3MH4A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
343
structure length
301
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSNFIQTDAAINRGNAGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease do
total genus 57
structure length 301
sequence length 343
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh4A01
1PQ8A 1Y3XA 1IQIA 5FCKA 3LNXA 2L4TA 3UWJH 3PDVA 4XHVA 2VWLA 1V2VT 1A2CH 4DGJA 3SNBA 2GCHG 1O2IA 3RXQA 4AMHA 1O30A 3A7XA 1BHXB 2WV4A 3E1XB 1WQSA 3RXCA 1JIRA 2J9NA 4JZEH 2BDAA 1YPEH 3A7YA 1V5LA 1QL8A 1O3KA 3E0NB 4ZXYH 1O3PB 4MLFB 4Q6SA 3HK3B 2H3LA 4KFWA 2BDIA 1SG8B 2AH4X 3SHUA 1ZMLA 2W3KA 3D65E 1JOUB 3KN2A 3MFJA 2YNAA 1RXPA 2EGNA 1A5IA 3LDXH 3ZZBA 2ZDNA 4CH2B 3PM3A 5EOKA 2KAIA 4X6MA 1AVWA 2KV8A 1JMOH 4JORA 4NSVA 1GBTA 3SQHE 5DP4A 3QK1A 1BRAA 1U39A 1Q3PA 1C1NA 1GI0A 4JZDH 2LA8A 1DX5M 1AKSA 2IWQA 1NFWA 2OMJA 1GBFA 1ABIH 1EJAA 1TPOA 2GD4B 3NFKA 2G52A 2PKAA 1RGRA 3SNCA 4OGXA 1KYNA 1UHBB 1DDJA 2B0FA 2QY0B 3I29A 5DPAA 2H9EH 3SGQE 3TK5A 1XXDA 1CHOG 4RKJB 2R2WU 2ZPMA 1ELGA 1ESAA 2M0TA 1C5NH 1SHYA 1QURH 5A0BA 1BE9A 1G3CA 3VGCB 1GJAB 1QR3E 3SU2A 1G36A 5F6MA 3O8BA 4YLQH 1AKSB 2RDLA 1H4WA 2ZTZA 3WKMA 1O3AA 2JH0D 3LIWA 4TY6A 5AF9H 2RRMA 4YYXA 1UHPA 1ANEA 3NCLA 1T4UH 1TNIA 1T8NA 1C5SA 4R8TB 2CF9H 3TMHA 4YESB 1XZ9A 3UUZA 1P1EA 1YPHE 4ZUHA 1NO9H 4X0WU 1Y7NA 5GWZA 2Y82A 2BVXH 1A5HA 4CR9A 1O3DA 2W7SA 5JPMH 2FX6A 4HOPA 1HXEH 2CSJA 2BY5X 2FMJA 2Y7XA 2CMYA 2OCVB 2A7HA 3AW0A 1GI3A 1AVXA 4BXSA 1T8OA 3GY7A 2CF8H 2R0LA 2OBOA 2ZPSA 4JK5A 4MNWA 3RXSA 3DIWA 5GCHF 1OOKB 4RI0A 2ESTE 1UEPA 5HMAA 1F0UA 1LVBA 3IITA 3URCA 4IMZA 1O2LA 3IWMA 1A4WH 1C5XB 1S6FA 1EZQA 1MBMA 4FXGH 2BQ7B 1QL7A 1HYLA 1N7FA 2CHAB 4CRAA 1LPKB 1P8VC 1ZSKA 1BBRK 3LOXA 4BNRA 4I8JA 1PDRA 1C5WB 1V2UT 1ZR0A 3BTFE 3RMMH 2OZFA 5L30H 1F5KU 1HAGE 3PV2A 4HZHA 1K1PA 2IWOA 1L4DA 4FU9A 3SV7A 2A5IA 2CHAC 3TH4H 1ELCA 1SLXB 5DJ7A 3UWIA 1CGHA 2VVUA 4X1NU 4E3BA 1D3TB 3RC6A 4D76A 1GJ9B 1F0SA 1AI8H 2R3UA 1P05A 3M3SA 3SV8A 1AO5A 4FVDA 5JB8S 5EW2H 3RXHA 4ABIA 5C67A 2NU0E 1TGSZ 1YBWA 1AFQB 1B8QA 1EJNA 2IWPA 1IU0A 1P04A 1Y5UT 3P8OA 1HAZB 4F49A 4X1PU 3QX5H 1SOZA 1FN6A 1LHFH 1SLVB 3R3GB 4FVBA 6GCHG 1FZZA 2VSPA 1LHCH 5BPEA 4E05H 2D92A 2ULLA 1GI8B 1EATA 3PLPA 6LPRA 1E34B 4Y8XA 3EGHC 2PDZA 2FTLE 1Y8TA 5HFEA 2Q6GA 1FXYA 2ZU4A 1TRYA 3AW1A 3TPIZ 1GHWH 1O3LA 4Y7BA 3FAOA 2IWNA 1GBDA 1WF7A 3ZVDA 5HYOA 2KOJA 4UD9H 1Z86A 1EZUC 2ZCHP 3DJAA 1O2NA 3UREA 1BDAA 1TBRH 1MQ6A 2NWNA 2F0AA 4JYVH 3VQGA 1GJDB 2A0QB 2MX6A 1U37A 1O3GA 2O2TA 1O31A 1WBGB 1PFXC 4XOJA 2PUXB 4GVCA 3FY5A 4R0IA 2O8LA 1UM1A 5FBEA 1ELFA 5DK1A 4JYTA 5EGMA 1GBBA 2DM8A 1W13U 1Y59T 3TGIE 3GCOA 4CBOA 5B6OA 1C9PA 1NU7B 2EV8A 4AYYB 1QB1A 1TRNA 2ILNA 2WPMS 2ZZUH 5HFBA 1KTTB 4X6NA 1V2OT 4NMQA 3TJUA 2FO9A 4B2CA 1AQ7A 1C2MA 1U6QA 1SL3A 1NRSH 1UITA 1ZHRA 3HGNA 4GPGA 4CRFA 4Z33A 1C5ZB 3LNYA 2C4FH 3QZRA 2VIDA 4YDPA 3TSZA 2EDVA 3LPRA 3ZRTA 5HEBA 1YPMH 3VB3A 1GHYH 3ZVFA 4ZKOU 2DE9A 2ZWLH 4Y0ZE 4JOFA 1K32A 3AVZA 1ZPCA 4DW2U 2WINI 1NC6A 2VIQA 3HKIB 3HPTB 1SGPE 3A80A 4ZHAA 3GDUA 3DFLA 1C9TA 2BDHA 3P17H 4TWWA 3SZNA 3V7TA 6CHAC 3S9AA 1OKXA 4A1XA 3T5FH 1P01A 3PTBA 2V6NA 2OGPA 2ZA5A 2EEGA 4JMYA 4LZ4B 4K8BA 5JBCS 4NWKA 3ZZ8A 7GCHG 7GCHF 1UJUA 4H42U 3RXUA 1KDQB 2GDEH 2I6VA 1QLCA 1OWJA 3P92A 1C1WH 3VEQB 5E0JA 2P8OC 3EA8A 2OPGA 2BD9A 2QAAA 2FP7B 1EJMA 3O8DA 4D9QA 3CC0A 1N6YA 1EASA 2SGAA 3LGIA 1O5CB 1Y5AT 3TU7H 3JZ1B 1NU9A 1LPGB 2ZU2A 3ZVAA 1TQ7B 2FS8A 3RXPA 1UCYH 1XXFA 4RKOB 1L6OA 2M0VA 1Q7XA 7KMEH 1BTHH 3S7KB 5D13A 4DT7B 4IGDA 2ZIQH 3RXLA 2ANYA 1RTFB 2M0ZA 3GY5A 1ZJDA 3SU0A 1V62A 1AZ8A 3GY3A 3EQ0H 2FI3E 4N6XA 4K6YA 3DORA 5HF4A 4H11A 2VH6A 1G9OA 4CR5A 3SJ8A 2BYGA 1TBZH 1RTLA 4I7YH 5SGAE 3MNCA 2DMZA 4U2WA 1GL0E 1ZZZA 3SUFA 1XUIA 1P2KA 1VITH 1OBZA 4P0CA 3U8OH 2AINA 5GNDA 5HFCA 3RXFA 1ETTH 1SGTA 1MCTA 3RXGA 4Z0KA 1W3CA 4ZHLU 1G2MA 3B76A 2Z9KA 3QN7A 4GVUA 1S84A 2UUJB 4INHA 7ESTE 4QT8C 5HM2A 2LC7A 3RU4T 3TSWA 1TNGA 5EZ0A 4THNH 2FIRH 3RL8A 3GDSA 1YPLH 2KJKA 1UJVA 3PROA 4ABFA 1P06A 3LGYA 1MQ5A 2A4OA 4O97A 3ZZ5A 4MQAA 1UVUH 4JK6A 1CT4E 1ZTJA 3VB4A 1UK4A 1LPZB 2A31A 3NWUA 1VA8A 2FN5A 1O2XA 2CV3A 1TPAE 5DKMA 2HWLB 4AZ2B 2O9QA 1AHTH 2HE4A 1GG6B 3PO1C 1ELBA 4B2BA 2F9OA 5JBAS 1C1MA 1BJUA 2KJDA 4KTUA 2BLWA 3SV6A 4GHNA 6GCHF 1VITG 3A7TA 3RU4D 1W0YH 2D26C 1KXAA 4XFQA 3R0HA 1Z1IA 4OGYA 3D49H 1CU1A 2Z9IA 1ANCA 1O2KA 4CRCA 5LPEA 3A82A 2ZHFH 1P2QA 1WQVH 2HVXA 1CBWC 3AAUA 3BV9B 4MVNA 2SGQE 1L1JA 1SGYE 3MU1A 3VXFH 3RXBA 2W4FA 3MOCA 4ABEA 3E17A 5TCCA 1KXEA 1WOFA 3UPEA 2UUFB 1GHBG 3VQFA 5FAHA 4X6PA 2ZDVH 2PKSC 3UQVA 1O3MA 1W11U 4B76A 1K21H 1F0TA 1O38A 1RIWC 1CQQA 2AERH 1QGFA 2H3MA 1C4U2 2P3UB 4MPVA 3SORA 1XX9A 4WJG2 1PPGE 3A7ZA 2FE5A 1UVTH 3MH4A 2BX4A 3QE1A 1AWFH 1QAVB 3STJA 2WUCA 1GI4A 2FLRH 2ANMH 1WV7H 3KZDA 1J15A 1P57B 2QGRA 1WI2A 4ISHH 2A32A 3S9BA 2QXHA 3AAVA 3KQCA 3T28A 3R68A 1C4V2 4I8GA 2EEIA 2QC2A 1XUJA 4KTCA 2DAZA 5IDKA 1V2RT 2QF3A 1QL9A 4H6TA 4JYUH 1HJ8A 1CT0E 4E7RG 5C2ZA 1ZRBA 4HFPB 1W9QA 1IQNA 2B7DH 1C1RA 3FP6E 1RFNA 2BMGB 1DUEA 4SGBE 1MH0A 2TIOA 1TA2A 