3MH5A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
254
structure length
191
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGYENFIQTDAAINRGNSGGALVNLNGELIGINTAIIGFAIPSNMVKNLTSQMVEYGQVKRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease do
total genus 43
structure length 191
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A01
3K2UA 2I6SA 3E0NB 3M35A 1W10U 5LPFA 3A80A 3FAOA 2VIVA 1TGNA 2QF3A 3SUEA 1G3DA 4O3TA 3SQHE 4ABAA 1O2MA 1O3OA 1VITG 1ZR0A 1C5OH 2XWBI 2Q6FA 5CE1A 2PTNA 2AGIX 5EOKA 4MG3A 2FZZA 3RXPA 2JETC 3GY5A 1YPHE 1ZHPA 2THFB 3ZVGA 5C1YA 1MZAA 4B74A 2ZPQA 5CMXH 1Q3XA 1UK3A 2GMTC 1O5BB 3SJ9A 1EB2A 4HI3A 2ZU2A 1ACBE 2BMGB 2ZTYA 3CS0A 2GZ9A 3RM2H 1RGQA 4CRFA 3MO3A 3VB3A 4X2XA 1CHOG 1O30A 1PPCE 1THPB 1PYTD 2BOKA 1AE5A 2BY8X 2ZHWH 1UTMA 3D23A 1XUFA 3MNBA 1TX7A 3BSQA 1EP5A 2VH0A 3M5MA 3UQVA 5C3NA 1UTPA 1N8OC 3GCTG 1V2WT 1GL1A 2D2DA 1UTQA 4FVBA 4CBOA 1O2XA 5H4IB 3KQEA 1GBIA 2R3YA 1PPFE 3GY3A 1J14A 2A45B 1PQ7A 2Z7FE 1D9IA 3D65E 3UWJH 2QC2A 1HAGE 1DDJA 2P94A 1EPTB 2ZIQH 3A7YA 3SU0A 4ZH8A 1HIAB 1E0FD 5BRRE 3RXEA 2D8WA 2ZFSA 3RMMH 3AASA 2UUFB 3A7ZA 1Z6JH 1OWDA 3R3GB 3F9HA 3P8NA 3MU5A 2ZGCA 2GVFA 1J9CH 3RU4E 3V12A 1EAWA 2UWLA 3LDXH 1TQ7B 4AORA 4NCYA 3TGIE 1QJ6B 1L0ZA 5GCHG 2QYIA 2AGEX 2VIQA 2CHAC 3ZYDA 1GCDA 1P2OA 3GCTF 1ETRH 5IDKA 1F7ZA 4X1NU 2HVXA 3EA7A 5DKMA 3SHAH 1ETSH 4DCDA 4XBCA 3D49H 1ESTA 3M36A 2PLXA 3GCHB 1QQUA 2C93B 2BDCA 1UK4A 2B8OH 1B5GH 5F8TA 5LPRA 1TPOA 4U30A 3HKJB 1PFXC 3S9AA 4CR9A 2QCYA 1QR3E 1TFXA 1GHVH 3QGJA 1W7XH 4HGCA 4LK4A 1AGJA 1J17T 2ZNKH 4UFDH 2ZQ1A 3A8DA 2UWOA 3RP2A 3URDA 1SSXA 1IQLA 5JBBS 1ELAA 2BVRH 2ZFFH 3HKIB 3SU5A 2EC9H 1LPGB 1FN8A 5HGGA 1WV7H 1FIWA 3ZZBA 3LONA 1P57B 1K1OA 3S7HB 3PWCA 1GHZA 1GVKB 1OWKA 2W26A 5J4QA 1YPEH 4Q7ZA 4K1TA 2B7DH 3S9BA 3FZDA 2CMYA 3KL6A 1GHXH 3VB7A 1B7XB 5EXLA 2R3UA 4TPIZ 2PWXA 1V6DA 4AB8A 1O2SA 2PHBA 3RXBA 1WTHD 5JB8S 1C2MA 4Y10E 3WY8A 4Y7BA 1GHWH 4M7GA 2STBE 4CHAC 1UJ1A 5L2ZH 2FIRH 5C1XA 3A89A 5EXNA 3VB6A 1RRKA 2Y7ZA 4OGXA 1ELVA 1FJSA 4RSPA 2OINA 1C2LA 2VU8E 4SGAE 2VJ1A 4WMFA 1BTPA 3SORA 1EKBB 2BY5X 3RXFA 3L33A 