB 3T25A 1O3GA 3GSLA 3B23B 3HPTB 7KMEH 1X45A 1NT1A 4NNLA 1RIWB 3PTBA 5GCHF 4H11A 1S82A 2BZAA 5D13A 4IW4E 5EXLA 4HZHA 3KZEA 1YYY1 1TP5A 1N6XA 3KQDA 1ID5H 2GT8A 2ZPLA 1K1MA 1SGFG 4AORA 1GHBF 1KDQA 1Z71A 1W8BH 3PB1E 5GIBA 2D90A 1S6HA 3TK5A 1C5WB 1UK4A 1U3BA 2Y81A 3EGHC 1D6WA 4MNWA 4Q2PA 1F0RA 3TITA 1L1JA 1WJLA 1SBWA 1WU1A 1QB9A 2DLUA 4JZEH 3MH6A 1P8VC 1ZRKA 1DOJA 4IMQA 2RA0A 4MNYA 2TPIZ 2I4SA 3TSVA 4RKOB 2O9QA 1DWBH 3UNRA 1O32A 3ELAH 3NKKA 1ESTA 2VNTA 3GCHC 3OTJE 5A2MH 1J14A 2AERH 1WF7A 4XSKU 5E21A 4X6OA 1Z6EA 1IQLA 5I46H 1GJ7B 4CH2B 2FE5A 5FPYA 1W12U 1GG6B 1P9SA 1EZQA 5A0AE 1K1PA 1ESBA 1U38A 1S84A 1TLDA 3RL7A 1PDRA 1V6BA 1H9IE 3B8JA 4Z6AH 1B5GH 1GJ6A 1XX9A 1QIXB 5ESBA 2XC0A 4ABIA 1THSH 1SQOA 1WCZA 1NRQH 1VITF 2BDYA 3NFLA 1PQ8A 1N6FA 2XBWA 2F0AA 1C1OA 1FN6A 1THRH 2XCFA 4X2VA 3SNCA 3M37A 1QB1A 3MHWU 2FCFA 1YPJH 3GY5A 5DP9A 2B0FA 3RXHA 2CSSA 1ELBA 2G81E 2KJDA 1GL0E 5JB9S 4BANB 4R0IA 2QCYA 1GMDF 3O8DA 3T26A 1DE7H 4JOJA 1Z8RA 2EEKA 3LOXA 2QV1A 3UNSA 3UFAA 1Q31A 2XRCA 3G01A 1PPHE 4Q2NA 3D49H 1X5QA 1AWHB 1Y3VA 4VGCB 2UZCA 1P10A 2H2BA 4ZMAH 1C1VH 2J92A 5H4IB 1T8NA 9LPRA 1O5GH 3K50A 1I92A 2WV4A 4H6SB 3R68A 1C5QA 1WQVH 1DT2A 1BMLA 2TIOA 1FY1A 2J38A 1P04A 1FY4A 1QQUA 1QTFA 1U6QA 3SV2H 2TGPZ 1B7XB 5EXNA 1F0TA 1HAPH 3QGLA 4K3JA 3RU4E 3CH8A 3GDSA 2PUQH 1WFVA 3M3TA 4ABFA 1AVGH 3V7TA 2GV6A 2W7UA 1C9TA 3SQEE 4HFPB 4FU7A 1GBEA 3S7KB 1PPZA 1TMUH 4D76A 1TFXA 4MPAA 3SJ8A 4BAQB 1UJVA 1LVYA 1TNHA 3VB4A 5BRRE 3O8RA 1PPCE 2M0TA 3ATKA 4NMSA 3RLWH 4X8SH 2W7RA 3BTTE 2AWUA 2HE2A 1AZ8A 1TGTA 1YLDA 2XCNA 1BMMH 1OWEA 2FDAA 1A0JA 4GCHG 1TBRH 2TRMA 3GISB 2KOHA 3RL8A 5TCAA 2A32A 1L2EA 4D8NA 1O2MA 1EQ9A 4O03A 5JBCS 3VEQB 2LA8A 1O0DH 1SQTA 3SV8A 2AGIX 3LGTA 3PDVA 1DXPA 2ODPA 5DP3A 5G1DA 1GVLA 1JMOH 1LHEH 1YPGH 4E35A 3S9CA 1Y3WA 3K2UA 1JXPA 1P2JA 1ZYOA 4IN2A 2M0ZA 4A1XA 3GYLB 1WQSA 1UCYH 4LOYH 2O8UA 3LPRA 5AVDA 1SHYA 1BFEA 5DP4A 2IWNA 2NWNA 4JCNA 1IQMA 1BDAA 3PROA 4FUIA 3TH3H 4JYVH 3KEEA 4NMOA 2BQWB 5DG6A 4Y79A 1GJ9B 4UEHH 5LGOA 3GCTG 3IWMA 1A0LA 2HE4A 4CR5A 2P93A 2OQUA 2AIQA 2GT7A 8GCHF 1P11E 3JZ2B 3E16B 3PLBA 2VWRA 3BTEE 1O2UA 3SUGA 3ZZ7A 2JOAA 1EAWA 2BB4A 2EDZA 3FY5A 1O2LA 1NFWA 3CBZA 4JK5A 1V2OT 5FX6A 3SU5A 1JRTA 5T6FA 1DM4B 4Y8ZA 3OU0A 1SSXA 1T8MA 3EGGC 1SGTA 4X8UH 4ISOA 1MCTA 2EEHA 2AINA 2I6VA 5HDYA 6CHAB 1GHVH 1Y3XA 1C1NA 2CF8H 1TRYA 1BTZA 1T2MA 3SHCH 1Q7XA 5EODA 1TGSZ 1WIFA 2WPJS 4AOQA 1OWJA 2VIDA 1UVSH 2CHAC 3RXLA 4K6YA 2FP7B 3ATWA 4UFGH 2IWPA 1D9IA 2H2CA 3ZVAA 3SV6A 1W3CA 2GDEH 2JETC 1BRAA 2O8LA 8ESTE 3LGYA 1E34B 1HYLA 3MFJA 2P3TB 2VGCB 2ENOA 3P70B 4NG9H 4DIIH 2ZFQH 2PSXA 2CSJA 3M5LA 1O2IA 5E2OA 2KPKA 2OC1A 3E3TA 5F03A 5FBEA 2D92A 2HGTH 2B7DH 1TGBA 4AG1A 1TRNA 5DP7A 2AMQA 2QGRA 5HYOA 1ZJKA 4NSVA 5C1XA 3VB3A 2V35A 1FY3A 2A4OA 3LT3A 1NTEA 1SC8U 2TGAA 3M7UA 4JZFH 1RGWA 1T8OA 2FI4E 3F9HA 1QB6A 5JDUB 2XBVA 2IWOA 3A8DA 5E8EH 1CHGA 4JOPA 1V2NT 3U69H 1AVXA 3U8OH 2XTTB 3BTFE 2LC6A 1YF4A 3ATIA 1ELAA 3O8CA 5HF1A 3CBXA 1W0YH 2P16A 2FXRA 1B8QA 2ALPA 2Z3EA 2BX4A 1G2LA 3LC3A 4MPWA 3TU7H 3BPUA 5JBTA 1P57B 5GXPA 3SHWA 3RXEA 1LVBA 4D9QA 1ZOMA 3KZDA 1HAGE 4KFVA 3MH7A 1IQNA 1RD3B 3FZDA 1HJ9A 1J17T 2UWOA 1UF1A 2Z6BD 2D8WA 3SUEA 4Y0ZE 2Z94A 3LC5A 1AUJA 1EPTC 2GTBA 2ZHFH 3E90B 1HPGA 1W14U 1FJSA 1MH0A 4K8YA 2HNTC 2RCZA 3A88A 3CS0A 2G5VA 4IC5A 1FC6A 4I33A 3KN2A 4INHA 2LNCA 3V12A 1C1SA 2W3IA 1P3EA 1NO9H 2DE9A 2JKHA 3H7OA 3ZZBA 1BOQA 3RMLH 2BXTH 1IAUA 3Q3KA 2I0LA 4AFQA 5GCHG 1BUIA 1ZSJA 1GHAF 3A84A 2FI3E 5LPFA 1SGDE 4YM9A 7GCHF 3ZVGA 1SGNE 1AO5A 3STIA 1YC0A 1LPZB 1HXFH 2F5YA 