3P8GA 3SHAH 1ARCA 3U69H 1WFVA 1K1NA 1FY4A 2ZDKA 1NT1A 1X5NA 2VPHA 2K1QA 1P1DA 4X6OA 3A87A 5EPYA 1QAVA 4JOHA 5F67A 4UFEH 2XBVA 4WY3A 5ESTE 2BZ6H 5EQQA 1EAWA 1TONA 3ATLA 1GDNA 3BIVH 2FODA 4XBCA 4IC6A 1VCWA 2GMTB 1UMAH 2AMQA 4AG2A 4AFQA 4GAWA 1UO6A 2UWPA 3GDVA 1CA8B 3NGHA 4FU7A 5G1EA 5A8XA 3SJKA 3ATKA 2KJPA 2XC0A 1ESBA 4AG1A 2GMTC 2BDGA 1TBQH 3A81A 2FOAA 5FPYA 4ZHMU 4O3TA 1NRQH 2I1NA 1J16A 4BTTB 1C2JA 2Z3EA 4CRDA 2ZGJA 1GGDC 4JCNA 1P3CA 2I0LA 1MD7A 3OTPA 2Z17A 2MHOA 3BPUA 1B7XB 4IS5A 1BMMH 1XUFA 1UF1A 4NFFA 5HETA 1XM1A 1DVAH 4PQWA 3DA9B 1C1PA 2ODPA 1EB2A 5EW1H 2SGFE 5F03A 4VGCB 2WV5A 1OZIA 3RC5A 1FJSA 2BY7X 4KELA 4ISOA 1GQ5A 2OC1A 2BOHB 4TYDA 2UUKB 2F9VA 4NCYA 4Y79A 4I31A 2HPPH 1MKXH 1OWIA 4MTBA 1THPB 5F8TA 2RCZA 3ZZ9A 1C2EA 1LHDH 2PLXA 3O46A 4AOQA 1PPFE 2HRVA 1WH1A 5C3NA 1C5VA 3MU5A 2ZGCA 4A92A 1GBMA 1VB7A 1CSOE 2J4IA 2ZCLP 2CS5A 3HATH 4K60A 1GJ5H 2A45B 3K82A 1C5RA 1NM6A 3BEFB 3BTWE 3UOPA 2GV6A 4U30A 1DE7H 1Z1JA 5EQRA 2BYAX 4AN7A 2C8XB 3GGEA 3ITIA 3SHWA 4WYTA 4I33A 4Q7XA 3MO6A 3TIUA 1AZZA 4LXBH 2GCHF 2H9HA 3PMHB 5I25A 2V0BA 2ZDMA 2V3OH 1HAHH 2GT7A 2VSVA 3WKLA 2ALPA 2R9PA 1AVGH 5GPIB 3CBZA 4Q2PA 2Y81A 5E0HA 1P03A 1TGNA 2VB0A 1YPGH 4E06H 4UU6A 1LO6A 5JBTA 2Q3GA 2HPQH 2VGCB 5DG6A 1UVOA 2PZDA 1GHXH 3ZYEA 4REYA 1FMGA 3B9FH 1DOJA 3PB1E 1S81A 3M5OA 5EPNA 2FNEA 3E0PB 2ZFPH 3PLBA 4AX9H 1A0JA 3HGPA 2QKUA 5EQSA 3ID1A 1UVSH 3ATWA 1O3HA 2VJ1A 2KL1A 2G5NA 1G37A 2ANKH 5FPSA 1X45A 4X1QU 4X2XA 1AB9B 1PPCE 5EYZA 3UY9A 2Y5FA 1BBRE 2ZTYA 1L2EA 1SR5C 1ZMNA 4O3UA 2QV1A 5FBIA 3RL7A 3A84A 5FXLA 1UEZA 1LQEA 1W9EA 1P09A 3SBKA 4O9VA 1FC6A 2EDPA 2BD7A 1EUFA 5K7RA 2G5VA 1C1QA 3EGGC 3QIKA 4TWYA 1O2VA 2V3HH 3PWBA 3NFLA 2BM2A 5HFFA 4KGAA 3SUEA 2XNIA 3M3VA 4I8LA 5FCRA 2BTCE 1K2I1 3I4WA 4MNVA 1C4Y2 1KIGH 5HM9A 4GHQA 1UCYE 1BTPA 4Q80A 5GDSH 1EAUA 3Q3YA 2OQ5A 3B23B 3BEIB 1OWHA 3SUGA 1NFXA 2PHBA 1EAIA 2G81E 1TGBA 3TVJB 2DLUA 1C1UH 9LPRA 1GMHF 4GCHF 2AYWA 1N8OB 1DFPA 3A89A 4X8TH 2V90A 1S85A 2O8MA 1Z71A 3LT3A 2YTWA 1E36B 5A2PA 3GY4A 3RUOA 1SHHB 1HUTH 4OS6A 2JOAA 1OWDA 3C1KA 1HV7A 3PDZA 3Q3XA 4L8NA 3G01A 1O3BA 3L6PA 2PFEA 3RXJA 2GZ8A 3DT0H 1LKAA 1XUGA 4HOPB 2ZPQA 2YOLA 2L4SA 1O2ZA 2D8WA 1EQ9A 4MNXA 5EXLA 3SU3A 1Q3OA 3HPKA 2OSGA 5DP9A 5A2MH 1QQUA 4CRGA 1HCGA 2H9TH 2DUCA 1BB0B 1DWCH 1OX1A 4MDSA 4U32A 1PQAA 2AWXA 2VWOA 4FUDA 2PTNA 1GHBF 3SFJA 1MKWH 1OP0A 3P95A 1UTQA 3BN9A 4JL7A 3RM2H 3SI3H 1QB6A 2P94A 4DOQA 2KQFA 4K69A 3V3MA 4JOKA 5HEYA 4JOPA 2AFQB 2STAE 5TCAA 1DSUA 2AMPA 1C5LH 1ZJKA 5EXMA 4E34A 1TX6A 3T25A 3GJ9A 2BHGA 2JETB 1B5GH 5ETXA 2FX4A 3BIUH 4MPWA 2C8YB 2ZNKH 3I77A 1HB0B 2WPIS 4AYVB 3KQBA 3L4FD 4RN6A 1SFIA 3TLOA 3D62A 3K2UA 1C5UA 1YCPH 1HAOH 2FYRA 1O34A 3PMJA 1Z6JH 1TX8A 1NESE 2ZPRA 1T2MA 2LNCA 2XBYA 4GHTA 3ZZ4A 3O5NA 2G4TA 4D7FA 1W0ZU 3RLWH 1V2ST 4Q7ZA 1PPZA 1TALA 2VIPA 3ATIA 3ZV9A 1GL1A 5DGJA 3R69A 5JB9S 1Z8RA 2BVRH 2M5TA 2QA9E 3LKWA 1HAIH 1D9IA 1Z8JB 1X6DA 3UNQA 1CGIE 1GBIA 2B9LA 1UCYK 1W2KH 1O2SA 3ZVEA 4ABGA 2Z3CA 3S69A 3PV4A 1BMLA 4UFDH 1LKBA 1AFEH 3GSLA 3FZDA 2ODQA 1W7GH 2EEHA 1UJDA 2ZDLA 2ZTXA 5HGGA 1IQHA 1O2PA 4LMMA 3SU5A 1UTJA 5H4IB 2Q9VA 1FN8A 2A7JA 3CENA 1V6DA 1JXPA 3E16B 2JINA 3NUMA 5T6FA 1NF3C 1DANH 4AGJA 4BAMB 5E11A 5HF1A 3DUXH 1GHAF 2HNTE 1L1NA 1QTFA 1WYKA 4NFEA 4XE4A 1MTVA 2RA3A 1CO7E 1G2LA 5ESBA 1KTSB 2GGVB 4B75A 1TNJA 1BTXA 2OQSA 2ZCKP 3GYLB 4BXWA 3U8RH 4Y6DA 1A5GH 1N1LA 2TGTA 1MFLA 2R3YA 1F7ZA 1NZQH 1YLDA 1EPTA 2KAWA 3RXAA 1K1OA 1XKBC 3KQDA 1ELVA 1TOMH 2VRFA 1BMNH 1N99A 2BX3A 2Y5GA 1X5RA 1P0SH 3QLPH 1O39A 2G51A 3MWIU 3RXDA 4X8SH 3LU9B 5HEDA 1PYTC 2HGAA 3VGCC 3H7TA 1S6HA 1U38A 1E0FD 4I8HA 1NN6A 1GJ4H 1QNJA 1UTOA 3F9GA 1LHGH 3HK6B 1BRCE 1CHGA 3KF2A 2C8ZB 1J8AA 1FONA 1SVPA 1H8IH 2IPHA 2I0IA 4X2YA 4KKDA 1OYTH 2ZGBH 3NXPA 4ABHA 5CMXH 4Q2OA 3TJNA 2Z9LA 3NPSA 1Y3UA 1A3EH 4Q2QA 2FYQA 4F8KA 3TK6A 4NIVA 3RU4E 4NWLA 4UDWH 2W5EA 4OEPA 4INKA 1W9OA 5DP6A 2X7ZA 1D6RA 1IHSH 5J4SA 3TGJE 1MUEB 1KXFA 1ELTA 1TLDA 2FOHA 1G9IE 1D3QB 3OY5U 1QIXB 3GCHB 2AWWA 1WHDA 2JXOA 1O3FA 1V2WT 4H6SB 4A6LA 2BD2A 4JZFH 1HBTH 3A8AA 2QG1A 1ESTA 1O2TA 3GY6A 1E38B 2AGEX 3UTUH 3ID3A 3LGUA 2ASUB 2XCFA 2TGDA 3QUMP 2GZVA 1ORFA 3TNTA 5TJXA 4O03A 1DT2A 1VCQA 5A09A 3EA9A 4A1TA 1H1BA 3VB5A 4Q7YA 1SC8U 4ESTE 2PSXA 3NK8A 4B73A 1DXWA 2Q1JA 1BHXF 1D6WA 4TPYA 3S9CA 1OWEA 1DY9A 5AVDA 1VJ6A 2OS6A 5T6DA 2P59A 1O3NA 1TMUH 3GICB 2JWEA 1CA0B 2VVVA 4I32A 1UK2A 4ABDA 1PQ5A 1ZPBA 1G30B 3K6YA 8KME2 2JETC 1WG6A 1MKWK 1GHVH 4PROA 1TFXA 2ODYB 2GKVE 1K28D 3QO6A 1AE8H 1P9UA 3RMOH 1L0ZA 1O2OA 1O5GH 5EXNA 1V6BA 2H2CA 5AFZH 2RG3A 3RXIA 4YM9A 1YF4A 1GBAA 3KGPA 5EODA 2ENOA 1IQMA 1KXBA 3MYWA 2C90B 1MC7A 1Q31A 4CHAC 1GBEA 2FZZA 4BAKB 2YNBA 5EU8A 4ASHA 2QXIA 3SW2B 2OUAA 3SGAE 5E2PA 4AFZA 2ZQ2A 3SU6A 3P70B 1TABE 1UTKA 1MBQA 4FUFA 3KIDU 5L2ZH 1IOEA 2DC2A 3BTQE 1K1LA 1GBCA 3OSYA 2ZU1A 1DM4B 5I7ZA 1SGIB 1GHZA 1SGRE 4XSKU 2XW9A 1RGQA 1HGTH 2BD3A 2UWOA 1E37B 2V35A 2VIOA 3K65B 3KEEA 4B71A 1FPCH 3M35A 4TPIZ 4FU8A 4OS1A 1FY1A 8GCHG 3QTVH 5JXBA 2QXGA 2VZ5A 3F9FA 1RGWA 4BAHB 2TPIZ 1SQOA 1LVOA 3S0NA 1O2UA 