1F0SA 1C2JA 2W5EA 1Y3WA 2BY9X 3NPSA 2SGQE 4JZDH 1O2IA 2Z94A 1EPTC 1C5QA 1TIOA 4E7RG 3SU3A 2H9EH 4MPUA 5EXMA 3RDZA 1GHBG 4GCHG 3RXQA 4A1TA 1HAHH 2FDAA 2HRVA 1FIZA 4GLYA 1J16A 2P93A 4ISNA 1XVMA 5E8EH 3ZZ5A 2FOBA 2Q1JA 1O2UA 1O5GH 3RXDA 4INLA 5A8XA 3MNXA 1JIRA 1GHAG 3RXRA 3RXUA 3MTYA 1DWDH 1HXEH 2ZFTA 1UTKA 2RG3A 2Y80A 4IW4E 4Y7AA 1CT0E 3RLWH 1C5SA 3MU0A 3PMBB 2YNAA 4I31A 1P9UA 4IMQA 1C4U2 3A7WA 6GCHF 2BTCE 4A6LA 3GCNA 4X2VA 2PKSB 1TGSZ 2Z9IA 2GMTB 1M9UA 3LH3A 5A09A 2BDAA 1A4WH 1B0EA 2Z6BD 1WSSH 1THRH 4UONA 3KEEA 3PM3A 1TE0A 1IQMA 2JETB 5EGMA 2YNBA 4KTUA 1UVOA 1PPEE 4KELA 3F9EA 4ISOA 1GBTA 1P09A 5F6MA 2GP9B 3S7KB 3A82A 3A8AA 1GJ5H 4ESTE 3BG4B 1C9TA 1F5LA 4ISHH 1QA0A 2O9QA 3KHVA 3AW0A 1MQ6A 4YLUA 1W11U 2XBXA 1YP9A 1KDQB 1TBQH 4MDSA 1JOUB 1BDAA 1K2I1 2FMJA 1G3BA 1T4UH 4X8VH 3ZYEA 2G4TA 3UIRA 2GDDA 1FAXA 7LPRA 2PGBB 4NFEA 1KTSB 4THNH 4X6MA 2A31A 5DP8A 1MTNC 3ATKA 2F9UA 3V7TA 3E1XB 1SQOA 4JMYA 4Q80A 1GMHG 3O8RA 3TNSA 2AIPA 1F0RA 1HAOH 4DGJA 1TA6A 3TITA 1HV7A 1YM0A 4FXGH 2ZFPH 5FX5A 3HPTB 4RKJB 1MU8B 1SGDE 1DM4B 2VGCB 2ZDNA 1C5WB 3E16B 3OSYA 3LGVA 2OC0A 1BTHH 1OWHA 2QF0A 5E2PA 2GTBA 4CR5A 1OKXA 6CHAC 8LPRA 5FCRA 1GI3A 3RXKA 3GCHC 1TNGA 3PMJA 4JCNA 5GJ4B 3SHCH 4KP0A 1LHCH 2V35A 1LQDB 5BPEA 1YLCA 1O31A 3VB4A 1W3CA 1WCZA 2ZCKP 1AZ8A 2FI3E 1NFUA 4BAHB 4Q7XA 2SNVA 1P8VC 1G2LA 1SC8U 1YPKH 2WPMS 1PPGE 1FUJA 8KME2 2FI4E 4Y8XA 2XBYA 3ZZDA 1BRBE 1O2TA 4AFZA 2J92A 2FS8A 4OS1A 5FXLA 2J9NA 3STJA 7KMEH 1BIOA 2FOMB 3QUMP 5EW1H 2SGFE 1GWAA 2FYRA 1S0RA 2CF8H 5E0HA 1MTNB 1SVPA 3QLPH 1H1BA 2FLBH 2EI8A 1BB0B 1MD8A 3ITIA 1BTUA 2Y5FA 4CREA 5J4SA 1QBOA 1GBLA 1Y5AT 1NFXA 1D3PB 2F91A 2AEIH 4AFUA 1EZXC 2GCHF 1DSTA 1GBHA 2VNTA 1P3CA 3NZIA 1WTGH 1O35A 2RDLA 2SGPE 4Y0ZE 1GCTB 5JBTA 1QRZA 5DP3A 4O9VA 2QXJA 1MCTA 2A2XH 1ELCA 2OD3B 5A8YA 4O03A 4AG1A 1VITH 1P2IA 1UMAH 2V0BA 1AY6H 3DD2H 2GZ8A 1CBWB 1O2VA 3TJOA 1CBWC 1GPZA 2QGRA 3A7TA 4JZIA 2AMDA 3MU4A 4O3UA 1KXDA 1AUTC 2BD5A 1UCYK 1DY8A 3KCGH 1SGFA 1BUIA 3A8CA 2P3TB 1AWFH 3NK8A 2G5NA 4ASHA 1ELGA 1QBNA 1S82A 2RCEA 3T29A 1AFQB 2ZGHA 1VR1H 3GYMA 1EJNA 4I8HA 4O97A 2NWNA 1NT1A 3M7QA 