3ZZ5A 1DPOA 1NROH 1TNIA 3ID4A 3VXEH 1EJAA 3ZZ4A 4NXQA 1DANH 1GHBG 1KTTB 2FI5E 1SOTA 1O2OA 4YLQH 2EGOA 2FS8A 1P06A 4UE7H 3QK1A 5F67A 1XUIA 3SNBA 1WTHD 3ZYEA 2BD7A 1ZUBA 3QGJA 5B6OA 2HNTE 1INCA 2IN2A 1CT4E 3Q76A 5DTHA 1U39A 1FAKH 3SI4H 2XWAA 2ZDKA 1XZ9A 1JOUB 3MNSA 1GPZA 1Y59T 4ABJA 4E06H 1QGFA 2EI8A 2VVUA 1FIWA 1NESE 5GWZA 1TE0A 2DLSA 2G5NA 1ELTA 1O35A 1H1BA 5FBIA 3RXIA 1MAYA 2R2MB 5G4BA 1SQAA 2FLBH 1AD8H 2C8YB 3RXVA 3SUFA 1GVZA 4UU5A 1V2JT 1AVWA 1UEWA 1VCWA 4YTAA 5DKMA 4E34A 1YBOA 2ZKSA 1N7EA 3P6ZB 3ZVEA 3U9AH 2VIQA 2ZDMA 1VITG 3RU4T 3VPKA 2PKSB 1GCTB 1RRKA 2ZWLH 4YESB 2CMYA 1UVUH 1RZXA 2GVFA 2VWMA 3SQHE 4Y0YE 1C5PA 2V90A 1EOJA 2W4FA 2SGPE 4WH8A 1FIZA 1J8AA 4HI3A 1GMDG 1UTKA 2KAIA 3BG4B 3ZVDA 1W10U 1GHWH 1LDTT 4GAWA 2NU3E 1GDQA 2F9UA 3PMJA 2A5AA 1GBAA 1P0SH 3UWJH 4ZHLU 1GMCF 4XBBA 1DWEH 2GCTB 2EAQA 5E2PA 2QKTA 1GHXH 1DS2E 2FIRH 3VQFA 1ZHRA 1NFUA 3A7WA 2PTNA 1GHYH 1MKXH 1P05A 1HXEH 3RM2H 3GGEA 1P01A 3GOVB 1ETTH 1VGCB 1B0EA 3I18A 3GYMA 1PQ5A 5CHAB 3A87A 1W9QA 1NPMA 2RA3A 4GLYA 3LKWA 4THNH 2FOFA 3F1SB 3EA9A 3HVQC 4L8NA 2FN5A 1HCGA 1WFGA 3R69A 1C1PA 3SU0A 4OS5A 3K65B 1TNJA 3SU1A 2IWQA 1QHRB 1BT7A 1D3TB 3QDOA 1YLCA 2EC9H 1EZUC 3HK6B 2SGFE 1D4PB 2JXOA 1EKBB 1NU7B 1TX8A 4U01A 4N6XA 1WI2A 1NY22 1T32A 2JILA 4K69A 4X1SU 5E0JA 3PO1B 3SGAE 3TJVA 1QBVH 1XUKA 2FLRH 1AWFH 1GVKB 5FB8C 2H3MA 3LGUA 5A0CA 4I8GA 3SNDA 2QF3A 1FPHH 5E0HA 1JBUH 1HAZB 1LHFH 3S9BA 1XXDA 3F68H 3RC4A 4DOQA 2IJOB 3STJA 1XKBC 1D3PB 2Z3CA 3UQOA 1CBWB 1C2IA 4HOPA 4JORA 3K82A 1BMNH 5C3NA 2HWLB 1K2I1 1K1OA 7LPRA 1SOZA 1TB6H 1V5LA 4E3BA 1ANEA 2GCHF 1GM1A 3SOEA 2ILNA 2ZGHA 2ZU5A 4UFFH 1WHAA 1O3EA 2BY8X 2PKAB 1BRCE 2ZCHP 3C1KA 1OPHB 1YCPK 1Q3OA 4JL7A 1PQ7A 2Z9JA 2J34A 1A0HB 1ZTKA 3BTWE 3HK3B 1UHBA 4H4FA 3CBYA 8GCHG 4Y11E 2BDAA 1HJAB 4OS7A 4TPIZ 3L4FD 2D8IA 2Y5FA 2AFQB 2D2DA 2RG3A 4DG4A 4NNMA 3MH4A 3TNSA 2J2UA 2BDBA 1QL9A 1K32A 1GBDA 2KJKA 5HMAA 1Z87A 1YPEH 3L6PA 1V2MT 1Y3UA 5C1YA 3NUMA 1WSSH 2JH6D 4SGBE 5HFFA 2VU8E 3M3VA 5LH8A 1CU1A 1GBTA 1SLUB 2BOKA 1W9OA 3KHFA 4B1TA 1XXFA 4X1QU 1TX7A 1BCUH 1BTPA 1RXPA 3OTPA 2BVRH 3BSQA 1MKWH 1GCDA 3BEUA 4Q7XA 4AYYB 1SMFE 1TRMA 4U30A 1EXFA 2PKUA 1S5SA 2Q6FA 2YNBA 4AX9H 4EDJA 3QLPH 7ESTE 5FX5A 1PYTD 1BB0B 1A61H 2FX6A 1O5CB 3H5CB 1AE5A 1LO6A 5FXLA 2ZQ1A 1V2UT 4ZH8A 2GGVB 4ZXYH 3QZRA 4X6PA 3GCNA 3TGJE 5F8XA 1CT0E 2H5CA 3SI3H 1P09A 2M0UA 3KHVA 1ZGVA 4CBNA 2LPRA 3HPMA 3SORA 1UTLM 2BDGA 1TGNA 1C5RA 4K72A 2EGNA 4ISHH 2M5TA 4ISNA 1YPKH 3KQCA 2Q3GA 4IS5A 2O8MA 1RY4A 1JIMA 2ZDVH 1QAUA 3DJ1A 1GBJA 4TWWA 1G37A 2GV7A 5DP8A 4FUEA 2ANKH 2FOMB 1TIOA 3MNBA 2FTLE 4Z0KA 1JWTA 2GP9B 1FI8A 3FVFB 2ANYA 3SHAH 5K0HA 1HAXB 4ABDA 3DORA 4DY7B 4I8HA 3N7OA 1ZOKA 2P94A 2UWPA 2ZPMA 3RXJA 2EI6A 3LDXH 4ZKNU 2YT8A 1KLJH 4XBCA 4U32A 2Z9LA 1UK2A 5DK1A 2ANWA 2EEIA 1V3XA 2Y7XA 4FUFA 3ESTA 2WYJA 3QDZB 4OS2A 4O06A 1C2MA 1XKAC 1SLVB 3PMBB 3NFKA 1GHAG 1AIXH 4WXIA 2H9TH 3SO3A 3R0FA 3UR9A 4NXPA 2CN0H 2ZPQA 7GCHG 1ZPCA 3A81A 4YT7H 4JOKA 1EJMA 1O3PB 2AIPA 4KTUA 2Y82A 1M9UA 4GUXA 3ATLA 4BTTB 2NU2E 1J9CH 1AFQB 4ZHMU 2XNIA 4DIHH 1FONA 4Y8YA 2A2QH 1LHDH 2WUCA 2Q6DA 1N6YA 1XUJA 1OP8A 3KIDU 4AFZA 1ELGA 1P2OA 1S0RA 3V13A 4GVCA 2F9BH 1EX3A 4J1YA 3VXFH 5C5OA
chains in the Genus database with same CATH superfamily