2BQWB 1JBUH 2Y6TA 3M7UA 2Z7FE 1TQ0B 1P3EA 2A4RA 2GCTB 4Z8JA 2A5AA 2EEKA 2ZFRH 2HLCA 5LPRA 4OAJA 1QA0A 3ELAH 1SOTA 1ZSLA 2QKTA 1MTNB 2GVFA 1IQJA 1S0RA 3ID2A 2FI4E 1UM7A 2LC6A 2BDCA 1BJVA 1V5QA 2FOBA 3NZIA 1YP9A 2BQ6B 3ZVCA 3MU4A 4ISLA 1CE5A 4WYUA 4D9RA 3JXTA 3LJOA 4WVPE 5HDYA 1UJ1A 1BFEA 2BDYA 1P2IA 5A8ZA 1MKXK 2ZEBA 1RS0A 1PQ7A 1BA8B 4JZ1A 2PA1A 1TP3A 4R2ZA 3DHKH 1M5ZA 3T26A 1Z8IB 8GCHF 5BRRE 2ZFFH 4DJZB 1TP5A 3BG8A 1XUKA 1SGCA 3DJ3A 1TPSA 4JZIA 1C5TA 1UTPA 1WHAA 1KWAA 3A83A 5AFYH 1GI5A 3A88A 1PPEE 5A0CA 2R2MB 4CBNA 1WUNH 2QXJA 1TE0A 1K1JA 3VXEH 4NIXA 1EAXA 2GT8A 3Q76A 3RXMA 2UZCA 1O32A 4GCHG 3M5LA 4AGKA 2FM2A 3CBXA 2VGCC 1GPZA 2WYGA 3RMNH 1X7AC 1H9LB 1FAXA 1UEQA 3MH6A 2ZFQH 1O2QA 2EXGA 5A8YA 1O3EA 1GCTB 1W10U 1N7TA 3P8FA 2BVSH 1NY22 1D3DB 3WY8A 1SBWA 1HJAC 3JZ2B 1V2JT 4DG4A 1FCFA 5H3JA 4NA8A 1MTNC 4A1VA 1YCPK 1ZGVA 4OS4A 3V0XA 5FHTA 4EDJA 1MMJN 1OP8A 2WPLS 2G00A 1FPHH 4IN2A 1IHJA 1ZOKA 2EI6A 3AXAA 3ZVBA 1HJAB 4GSOA 2BB4A 1HAYB 1S5SA 2FOGA 1AN1E 3TH2H 1BMAA 1TGTA 4FUJA 1WF8A 2ZF0H 3GY2A 2H2BA 1DS2E 1DWEH 1IQEA 1B0EA 2W7UA 3EYDA 1DICA 4A7IB 2Z6BD 1SLUB 1QCPA 2GZ7A 3TK9A 4LK4A 2XWBI 1AUJA 2KPKA 1O5AB 4NA9H 1O2YA 1SI5H 3PO1B 2XRCA 1AIXH 3T62A 1GMHG 1WTHD 4Y0YE 3SNAA 2FOMB 3KZEA 2F91A 3I18A 2K1ZA 1GCDA 1IAUA 1SB1H 4CH8B 1EZSC 2BD5A 4Q3HA 1HNEE 2JIKA 2M3MA 4WH6A 2QN5T 1C1VH 1A1RA 1WIFA 2ZHWH 2REYA 4GVDA 3L3TA 2BDBA 3A8CA 3M36A 4I8KA 2AGIX 2OC7A 2Q6FA 1GI7B 3GCTG 4K5ZA 2AEIH 2QKVA 2P95A 1FC9A 3I1EA 3OY6U 1FIWA 2ZFTA 4LZ1H 2W3IA 3CS7A 1CBWB 1DUAA 1HFDA 5DP3A 5PTPA 1SLWB 1UEWA 1QRXA 1GMDF 3F68H 1QJ1B 2IN2A 1W14U 1P2JA 2PSYA 1BRUP 1KXCA 4YO9A 2WL7A 4J2YB 4NMRA 1SPJA 4K1TA 1GCTC 2VIVA 1IQKA 1HRTH 2TBSA 1NROH 2H2ZA 3A7VA 4YLUA 4OS2A 4X1RU 3M5NA 1DITH 1GDUA 1AUTC 3ZZ7A 3SNEA 2EAQA 2KA9A 3A86A 2AIPA 3I78A 3QJNA 4M7GA 3GYMA 3RXVA 1T7CA 1OS8A 2HNTC 2PKUA 2WPJS 5IYTA 3M5MA 1C1TA 1BQYA 5LGOA 1OBYA 5B6LA 3MNBA 1TWXB 2XYAA 1ZRKA 5HJ1A 1VCPA 1ZSJA 4HI3A 1XVOA 3BTME 1C5OH 5EG4A 3ID4A 1ZTLA 2JILA 1SQTA 3A8DA 3UOUA 1QJ6B 1LQDB 1O36A 3CYYA 3ESTA 4NMOA 1AE5A 3ZZCA 1VJAU 2SGPE 2ZECA 5F3XA 4AFSA 1GVZA 2DE8A 2QYIA 2A4GA 1YM0A 5HFDA 2QCYA 1UFXA 3LC5A 1P12E 4ABJA 1F2SE 3P6ZB 5L6NH 1O5FH 3A85A 3EDXB 2J95A 3UNRA 2SNWA 1V2LT 4UU5A 1MAXA 2AMDA 2OXSA 1GJ7B 4CRBA 2LUIA 1FY5A 3PMBB 4FGMA 5E6PB 4DVAU 2D8IA 1GI1A 1TNLA 4MPXA 3HVQC 1BITA 1F92A 1AU8A 2NU2E 5L2YH 1ZOMA 4MNYA 4IMQA 3SU1A 3K50A 3RMLH 3GCHC 3KCGH 2OTVA 2F3CE 4FUEA 1T4VH 1NFUA 3OU0A 4BTUB 2FOCA 4INLA 1CVWH 2ZFSA 2FDAA 4YT7H 2A1DB 1IQFA 2B5TB 2HALA 3VB7A 3CS0A 1XMNB 3ATMA 4BANB 1NFYA 2I4SA 2EDZA 1KLJH 3BF6H 4F4OC 3DD2H 1BTYA 5LH8A 1P2NA 1GDQA 3BTKE 3FFGA 4K1EA 1EPTB 1BTZA 1WTGH 1TIOA 4OS5A 1GGDB 3LC3A 2O8WA 4HTCH 2VVCA 1ZTKA 1G3EA 1FNIA 1Y5BT 2JH6D 2V1WA 1OWKA 2P3TB 2JKHA 1H9HE 2FTMA 3ZZAA 1H8DH 3DFJA 1Y3WA 3LGWA 4B2AA 4NXQA 4NNLA 2KPLA 3IG6B 1LVYA 2P3FH 1I92A 1CHOF 4WMFA 4Q2NA 3BTDE 2SGDE 5E0GA 1HAVB 3TH3H 1O3JA 1FIZA 2BZAA 4D7GA 1GMDG 3E8LA 2VWNA 2WPHS 2A7CA 3EE0B 2JH5D 4TY7A 3M3TA 4NMTA 3SJ9A 1TA6A 1RTKA 4ZMAH 2QIQA 5GLJA 3MHWU 1DXPA 1TNKA 5E1YA 4OS7A 2XC5A 5GXPA 1WI4A 1UHBA 1ZGIA 3BTGE 1DLEA 1LMWB 1O2MA 3SOEA 2ZPLA 4E35A 4AB9A 1QBOA 3HKJB 1IQLA 3ODDA 2G2LA 4YT6H 5E2OA 1V1TA 2VNTA 1DLKB 2THFB 2DLSA 2ZP0H 3CP7A 4VGCC 1P02A 2FLBH 2FEQH 4K78A 1OXGA 2KAIB 6ESTA 3FZZA 2I6QA 1EXFA 1BCUH 2ALVA 1D3PB 1MTWA 3QGJA 1TYNA 3SU4A 1OP2A 3SUDA 3MTYA 1LHEH 2ZG0H 1O3OA 1NPMA 1F5LA 1O35A 1HAVA 3GCNA 3PWCA 2VINA 4O06A 2GP9B 2J38A 5ABWA 1WFGA 3V13A 1BRBE 3F1SB 5C1UA 2DB5A 2JREA 2R0KA 2HNTF 3EGKH 4H4FA 3AASA 3BG4C 1O2HA 5G4BA 2D2DA 1PYTD 1WAYB 4UEHH 2Y7ZA 1P2OA 1W7XH 4FUHA 2VIWA 3VFEA 1UK3A 4Y71A 1INCA 1LVMA 1QQ4A 3LH1A 3ZV8A 3Q77A 1GI6A 1YGCH 1P10A 1ZLRA 1AD8H 4YTAA 5JDUB 3RP2A 2PWXA 2XBWA 1C1OA 1SSXA 1GBKA 6CHAB 2VU8E 1BTUA 3ZZDA 4NIYA 2PTCE 2AIQA 1J17T 3T2NA 1VZQH 5HXFA 2P3WA 2KOMA 1C2DA 8LPRA 4K72A 1Z87A 3FANA 5C5OA 3K9XB 3QZQA 2L97A 1QHRB 3TNSA 1A0HB 1O2RA 4UE7H 2K20A 1TGCA 1MU8B 3U8TH 1C5YB 2E7KA 1K1IA 2H1UA 2CGAA 5DP7A 4A5TS 2BY8X 1AY6H 2A4QA 3U1IB 2I04A 1C2KA 3QDOA 2ZQ1A 4RSPA 3UR9A 1AFQC 2DJTA 3UQOA 3SQEE 1SGFG 1T8LA 1Y3YA 4NSYA 1V2MT 1G32B 1BUIA 5LPFA 2HOBA 3SHCH 3UR6A 2CXVA 2G8TA 3PMAB 2D1JA 4NZLA 1YKTA 4XBBA 2PW8H 4Y76A 2GCTC 4NXPA 3E6PH 3GCTF 1GQ4A 1THSH 2EI8A 2XTTB 3MU8A 2NU3E 1OBXA 2H6MA 2Y5HA 2FPZA 1BZXE 1ARBA 1HIAB 2PV9B 1VJ9U 3BEUA 4NGAH 5K0HA 1TAWA 2ZKSA 3KQEA 2PGBB 2BXUH 1DSTA 4NG9H 3RXRA 1UTNA 2A2XH 1K9OE 2PR3A 3KHFA 2AWUA 2OC8A 1C1SA 3MNXA 1V2QT 1FI8A 1MTUA 1V2NT 2UWLA 2ZDAH 1EB1H 3LONA 1DWDH 3H7OA 1CT2E 3LGVA 3RC4A 4AFUA 3RXEA 3DJ1A 1FDPA 2OINA 2A5KA 2LPRA 1P9SA 1NRPH 5AHGH 3FP7E 1EZXC 2F9UA 3E91A 4AORA 1R6JA 1RRKA 3ZZ6A 3QJMA 1UVPA 2BLVA 2XCNA 3TSVA 2SFAA 4LOYH 1YPKH 1Z7KA 5F8ZA 2TGAA 3OYPA 1A0LA 2J2UA 1YBOA 2GX4A 2FS9A 2ZHDA 1S0QA 2CJIA 3A7WA 1RZXA 4HGCA 1O2WA 1QY6A 3RXOA 1O5DH 2R4HA 1O33A 2EGKA 2FWWA 1JWTA 4ZXXH 3M37A 2GZ9A 5I46H 3Q00A 2KBSA 1C2LA 1X5QA 2QF0A 1Q3XA 1LDTT 1BTWA 2FXRA 2XBXA 4ZKSU 3BTEE 1HJ9A 4K1SA 1EOLA 5G1DA 2IJOB 4FUCA 4Q2KA 1ABJH 5GIBA 4D8NA 1TMBH 3KHVA 3BTTE 