3A83A 2H9TH 2WV5A 4OS7A 4ABBA 1UTJA 2Q6DA 1RFNA 3GYLB 5F8ZA 5C67A 2P59A 1FY4A 3CP7A 2JH5D 2ZKSA 4MPXA 2PUQH 1O5FH 1V2LT 1SGIB 2WYGA 1AHTH 3ZVBA 2O8WA 3MNSA 1KXEA 3DT0H 3DUXH 3MHWU 1C1TA 1ELDE 1TAWA 2FOEA 1GGDB 5FAHA 2CF9H 3EE0B 3KQBA 5E0JA 1H9LB 4NZQA 2A5KA 2SGDE 2FTMA 4ZHAA 2ZTZA 2QXGA 4JZ1A 2ZDKA 3M7TA 4MNVA 3ODDA 1V2JT 2ZQ2A 1SLUB 4H4FA 5FBEA 4ABFA 3P17H 3QX5H 5LH8A 2ZHFH 1BOQA 3B8JA 1ELEE 1TOCB 4TY7A 2BY6X 4BTIB 1HAVA 2PGQB 4D7FA 5GXPA 1Z71A 1DT2A 1P2JA 2OC7A 3BTEE 2VVUA 4UE7H 2J94A 3EDXB 3ZV8A 3UR6A 1KXBA 2ASUB 5AVDA 4CRAA 5DPAA 4NIWA 1S81A 1SPJA 1TPAE 1K1IA 2SGAA 1XXDA 3L3TA 5JDUB 1O39A 1ANBA 4BXSA 1HAIH 1BHXB 1C1QA 1IAUA 4ABIA 1PPBH 1NROH 2BLOA 3PV4A 3SV7A 1TLDA 2TGTA 3S0NA 1A3BH 1TMBH 1O3LA 1FNIA 3PLBA 1Y3YA 3OU0A 1VJAU 2CV3A 5SGAE 1C4Y2 4SGBE 1SHYA 1G32B 4JK6A 2BB4A 3KF2A 3T27A 2BLVA 2ZCHP 1O2GH 1QTFA 1VCQA 3A8BA 5F8XA 2F83A 2EI7A 1HNEE 4MNXA 1FQ3A 2F9OA 8ESTE 4CRCA 1P02A 1C1MA 5CHAB 1NRNH 3BV9B 1T32A 1O3HA 1XKBC 2BLQA 4DURA 1TOMH 1EX3A 4TWWA 1GBMA 1AZZA 2CXVA 2RA3A 1P04A 4GVUA 1UHBA 3LIWA 5HXFA 2ZI2H 5E2OA 3M5NA 4JYVH 2XNIA 2AH4X 2NU0E 1GJDB 4IN1A 1TMUH 1JMOH 4FUJA 2XW9A 1TBRH 2BLWA 3FFGA 2HALA 3ELAH 3GY4A 1FY8E 4K60A 2D1JA 1ELTA 1O37A 1LPKB 3UR9A 2BD8A 2C90B 1VZQH 4Q2KA 3SI3H 2GGVB 2STAE 4IC6A 1O3KA 1EZSC 5T6FA 4U32A 3QN7A 2BXTH 2FWWA 5DO4H 3V13A 2O8TA 1RTFB 3LC5A 1NY22 1ZMLA 2ZGXH 1DPOA 1GMDG 4X2YA 2ZDLA 2ANWA 2ZCLP 3MOCA 1D3QB 4DVAU 5ABWA 1AMHA 1Z8RA 1H8IH 3ZVEA 4FU7A 1GI2A 1ZTLA 1K1NA 1Y8TA 4BAQB 1EATA 3LJOA 3QTVH 2QY0B 2Y6TA 5E0GA 7ESTE 3MFJA 4Y71A 1AB9B 1MH0A 4TPYA 4Y8ZA 1Z1IA 2OC1A 2PUXB 4GUXA 4Y76A 1QURH 1HJ8A 1RS0A 4AX9H 1NN6A 1AIXH 5DP4A 1Z1JA 4B2AA 4XBDA 2EA3A 2HGTH 2FESH 4IBLH 2GDEH 4CH8B 1HJ9A 3E3TA 1YYY1 2AS9A 1GJCB 3ESTA 5GIBA 1ABIH 2ZHEH 1UTNA 1QGFA 2P8OB 2BX4A 3N7OA 5GDSH 1Z6EA 1IQFA 3PLPA 3LGWA 1DY9A 2W3IA 2QAAA 1O3BA 5ESBA 1DSUA 2A7CA 4YOIA 2Z9LA 3TLOA 5FBIA 1ANCA 4WMEA 2H5CA 3AW1A 5C5NA 3JZ1B 2TRMA 5A0CA 1Q31A 1O2LA 3FANA 1FY3A 2V3HH 1PQ8A 1WUNH 1A2CH 3EAJA 3Q3YA 4B75A 3PTNA 1O34A 2I6QA 1BQYA 1SLVB 4INHA 1EJMA 1JXPA 1GVLA 3U98H 1SL3A 1GBAA 1OPHB 4I8JA 4NA8A 