1O5DH 3RP2A 1PPGE 1T4VH 1V2WT 1K21H 4B75A 2FO9A 2WPIS 5HFDA 4AB8A 1RJXB 4K8BA 4YDPA 4YOGA 1CVWH 1UFXA 3MO3A 4D7GA 3AASA 2CJIA 2O2TA 2FESH 3QWCH 1VR1H 2SFAA 2PHBA 2PTCE 1V2ST 1QQ4A 3SGQE 1NZQH 1AGJA 1HBTH 1TPAE 1MUEB 3QX5H 4TSFD 3UNQA 3PDZA 2ODQA 1ELDE 2A7HA 1C4U2 3M5OA 2GMTB 2KBSA 4Y7AA 1WG6A 1RS0A 1XVMA 1FZZA 3NZIA 2M0VA 4JOFA 4K60A 2VPHA 1MQ5A 5KEDA 3SGBE 2G4TA 5TCCA 1BHXB 2P59A 1C1WH 4IN1A 2OZFA 2ZDAH 3RXGA 2XNDD 2R0LA 3Q3YA 2PKAA 1A5HA 3BF6H 1S85A 5E0GA 1UVTH 1YCPH 1O2RA 2C93B 2HALA 4KFWA 1O2TA 1X5NA 2P8OB 3SJ9A 3CC0A 2C8XB 2IPHA 1O2SA 1OWKA 3T2NA 1GMCG 1W0ZU 2KFWA 1W7GH 2EJYA 2GEFA 3PTNA 4MNVA 1IQGA 1NRRH 4WF8A 4K75A 3ZZ3A 3ZVFA 3DA9B 2CF9H 1A1RA 1TA6A 1NFXA 3SJIA 4TWYA 4CR9A 5A8ZA 1TA2A 1AE8H 4LK4A 2PNTA 1TQ7B 3PV4A 2P3WA 1QBOA 1N8OB 4K2YA 2J95A 2JREA 1NRSH 3FOAA 3UY9A 1X5RA 1GI1A 1O3DA 3QN7A 3S0NA 3RDZA 3DFLA 4FUCA 1KXDA 2BYGA 1O3OA 3NCVA 4YXWD 5E22A 2XWBI 2BD5A 2QAAA 2B5TB 2WSSD 2DAZA 1D5GA 2Y5GA 1BITA 1E38B 1ETSH 2QXHA 1C1RA 2ZHQH 4INKA 2OC7A 1CA0B 3PWCA 4WY3A 5E1YA 3SNAA 2AMDA 4J2YB 3NK8A 4PQWA 4AB9A 3I78A 1TNGA 2V0BA 5C5NA 1LKAA 3A89A 3LONA 1YKTA 4HGCA 4A5TS 2ZP0H 1EZSC 2OINA 5GLJA 4FUGA 1D3DB 1ORFA 1CE5A 2A4RA 2D26C 1C2JA 1SFIA 1UVPA 1ZMNA 2HRVA 2VIVA 1K0HA 3MOCA 1FMGA 1L1GA 1THPB 3A86A 3A80A 3RXTA 2OTVA 3BN9A 1NF3C 2J9NA 2F83A 4NA8A 2KAIB 3RUOA 4NXRA 2KPLA 1KMHB 4Y6DA 1QJ1B 1W7XH 1G9OA 1C5UA 1HAOH 1TPOA 2PA1A 1C5XB 3FANA 1L4DA 3C27B 2BM2A 3RXBA 5HIZA 1DITH 5EW2H 2IPQX 4E7NA 2GCHG 1AB9B 2FOEA 4X6MA 3SFJA 3VB6A 5J4SA 1SGIB 2SGDE 4AGKA 2V3OH 1C2FA 2PFEA 4WYTA 2EEJA 2M3MA 3NGHA 1MKXK 2YT7A 3DT0H 5HM2A 4XHVA 3ZV8A 1HJ8A 4ZAEA 3DD2H 1QLCA 3QJNA 2LOBA 5HF4A 1MU6B 1C1UH 3D23A 4D7FA 1LVMA 2K20A 2SGQE 4NIXA 1OOKB 2BLOA 2JIKA 4NIVA 4CHAB 2H9HA 1MD7A 5DP5A 1TOCB 3LGVA 1C1QA 3A7VA 1ELCA 2ZHEH 3GDUA 3GY4A 1C1TA 3BTHE 3S69A 1O3IA 2STAE 1C4V2 3OSYA 1GGDB 1EATA 2BDHA 3RXKA 5G1EA 1QA0A 5JPMH 5A09A 2OPGA 1BJUA 1RTKA 2VH0A 1ZJDA 1J16A 2QF4A 3M5MA 4ABEA 3SN8A 1SGCA 4FETA 4KGAA 2AS9A 1IQEA 1WV7H 1V2RT 1N6EA 1MZDA 2A45B 4MNXA 3SOSA 1CGHA 3VGCB 5HFCA 4BNRA 2SGAA 2G8TA 1P2NA 3E91A 3UOPA 2W6JD 3UQVA 3KQ5A 1AZZA 2VVVA 1OYQA 1A5GH 1T4UH 2Y80A 1NC6A 1G9IE 4HOPB 1G36A 1QR3E 1TGCA 4WMEA 5C0TA 3LGIA 3CYYA 1O2GH 1XM1A 1XMNB 2PKTA 1ZHMA 1NS3A 2KV8A 1O2YA 1AY6H 1Z86A 1QRZA 2LUIA 5A8XA 2G4UA 1P03A 1O34A 2EDPA 2KG2A 4JMYA 1Y5BT 1ZGIA 5AHGH 1F7ZA 4UONA 4Q7ZA 3TSWA 1RIWC 2JIZD 5HFEA 1FY8E 1O5EH 3KDKA 2FNEA 1UHBB 2C8WB 4A1VA 1WH1A 1MFGA 3E0NB 3BIUH 5EW1H 3M5NA 2GZVA 3O8BA 2ZIQH 1OP0A 1Z8GA 4ISIH 2BY9X 4X6NA 1XUGA 4K5ZA 4ZROA 1UJ1A 3OAAD 3A8AA 4UU6A 1GL1A 2VIOA 5EZ0A 1KXAA 4ZKRU 2XC4A 1HAHH 2AWWA 5EQRA 1V1TA 2SNVA 2EV8A 1TBZH 1Z1JA 1Q3PA 4XD7D 3DUXH 3NCLA 3TJOA 3ZZ8A 1WTGH 2C4FH 2YUYA 1ESAA 2FEQH 3ZRTA 2VWOA 4MPXA 1O3JA 2V3MA 4Q80A 5EPYA 4UFEH 4GHQA 2WV5A 2QBWA 2O8WA 1BZXE 1MTNB 1T7CA 1KXBA 3A7XA 4ACBA 3SUZA 1OWDA 1IU2A 1G3DA 1QY6A 4Q7YA 3V3MA 2BHGA 1ABJH 3P8GA 4NMVA 1AQ7A 1PFXC 1GG6C 3BTQE 3GY2A 4F48B 1MTVA 1J15A 2FOCA 2QXGA 1KEFA 1DWCH 1MKWK 1Z7KA 1IHSH 1Y7NA 1WBGB 3FP8E 4FVDA 3IG6B 3RLEA 4MLFB 2WPLS 2FOAA 5B6LA 2VZ5A 1P3CA 1NM6A 5A8YA 3EAJA 4RSPA 1ZPBA 3RU4D 3FKSD 1GJAB 4NGAH 2J4IA 3F0OA 2FOHA 3I1EA 2UWLA 3KL6A 3PWBA 2L97A 2PV9B 3A85A 5EYZA 1IQHA 5EG4A 1PPBH 3GCHB 2RDEA 1EAIA 5ETXA 1ANDA 3EDXB 4PROA 4K78A 4BXSA 4NMTA 3U1JB 2BD8A 2F43B 4CH8B 1U37A 5HFBA 1QURH 2AYWA 1ELFA 1EASA 1UVOA 1E0FD 1VB7A 2TGDA 4AGJA 3B76A 2WPMS 4VGCC 3LJOA 3N7EA 3QIKA 4NMRA 1ZHPA 1RFNA 3FP7E 2HGAA 3EYDA 1LMWB 4JK6A 1C2EA 1HLTH 1S6FA 4XDEA 2GZ7A 3MMGA 3RC5A 1UITA 2YMSC 1DVAH 1DLKB 4REYA 2JH0D 1BTXA 2OCVB 3AK5A 2Y7ZA 3LNXA 2A31A 3SW2B 2XXLA 1H9HE 1TALA 3QZQA 1KYNA 3BEIB 3EE0B 4Y71A 1VITH 2G5MB 1O2XA 4Y10E 2L6OA 2BLWA 1BBRH 2BXUH 5K7RA 1OKXA 5LPEA 3OYPA 1X7AC 1QJ6B 3K6ZA 1UMAH 4I8KA 3ZZDA 2VWNA 3RMOH 1UEZA 3T27A 3F2HA 1IQJA 3RXMA 5GDSH 1QJ7B 1DY8A 1O3NA 