4MPAA 2Q6DA 1EP5A 1BBRH 3NKKA 2I6SA 3KNXA 1YCPM 2PKAB 1B0FA 1FY8E 1TMTH 4B74A 1K1MA 1T31A 2PNTA 3O8RA 1UTLM 2O8TA 2KG2A 2CSSA 1BIOA 1ZUBA 1ETSH 2C3SA 2G4UA 4K2YA 1TNHA 1O3IA 2H5CA 4X8VH 1Z8GA 2OQUA 3ZVGA 4YOIA 3EA7A 1SGFA 1N6DA 2KYLA 4B1TA 1YPHC 1O5BB 2STBE 1TQ3A 4G69A 1GMCF 1GMCG 4MG3A 1JIMA 2XWAA 2TGPZ 3TITA 1JRTA 5DO4H 4NXRA 1GG6C 1FAKH 1I16A 3UFAA 2ZHEH 1ZYOA 2DKRA 3SO3A 1NRRH 1O5EH 1IHTH 1ELDE 1X8SA 4P2AB 1EX3A 2P8OB 1MAYA 2VWRA 2ZI2H 4J1YA 1OSSA 2XXLA 2EEJA 4YZUA 3ODFA 1K22H 4ABBA 1TPPA 1GI2A 1MZAA 3PYHA 3L33A 1RIWB 3MO3A 7LPRA 2J94A 3U98H 4DIHH 5FPTA 2BLOA 2C8WB 1U3BA 2TRMA 2RA0A 2YT8A 4NNMA 3UNSA 3CBYA 1MTSA 1ZPZA 3U9AH 5T6GA 2GDDA 1YPJH 3K6ZA 2FI5E 5E8EH 1N7EA 2WPKS 3VPKA 4NMPA 2Z3DA 1EKBB 2ZGXH 4Y7AA 3STIA 1W8BH 3SNDA 2BY9X 3SJOA 1AMHA 3SI4H 2PGQB 1IU2A 2EC9H 1J14A 4X2WA 1SMFE 5FX5A 2YUYA 1EPTC 1SFQB 3K1RA 1AGJA 1RY4A 1EOJA 3E90B 1TOCB 3M7QA 5GCHG 4IBLH 3N7OA 4K75A 1OYQA 4ISNA 1F5RA 1ZHPA 4KTSA 4MPUA 5FB8C 4GUXA 4Q6HA 3E3TA 5JBBS 1KY9A 5E22A 1GVLA 1NTPA 1A61H 2NU1E 1PJPA 3U1JB 5CHAC 3MH5A 1VGCB 4K8YA 4U01A 3W94A 1HLTH 3T29A 3TJVA 1ID5H 2F9BH 4BAOB 2W7RA 1ZHMA 3M7TA 2F5YA 3RDZA 1MCVA 2ZHQH 4Z6AH 1CGJE 1FY3A 1GHAG 2OBQA 5CHAB 1E35B 3GY8A 4K76A 4BTIB 3P8NA 3RM0H 1C2FA 1CA0C 4Y11E 4XBDA 5C5NA 2M0UA 4WF8A 1BT7A 2QBWA 2P93A 2KOHA 2F83A 1GJBB 1GI9B 2Z94A 3F9EA 1MU6B 2ZU3A 1LTOA 1O0DH 3HPMA 3A8BA 2BY6X 2BXTH 2ZC9H 4CHAB 5DP5A 1G3DA 3M61U 4XDEA 1SGDE 4K3JA 2PKTA 1S83A 3LJJA 1O3CA 1ELAA 3VB6A 1KLIH 2AS9A 3PTNA 1V2KT 3RLEA 2KRGA 2YUBA 3PLKA 1VAEA 5GJ4B 2EHRA 1SGNE 1YLCA 1KSNA 4AB8A 1P11E 2LOBA 3H5CB 3OTJE 2HGTH 1JRSA 2NU4E 3UIRA 2SNVA 1QAUA 5F8XA 4Y10E 1YYY1 1GJCB 3F9HA 3SJIA 5C1XA 4WMEA 1FC7A 2OP9A 3ENSB 1QFKH 1GBJA 1N6EA 4JOEA 2Z9GA 1O2JA 1PPBH 2RCEA 4WMDA 2YT7A 2H5DA 3MU0A 1MZDA 4JOGA 1MFGA 1HIAA 1HAXB 3B8JA 3BG4B 1QJ7B 4FUGA 2ZGHA 4ZROA 1XVMA 1QBNA 1UTMA 4X2VA 1Q2WA 2VH0A 1DY8A 2BOKA 3SV2H 4UFGH 3MI4A 5DTHA 1SGQE 1GJ6A 1PPHE 1IQGA 3C27B 3SN8A 3TGKE 1LCYA 1XKAC 4KP0A 1SQAA 3MMGA 4IC5A 4E7NA 2OCSA 1OPHB 3LGTA 1NTEA 1QA7A 1F0RA 8ESTE 2Y80A 3QDZB 3FVFB 4GLYA 5A0AE 1EP6A 2F9PA 1GWAA 1WJLA 1VGCC 2BD8A 4ZKRU 4UFFH 2GTBA 3SGBE 1ANDA 2OLGA 1TX7A 3TJOA 2EI7A 1QRZA 5E21A 3GISB 4X8UH 2CN0H 3QWCH 3SV9A 4UONA 2BD4A 1GJ8B 1D5GA 1C2HA 2M10A 1ACBE 4IW4E 1NS3A 1HAPH 1L4ZA 1V2PT 3KL6A 1QBVH 1AWHB 4OEOA 1FV9A 3GOVB 4ISIH 1QB9A 4WWYA 1N6FA 4JOJA 3V12A 1FQ3A 2EJYA 1KDQA 1T8MA 1Z6EA 2EA3A 3RXKA 1RD3B 4DIIH 3SOSA 3W95A 2G55A 5FX6A 3ZYDA 2XC4A 3BTHE 1V3XA 4X1SU 2P16A 1ZMJA 1C2IA 1KXDA 3D23A 2WYJA 3F6UH 3URDA 1A7SA 1GM1A 2FCFA 3T27A 1A46H 1GVKB 4NZQA 3CH8A 4YOGA 3S7HB 1VITF 4ZH8A 1AB9C 1XUHA 1S82A 1O37A 2HE2A 1HDTH 3RLYH 1L1GA 4WXIA 1HPGA 2A2QH 3QTOH 2ANWA 1GBHA 1TB6H 4KFVA 1T32A 2FOEA 1KLTA 2FOFA 3QGLA 2SGEE 2GV7A 2ZU5A 2W26A 1FLEE 3BSQA 1M9UA 2FESH 2G5MB 2EGOA 4DY7B 2OD3B 2IOTA 1N6XA 5DP8A 2O8UA 1O2GH 4WH8A 4BAQB 5CE1A 2D90A 1WU1A 1DWBH 1ELEE 1H9IE 2C93B 4NMSA 1V2TT 4DURA 4FUIA 2WUBA 1TRMA 3LH3A 4SGAE 5C1YA 1D4PB 9ESTA 3QGNB 3R0FA 1KEFA 1FUJA 3RXTA 4NIWA 3EAJA 4ZAEA 1P2MA 1WSSH 2AGGX 1NRNH 1C2GA 1N8OC 1THRH 1G3BA 2PUQH 3ZZ3A 1WCZA 5J4QA 2VWMA 1HXFH 5JYIA 1SGEE 1Y3VA 3PV5A 2OC0A 4ABAA 3OX7U 2J34A 2QT5A 3MO9A 1A3BH 2B8OH 4FUBA 2ZO3H 5C20A 1GBLA 1C5PA 1YC0A 2F9NA 2J92A 4YOJA 3SUZA 4IN1A 4NA7A 4ZKNU 1ANBA 1BOQA 3MNSA 2UUYA 1J9CH 1MD8A 3PS4A 3O8CA 1RJXB 2Z9JA 5T3HA 1C5QA 3FP8E 4NMVA 4BOHA 1W12U 1QRWA 4CREA 3Q3KA 2PKSB 1C5MD 4DCDA 2BLQA 4Y8YA 1VR1H 3MH7A 1ETRH 4Y8ZA 4WXVA 1DPOA
chains in the Genus database with same CATH superfamily
1PQ8A 1Y3XA 1IQIA 5FCKA 3LNXA 2L4TA 3UWJH 3PDVA 4XHVA 2VWLA 1V2VT 1A2CH 4DGJA 3SNBA 2GCHG 1O2IA 3RXQA 4AMHA 1O30A 3A7XA 1BHXB 2WV4A 3E1XB 1WQSA 3RXCA 1JIRA 2J9NA 4JZEH 2BDAA 1YPEH 3A7YA 1V5LA 1QL8A 1O3KA 3E0NB 4ZXYH 1O3PB 4MLFB 4Q6SA 3HK3B 2H3LA 2JDID 4KFWA 2BDIA 5C94A 1SG8B 2AH4X 3SHUA 1ZMLA 2W3KA 3D65E 1JOUB 3KN2A 3MFJA 2YNAA 1RXPA 2EGNA 1A5IA 3LDXH 3ZZBA 2ZDNA 3KDKA 4CH2B 3PM3A 5EOKA 2KAIA 4X6MA 1AVWA 2KV8A 1JMOH 4JORA 4NSVA 1GBTA 3SQHE 5DP4A 3QK1A 1BRAA 1U39A 1Q3PA 1C1NA 1GI0A 4JZDH 2HLDD 2LA8A 1DX5M 1AKSA 2IWQA 1NFWA 2OMJA 1GBFA 1ABIH 1EJAA 1TPOA 2GD4B 3NFKA 2G52A 2PKAA 1RGRA 3SNCA 4OGXA 1KYNA 1UHBB 1DDJA 2B0FA 2QY0B 3I29A 5DPAA 2H9EH 2IPQX 3SGQE 3TK5A 1XXDA 1CHOG 4RKJB 2R2WU 2ZPMA 1ELGA 1ESAA 2M0TA 3N99A 1C5NH 1SHYA 1QURH 5A0BA 1BE9A 1G3CA 3VGCB 2J98B 1GJAB 1QR3E 3SU2A 1G36A 5F6MA 3O8BA 4YLQH 1AKSB 2RDLA 1H4WA 2ZTZA 3WKMA 1O3AA 2JH0D 3LIWA 4TY6A 5AF9H 2RRMA 4YYXA 1UHPA 1ANEA 3NCLA 3DSGA 1T4UH 1TNIA 1T8NA 1C5SA 4R8TB 2CF9H 3TMHA 4YESB 1XZ9A 3UUZA 1P1EA 1YPHE 4ZUHA 1NO9H 4X0WU 1Y7NA 5GWZA 2Y82A 2BVXH 1A5HA 4CR9A 1O3DA 2W7SA 5JPMH 2FX6A 4HOPA 1HXEH 2CSJA 2BY5X 2FMJA 2Y7XA 2CMYA 2OCVB 2A7HA 3AW0A 1GI3A 1AVXA 4BXSA 1T8OA 3GY7A 2CF8H 2R0LA 2OBOA 2ZPSA 4JK5A 4MNWA 3RXSA 3DIWA 5GCHF 1OOKB 4RI0A 2ESTE 1UEPA 5HMAA 1F0UA 1LVBA 3IITA 3URCA 2K8IA 4IMZA 1O2LA 3IWMA 1A4WH 1C5XB 1S6FA 1EZQA 1MBMA 5HIZA 4FXGH 2BQ7B 1QL7A 1HYLA 1N7FA 2CHAB 4CRAA 1LPKB 1P8VC 1ZSKA 1BBRK 3LOXA 4BNRA 4I8JA 1PDRA 1C5WB 1V2UT 