5C2ZA 3QZQA 1GBJA 3RXAA 1DE7H 1H8DH 5AFZH 3UWIA 1IQJA 1TBZH 4H42U 2B5TB 4K3JA 1EAIA 3HATH 3GCOA 1MTVA 3OX7U 1QJ7B 1A1RA 1P9SA 3SZNA 4BAOB 1Y59T 1IQNA 1C5UA 4X8UH 1T7CA 1Y3UA 1IQIA 2OBOA 1ZJKA 1GI7B 1UHBB 1MAXA 1LVBA 2J95A 3U69H 1AKSB 1QRWA 1ELBA 2XC5A 5CHAC 1V2NT 1W12U 5DP6A 7GCHG 1XM1A 2JH6D 3BG4C 3GY8A 3TNTA 1P01A 1ANEA 1K1JA 1O2PA 1CT4E 3LKWA 4ZKOU 4IN2A 4IC5A 1HAVB 1GI8B 1W7GH 1O2NA 2BZAA 1GBDA 2ZC9H 2ZEBA 3E91A 4RN6A 2GD4B 3M37A 4XBBA 3OYPA 3VGCB 1HAYB 4LZ1H 2HPPH 3U8OH 5EQQA 3TGKE 2BVXH 4NIXA 4NSYA 2R2WU 1L1NA 2ANMH 5A0AE 1Y3XA 1AI8H 1GBFA 3O8CA 1SOZA 3LU9B 1C1UH 2Y5GA 2HNTF 3PLKA 1V2RT 5FPSA 2G8TA 3BF6H 2F3CE 3A7VA 4K69A 1TQ0B 5TCCA 3BTKE 4NA9H 2LNCA 1V2OT 2ZA5A 4NZLA 1LQEA 3KGPA 1K1MA 1QL7A 3AAVA 3A88A 5C1UA 3EQ0H 2H6MA 3ZZAA 4E7NA 2C4FH 6LPRA 1C9PA 1C2GA 4YT7H 1UVSH 2ZHDA 3RC6A 1A61H 1V2PT 1ESBA 1ZMJA 2NU3E 4YTAA 4OS2A 3ZZCA 4WWYA 1OX1A 3STIA 1P03A 4LOYH 1VCPA 1BRCE 3ZVAA 1ELFA 2ZHQH 5EODA 2A32A 1DXWA 1WBGB 1ZHRA 3SI4H 1MKWH 1V2ST 1HAZB 5FCKA 1GBBA 3VFEA 1LPZB 2HNTC 1RTKA 1D6WA 1CSOE 2Z3EA 5L6NH 4X6NA 4IMZA 2ZTXA 1WYKA 1C1OA 3LGYA 1GHAF 3NXPA 4MPVA 3RUOA 1T8MA 5IYTA 3IWMA 4XE4A 4CRGA 3BTDE 1V2QT 3Q3XA 2VB0A 2O8MA 4I8KA 3MMGA 3RMNH 2A5AA 1LDTT 4FUEA 1SHHB 2HWLB 3UNQA 2VH6A 1OOKB 5I46H 3RXTA 3F9GA 3RU4T 1S0QA 1F0UA 1TX6A 3V0XA 1SLWB 1TGBA 1BBRK 4B2BA 3P8FA 1QB1A 4ZXYH 1DS2E 3EA9A 4OS6A 3IG6B 1JRTA 1ZTJA 3BIUH 2Q6GA 2ODYB 2ZWLH 1GJBB 3SUFA 4FVDA 4Y79A 3P70B 3ZZ6A 5ESTE 1C2KA 2TIOA 4NIVA 1C5NH 1MUEB 1ZPCA 2BYAX 2TGAA 3OY5U 3TH2H 2WPIS 3SNBA 1O3NA 1TPSA 2UWPA 2G5VA 4QT8C 1XX9A 1C2EA 3B9FH 1F5KU 2ZGJA 2YOLA 2VWNA 3TJUA 1BMNH 3KQDA 1K21H 2FTLE 5K7RA 1O2WA 1CQQA 1OYQA 2OLGA 1G30B 2VIPA 1EZQA 1NPMA 1EASA 1ETTH 1GBEA 1DFPA 2GV7A 1XXFA 1C5MD 4XOJA 1QQ4A 2TGPZ 1ZGVA 3BTQE 1BZXE 2ZU5A 4JZEH 4K8BA 4Q7YA 3ZZ4A 3D62A 4MVNA 4FUGA 3TJNA 2CGAA 2VIWA 5HMAA 2BD7A 1SGEE 1A5HA 2QXIA 3UUZA 2CJIA 1TABE 4JZFH 3C1KA 2BQ7B 4R8TB 2AMQA 1HDTH 2FP7B 4GSOA 1P06A 1TGTA 2H5DA 1CGIE 4ZKNU 5B6OA 1J15A 1O2KA 3DFJA 4K8YA 4DIHH 1LHFH 1SGPE 2XC0A 1NFYA 2FEQH 3BTWE 1O3JA 3ZZ8A 1SGNE 3AVZA 3K6ZA 1QBVH 1LO6A 4Z0KA 4NA7A 