2A2XH 3KQBA 3TK6A 4I7YH 2FYQA 2GDDA 4ABHA 1IU0A 1O2WA 3S7HB 2B9LA 2A4QA 4X8TH 2GKVE 2W26A 3RC6A 1F0UA 2ZFPH 3E0PB 3GY3A 1L1NA 3O46A 2KOMA 3VG8A 1F5KU 1O31A 4FUBA 3MU0A 1QNJA 1UTJA 4NCYA 3TGIE 3W95A 2ZF0H 1C5ZB 1OYTH 2EXGA 3RXFA 1LVOA 1O2NA 1NRNH 4Y8XA 2QYIA 5J4QA 4NIYA 4F8KA 1DICA 1X8SA 1WI4A 1BTUA 3ZZ9A 1W13U 1MTWA 3UREA 1DDJA 2FS9A 2V7QD 3F2FA 3KCGH 3ITIA 2ZHDA 4X1NU 1L0ZA 2QIQA 5C1UA 6LPRA 6GCHF 1QBNA 3JZ1B 1SGQE 2V6NA 1PPFE 3BTDE 5LPRA 2VSVA 5IYTA 4XE4A 2D1JA 1G30B 1VJAU 2JDID 3BTGE 2DKRA 1JIRA 3T62A 1MTUA 5HEBA 1ARCA 2EA3A 4Q63A 4B74A 2OUAA 5C20A 4NA7A 2Y5HA 3BG8A 5EQSA 1W0KD 2Q1JA 1ZZZA 2ZCKP 2ZDLA 2STBE 1K1IA 4KP0A 1IQIA 1FXYA 1MBQA 2DUCA 3EQ0H 3CNRA 3I4WA 3RXDA 5L2YH 2MHOA 1CO7E 3GCTF 2YOLA 1OBXA 1C5OH 2ZI2H 2JWEA 1SQRA 1QL8A 3QUMP 4GVDA 1G2MA 3RXSA 1KXEA 6CHAC 2K8IA 1GQ4A 3A7TA 3ATMA 3K1RA 1TONA 2HNTF 1CQQA 4GPGA 2K1ZA 2G00A 4AFSA 2ESTE 1F5LA 2ODYB 3AXAA 3DCLA 1B0FA 3E6PH 2EI7A 1E35B 1GI5A 4K1SA 1O3KA 1YP9A 2FOBA 2ZPRA 2FYRA 1HDTH 2WPHS 4KTCA 2I6QA 2VGCC 2ZA5A 2W5EA 1VA8A 2UUJB 1BBRE 4R8TB 3TMHA 2M10A 5ILBA 3E8LA 2BD9A 5T6GA 4MG3A 3UOUA 1GI8B 1HB0B 1QZ8A 1ZRBA 2XYAA 3GDVA 4ABBA 1DWDH 2CK3D 5F6MA 4RI0A 4Q6SA 4AG2A 3SBKA 1RGQA 1AUTC 2H1UA 4OS4A 1DY9A 1GBMA 2ZZUH 2KQFA 1GBCA 3SV7A 1GMHF 1OZIA 3SZNA 2A1DB 1BTHH 1O38A 1FAXA 1K28D 2RDLA 5T3HA 2ZU3A 1AKSA 2BD2A 5ESTE 3PV2A 3KQEA 2DJTA 3VB5A 3TLOA 4QT8C 2CHAB 1GJDB 6ESTA 2XBXA 4O9VA 4NMQA 3T29A 1OWHA 1OSSA 4OGXA 4TY6A 2I0IA 1SGRE 2W7SA 1FPCH 2ZU4A 4OGYA 2JETB 1O3BA 2EHRA 2PUXB 1UM7A 3M7TA 1VJ9U 1UTPA 1IOEA 1BMAA 2C8ZB 3JXTA 1TPSA 2WV9A 1CSOE 1Y8TA 3T28A 3LU9B 4ZHAA 2R0KA 3HKIB 1ELEE 1DSTA 3P8FA 1UHPA 4WWYA 1WHDA 1G32B 5T6DA 1GWAA 1SLWB 3SJKA 2I04A 1O3FA 1V2LT 1BHXF 4DURA 4I8LA 2VVCA 5IL9A 2PW8H 4H42U 1E37B 5T1VA 3PS4A 3SU4A 1GI9B 1P2MA 1K1NA 5FPSA 1C5NH 2R3UA 2ASUB 3RXOA 2J94A 1A4WH 1KY9A 1GI6A 1L6OA 2EGKA 4TYDA 2FTMA 4O3TA 2KJPA 5EGMA 2JJ1D 2ZEBA 3EE7A 2VRFA 1VZQH 1YCPM 1P2KA 3SU6A 3TK9A 1YPHC 1HNEE 2A5KA 4MPUA 2VIPA 1MAXA 2AGEX 4YOJA 1KIGH 4JOHA 1S83A 5DJ7A 5HEDA 1LTOA 1SGPE 1HV7A 3UB0A 3BEFB 1AN1E 1OXGA 1N1LA 2A0QB 1LHGH 4WYUA 1BIOA 4KKDA 1C4Y2 1MQ6A 4AMHA 2E7KA 2QXJA 2C90B 3KYGA 2H2ZA 9ESTA 2F9NA 1GBFA 1R6JA 1KLTA 5FAHA 1HUTH 1GJ5H 4LMMA 4NZLA 2MX6A 3N7DA 4TY7A 5DGJA 4HTCH 4FLNA 3CP7A 3TNTA 4I86A 1EPTB 1WYKA 4I32A 3P95A 3F9GA 2GJGA 3O5NA 4X2XA 4CRGA 1IQFA 1GI4A 4Q6HA 1SFQB 2GX4A 2ANMH 3KDGA 4NWLA 1MU8B 1S0QA 1SLXB 2SNWA 4CRCA 1ZLRA 4ZXXH 2BVSH 2YTWA 1Y5UT 1YPHE 2AMPA 3RMMH 2Z9IA 4MTBA 1C5MD 1RTFB 1EUFA 3IITA 3U98H 4INLA 3P8OA 4BTUB 5FCRA 4B76A 4E7RG 2QC2A 1NFYA 4JZ1A 1SGFA 4YT6H 3ZV9A 3NWUA 3MU1A 2Z3DA 3L33A 1C2KA 2J97A 1VCPA 3UWIA 1H8ED 1WOFA 1KXCA 2CGAA 1UEPA 1C5VA 2PLXA 3FP6E 4NWKA 3SNEA 2PKSC 2ZQ2A 1BTWA 1OBZA 4AC9A 1GCTC 1S81A 1EJNA 1SG8B 2DE8A 2QY0B 2KRGA 4AZ2B 4IBLH 1P2QA 3ZZ6A 2A7CA 1ABIH 5L6NH 3FZZA 3Q00A 1ARBA 3M35A 1PPEE 2AGGX 1SGEE 1DX5M 1C5TA 3F9EA 1TMBH 1P1EA 4MPVA 1O5FH 1V2VT 3BG4C 2BVXH 1GBBA 3K9XB 3WW7A 2HVXA 2OMJA 2GZ8A 3U1IB 1ZMLA 2ZTXA 3HKJB 3UTUH 1N99A 1SVPA 2GCTC 5HGGA 3I29A 5I25A 3F9FA 3QTOH 1RGRA 2AWXA 1JRSA 2FODA 1TOMH 1TP3A 3DJ3A 1DFPA 3LJJA 2VINA 5L2ZH 4WJG2 2R4HA 1V2QT 4YYXA 3NXPA 4UD9H 2WPKS 4CRAA 1GI0A 1ETRH 3SU3A 1FN8A 2KM0A 4G69A 3MWIU 4JJ3A 3GCOA 1VGCC 4GSOA 1CHOF 2ZO3H 5CHAC 5IK2D 2IJD1 4GHTA 3LNYA 1GI2A 1OX1A 4XRNA 2BD4A 4TPYA 3GJ9A 4OS6A 2A5IA 1V2KT 4D9RA 4WVPE 1BTYA 1O37A 5GPIB 4A92A 2WINI 2VJ1A 3UIRA 1O2VA 1TNLA 3RXAA 3TGKE 3I77A 3PMAB 4Z8JA 3FN8A 2BLQA 1BA8B 1N6DA 3R3GB 1ZMJA 2OQ5A 4CRBA 2H3LA 3PO1C 2A4GA 2F9OA 2H9EH 2QA9E 