1ZR0A 3BTFE 3RMMH 2OZFA 5L30H 1F5KU 1HAGE 3PV2A 4HZHA 1K1PA 2IWOA 1L4DA 4FU9A 3SV7A 2A5IA 2CHAC 3TH4H 1ELCA 1SLXB 5DJ7A 3UWIA 1CGHA 2VVUA 4X1NU 4E3BA 1D3TB 2OK5A 3RC6A 4D76A 1GJ9B 1F0SA 1AI8H 2R3UA 1P05A 3M3SA 3SV8A 1AO5A 4FVDA 5JB8S 5EW2H 3RXHA 4ABIA 5C67A 2NU0E 1TGSZ 1YBWA 1AFQB 1B8QA 1EJNA 2IWPA 1IU0A 1P04A 1Y5UT 3P8OA 1HAZB 4F49A 4X1PU 3QX5H 1SOZA 1FN6A 1LHFH 2WSSD 1SLVB 3R3GB 4FVBA 6GCHG 3OEED 1FZZA 2KCOA 2VSPA 1LHCH 5BPEA 4E05H 2D92A 2ULLA 1GI8B 1EATA 3PLPA 6LPRA 1E34B 3KYFA 4Y8XA 3EGHC 2PDZA 2FTLE 1Y8TA 5HFEA 2Q6GA 1FXYA 2ZU4A 1TRYA 3AW1A 3TPIZ 1GHWH 1O3LA 4Y7BA 3H09A 3FAOA 2IWNA 1GBDA 1WF7A 3ZVDA 5HYOA 2KOJA 4UD9H 1Z86A 1EZUC 2ZCHP 3DJAA 1O2NA 3UREA 1BDAA 1TBRH 1MQ6A 2NWNA 2F0AA 4JYVH 3VQGA 1GJDB 2A0QB 2MX6A 1U37A 1O3GA 2O2TA 1O31A 4XRNA 2YMSC 1WBGB 1PFXC 4XOJA 2PUXB 2J98A 5IL9A 4GVCA 1YWUA 3GS9A 3FY5A 4R0IA 2O8LA 1UM1A 5FBEA 1ELFA 5DK1A 4JYTA 5EGMA 1GBBA 2DM8A 1W13U 1Y59T 3TGIE 3GCOA 4CBOA 2RFKC 5B6OA 1C9PA 1NU7B 2EV8A 4AYYB 1QB1A 1TRNA 2ILNA 2EY4C 2WPMS 2EQNA 2ZZUH 5HFBA 1KTTB 4X6NA 1V2OT 4NMQA 3TJUA 2FO9A 4B2CA 1AQ7A 1C2MA 1U6QA 1SL3A 1NRSH 1UITA 1ZHRA 3HGNA 4GPGA 1S6LA 4CRFA 4Z33A 1C5ZB 3LNYA 2C4FH 3QZRA 2VIDA 4YDPA 3TSZA 2EDVA 3LPRA 3ZRTA 5HEBA 1YPMH 3N7DA 3VB3A 1GHYH 3ZVFA 4ZKOU 1K0HA 3FO8D 2DE9A 2ZWLH 4Y0ZE 4JOFA 5DSFA 1K32A 3AVZA 1ZPCA 4DW2U 2WINI 1NC6A 2VIQA 3HKIB 3HPTB 1SGPE 3A80A 4ZHAA 3GDUA 3DFLA 1C9TA 2BDHA 3P17H 4TWWA 3SZNA 3V7TA 6CHAC 3S9AA 1OKXA 4A1XA 3T5FH 1P01A 3PTBA 2V6NA 2OGPA 2ZA5A 2EEGA 4JMYA 4LZ4B 4K8BA 5JBCS 4NWKA 3ZZ8A 7GCHG 7GCHF 1UJUA 4H42U 3RXUA 1KDQB 2GDEH 2I6VA 1QLCA 1OWJA 3P92A 1C1WH 3VEQB 5E0JA 3OFND 2P8OC 2F4LA 2OPGA 2BD9A 3EA8A 2QAAA 2FP7B 1EJMA 3O8DA 4D9QA 3CC0A 1N6YA 1EASA 2SGAA 3LGIA 1O5CB 1Y5AT 3TU7H 4HG6A 3JZ1B 1NU9A 1LPGB 2ZU2A 3ZVAA 1TQ7B 2FS8A 3RXPA 1UCYH 1XXFA 4RKOB 1L6OA 2M0VA 1Q7XA 7KMEH 1BTHH 3S7KB 5D13A 4DT7B 4IGDA 2ZIQH 3RXLA 2ANYA 1RTFB 2M0ZA 3GY5A 1ZJDA 3SU0A 1V62A 5T1VA 1AZ8A 3GY3A 3EQ0H 2FI3E 3DCLA 4N6XA 4K6YA 3DORA 5HF4A 4H11A 2VH6A 1G9OA 4CR5A 3SJ8A 2BYGA 1TBZH 1RTLA 4I7YH 5SGAE 3MNCA 2DMZA 4U2WA 1GL0E 1ZZZA 3SUFA 1XUIA 1P2KA 1VITH 1OBZA 4P0CA 3U8OH 2AINA 5GNDA 5EIYA 5HFCA 3RXFA 1ETTH 1SGTA 1MCTA 3UB0A 3RXGA 4Z0KA 1W3CA 4ZHLU 1G2MA 3B76A 2Z9KA 3QN7A 4GVUA 1S84A 2UUJB 4INHA 7ESTE 4QT8C 5HM2A 2LC7A 3RU4T 3TSWA 1TNGA 5EZ0A 4THNH 2FIRH 3RL8A 5EJ1A 3GDSA 1YPLH 2KJKA 1UJVA 3PROA 4ABFA 1P06A 3LGYA 1MQ5A 2A4OA 4O97A 3ZZ5A 4MQAA 1UVUH 4JK6A 1CT4E 1ZTJA 3VB4A 1UK4A 1LPZB 2A31A 3NWUA 1VA8A 2FN5A 1O2XA 2CV3A 1TPAE 5DKMA 2HWLB 4AZ2B 2O9QA 1AHTH 2HE4A 1GG6B 3PO1C 1ELBA 4B2BA 2F9OA 5JBAS 1C1MA 1BJUA 2KJDA 4KTUA 2BLWA 2WPDD 3SV6A 4GHNA 6GCHF 1VITG 3A7TA 3RU4D 1W0YH 2D26C 1KXAA 4XFQA 3R0HA 1Z1IA 4OGYA 3D49H 1CU1A 2Z9IA 1ANCA 1O2KA 4CRCA 5LPEA 3A82A 2ZHFH 1P2QA 1WQVH 2HVXA 1CBWC 3AAUA 3BV9B 4Z1MD 4MVNA 2SGQE 1L1JA 1SGYE 3MU1A 3VXFH 3RXBA 2W4FA 3MOCA 4ABEA 3E17A 5TCCA 1KXEA 1WOFA 3UPEA 2UUFB 1GHBG 3VQFA 5FAHA 4X6PA 2ZDVH 2PKSC 3UQVA 1W11U 1E79D 1O3MA 1K21H 4B76A 1F0TA 1O38A 1RIWC 1CQQA 2AERH 1QGFA 2H3MA 1C4U2 2P3UB 4MPVA 3SORA 1XX9A 4WJG2 1PPGE 2V3MA 2FE5A 1UVTH 3A7ZA 3MH4A 2BX4A 3QE1A 3F2GA 1AWFH 1QAVB 3STJA 2WUCA 1GI4A 2FLRH 2ANMH 1WV7H 3KZDA 1J15A 1P57B 2QGRA 1WI2A 4ISHH 2J5UA 2A32A 3S9BA 2QXHA 3AAVA 3KQCA 3T28A 3R68A 1C4V2 4I8GA 2EEIA 2QC2A 1XUJA 4KTCA 2DAZA 1NBME 5IDKA 1V2RT 2QF3A 1QL9A 4H6TA 4JYUH 1HJ8A 1CT0E 4E7RG 5C2ZA 4RT0A 1ZRBA 4HFPB 1W9QA 1IQNA 2B7DH 1C1RA 3FP6E 1RFNA 2BMGB 1DUEA 4SGBE 1MH0A 2TIOA 1TA2A 3P8GA 4P02A 3SHAH 1ARCA 3U69H 1WFVA 1K1NA 1FY4A 2ZDKA 1NT1A 1X5NA 2VPHA 2K1QA 1P1DA 4X6OA 3A87A 5EPYA 1QAVA 4JOHA 5F67A 4UFEH 2XBVA 4WY3A 5ESTE 2BZ6H 5EQQA 1EAWA 1TONA 3ATLA 1GDNA 3BIVH 2FODA 4XBCA 4IC6A 1VCWA 2GMTB 2RDEA 1UMAH 2AMQA 4AG2A 4AFQA 4GAWA 4FOUC 1UO6A 2UWPA 3GDVA 1CA8B 3NGHA 4FU7A 5G1EA 5A8XA 3SJKA 3ATKA 2KJPA 2XC0A 1ESBA 4AG1A 2GMTC 2BDGA 1TBQH 3A81A 2FOAA 5FPYA 4ZHMU 4O3TA 4F55A 1NRQH 2I1NA 1J16A 3WW7A 4BTTB 1C2JA 2Z3EA 4CRDA 2ZGJA 1GGDC 4JCNA 1P3CA 2I0LA 1MD7A 3OTPA 2Z17A 2MHOA 3BPUA 1B7XB 4IS5A 1BMMH 1XUFA 1UF1A 4NFFA 5HETA 1XM1A 1DVAH 4PQWA 3DA9B 1C1PA 2ODPA 4P00A 1EB2A 5EW1H 2SGFE 5F03A 4VGCB 2WV5A 1OZIA 3RC5A 1FJSA 2BY7X 4KELA 4ISOA 1GQ5A 2OC1A 4I86A 2BOHB 3OAAD 4TYDA 2UUKB 2F9VA 4NCYA 4Y79A 4I31A 2HPPH 1MKXH 1OWIA 4MTBA 1THPB 5F8TA 2RCZA 3ZZ9A 1C2EA 1LHDH 2PLXA 3O46A 4AOQA 2K0QA 1PPFE 2HRVA 1WH1A 5C3NA 1C5VA 3MU5A 2ZGCA 4A92A 1GBMA 1VB7A 1CSOE 2J4IA 2ZCLP 2CS5A 3HATH 4K60A 1GJ5H 2A45B 3K82A 1C5RA 2QF5A 1NM6A 3BEFB 3BTWE 3UOPA 2GV6A 4U30A 1DE7H 1Z1JA 2AHME 5EQRA 2BYAX 4AN7A 2C8XB 3GGEA 3ITIA 3SHWA 4WYTA 4I33A 4Q7XA 3MO6A 3TIUA 1AZZA 2YMSD 4LXBH 5KECA 2GCHF 2H9HA 3PMHB 5I25A 2V0BA 2ZDMA 2V3OH 1HAHH 2GT7A 2VSVA 3WKLA 2ALPA 2R9PA 1AVGH 5GPIB 3CBZA 4Q2PA 2Y81A 5E0HA 1P03A 1TGNA 2VB0A 1YPGH 4E06H 4JJ0A 4UU6A 1W0JD 1LO6A 5JBTA 2Q3GA 2HPQH 2VGCB 5DG6A 1UVOA 2PZDA 1GHXH 3ZYEA 4REYA 1FMGA 3B9FH 1DOJA 3PB1E 1S81A 3M5OA 5EPNA 2FNEA 3E0PB 2ZFPH 3PLBA 4AX9H 1A0JA 3HGPA 2QKUA 5EQSA 3ID1A 1UVSH 3ATWA 1O3HA 2VJ1A 2KL1A 2G5NA 1G37A 2ANKH 5FPSA 1H8HD 