3LGUA 4X8TH 1XVOA 1GBCA 1O2OA 2PKAA 3A87A 1V2UT 2WYJA 1GI6A 3W94A 5FX6A 2UUYA 1INCA 3SJ8A 2KAIA 5LPEA 3GY2A 3E8LA 3S69A 2NU1E 5DJ7A 1BMAA 4NWLA 5LGOA 3B23B 4PROA 3TIUA 1RIWC 1YCPM 2Z9GA 5A8ZA 1E36B 3MH7A 1O2QA 3H5CB 4B73A 3CS7A 2BDGA 1QJ1B 1O3PB 4YESB 2BY7X 1SGCA 3RXJA 1GMHF 1XUGA 3H7OA 2F9VA 3P6ZB 1MAYA 1HRTH 5DP7A 4X1QU 1TNJA 1PYTC 1X7AC 4NG9H 1A46H 2ZU4A 2J38A 2Z9KA 2BZ6H 1CGJE 2OQUA 2Y7XA 2CHAB 2BXUH 4D9RA 1O5AB 4X6PA 2OC8A 4VGCB 1RJXB 2FOGA 3VXFH 4BNRA 4WH8A 1QL8A 4A5TS 1QB9A 4FU9A 3UREA 1CU1A 3BEUA 3LC3A 2FOFA 3T26A 3QWCH 1VGCC 2VWOA 1GJ8B 1HJAB 1C4V2 2P3FH 1ESAA 3TK5A 3PO1C 3SNEA 1TRYA 1YPGH 2PKAB 2ZU1A 4YLQH 3HGPA 3SUGA 1ZOMA 1MKXH 2FXRA 4NWKA 1AWHB 1C1WH 1QCPA 4D7GA 1FY5A 3Q77A 1GI5A 2OUAA 2ZPSA 4X1RU 1EP6A 3F1SB 3NUMA 2C8WB 5EW2H 1VITF 2FX6A 3IITA 3A84A 3BTHE 4IS5A 3ZVFA 4ABGA 3E6PH 1EB1H 2ALVA 1OWIA 1VJ9U 1GI0A 1N6YA 5DGJA 4X1PU 1TNIA 1CHOF 1TALA 3RXLA 1AB9C 1NRQH 3URCA 1S85A 1OWJA 6GCHG 3PTBA 1QA7A 4GPGA 3VXEH 1F92A 1GL0E 2A7HA 1HYLA 4BXWA 1D3TB 1BTYA 1SR5C 3RXVA 1AVXA 2B9LA 2PV9B 2ULLA 1FPHH 1CA8B 4WJG2 4E05H 1B0FA 9LPRA 1Y3VA 1FI8A 4AN7A 2WUCA 3TJVA 2G4UA 1NU9A 2W7SA 1KTTB 1E38B 2ILNA 4WH6A 1W2KH 3MWIU 4UD9H 4AFQA 1C2HA 2XTTB 1AKSA 1O3FA 1GVZA 2OQ5A 1ZSJA 7GCHF 1CGHA 1GGDC 2G81E 2R9PA 1AU8A 3MI4A 1NESE 2FODA 3EYDA 1Z7KA 3LGIA 1G2MA 1P2NA 2FYQA 5GPIB 1CVWH 2ZPRA 4INKA 1NM6A 2Z3DA 1SOTA 2A5IA 4K1SA 4KGAA 5AFYH 1BTWA 1FV9A 2FOCA 1MKWK 5C20A 3UFAA 1P05A 1HB0B 1K1LA 3MO6A 1K28D 3HK6B 4ABEA 1DICA 3LOXA 3QZRA 4YO9A 1MTWA 1G9IE 1K9OE 1D6RA 1HAXB 2BDBA 3F9FA 2GX4A 1C5VA 3OTJE 3KQCA 1Z8JB 4FUIA 3RXMA 3DFLA 1ZTKA 1BITA 1P12E 4D76A 3I77A 1O32A 1EUFA 3G01A 1TRNA 1RIWB 3ZV9A 2XRCA 3A86A 1G3EA 1CE5A 2FO9A 1TX8A 2KAIB 3MU8A 4DJZB 1TNLA 2GV6A 3I78A 4ISIH 3PYHA 1FN6A 3SGBE 2GZ7A 1PPHE 4UEHH 2C8YB 4TWYA 1GDQA 1CHGA 1G3CA 1GCTC 5F03A 3RLYH 3MH5A 1ZMNA 2P16A 2R0KA 1UVTH 2O8LA 4NSVA 1QIXB 3ZVCA 1GJ7B 1SG8B 1GJAB 1C5ZB 1S6HA 1YLDA 3SV8A 3UOPA 1DITH 1LKBA 4GCHF 5EU8A 1L1JA 3V3MA 5K0HA 1GMCG 1OP8A 1DUEA 1T4VH 3OY6U 4ZUHA 3FP6E 2LPRA 1JBUH 1T8OA 2M5TA 1NFWA 1TRMA 1UVPA 1HUTH 1DXPA 1YF4A 2FI5E 1YPHC 