4Q2KA 1C2GA 1ZTLA 1O36A 1HAVB 4JOEA 2AEIH 5F8TA 1ACBE 4BOHA 5CE1A 1QAVA 5L30H 2XW9A 1QRXA 4NFFA 2QT5A 3P92A 3AAVA 4RN6A 2BDIA 3PLPA 3HGPA 4AYVB 1SR5C 1CBWC 1QRWA 1WUNH 3LGWA 3TJUA 2I1NA 3MU8A 4WH6A 4A1TA 5PTPA 2ZFRH 1W11U 5EPNA 1EZXC 2ZHWH 1W9EA 1IHTH 2QF0A 3GY8A 1FLEE 1MZAA 5F8ZA 2OQSA 2JSNA 4WMFA 3TH4H 4XOJA 3ID2A 1P02A 6GCHG 1SPJA 1VAEA 1K1LA 2FZZA 2KL1A 2TGTA 5GNDA 2P3UB 5ABWA 1TMTH 1Z8IB 3MNXA 4F49A 4DVAU 5B42A 1UM1A 1ZPZA 3M36A 1YM0A 2ZECA 3PRBA 1Q2WA 1VJ6A 4M7GA 5SGAE 2KAWA 2OC8A 1BBRK 3MU4A 2LELA 1HJAC 5C67A 4AN7A 1KTSB 1QCPA 2ZDNA 5DO4H 4ZKSU 3FO8D 1NTPA 3ENSB 3VFEA 1A2CH 2NU4E 3F3BA 3PRDA 1O2KA 2GZ9A 3HATH 3B9FH 3MO9A 2RRMA 4ABAA 1UTNA 4WXVA 1LPGB 5EIYA 2ZTZA 5KECA 2IOTA 4Q2QA 1BE9A 1CA8B 4JOGA 3OFND 2BQ6B 3V0XA 1N7TA 2F9PA 1GBHA 1EB2A 2CXVA 1GBIA 1MCVA 3F2GA 1Z8JB 2H5DA 1EPTA 4A7IB 1DUEA 1XUFA 3SUDA 1FQ3A 1GJ4H 1C2LA 1UTQA 5EQQA 3DIWA 2PSYA 4OEOA 1F0SA 3A7ZA 4XBDA 2Q9VA 3KF2A 1O2JA 3OY5U 1GQ5A 3M61U 3RXPA 3RLYH 2UUYA 3GY6A 3UUZA 4K1EA 1C5YB 1OP2A 1GMHG 1NN6A 2GD4B 5JBAS 1ANBA 1XUHA 1O2ZA 1P12E 2OCSA 4IMZA 5GJ4B 1EP5A 2FPZA 1K9OE 3L3TA 4XFQA 4DJZB 1PJPA 1I16A 1GJBB 2PWXA 1X6DA 3QE1A 2JH5D 3LIWA 3EA7A 3ZIAD 1MBMA 3U8TH 1MMJN 4RT0A 5CMXH 2K1QA 1O2PA 2EEGA 2L4SA 1ELVA 3A82A 3TH2H 2ZTYA 2KCOA 4WMDA 2Q6GA 2PR3A 2OSGA 2OS6A 3S9AA 2PP6A 2EDVA 1HIAB 2PGBB 3QO6A 4FUDA 2P3FH 1PYTC 1IHJA 3AW0A 2ZC9H 5FPTA 2Z9GA 2ZGBH 2ZPSA 3M3SA 1HAIH 1OWIA 1ZSKA 4GVUA 4I8JA 1TYNA 3UPEA 4ISLA 2QKUA 3TIUA 2DMZA 2G2LA 3EGKH 1V5QA 1UJDA 3BIVH 3RXRA 5H3JA 2VB0A 1ANCA 2ZFFH 1MFLA 1C9PA 1C5LH 5HM9A 1LKBA 1A46H 4K1TA 3RXCA 1UCYE 2DC2A 1W2KH 1FY5A 3OEED 4BAOB 1FV9A 1P9UA 1O3MA 2H6MA 4YOIA 3HPKA 3QGNB 1G3CA 1RTLA 1Z1IA 3F6UH 5CHBA 2G51A 1P2IA 5HETA 2OLGA 2BZ6H 3BTME 1F2SE 3TPIZ 1LPKB 1NRPH 4ESTE 1O5AB 3DHKH 4H6TA 2P95A 2R9PA 1HRTH 2OK5A 1SL3A 1AKSB 3AAUA 2ZFSA 1GDUA 2VWLA 4O97A 1AFQC 4U2WA 1TABE 4IGDA 3ZZCA 4CRDA 1WF8A 2AH4X 5BPEA 2ZFTA 4TT3D 4Y7BA 2OC0A 1H8IH 1AMHA 1NBME 3GICB 1PQAA 3P8NA 2LC7A 4X1PU 2JJ2D 3R0HA 1GJ8B 2F9VA 4BXWA 2BTCE 2OXSA 4BTIB 1DUAA 4UFDH 4RKJB 1GBLA 1Y5AT 2NU1E 5F3XA 1AHTH 1SI5H 4KTSA 1F5RA 2Z9KA 2YUBA 3D62A 1HAVA 1EAUA 3MI4A 3WKMA 4FUJA 1FUJA 4YLUA 1ZSLA 2THFB 3BTKE 3CS7A 1TPPA 1A7SA 1TQ3A 2ZCLP 1O3AA 4OS1A 4Y76A 2WUBA 2OBOA 3K6YA 1CT2E 2CV3A 1AI8H 1KWAA 1IQKA 4X1RU 3ODFA 1GI7B 2BMGB 2OD3B 2KCPA 1SHHB 3RXQA 8LPRA 4AFUA 1V2PT 2GMTC 4NFEA 1Y3YA 2KR7A 2A7JA 4JZDH 3E17A 2R2WU 1UK3A 3KGPA 3SJOA 1BRBE 4Z33A 4ABGA 2Z17A 4R2ZA 3QTVH 4B2AA 1MC7A 2REYA 1UO6A 4ASHA 1OBYA 1A3EH 3SV9A 5DP6A 1DLEA 2RCEA 2WZQA 1TBQH 1A3BH 2G52A 3ZVCA 3MH5A 2P8OC 2HPPH 3VQGA 1O3CA 1DSUA 1FCFA 4Q3HA 1EAXA 2FOGA 2QG1A 4X2WA 2W6ID 5HJ1A 1YGCH 2V3HH 2BY5X 4MVNA 1MABB 1NU9A 2ALVA 2XC5A 3U8RH 1CGIE 3SU2A 3OX7U 1E36B 3QJMA 4OM9A 1K22H 4BAKB 3DFJA 3ODDA 3URCA 3A8CA 4DT7B 1O39A 5F53A 1G3EA 1G3BA 2PZDA 2ZGCA 3FAOA 3LH1A 3NPSA 2R3YA 1CHOG 1KDQB 2ZG0H 4NMPA 3A83A 1CGJE 1N8OC 1VCQA 3LH3A 1A5IA 1O30A 5JBBS 3VB7A 2QXIA 1BRUP 1UJUA 3Q3XA 1L4ZA 3BV9B 5E6PB 4B2CA 5FHTA 2HOBA 4CRFA 2V1WA 3RMNH 2RFKC 3PLKA 1H9LB 2PGQB 1LQDB 1H8DH 1AU8A 1YPMH 1CA0C 1GJCB 1O33A 4DCDA 1OHHD 4DGJA 4UDWH 3ID3A 5E11A 4ZKOU 5HEYA 4NSYA 5JXBA 1C2DA 4P2AB 1V2TT 1E1RD 3M7QA 1C2HA 2KOJA 4I31A 1K1JA 4GCHF 1D6RA 3ID1A 1S6LA 3TSZA 3KNXA 4O3UA 1X9ZA 1LQEA 2ZGXH 3DJAA 3DSGA 3A7YA 5EU8A 3WY8A 1TQ0B 4YO9A 1DXWA 4X2YA 2BOHB 3CENA 4F55A 2Y6TA 1T31A 4FU9A 4NZQA 1F92A 4SGAE 1N7FA 4CREA 3E1XB 1FDPA 2VSPA 4JYTA 5JB8S 4FUHA 3T5FH 2KYLA 4DW2U 1WAYB 4B71A 1C5SA 1AB9C 1O3LA 5TJXA 3ZVBA 1EP6A 3OY6U 2L4TA 1EOLA 1TWXB 1O2HA 