1X45A 3NRLA 4X1QU 4X2XA 1AB9B 1PPCE 5EYZA 3UY9A 2Y5FA 1BBRE 2ZTYA 1L2EA 1SR5C 1ZMNA 4O3UA 2QV1A 5FBIA 3RL7A 3A84A 5FXLA 1UEZA 1LQEA 1W9EA 1P09A 3SBKA 4O9VA 1FC6A 2EDPA 2BD7A 1EUFA 5K7RA 2G5VA 1C1QA 2KCYA 3EGGC 3QIKA 4TWYA 1O2VA 2V3HH 3PWBA 3NFLA 2BM2A 5HFFA 4KGAA 3SUEA 2XNIA 3M3VA 4I8LA 5FCRA 2BTCE 1K2I1 3I4WA 4MNVA 1C4Y2 1KIGH 5HM9A 4GHQA 1UCYE 1BTPA 4Q80A 5GDSH 1EAUA 3Q3YA 2OQ5A 3B23B 3BEIB 1OWHA 3SUGA 1NFXA 2PHBA 1EAIA 2G81E 1TGBA 3TVJB 2DLUA 1C1UH 9LPRA 1GMHF 4GCHF 2AYWA 1N8OB 1DFPA 3A89A 4X8TH 2V90A 1S85A 2O8MA 1Z71A 3LT3A 2YTWA 1E36B 5A2PA 3GY4A 3RUOA 1SHHB 3W1EA 1HUTH 4OS6A 2JOAA 1OWDA 4B6EA 3C1KA 1HV7A 3PDZA 3Q3XA 4L8NA 3G01A 1O3BA 3L6PA 2PFEA 3RXJA 2GZ8A 3DT0H 1LKAA 1XUGA 4HOPB 2ZPQA 2YOLA 2L4SA 1O2ZA 2D8WA 1EQ9A 4MNXA 5EXLA 3SU3A 1Q3OA 3HPKA 2OSGA 5DP9A 5A2MH 1QQUA 4CRGA 1HCGA 2H9TH 1SKYE 2DUCA 1BB0B 1DWCH 1OX1A 4MDSA 4U32A 1PQAA 2AWXA 2VWOA 4FUDA 2PTNA 1GHBF 3SFJA 1MKWH 1OP0A 3P95A 1UTQA 3BN9A 4JL7A 3RM2H 3AK5A 3SI3H 1QB6A 2P94A 4DOQA 2KQFA 4K69A 3V3MA 5KEDA 4JOKA 5HEYA 4JOPA 2AFQB 2STAE 5TCAA 1DSUA 2AMPA 1C5LH 1ZJKA 5EXMA 4E34A 1TX6A 3T25A 3GJ9A 2BHGA 2JETB 1B5GH 5ETXA 2JSNA 3UAIC 2FX4A 3BIUH 4MPWA 2C8YB 2ZNKH 2JJ2D 3I77A 1HB0B 2WPIS 4AYVB 3KQBA 3L4FD 4RN6A 1SFIA 3TLOA 3D62A 3K2UA 1C5UA 1YCPH 1HAOH 2FYRA 1O34A 3PMJA 1Z6JH 1TX8A 1NESE 2ZPRA 1T2MA 2LNCA 2XBYA 4GHTA 3ZZ4A 3O5NA 2G4TA 4D7FA 1W0ZU 3F2HA 3RLWH 1V2ST 4Q7ZA 1PPZA 1TALA 2VIPA 3ATIA 3ZV9A 1GL1A 5DGJA 3R69A 5JB9S 1Z8RA 2BVRH 2M5TA 2QA9E 3LKWA 1HAIH 1D9IA 1Z8JB 1X6DA 3UNQA 1CGIE 1GBIA 2B9LA 1UCYK 1W0KD 1W2KH 1O2SA 3ZVEA 4ABGA 2Z3CA 3S69A 3PV4A 4JJ3A 1BMLA 4UFDH 1LKBA 1AFEH 3GSLA 3FZDA 2ODQA 1W7GH 2EEHA 1UJDA 2ZDLA 2ZTXA 5HGGA 1IQHA 1O2PA 4LMMA 1OHHD 3SU5A 1UTJA 5H4IB 2Q9VA 1FN8A 2A7JA 3CENA 1V6DA 1JXPA 3E16B 2JINA 3NUMA 5F53A 5T6FA 1NF3C 1DANH 1FX0B 4AGJA 4BAMB 5E11A 5HF1A 3DUXH 1EFRD 1GHAF 2HNTE 1L1NA 1QTFA 1WYKA 4NFEA 4XE4A 1MTVA 2RA3A 1CO7E 1G2LA 5ESBA 1KTSB 2GGVB 4B75A 2JJ1D 1TNJA 1BTXA 2OQSA 4B6FA 2ZCKP 3GYLB 4BXWA 3FN8A 3U8RH 4Y6DA 1A5GH 1N1LA 2TGTA 1MFLA 2R3YA 3WWBA 1F7ZA 1NZQH 1YLDA 1EPTA 2KAWA 3RXAA 1K1OA 1XKBC 3KQDA 1ELVA 1TOMH 3FKSD 2VRFA 1BMNH 1N99A 2BX3A 2Y5GA 1X5RA 5HKKD 1P0SH 3QLPH 5C0TA 1O39A 2G51A 3MWIU 3RXDA 4X8SH 3LU9B 5HEDA 1PYTC 2HGAA 3VGCC 3H7TA 1S6HA 1U38A 1E0FD 4I8HA 1NN6A 1GJ4H 1QNJA 1UTOA 3F9GA 1LHGH 3HK6B 1BRCE 1CHGA 3KF2A 2C8ZB 1J8AA 1FONA 1SVPA 1H8IH 2IPHA 2I0IA 4X2YA 4KKDA 1OYTH 2ZGBH 3NXPA 4ABHA 5CMXH 4Q2OA 3TJNA 2Z9LA 3NPSA 1Y3UA 1A3EH 4Q2QA 2FYQA 4F8KA 3TK6A 3EE7A 4NIVA 3RU4E 4NWLA 4UDWH 2W5EA 1X9ZA 4OEPA 4INKA 1W9OA 5DP6A 2X7ZA 1D6RA 1IHSH 5J4SA 3TGJE 1MUEB 1KXFA 1ELTA 1TLDA 2FOHA 1G9IE 1D3QB 3OY5U 1QIXB 3GCHB 2AWWA 1WHDA 2JXOA 1O3FA 1V2WT 4H6SB 4A6LA 2BD2A 4JZFH 1HBTH 3A8AA 2QG1A 1ESTA 1O2TA 3GY6A 1E38B 2AGEX 3UTUH 3ID3A 3LGUA 2ASUB 2XCFA 2TGDA 3QUMP 2GZVA 1ORFA 3TNTA 5TJXA 4O03A 1DT2A 1VCQA 5A09A 3EA9A 4A1TA 1H1BA 2LELA 3VB5A 4Q7YA 1SC8U 4ESTE 2PSXA 3NK8A 4B73A 1DXWA 2Q1JA 1BHXF 1D6WA 4TPYA 3S9CA 1OWEA 1DY9A 5AVDA 1VJ6A 2OS6A 5T6DA 2P59A 1O3NA 1TMUH 3GICB 2JWEA 1CA0B 2VVVA 4I32A 1UK2A 4ABDA 1PQ5A 1ZPBA 1G30B 3K6YA 8KME2 2JETC 1WG6A 1MKWK 1GHVH 4PROA 3F2FA 1TFXA 2ODYB 2GKVE 1K28D 3QO6A 1AE8H 1P9UA 3RMOH 1L0ZA 1O2OA 1O5GH 5EXNA 4ACBA 1V6BA 2H2CA 5AFZH 1MABB 2RG3A 3RXIA 4YM9A 1YF4A 1GBAA 3KGPA 5EODA 2ENOA 1IQMA 1KXBA 3MYWA 2C90B 1MC7A 1Q31A 4CHAC 1GBEA 2FZZA 4BAKB 2YNBA 5EU8A 4ASHA 2QXIA 3GABA 3SW2B 2OUAA 3SGAE 5E2PA 4AFZA 2ZQ2A 3SU6A 3P70B 1TABE 1UTKA 1MBQA 4FUFA 3KIDU 5L2ZH 1IOEA 2DC2A 3BTQE 2HVYB 1K1LA 1GBCA 3OSYA 2ZU1A 1DM4B 5I7ZA 1SGIB 1GHZA 2L6OA 1SGRE 4XSKU 2XW9A 1RGQA 1HGTH 2BD3A 2UWOA 1E37B 2V35A 2VIOA 3K65B 3KEEA 4B71A 1FPCH 3M35A 4TPIZ 4FU8A 4OS1A 1FY1A 8GCHG 3QTVH 5JXBA 2QXGA 2VZ5A 3F9FA 1RGWA 4BAHB 2TPIZ 1SQOA 1LVOA 3S0NA 1O2UA 2BQWB 1JBUH 2Y6TA 3M7UA 2Z7FE 1TQ0B 1P3EA 2A4RA 2GCTB 4Z8JA 2A5AA 2EEKA 2ZFRH 2HLCA 5LPRA 4OAJA 1QA0A 3ELAH 1SOTA 1ZSLA 2QKTA 1MTNB 2GVFA 1IQJA 1S0RA 3ID2A 2FI4E 1UM7A 2LC6A 2BDCA 1BJVA 1V5QA 2FOBA 3NZIA 1YP9A 2BQ6B 3ZVCA 3MU4A 4ISLA 1CE5A 4WYUA 4D9RA 3JXTA 3LJOA 4WVPE 5HDYA 1UJ1A 1BFEA 2BDYA 1P2IA 5A8ZA 1MKXK 2ZEBA 1RS0A 2J97A 1PQ7A 1BA8B 4JZ1A 2PA1A 1TP3A 4R2ZA 3DHKH 1M5ZA 4Q63A 3T26A 1Z8IB 8GCHF 5BRRE 2ZFFH 4DJZB 1TP5A 3BG8A 1XUKA 1SGCA 3DJ3A 1TPSA 4JZIA 1C5TA 1UTPA 1WHAA 4ZCNA 1KWAA 3A83A 5AFYH 1GI5A 3A88A 1PPEE 5A0CA 2R2MB 4CBNA 1WUNH 2QXJA 1TE0A 1K1JA 3VXEH 4NIXA 1EAXA 2GT8A 3Q76A 5B42A 3RXMA 1WXRA 2UZCA 1O32A 4GCHG 3M5LA 4AGKA 2FM2A 3CBXA 1UW7A 2VGCC 1GPZA 2WYGA 3RMNH 1X7AC 1H9LB 5CDFE 1FAXA 1UEQA 3MH6A 2ZFQH 1O2QA 2EXGA 5A8YA 1O3EA 3DSOA 1GCTB 1W10U 1N7TA 3P8FA 2BVSH 1NY22 1D3DB 5FL7D 1SBWA 3WY8A 1HJAC 3JZ2B 1V2JT 3ZIAD 4DG4A 1FCFA 5H3JA 4NA8A 1MTNC 4A1VA 3F0PA 1YCPK 1ZGVA 4OS4A 3V0XA 1NBMD 5FHTA 4EDJA 1MMJN 1OP8A 2WPLS 2G00A 1FPHH 4IN2A 1IHJA 1ZOKA 2EI6A 3AXAA 3ZVBA 1HJAB 4GSOA 1H8ED 2BB4A 1E1QD 1HAYB 1S5SA 2FOGA 1AN1E 3TH2H 1BMAA 1TGTA 4FUJA 1WF8A 2ZF0H 3GY2A 4OM9A 2H2BA 1DS2E 1DWEH 1IQEA 1B0EA 2W7UA 3EYDA 1DICA 4A7IB 2Z6BD 1SLUB 1QCPA 2GZ7A 3TK9A 2L74A 