2GCTC 3P92A 3E0PB 1P2QA 2A4OA 4UFFH 1ARCA 2A4RA 5HM9A 4BANB 1DUAA 2A7JA 4LXBH 2AGGX 1GI4A 1ZZZA 6ESTA 2HOBA 2UUKB 1VGCB 3NWUA 3Q76A 1C5LH 1SFIA 3SU4A 5C5OA 4CRBA 2ANYA 2SNWA 1ZPBA 3PMAB 3RXCA 1TPPA 1LMWB 3ENSB 1RTLA 1GBKA 1ZRBA 1NRSH 4YOGA 4YM9A 2WINI 3DA9B 1V2MT 3S9CA 1MBQA 4Y6DA 4JK5A 1KYNA 2BD4A 1O33A 1LVMA 1SGYE 4J1YA 1FY1A 3QDZB 2FM2A 1MQ5A 4I7YH 1L1GA 1Y5BT 4OS4A 1QB6A 1UK2A 1V2TT 1YPMH 4ZAEA 4CH2B 1V3XA 1ZPZA 2P3UB 1AFQC 1IQGA 1YKTA 3ZZ3A 1UCYE 1JIMA 1NRPH 4X6OA 3ATIA 1T31A 1MZDA 1NZQH 3BTFE 1HJAC 4MNWA 4DT7B 3LJJA 2EI6A 2BVSH 4ABHA 1HFDA 1YCPK 2QXHA 1WQSA 3L6PA 1MTUA 4I8LA 1F2SE 1FZZA 4ZHLU 1O3IA 1GDUA 2QN5T 1C1PA 3EGKH 4X2WA 1ANDA 1C5YB 2Y81A 1GHBF 1WQVH 2R2MB 3TVJB 1OP0A 1O2RA 3SU1A 1PQ5A 1EAXA 1L4ZA 3SUDA 3RU4D 5TJXA 3GOVB 4FUFA 3F68H 1EOJA 1XUJA 3P8OA 1IOEA 1OP2A 2V6NA 2B0FA 1ZRKA 1IQHA 1C5PA 4E06H 1N6XA 2BQWB 1EXFA 1O3CA 4UFEH 5GCHF 2XBWA 4GHQA 3RXHA 1RXPA 2ALPA 1JWTA 5JBAS 5T3HA 1O5DH 3W95A 4X0WU 4I33A 1IQEA 4HTCH 3RC5A 3SBKA 3SN8A 2J4IA 3SV2H 1KIGH 3O8BA 1P10A 3LH1A 4FUBA 1XUHA 1GJ9B 3GICB 3U8TH 4AGJA 1GG6C 4Z6AH 3A85A 2ZDMA 3M5OA 3Q00A 3LGTA 5JBCS 1RD3B 4XDEA 3RMOH 1C1NA 3ZZ7A 1Q2WA 5DP9A 1LVOA 2P95A 2ZZUH 1T8NA 1KXFA 4Y0YE 1DOJA 1ZSKA 1CO7E 1S6FA 2K1QA 2VIDA 4NFFA 4BAMB 3M61U 2ZECA 1KSNA 5FPTA 1O2YA 3MH6A 1QY6A 2V3OH 3MU1A 4WXVA 3TGJE 1GDNA 3SJOA 4K5ZA 1A0HB 1GI1A 2VGCC 1OSSA 2IN2A 4Y8YA 1AO5A 3QGNB 1O3AA 2TPIZ 3PMHB 1NRRH 3SV6A 4I8GA 1SFQB 1SGTA 1L4DA 1ZYOA 1AUJA 1QRXA 1K22H 1MKXK 3VGCC 2QV1A 3SGQE 1FAKH 1DX5M 5G4BA 2FLRH 2G52A 3QO6A 1HLTH 3CENA 3NKKA 1UVUH 2UUJB 1ZJDA 2XC4A 4MPWA 1CA0C 1G37A 2FOHA 3VB5A 2G55A 2JH0D 2BM2A 1KXAA 1HCGA 1HPGA 2Z3CA 4ZKSU 2PFEA 2CN0H 1GHYH 3BTTE 3E90B 3BEFB 4YOJA 2HPQH 3A81A 3DHKH 4OS5A 2TGDA 3ZVDA 5JYIA 1C2IA 2FOAA 1GMCF 1UCYH 2QIQA 4X8SH 1CT2E 5L30H 1IHSH 2OXSA 3UTUH 3FZZA 1VCWA 3T2NA 1Y5UT 2OCVB 2ZDVH 1BBRE 5EPYA 2PTCE 3MNCA 3SU6A 2A4QA 1O38A 1AVGH 1W14U 2VWMA 2GKVE 1D3DB 4R0IA 3SW2B 1BBRH 1S83A 1D4PB 1THSH 2BD3A 2GCHG 2ODQA 3EA8A 1TMTH 1C1VH 2H1UA 2XBVA 4BOHA 1LCYA 4MNYA 1TGCA 2VVVA 2NU2E 3BG8A 1S84A 3BTGE 2AFQB 1C2DA 1DWCH 4H6TA 2SGEE 