2HLCA 4NIWA 3URDA 2KZ4A 1M5ZA 1HIAA 4A6LA 1QFKH 1HAYB 1V62A 2ULLA 2OGPA 1AFEH 2SGEE 1ZR0A 1BJVA 2QF5A 5A2PA 3MO6A 4CHAC 4X0WU 3AVZA 2YNAA 5AFZH 1WXRA 4OAJA 4CBOA 2KA9A 2W3KA 3MU5A 2C3SA 1E1QD 1GI3A 4LXBH 1H4WA 3PYHA 1GGDC 2FM2A 4KELA 3EA8A 2ZU1A 8KME2 5C0UA 4NA9H 1O2QA 3WKLA 4FU8A 2DM8A 2QKVA 4LZ1H 1FC7A 3P17H 3ZYDA 3D65E 1HGTH 4Q2OA 3ZZAA 1UTOA 4JYUH 4YZUA 3KYFA 1GBKA 3RM0H 1KSNA 1HFDA 2FWWA 2VIWA 1QL7A 2HPQH 3MTYA 1XVOA 5HXFA 1D3QB 5C2ZA 2BY7X 3VGCC 2BD3A 2WYGA 4FXGH 1QAVB 1Z6JH 1C1MA 1TAWA 1LCYA 1FNIA 1YPLH 1UEQA 1YBWA 1T8LA 2BDCA 3MNCA 1SB1H 3PV5A 2CS5A 3PMHB 2FMJA 1O5BB 2BYAX 2G55A 2F91A 3H7TA 5IDKA 3DSPA 1MTSA 2BY6X 4X8VH 3H09A 1KLIH 3FFGA 5AFYH 1V6DA 3RXUA 3TVJB 1YLNA 2XOKD 5AF9H 1MD8A 4B2BA 5I7ZA 5FCKA 2PDZA 2X7ZA 1QA7A 4ZCNA 2UUFB 1ZTJA 2WL7A 1O3HA 2Z7FE 1FC9A 1Q3XA 2XBYA 1KXFA 3Q77A 4F4OC 4IC6A 3MYWA 1P1DA 1SGYE 4FVBA 3PM3A 4LZ4B 1TX6A 2B8OH 5DPAA 2NU0E 5EOKA 4MDSA 1LHCH 3A8BA 1UCYK 5EXMA 2BX3A 2FX4A 4OEPA 4P0CA 4B73A 1EB1H 1GDNA 4BAMB 2TBSA 2JINA 4E05H 3AW1A 4BAHB 4K76A 2ZGJA 4JZIA 2OBQA 1UTMA 2F3CE 4FGMA 2I6SA 3HGNA 4MQAA 1BQYA 4GHNA 3GY7A 5JYIA 1TNKA 3UR6A 4ZUHA 2O8TA 2VH6A 3SHUA 2BLVA 5CDFE 3TJNA 1OS8A 1GHZA 2ZNKH 2QN5T 2OP9A 2DB5A 2ZU2A 3W94A 3WWFA 2BQ7B 5A0BA 1MTNC 2UUKB 3T25A 1O3GA 3GSLA 1FX0B 3B23B 3HPTB 7KMEH 1X45A 1NT1A 4NNLA 1W0JD 1RIWB 3PTBA 5GCHF 4H11A 1S82A 2BZAA 5D13A 4IW4E 5EXLA 4HZHA 3KZEA 1YYY1 1TP5A 1N6XA 3KQDA 1ID5H 2GT8A 2ZPLA 1K1MA 1SGFG 2F4LA 4AORA 1GHBF 1KDQA 1Z71A 1W8BH 3PB1E 5GIBA 2D90A 3U28C 1S6HA 3TK5A 1C5WB 2WPDD 1UK4A 1U3BA 2Y81A 3EGHC 1D6WA 4MNWA 4Q2PA 1F0RA 3TITA 1L1JA 1WJLA 1SBWA 1WU1A 1QB9A 2DLUA 4JZEH 3MH6A 1P8VC 1ZRKA 1DOJA 4IMQA 2RA0A 4MNYA 2TPIZ 2I4SA 3TSVA 4RKOB 2O9QA 1DWBH 3UNRA 1O32A 3ELAH 3NKKA 1ESTA 2VNTA 3GCHC 3OTJE 5A2MH 1J14A 2AERH 1WF7A 4XSKU 5E21A 4X6OA 1Z6EA 1IQLA 5I46H 1GJ7B 4CH2B 2FE5A 5FPYA 1W12U 1GG6B 1P9SA 1EZQA 5A0AE 1K1PA 1ESBA 1U38A 1S84A 4UFFH 4P02A 1TLDA 2VBCA 3RL7A 1PDRA 1V6BA 1H9IE 3B8JA 4Z6AH 1B5GH 1GJ6A 1XX9A 1QIXB 5ESBA 2XC0A 4ABIA 1THSH 1SQOA 1WCZA 1NRQH 1VITF 2BDYA 3NFLA 1PQ8A 1N6FA 2XBWA 2F0AA 1C1OA 1FN6A 1THRH 2XCFA 4X2VA 5FL7D 3SNCA 3M37A 1QB1A 3MHWU 2FCFA 1YPJH 2EQNA 3GY5A 2B0FA 5DP9A 3RXHA 1EFRD 2CSSA 1ELBA 2G81E 2KJDA 1GL0E 5JB9S 4BANB 4R0IA 2QCYA 1GMDF 3O8DA 3T26A 5C17A 1DE7H 4JOJA 1Z8RA 2EEKA 3LOXA 2QV1A 3UNSA 3UFAA 1Q31A 2XRCA 3G01A 1PPHE 4Q2NA 3D49H 1X5QA 1AWHB 1Y3VA 4VGCB 2UZCA 1P10A 2H2BA 4ZMAH 1C1VH 2J92A 5H4IB 1T8NA 2AHME 9LPRA 1O5GH 3K50A 1I92A 2YMSB 2WV4A 4H6SB 3R68A 1C5QA 1WQVH 1DT2A 1BMLA 2TIOA 1FY1A 2J38A 1P04A 1FY4A 1QQUA 1QTFA 1U6QA 3SV2H 2TGPZ 1B7XB 5EXNA 1F0TA 1HAPH 3QGLA 4K3JA 3RU4E 3CH8A 3GDSA 2PUQH 1WFVA 3M3TA 4ABFA 1AVGH 3V7TA 2GV6A 2W7UA 1C9TA 3F0PA 3SQEE 4HFPB 3UAIC 4FU7A 1COWD 1GBEA 3S7KB 1PPZA 1TMUH 4D76A 1TFXA 4MPAA 3SJ8A 4BAQB 1UJVA 1LVYA 1TNHA 3VB4A 5BRRE 3O8RA 1PPCE 2M0TA 3ATKA 4NMSA 5DSFA 3RLWH 4X8SH 2W7RA 3BTTE 2AWUA 2HE2A 1AZ8A 3OEHD 1TGTA 1YLDA 2XCNA 1BMMH 1OWEA 2FDAA 1A0JA 4GCHG 1TBRH 2TRMA 2HVYB 3GISB 2KOHA 3RL8A 5TCAA 2A32A 1L2EA 4D8NA 1O2MA 1EQ9A 4O03A 4ACAA 5JBCS 3VEQB 2LA8A 1O0DH 1SQTA 3SV8A 2AGIX 3LGTA 3PDVA 1DXPA 2ODPA 5DP3A 5G1DA 1GVLA 1JMOH 1LHEH 1YPGH 4E35A 3S9CA 1Y3WA 3K2UA 1JXPA 1P2JA 1ZYOA 4IN2A 2M0ZA 4A1XA 2LP6A 3GABA 3GYLB 1WQSA 1UCYH 4LOYH 2O8UA 3LPRA 5AVDA 1SHYA 1BFEA 5DP4A 2IWNA 2NWNA 4JCNA 1IQMA 1BDAA 3PROA 4FUIA 3TH3H 4JYVH 3KEEA 4NMOA 2BQWB 5DG6A 4Y79A 1GJ9B 4UEHH 5LGOA 3GCTG 3IWMA 1A0LA 2HE4A 4CR5A 2P93A 2OQUA 2AIQA 2GT7A 8GCHF 1P11E 3JZ2B 3E16B 3PLBA 2VWRA 3BTEE 1O2UA 3SUGA 3ZZ7A 