4LK4A 2XWBI 1AUJA 2KPKA 1O5AB 4NA9H 1O2YA 1SI5H 3PO1B 2XRCA 1AIXH 3T62A 1GMHG 1WTHD 4Y0YE 3SNAA 2FOMB 3KZEA 2F91A 3I18A 2K1ZA 1GCDA 1IAUA 1SB1H 4CH8B 1EZSC 4AC9A 2BD5A 4Q3HA 1HNEE 2JIKA 2M3MA 4WH6A 2QN5T 1C1VH 1A1RA 1WIFA 2ZHWH 2REYA 4GVDA 3L3TA 2BDBA 3A8CA 3M36A 3CNRA 2AGIX 4I8KA 5KGOA 2OC7A 2Q6FA 1GI7B 3GCTG 4K5ZA 2AEIH 2QKVA 2P95A 1FC9A 3I1EA 3OY6U 1FIWA 2ZFTA 4LZ1H 2W3IA 3CS7A 3SZEA 1CBWB 1DUAA 1HFDA 5DP3A 5PTPA 1SLWB 1UEWA 1QRXA 1GMDF 3F68H 1QJ1B 2IN2A 1W14U 1P2JA 2PSYA 1BRUP 1KXCA 4YO9A 2WV9A 2WL7A 4J2YB 4NMRA 1SPJA 4K1TA 1GCTC 2VIVA 1IQKA 1HRTH 2TBSA 1NROH 2H2ZA 3A7VA 4YLUA 4OS2A 4X1RU 3M5NA 1DITH 1GDUA 1AUTC 3ZZ7A 3SNEA 2EAQA 2KA9A 3A86A 2AIPA 3I78A 3QJNA 4M7GA 3GYMA 3RXVA 1SQRA 1T7CA 3KDGA 1OS8A 2HNTC 2PKUA 2WPJS 5IYTA 3M5MA 1C1TA 1BQYA 5LGOA 1OBYA 2GJGA 5B6LA 3MNBA 1TWXB 2XYAA 1ZRKA 5HJ1A 1VCPA 1ZSJA 4HI3A 1XVOA 3BTME 1C5OH 4ASUD 5EG4A 3ID4A 2KCPA 2KZ4A 1ZTLA 2JILA 1SQTA 3A8DA 3UOUA 1QJ6B 1LQDB 1O36A 3CYYA 3ESTA 4NMOA 3PRBA 1AE5A 3ZZCA 1VJAU 2SGPE 2ZECA 5F3XA 4DT4A 4AFSA 1GVZA 2DE8A 2QYIA 2A4GA 1YM0A 5HFDA 2QCYA 1UFXA 3LC5A 1P12E 4ABJA 1F2SE 3P6ZB 5L6NH 2KX4A 1O5FH 3A85A 3EDXB 2J95A 3UNRA 2SNWA 1V2LT 4UU5A 1MAXA 2AMDA 2OXSA 1GJ7B 4CRBA 2LUIA 1FY5A 3PMBB 4FGMA 5E6PB 4DVAU 2D8IA 1GI1A 1TNLA 4MPXA 3HVQC 1BITA 1F92A 1AU8A 2NU2E 5L2YH 2QF4A 1ZOMA 4MNYA 4IMQA 3SU1A 3K50A 3RMLH 3GCHC 3KCGH 5HIYA 2OTVA 2F3CE 4FUEA 1T4VH 1NFUA 3OU0A 4BTUB 2FOCA 4INLA 2KR7A 1CVWH 2ZFSA 2FDAA 4YT7H 2A1DB 1IQFA 2B5TB 2HALA 3VB7A 3CS0A 1XMNB 3ATMA 4BANB 1NFYA 2I4SA 2EDZA 1KLJH 3BF6H 4F4OC 3DD2H 1BTYA 5LH8A 1P2NA 1GDQA 3BTKE 3FFGA 4K1EA 1EPTB 1BTZA 1WTGH 1TIOA 2IJD1 4OS5A 1GGDB 3LC3A 2O8WA 4HTCH 2VVCA 1ZTKA 3MQKC 1G3EA 1FNIA 1Y5BT 2JH6D 2V1WA 1OWKA 2P3TB 2JKHA 1H9HE 2FTMA 3ZZAA 1H8DH 3DFJA 1Y3WA 3LGWA 4B2AA 4NXQA 4NNLA 2KPLA 3IG6B 1LVYA 2P3FH 1I92A 1CHOF 4WMFA 4Q2NA 3BTDE 2SGDE 5E0GA 1HAVB 3TH3H 1O3JA 1KMHB 1FIZA 2BZAA 4D7GA 1GMDG 3E8LA 2VWNA 2WPHS 2A7CA 3EE0B 2JH5D 4TY7A 3M3TA 4NMTA 3SJ9A 1TA6A 1RTKA 4ZMAH 2QIQA 5GLJA 3MHWU 1DXPA 1TNKA 5E1YA 4OS7A 2XC5A 5GXPA 1WI4A 1UHBA 1ZGIA 3BTGE 1DLEA 1LMWB 1O2MA 3SOEA 2ZPLA 4E35A 3DSPA 4AB9A 5IK2D 1QBOA 3HKJB 1IQLA 3ODDA 4XD7D 2G2LA 4YT6H 5E2OA 1V1TA 2VNTA 1DLKB 2THFB 2DLSA 2ZP0H 3CP7A 4VGCC 1P02A 2FLBH 2FEQH 4K78A 1OXGA 2KAIB 6ESTA 3FZZA 2I6QA 1EXFA 1BCUH 3OEHD 2ALVA 1D3PB 1MTWA 4YXWD 5DN6D 3QGJA 1TYNA 3SU4A 1OP2A 3SUDA 3MTYA 1LHEH 2ZG0H 1O3OA 1NPMA 1F5LA 1O35A 1HAVA 3GCNA 3PWCA 2VINA 4O06A 2GP9B 2J38A 5ABWA 1WFGA 3V13A 1BRBE 3F1SB 5C1UA 2DB5A 2JREA 4F48B 4TT3D 2R0KA 2HNTF 3EGKH 4H4FA 3AASA 3BG4C 1O2HA 5G4BA 2D2DA 1PYTD 1WAYB 4UEHH 2Y7ZA 1P2OA 1W7XH 4FUHA 2VIWA 3VFEA 1UK3A 4Y71A 1INCA 1LVMA 1QQ4A 3LH1A 3ZV8A 3Q77A 1GI6A 1YGCH 1P10A 1ZLRA 1AD8H 4YTAA 5JDUB 3RP2A 2PWXA 2XBWA 1C1OA 1SSXA 1GBKA 6CHAB 2VU8E 1BTUA 3ZZDA 4NIYA 2PTCE 2AIQA 1J17T 3T2NA 1VZQH 5HXFA 2P3WA 2KOMA 1C2DA 8LPRA 4K72A 1Z87A 3FANA 3KYGA 3K9XB 3QZQA 5C5OA 2L97A 1QHRB 3TNSA 1A0HB 1O2RA 4UE7H 2K20A 1TGCA 1MU8B 3U8TH 1C5YB 2E7KA 2WHXA 1K1IA 2H1UA 2CGAA 5DP7A 4A5TS 2BY8X 2VBCA 1AY6H 2A4QA 3U1IB 2I04A 1C2KA 3QDOA 2ZQ1A 4RSPA 3UR9A 1AFQC 2DJTA 3UQOA 3SQEE 1SGFG 1T8LA 1Y3YA 4NSYA 1V2MT 1G32B 1BUIA 5LPFA 2HOBA 3SHCH 3UR6A 2CXVA 2G8TA 3F0OA 3PMAB 2D1JA 4NZLA 1YKTA 4XBBA 2PW8H 4Y76A 2GCTC 4NXPA 3E6PH 3GCTF 1GQ4A 1THSH 2EI8A 2XTTB 3MU8A 2NU3E 1OBXA 2H6MA 2Y5HA 2FPZA 1BZXE 1ARBA 1HIAB 2PV9B 1VJ9U 3BEUA 4NGAH 5K0HA 1TAWA 2ZKSA 3KQEA 2PGBB 2BXUH 1DSTA 4NG9H 3RXRA 1UTNA 2A2XH 1K9OE 2PR3A 3KHFA 2AWUA 2OC8A 1C1SA 3MNXA 1V2QT 1E1RD 1FI8A 1MTUA 1V2NT 2UWLA 2ZDAH 1EB1H 3LONA 1DWDH 3H7OA 1CT2E 3LGVA 3RC4A 4AFUA 3RXEA 3DJ1A 1FDPA 2OINA 2A5KA 2LPRA 1P9SA 1NRPH 5AHGH 3FP7E 1EZXC 4M9FA 2F9UA 3E91A 4AORA 1R6JA 1RRKA 3ZZ6A 3QJMA 1UVPA 2BLVA 2XCNA 3TSVA 2SFAA 2QE7D 4LOYH 1YPKH 1Z7KA 5F8ZA 2TGAA 3OYPA 1A0LA 4ACAA 2J2UA 1YBOA 2GX4A 2FS9A 2ZHDA 1S0QA 2CJIA 3A7WA 1RZXA 4HGCA 1O2WA 1QY6A 1WDIA 3RXOA 1O5DH 2R4HA 1O33A 2EGKA 2FWWA 1JWTA 3F3BA 4ZXXH 3M37A 2GZ9A 5I46H 3Q00A 2KBSA 2F43B 1C2LA 1X5QA 2QF0A 1Q3XA 1LDTT 1BTWA 2FXRA 2V7QD 2XBXA 4ZKSU 3BTEE 1HJ9A 4K1SA 1EOLA 5G1DA 2IJOB 4FUCA 4Q2KA 1ABJH 5GIBA 4D8NA 1TMBH 3KHVA 3BTTE 4MPAA 2KFWA 2Q6DA 1EP5A 1BBRH 3NKKA 2I6SA 3KNXA 1YCPM 2PKAB 1B0FA 1FY8E 1TMTH 4B74A 1YLNA 1K1MA 1T31A 2PNTA 3O8RA 1UTLM 3VG8A 2O8TA 2KG2A 2CSSA 1BIOA 1ZUBA 1ETSH 2C3SA 2G4UA 4K2YA 1TNHA 1O3IA 2H5CA 4X8VH 1Z8GA 2OQUA 3ZVGA 4YOIA 2KM0A 3EA7A 4FLNA 1SGFA 1N6DA 2KYLA 4B1TA 1YPHC 1O5BB 2STBE 1TQ3A 4G69A 1GMCF 1GMCG 4MG3A 1JIMA 2XWAA 2TGPZ 3TITA 1JRTA 5DO4H 4NXRA 1GG6C 4RT1A 1FAKH 1I16A 3UFAA 2ZHEH 1ZYOA 2DKRA 3SO3A 1NRRH 1O5EH 1IHTH 1ELDE 1X8SA 4P2AB 1EX3A 2P8OB 1MAYA 2VWRA 2ZI2H 4J1YA 3FOAA 1OSSA 4TSFD 2XXLA 2EEJA 4YZUA 3ODFA 1K22H 4ABBA 1TPPA 1GI2A 1MZAA 3PYHA 2M2AA 3L33A 1RIWB 3MO3A 7LPRA 2J94A 3U98H 4DIHH 5FPTA 5C17A 4Q4LA 2BLOA 2C8WB 1U3BA 2TRMA 2RA0A 2YT8A 4NNMA 3UNSA 3CBYA 1MTSA 1ZPZA 3U9AH 2XOKD 5C0UA 5T6GA 2GDDA 1YPJH 3K6ZA 2FI5E 5E8EH 1N7EA 2WPKS 3VPKA 4NMPA 2Z3DA 1EKBB 2ZGXH 4Y7AA 3STIA 1W8BH 3SNDA 2BY9X 3SJOA 1AMHA 3SI4H 