4AB9A 3KN2A 3O8DA 1PQAA 1FLEE 2P8OC 1MTSA 1ORFA 1HBTH 1KLJH 2FS9A 2WPKS 1WAYB 4KTCA 3R0FA 1O36A 3PROA 1UO6A 1C2FA 1TNKA 2FPZA 3K6YA 1W13U 1T8LA 1BJUA 5HYOA 1OS8A 1SQAA 2GCTB 1BRUP 4TYDA 1BRAA 2AERH 3KNXA 1GJ6A 4D9QA 1ID5H 1W0YH 1GJ4H 3AAUA 3SJIA 1O2HA 1A3EH 1SQTA 3UOUA 1KLTA 4F4OC 1DVAH 4K1EA 2A1DB 4ZKRU 1QFKH 2W3KA 1U6QA 5EQSA 4DIIH 1SMFE 2WPJS 1E37B 5A2MH 3SNCA 4ZHMU 5AF9H 3SO3A 3QK1A 1C1SA 4MTBA 2WV4A 4B71A 2BD9A 1KXCA 4A1XA 5JPMH 1TYNA 1SBWA 2PR3A 3ATMA 3ATLA 1XMNB 2NU4E 4U2WA 3RXSA 1TB6H 4ISLA 3K65B 1JRSA 2J2UA 2ZO3H 5TCAA 1TA2A 3TU7H 3U9AH 3P95A 5FPYA 2A0QB 1BA8B 1HXFH 1H9IE 1Z8IB 1FPCH 1F0TA 2PSXA 2IOTA 3TK6A 4WMDA 1DWBH 3VEQB 4XFQA 2BX3A 5ETXA 5GWZA 2D26C 3VPKA 2ZF0H 2BQ6B 2OTVA 4LZ4B 3FP7E 1SGQE 4UFGH 5AHGH 3RXGA 2ESTE 4JYUH 3UQOA 1ZGIA 3BN9A 1C5XB 1BCUH 4CBNA 1O5EH 1C1RA 3TH4H 3RMLH 3MYWA 4IGDA 1PPZA 3ODFA 5I25A 4ABJA 1O3DA 4GHTA 2F9BH 4U01A 2WPLS 1O3MA 1GI9B 4DY7B 1KDQA 8GCHG 3GISB 1LVYA 2A2QH 5EQRA 3SV9A 1SLXB 3BEIB 4HFPB 1YC0A 3M3SA 3U1IB 3K9XB 1UTOA 4WXIA 2FX4A 3T62A 4BTUB 2IPHA 2F9PA 4I32A 2PKSC 1AVWA 1P2KA 2BDHA 2Y5HA 1XUKA 1AE8H 5FHTA 2AIQA 5DP5A 4J2YB 4AZ2B 2VINA 3LT3A 4Y11E 2C8XB 2DE8A 3ATWA 2BD2A 3SNAA 1WU1A 3UNSA 1LHEH 2XYAA 4ZROA 1ZHMA 1XKAC 3ZZ9A 3C27B 1C5TA 2O8UA 4DW2U 3T5FH 3RXIA 1EPTA 1NS3A 4NGAH 9ESTA 3SJKA 5JB9S 1SGRE 1V2VT 4HZHA 1LTOA 1XUIA 1FONA 1OYTH 4H6SB 1Z8GA 3SU2A 3GDVA 1J8AA 1BTZA 1UTLM 3KIDU 3PB1E 1GG6B 2ZGBH 3PO1B 1KY9A 3UPEA 4CRDA 1OXGA 1PJPA 1WOFA 4A1VA 4XSKU 5EPNA 1NTPA 2VIOA 3SNDA 3H7TA 2ZDAH 4JYTA 4ZXXH 4MLFB 3BTME 1IHTH 1MCVA 3SOSA 4AYYB 1HIAA 2WPHS 4VGCC 2GT8A 1BMMH 2BDIA 4AGKA 8GCHF 4FUHA 2PW8H 1O3GA 1ARBA 4CHAB 4KKDA 6CHAB 1S5SA 2C8ZB 2ODPA 1BMLA 5A0BA 3RXOA 1YCPH 4UDWH 1AFEH 4K2YA 1G36A 1BJVA 3SGAE 2AYWA 2HLCA 1IQKA 1DLKB 3QTOH 4OGYA 1FXYA 3TH3H 2F9NA 2XCNA 1W8BH 3F6UH 1A5IA 1NO9H 1O5CB 2ZP0H 4F49A 1L2EA 2H9HA 4RKOB 3NCLA 1SI5H 1TNHA 1EAUA 2QA9E 1E34B 1NU7B 1AD8H 1SGFG 3MO9A 5HM2A 2ANKH 3FP8E 2EEKA 2C3SA 4ABDA 1ABJH 3JZ2B 4BTTB 1AN1E 4D8NA 4ZMAH 1YGCH 4AOQA 1BTXA 1H4WA 4KTSA 2A4GA 4YZUA 2IJOB 3LPRA 5EG4A 3HGNA 4B1TA 3M7UA 1YPJH 4AFSA 2G51A 