2JOAA 1EAWA 4Q4LA 3SZEA 2BB4A 2EDZA 3FY5A 1O2LA 1NFWA 3CBZA 4JK5A 1V2OT 5FX6A 3SU5A 2J98A 1JRTA 5T6FA 1DM4B 4Y8ZA 3OU0A 1SSXA 1T8MA 3EGGC 1SGTA 4X8UH 4ISOA 1MCTA 2EEHA 2AINA 2I6VA 5HDYA 6CHAB 1GHVH 1Y3XA 1C1NA 2CF8H 1TRYA 1BTZA 1T2MA 3SHCH 1Q7XA 5EODA 1TGSZ 1WIFA 2WPJS 3MQKC 4AOQA 1OWJA 2VIDA 1UVSH 2CHAC 3RXLA 4K6YA 2FP7B 3ATWA 4UFGH 2IWPA 3SYJA 1D9IA 2H2CA 3ZVAA 3SV6A 1W3CA 2GDEH 2JETC 1BRAA 2O8LA 8ESTE 3LGYA 1E34B 1SKYE 1HYLA 3MFJA 2P3TB 2VGCB 2ENOA 5HKKD 3P70B 4NG9H 4DIIH 2ZFQH 2PSXA 2CSJA 5KGOA 3M5LA 1O2IA 5E2OA 2KPKA 2OC1A 3E3TA 5F03A 5FBEA 2D92A 2HGTH 2B7DH 2KCAA 1TGBA 4AG1A 1TRNA 5DP7A 2AMQA 2QGRA 5HYOA 1ZJKA 4NSVA 5C1XA 3VB3A 2V35A 1FY3A 2A4OA 3LT3A 1NTEA 1SC8U 2TGAA 3M7UA 4JZFH 1RGWA 1T8OA 2FI4E 3F9HA 1QB6A 5JDUB 2XBVA 5HIYA 2IWOA 3A8DA 5E8EH 1CHGA 4JOPA 1V2NT 3U69H 1AVXA 2KX4A 3U8OH 2XTTB 3BTFE 2LC6A 4JJ0A 1YF4A 3ATIA 1ELAA 3O8CA 5HF1A 3CBXA 1W0YH 2P16A 2FXRA 1B8QA 2ALPA 2Z3EA 2BX4A 1G2LA 3LC3A 4MPWA 3TU7H 3BPUA 4P00A 5JBTA 1P57B 5GXPA 3SHWA 3RXEA 1LVBA 4D9QA 1ZOMA 2J5UA 3KZDA 1HAGE 4KFVA 3MH7A 1IQNA 1RD3B 3FZDA 1HJ9A 1J17T 2K0QA 2UWOA 1UF1A 2Z6BD 2D8WA 3SUEA 4Y0ZE 2Z94A 3LC5A 1AUJA 1EPTC 2GTBA 2ZHFH 3E90B 1HPGA 1W14U 1FJSA 1MH0A 4K8YA 2HNTC 2RCZA 3A88A 3CS0A 2G5VA 4IC5A 1FC6A 4I33A 3KN2A 4INHA 2LNCA 3V12A 1C1SA 2W3IA 1P3EA 1NO9H 2DE9A 2JKHA 3H7OA 3ZZBA 1BOQA 3RMLH 2BXTH 1IAUA 3Q3KA 2I0LA 4AFQA 5GCHG 1BUIA 1ZSJA 1GHAF 3A84A 4RT1A 2FI3E 5LPFA 1SGDE 4YM9A 7GCHF 3ZVGA 1SGNE 1AO5A 3STIA 1YC0A 1LPZB 1HXFH 2F5YA 3ZZ5A 1DPOA 1NROH 1TNIA 3ID4A 5EJLA 3VXEH 1EJAA 3ZZ4A 4NXQA 1DANH 1GHBG 1KTTB 2FI5E 1SOTA 1O2OA 4YLQH 2EGOA 2FS8A 1P06A 4UE7H 3QK1A 5F67A 1XUIA 3SNBA 1WTHD 3ZYEA 2BD7A 1ZUBA 3QGJA 5B6OA 2HNTE 1INCA 2IN2A 1CT4E 3Q76A 5DTHA 1U39A 1FAKH 3SI4H 2XWAA 2ZDKA 1XZ9A 1JOUB 3MNSA 1GPZA 1Y59T 4ABJA 4E06H 1QGFA 2EI8A 2VVUA 1FIWA 1NESE 5GWZA 1TE0A 2DLSA 2G5NA 1ELTA 1O35A 1H1BA 5FBIA 3RXIA 1MAYA 2R2MB 3NRLA 5G4BA 1SQAA 2FLBH 1AD8H 2C8YB 3RXVA 3SUFA 1GVZA 4UU5A 1V2JT 1AVWA 1UEWA 1VCWA 4YTAA 5DKMA 4E34A 1YBOA 2ZKSA 1N7EA 3P6ZB 3ZVEA 3U9AH 2VIQA 2ZDMA 1VITG 3RU4T 3VPKA 2PKSB 1GCTB 1RRKA 2ZWLH 4YESB 2CMYA 1UVUH 1RZXA 2GVFA 2VWMA 3SQHE 4Y0YE 1C5PA 2V90A 1EOJA 2W4FA 2SGPE 4WH8A 1FIZA 1J8AA 4HI3A 1GMDG 1UTKA 2KAIA 3BG4B 3ZVDA 1W10U 1GHWH 1LDTT 4GAWA 2NU3E 1GDQA 2F9UA 3PMJA 2A5AA 1GBAA 1P0SH 3UWJH 2L74A 3WWBA 4ZHLU 1GMCF 4XBBA 1DWEH 2GCTB 2EAQA 5E2PA 2QKTA 1GHXH 1DS2E 1UW7A 2FIRH 3VQFA 1ZHRA 1NFUA 3A7WA 2PTNA 2WHXA 1GHYH 1MKXH 1P05A 1HXEH 1BMFD 3RM2H 3GGEA 1P01A 3GOVB 1ETTH 1VGCB 1B0EA 3I18A 3GYMA 1PQ5A 5CHAB 3A87A 1W9QA 1NPMA 3DSOA 2RA3A 4GLYA 3LKWA 4THNH 2FOFA 3F1SB 3EA9A 3HVQC 4L8NA 2FN5A 1HCGA 1WFGA 3R69A 1C1PA 3SU0A 4OS5A 3K65B 4B6EA 1TNJA 3SU1A 2IWQA 1QHRB 1BT7A 1D3TB 3QDOA 1YLCA 2EC9H 1EZUC 3HK6B 2SGFE 1D4PB 2JXOA 1EKBB 1NU7B 1TX8A 4U01A 4N6XA 5EJ1A 1WI2A 1NY22 1T32A 2JILA 4K69A 4X1SU 5E0JA 3PO1B 3SGAE 3TJVA 1QBVH 1XUKA 2FLRH 1AWFH 1GVKB 5FB8C 2H3MA 3LGUA 5A0CA 4I8GA 3SNDA 2QF3A 1FPHH 4M9FA 5E0HA 1JBUH 1HAZB 1LHFH 3S9BA 1XXDA 3F68H 3RC4A 4DOQA 2IJOB 3STJA 1XKBC 1D3PB 2QE7D 2Z3CA 3UQOA 1CBWB 1C2IA 4HOPA 4JORA 3K82A 1BMNH 2KCYA 5C3NA 2HWLB 1K2I1 1K1OA 7LPRA 1SOZA 1TB6H 1V5LA 4E3BA 1ANEA 2GCHF 1GM1A 3SOEA 1H8HD 2ILNA 2ZGHA 2ZU5A 1WHAA 5DN6D 1O3EA 2BY8X 2PKAB 1BRCE 2ZCHP 3C1KA 1OPHB 1YCPK 1Q3OA 4JL7A 1PQ7A 2Z9JA 2J34A 1A0HB 1ZTKA 3BTWE 3HK3B 1UHBA 4FOUC 4H4FA 3CBYA 8GCHG 4Y11E 2BDAA 1HJAB 4OS7A 4TPIZ 3L4FD 2D8IA 2Y5FA 2AFQB 2D2DA 2RG3A 4DG4A 4NNMA 3MH4A 1YY3A 3TNSA 2J2UA 2BDBA 1QL9A 1K32A 1GBDA 4B6FA 2KJKA 2M2AA 5HMAA 1Z87A 1YPEH 