2PGQB 1IU2A 5CHBA 2EC9H 1J14A 4X2WA 1SMFE 5FX5A 2YUYA 1EPTC 1SFQB 3K1RA 1AGJA 1RY4A 1EOJA 3E90B 1TOCB 3M7QA 5GCHG 4IBLH 3N7OA 4K75A 1OYQA 4ISNA 1F5RA 5EJZA 1ZHPA 4KTSA 4MPUA 5FB8C 4GUXA 4Q6HA 2CK3D 3E3TA 5JBBS 1KY9A 5E22A 1GVLA 1NTPA 1A61H 2NU1E 1PJPA 3U1JB 5CHAC 3MH5A 1VGCB 4K8YA 4U01A 3W94A 1HLTH 3T29A 3TJVA 1ID5H 2F9BH 4BAOB 2W7RA 1ZHMA 3M7TA 2F5YA 3RDZA 1MCVA 2ZHQH 4Z6AH 1CGJE 1FY3A 1GHAG 2GEFA 2OBQA 5CHAB 1E35B 3GY8A 4K76A 4FETA 4BTIB 3P8NA 3RM0H 1BMFD 1C2FA 1CA0C 4Y11E 4XBDA 5C5NA 2M0UA 4WF8A 1BT7A 2QBWA 2P93A 2KOHA 2F83A 1GJBB 1GI9B 2Z94A 3F9EA 1MU6B 2ZU3A 1LTOA 1O0DH 3HPMA 3A8BA 2BY6X 2BXTH 2ZC9H 4CHAB 5DP5A 1G3DA 3M61U 4XDEA 1SGDE 2XNDD 4K3JA 2PKTA 1S83A 3LJJA 3WWFA 1O3CA 1ELAA 3VB6A 1KLIH 2AS9A 3PTNA 1V2KT 3RLEA 2KRGA 2YUBA 3PLKA 1VAEA 5GJ4B 2EHRA 1SGNE 1YLCA 1KSNA 4AB8A 1P11E 2LOBA 3H5CB 3OTJE 2HGTH 1JRSA 2NU4E 3UIRA 2SNVA 1QAUA 5F8XA 4Y10E 1YYY1 1GJCB 3F9HA 3SJIA 2PP6A 5C1XA 4WMEA 1FC7A 2OP9A 3ENSB 1QFKH 3OE7D 1GBJA 1N6EA 4JOEA 2Z9GA 1O2JA 1PPBH 2RCEA 1QZ8A 4WMDA 2YT7A 2H5DA 3MU0A 1MZDA 4JOGA 1MFGA 1HIAA 1YY3A 1HAXB 3B8JA 3BG4B 1QJ7B 4FUGA 2ZGHA 4ZROA 1XVMA 1QBNA 1UTMA 4X2VA 1Q2WA 2VH0A 1DY8A 2BOKA 3SV2H 4UFGH 3MI4A 5DTHA 1SGQE 1GJ6A 1PPHE 1IQGA 3C27B 3SN8A 3TGKE 1LCYA 1COWD 2WZQA 1XKAC 2JIZD 4KP0A 1SQAA 3MMGA 4IC5A 4E7NA 3NCVA 2OCSA 1OPHB 3LGTA 1NTEA 1QA7A 1F0RA 8ESTE 2Y80A 3QDZB 3FVFB 4GLYA 5A0AE 1EP6A 2F9PA 1GWAA 1WJLA 1VGCC 2BD8A 2YMSB 3N7EA 4ZKRU 4UFFH 2GTBA 3SGBE 1ANDA 2OLGA 1TX7A 3TJOA 2EI7A 2KCAA 1QRZA 5E21A 3GISB 4X8UH 2CN0H 3QWCH 3SV9A 4UONA 5EJLA 2BD4A 1GJ8B 1D5GA 1C2HA 4WXVA 2M10A 1ACBE 4IW4E 1NS3A 1HAPH 1L4ZA 1V2PT 3KL6A 1QBVH 1AWHB 4OEOA 1FV9A 3GOVB 4ISIH 1QB9A 2W6JD 4WWYA 1N6FA 4JOJA 3V12A 1FQ3A 2EJYA 1KDQA 1T8MA 1Z6EA 2EA3A 3RXKA 1RD3B 4DIIH 3SOSA 3W95A 2G55A 5FX6A 3ZYDA 2XC4A 3BTHE 1V3XA 3PRDA 4X1SU 2P16A 1ZMJA 1C2IA 1KXDA 2LP6A 3D23A 2WYJA 3F6UH 3URDA 1A7SA 1GM1A 2FCFA 3T27A 1A46H 1GVKB 4NZQA 3CH8A 4YOGA 3S7HB 1VITF 4ZH8A 1AB9C 1XUHA 1S82A 1O37A 3KQ5A 2HE2A 1HDTH 3RLYH 1L1GA 4WXIA 1HPGA 2A2QH 3QTOH 2ANWA 1GBHA 1TB6H 4KFVA 1T32A 2FOEA 1KLTA 2FOFA 3QGLA 2SGEE 2GV7A 2ZU5A 2W26A 1FLEE 3BSQA 1M9UA 2FESH 2G5MB 2EGOA 4DY7B 2OD3B 2IOTA 1N6XA 5DP8A 2O8UA 1O2GH 4WH8A 4BAQB 5CE1A 2D90A 1WU1A 1DWBH 1ELEE 1H9IE 2C93B 4NMSA 1V2TT 4DURA 2W6ID 2WUBA 1TRMA 3LH3A 4FUIA 4SGAE 1D4PB 5C1YA 9ESTA 3QGNB 3R0FA 1KEFA 1FUJA 3RXTA 4NIWA 3EAJA 4ZAEA 1P2MA 1WSSH 2AGGX 1NRNH 1C2GA 1N8OC 1THRH 1G3BA 2PUQH 3ZZ3A 1WCZA 5J4QA 2VWMA 1HXFH 3U28C 5JYIA 1SGEE 3PV5A 1Y3VA 2OC0A 4ABAA 3OX7U 2J34A 2QT5A 1VKYA 3MO9A 1A3BH 2B8OH 4FUBA 2ZO3H 5C20A 1GBLA 1C5PA 1YC0A 2F9NA 3SYJA 2J92A 4YOJA 3SUZA 4IN1A 4NA7A 4ZKNU 1ANBA 1BOQA 3MNSA 2UUYA 1J9CH 1MD8A 3PS4A 3O8CA 1RJXB 2Z9JA 5T3HA 1C5QA 3FP8E 4NMVA 4BOHA 1W12U 1QRWA 4CREA 3Q3KA 2PKSB 1C5MD 4DCDA 2BLQA 4Y8YA 1VR1H 3MH7A 1ETRH 4Y8ZA 5ILBA 1DPOA
chains in the Genus database with same CATH topology
1PQ8A 1Y3XA 1IQIA 5FCKA 3LNXA 2L4TA 3UWJH 3PDVA 4XHVA 2VWLA 1V2VT 1A2CH 4DGJA 3SNBA 2GCHG 1O2IA 3RXQA 4AMHA 1O30A 3A7XA 1BHXB 2WV4A 3E1XB 1WQSA 3RXCA 1JIRA 2J9NA 4JZEH 2BDAA 1YPEH 3A7YA 1V5LA 1QL8A 1O3KA 3E0NB 4ZXYH 1O3PB 4MLFB 4Q6SA 3HK3B 2H3LA 4KFWA 2BDIA 1SG8B 2AH4X 3SHUA 1ZMLA 2W3KA 3D65E 1JOUB 3KN2A 3MFJA 2YNAA 1RXPA 2EGNA 1A5IA 3LDXH 3ZZBA 2ZDNA 3KDKA 4CH2B 3PM3A 5EOKA 2KAIA 4X6MA 1AVWA 2KV8A 1JMOH 4JORA 4NSVA 1GBTA 3SQHE 5DP4A 3QK1A 1BRAA 1U39A 1Q3PA 1C1NA 1GI0A 4JZDH 2LA8A 1DX5M 1AKSA 2IWQA 1NFWA 2OMJA 1GBFA 1ABIH 1EJAA 1TPOA 2GD4B 3NFKA 2G52A 2PKAA 1RGRA 3SNCA 4OGXA 1KYNA 1UHBB 1DDJA 2B0FA 2QY0B 3I29A 5DPAA 2H9EH 3SGQE 3TK5A 1XXDA 1CHOG 4RKJB 2R2WU 2ZPMA 1ELGA 1ESAA 2M0TA 1C5NH 1SHYA 1QURH 5A0BA 1BE9A 1G3CA 3VGCB 1GJAB 1QR3E 3SU2A 1G36A 5F6MA 3O8BA 4YLQH 1AKSB 2RDLA 1H4WA 2ZTZA 3WKMA 1O3AA 2JH0D 3LIWA 4TY6A 5AF9H 2RRMA 4YYXA 1UHPA 1ANEA 3NCLA 1T4UH 1TNIA 1T8NA 1C5SA 4R8TB 2CF9H 3TMHA 4YESB 1XZ9A 3UUZA 1P1EA 1YPHE 4ZUHA 1NO9H 4X0WU 1Y7NA 5GWZA 2Y82A 2BVXH 1A5HA 4CR9A 1O3DA 2W7SA 5JPMH 2FX6A 4HOPA 1HXEH 2CSJA 2BY5X 2FMJA 2Y7XA 2CMYA 2OCVB 2A7HA 3AW0A 1GI3A 1AVXA 4BXSA 1T8OA 3GY7A 2CF8H 2R0LA 2OBOA 2ZPSA 4JK5A 4MNWA 3RXSA 3DIWA 5GCHF 1OOKB 4RI0A 2ESTE 1UEPA 5HMAA 1F0UA 1LVBA 3IITA 3URCA 4IMZA 1O2LA 3IWMA 1A4WH 1C5XB 1S6FA 1EZQA 1MBMA 4FXGH 2BQ7B 1QL7A 1HYLA 1N7FA 2CHAB 4CRAA 1LPKB 1P8VC 1ZSKA 1BBRK 3LOXA 4BNRA 4I8JA 1PDRA 1C5WB 1V2UT 1ZR0A 3BTFE 3RMMH 2OZFA 5L30H 1F5KU 1HAGE 3PV2A 4HZHA 1K1PA 2IWOA 1L4DA 4FU9A 3SV7A 2A5IA 2CHAC 3TH4H 1ELCA 1SLXB 5DJ7A 3UWIA 1CGHA 2VVUA 4X1NU 4E3BA 1D3TB 3RC6A 4D76A 1GJ9B 1F0SA 1AI8H 2R3UA 1P05A 3M3SA 3SV8A 1AO5A 4FVDA 5JB8S 5EW2H 3RXHA 4ABIA 5C67A 2NU0E 1TGSZ 1YBWA 1AFQB 1B8QA 1EJNA 2IWPA 1IU0A 1P04A 1Y5UT 3P8OA 1HAZB 4F49A 4X1PU 3QX5H 1SOZA 1FN6A 1LHFH 1SLVB 3R3GB 4FVBA 6GCHG 1FZZA 2VSPA 1LHCH 5BPEA 4E05H 2D92A 2ULLA 1GI8B 1EATA 3PLPA 6LPRA 1E34B 4Y8XA 3EGHC 2PDZA 2FTLE 1Y8TA 5HFEA 2Q6GA 1FXYA 2ZU4A 1TRYA 3AW1A 3TPIZ 1GHWH 1O3LA 4Y7BA 3FAOA 2IWNA 1GBDA 1WF7A 3ZVDA 5HYOA 2KOJA 4UD9H 1Z86A 1EZUC 2ZCHP 3DJAA 1O2NA 3UREA 1BDAA 1TBRH 1MQ6A <