3L6PA 1V2MT 1Y3UA 3GS9A 5C1YA 3NUMA 1WSSH 2JH6D 4SGBE 5HFFA 2VU8E 3M3VA 4Z1MD 5LH8A 1CU1A 1GBTA 1SLUB 2BOKA 1W9OA 4HG6A 3KHFA 4B1TA 1XXFA 4X1QU 1TX7A 1BCUH 1BTPA 1RXPA 3OTPA 2BVRH 3BSQA 1MKWH 1GCDA 3BEUA 4Q7XA 4AYYB 1SMFE 2EY4C 1TRMA 5C94A 4U30A 1EXFA 2PKUA 1S5SA 2Q6FA 2YNBA 4AX9H 4EDJA 3OE7D 3QLPH 7ESTE 5EJZA 3W1EA 1E79D 5FX5A 1PYTD 1BB0B 1A61H 2FX6A 1O5CB 3H5CB 1AE5A 1LO6A 1NBMD 5FXLA 2ZQ1A 1V2UT 4ZH8A 2GGVB 4ZXYH 3QZRA 4X6PA 3GCNA 3TGJE 5F8XA 1CT0E 2H5CA 3SI3H 1P09A 2M0UA 3KHVA 1ZGVA 4CBNA 4ASUD 2LPRA 3HPMA 3SORA 1UTLM 2BDGA 1TGNA 1C5RA 4K72A 2EGNA 1VKYA 4ISHH 2M5TA 4ISNA 1YPKH 3KQCA 2Q3GA 4IS5A 2O8MA 1RY4A 1JIMA 2J98B 2ZDVH 1QAUA 3DJ1A 1GBJA 4TWWA 1G37A 2GV7A 5DP8A 4FUEA 2ANKH 2FOMB 1WDIA 1TIOA 3MNBA 2FTLE 4Z0KA 1JWTA 2GP9B 1FI8A 3FVFB 2ANYA 4DT4A 3SHAH 5K0HA 1HAXB 2HLDD 4ABDA 3DORA 4DY7B 4I8HA 3N7OA 1ZOKA 2P94A 2UWPA 2ZPMA 3RXJA 2EI6A 3LDXH 4ZKNU 2YT8A 1KLJH 4XBCA 4U32A 2Z9LA 1UK2A 5DK1A 2ANWA 2EEIA 1V3XA 2Y7XA 4FUFA 3ESTA 2WYJA 3QDZB 4OS2A 4O06A 1C2MA 1XKAC 1SLVB 3PMBB 3NFKA 1GHAG 1AIXH 4WXIA 2H9TH 3SO3A 3R0FA 3UR9A 4NXPA 2CN0H 2ZPQA 7GCHG 1ZPCA 3A81A 4YT7H 4JOKA 1EJMA 1O3PB 2AIPA 4KTUA 2Y82A 3N99A 1M9UA 4GUXA 3ATLA 4BTTB 2NU2E 1J9CH 1YWUA 1AFQB 4ZHMU 2XNIA 4DIHH 1FONA 4Y8YA 2A2QH 2YMSD 1LHDH 2WUCA 2Q6DA 1N6YA 1XUJA 1OP8A 3KIDU 4AFZA 1ELGA 1P2OA 1S0RA 3V13A 4GVCA 2F9BH 1EX3A 4J1YA 3VXFH 5C5OA
chains in the Genus database with same CATH topology
1O5DH 3RP2A 1PPGE 1T4VH 1V2WT 1K21H 4B75A 2FO9A 2WPIS 5HFDA 4AB8A 1RJXB 4K8BA 4YDPA 4YOGA 1CVWH 1UFXA 3MO3A 4D7GA 3AASA 2CJIA 2O2TA 2FESH 3QWCH 1VR1H 2SFAA 2PHBA 2PTCE 1V2ST 1QQ4A 3SGQE 1NZQH 1AGJA 1HBTH 1TPAE 1MUEB 3QX5H 3UNQA 3PDZA 2ODQA 1ELDE 2A7HA 1C4U2 3M5OA 2GMTB 2KBSA 4Y7AA 1WG6A 1RS0A 1XVMA 1FZZA 3NZIA 2M0VA 4JOFA 4K60A 2VPHA 1MQ5A 3SGBE 2G4TA 5TCCA 1BHXB 2P59A 1C1WH 4IN1A 2OZFA 2ZDAH 3RXGA 2R0LA 3Q3YA 2PKAA 1A5HA 3BF6H 1S85A 5E0GA 1UVTH 1YCPH 1O2RA 2C93B 2HALA 4KFWA 1O2TA 1X5NA 2P8OB 3SJ9A 3CC0A 2C8XB 2IPHA 1O2SA 1OWKA 3T2NA 1GMCG 1W0ZU 1W7GH 2EJYA 2GEFA 3PTNA 4MNVA 1IQGA 1NRRH 4WF8A 4K75A 3ZZ3A 3ZVFA 3DA9B 2CF9H 1A1RA 1TA6A 1NFXA 3SJIA 4TWYA 4CR9A 5A8ZA 1TA2A 1AE8H 4LK4A 2PNTA 1TQ7B 3PV4A 2P3WA 1QBOA 1N8OB 4K2YA 2J95A 2JREA 1NRSH 3UY9A 1X5RA 1GI1A 1O3DA 3QN7A 3S0NA 3RDZA 3DFLA 4FUCA 1KXDA 2BYGA 1O3OA 3NCVA 5E22A 2XWBI 2BD5A 2QAAA 2B5TB 2DAZA 1D5GA 2Y5GA 1BITA 1E38B 1ETSH 2QXHA 1C1RA 2ZHQH 4INKA 2OC7A 1CA0B 3PWCA 4WY3A 5E1YA 3SNAA 2AMDA 4J2YB 3NK8A 4PQWA 4AB9A 3I78A 1TNGA 2V0BA 5C5NA 1LKAA 3A89A 3LONA 1YKTA 4HGCA 4A5TS 2ZP0H 1EZSC 2OINA 5GLJA 4FUGA 1D3DB 1ORFA 1CE5A 2A4RA 2D26C 1C2JA 1SFIA 1UVPA 1ZMNA 2HRVA 2VIVA 3MOCA 1FMGA 1L1GA 1THPB 3A86A 3A80A 3RXTA 2OTVA 3BN9A 1NF3C 2J9NA 2F83A 4NA8A 2KAIB 3RUOA 4NXRA 2KPLA 4Y6DA 1QJ1B 1W7XH 1G9OA 1C5UA 1HAOH 1TPOA 2PA1A 1C5XB 3FANA 1L4DA 3C27B 2BM2A 3RXBA 1DITH 5EW2H 4E7NA 2GCHG 1AB9B 2FOEA 4X6MA 3SFJA 3VB6A 5J4SA 1SGIB 2SGDE 4AGKA 2V3OH 1C2FA 2PFEA 4WYTA 2EEJA 2M3MA 3NGHA 1MKXK 2YT7A 3DT0H 5HM2A 4XHVA 3ZV8A 1HJ8A 4ZAEA 3DD2H 1QLCA 3QJNA 2LOBA 5HF4A 1MU6B 1C1UH 3D23A 4D7FA 1LVMA 2K20A 2SGQE 4NIXA 1OOKB 2BLOA 2JIKA 4NIVA 4CHAB 2H9HA 1MD7A 5DP5A 1TOCB 3LGVA 1C1QA 3A7VA 1ELCA 2ZHEH 3GDUA 3GY4A 1C1TA 3BTHE 3S69A 1O3IA 2STAE 1C4V2 3OSYA 1GGDB 1EATA 2BDHA 3RXKA 5G1EA 1QA0A 5JPMH 5A09A 2OPGA 1BJUA 1RTKA 2VH0A 1ZJDA 1J16A 3M5MA 4ABEA 3SN8A 1SGCA 4KGAA 2AS9A 1IQEA 1WV7H 1V2RT 1N6EA 1MZDA 2A45B 4MNXA 3SOSA 1CGHA 3VGCB 5HFCA 4BNRA 2SGAA 2G8TA 1P2NA 3E91A 3UOPA 3UQVA 1AZZA 2VVVA 1OYQA 1A5GH 1T4UH 2Y80A 1NC6A 1G9IE 4HOPB 1G36A 1QR3E 1TG