4X1SU 1E35B 2TBSA 1O2ZA 1A7SA 5DK1A 1O3EA 2R0LA 4A7IB 1DLEA 1KLIH 2XXLA 1FDPA 1CA0B 4BAKB 3TPIZ 1QHRB 3M3VA 3GY7A 1YPLH 3TK9A 3M5LA 3GDUA 4AYVB 1LKAA 4AG2A 3P8GA 1K1PA 3UY9A 2BHGA 2H2ZA 2Z9JA 1OWEA 3BIVH 2W7UA 5DG6A 4A92A 5T6DA 2ZU3A 1QL9A 4DG4A 3GDSA 4DOQA 1NC6A 2VVCA 1GMDF 1A0LA 3U1JB 4GAWA 4B2CA 1YBWA 1QNJA 1LHDH 1EJAA 4FU8A 1FMGA 1HGTH 3A7XA 1SB1H 2PSYA 2OBQA 3Q3KA 1O0DH 3HK3B 2ZFRH 4MQAA 3U8RH 1BT7A 1LHGH 1MD7A 2XCFA 2DE9A 4NIYA 1N8OB 2ZG0H 1BHXF 4FUDA 3T25A 4B76A 2J34A 3GY6A 1HAPH 5PTPA 4WVPE 1EOLA 2JKHA 4WF8A 1P0SH 3T28A 2XWAA 1AQ7A 2GT7A 2WUBA 1F5RA 1MMJN 1TONA 1P3EA 2ZFQH 4WY3A 2OP9A 2SFAA 3PWBA 1TWXB 2BOHB 2Y82A 3UNRA 1EQ9A 5L2YH 1MBMA 1O2JA 1C5RA 2DUCA 1ZLRA 1N1LA 1P2MA 1ZSLA 1A5GH 2HNTE 2G00A 3I29A 3RM0H 1V2KT 3MH4A 3SQEE 4TY6A 3RC4A 5T6GA 2VWLA 4YT6H 1MU6B 1W0ZU 1DANH 3FVFB 3M3TA 1P11E 2RA0A 1H9HE 1DWEH 4FUCA 1A0JA 2BDYA 2AMPA 1EZUC
chains in the Genus database with same CATH superfamily
4I86A 3K2UA 2I6SA 3E0NB 3M35A 3WWFA 1W10U 5LPFA 3A80A 3FAOA 2VIVA 1TGNA 2QF3A 3SUEA 1G3DA 4P00A 4O3TA 3SQHE 4ABAA 1O2MA 1O3OA 1VITG 1ZR0A 1C5OH 2XWBI 2Q6FA 5CE1A 2PTNA 2AGIX 5EOKA 4MG3A 2FZZA 3RXPA 2JETC 3GY5A 1YPHE 1ZHPA 2THFB 3ZVGA 5C1YA 1MZAA 4B74A 2ZPQA 5CMXH 1Q3XA 1UK3A 2GMTC 1O5BB 3SJ9A 1EB2A 4HI3A 1H8ED 2ZU2A 1ACBE 2BMGB 2ZTYA 3CS0A 2GZ9A 3RM2H 1RGQA 4CRFA 1NBMD 3MO3A 3VB3A 4X2XA 1CHOG 1O30A 1PPCE 5C94A 1THPB 1PYTD 2BOKA 1AE5A 2BY8X 2ZHWH 1UTMA 3D23A 1XUFA 3MNBA 1TX7A 3BSQA 1EP5A 2VH0A 3M5MA 3F2GA 5FL7D 3UQVA 5HKKD 5C3NA 1UTPA 1N8OC 3GCTG 1V2WT 1GL1A 2D2DA 1UTQA 4FVBA 4CBOA 1O2XA 5H4IB 3KQEA 1GBIA 2R3YA 1PPFE 3GY3A 1J14A 2A45B 1PQ7A 2Z7FE 1D9IA 3D65E 3UWJH 2QC2A 1HAGE 1DDJA 2P94A 1EPTB 2ZIQH 3A7YA 3SU0A 4ZH8A 1HIAB 1E0FD 3UAIC 3RXEA 2D8WA 5BRRE 2ZFSA 3RMMH 3AASA 2UUFB 3A7ZA 1Z6JH 1OWDA 3R3GB 3F9HA 3P8NA 3MU5A 2ZGCA 2GVFA 1J9CH 3RU4E 3V12A 4ACAA 1EAWA 2UWLA 3LDXH 1TQ7B 4AORA 4NCYA 3TGIE 1QJ6B 1L0ZA 5GCHG 2QYIA 2AGEX 2VIQA 2CHAC 3ZYDA 1GCDA 1P2OA 3GCTF 1ETRH 5IDKA 1F7ZA 4X1NU 2HVXA 3EA7A 5DKMA 3OTPA 3SHAH 1ETSH 4DCDA 4XBCA 3D49H 1ESTA 3M36A 2PLXA 3GCHB 1QQUA 5EJZA 2C93B 2BDCA 1UK4A 2B8OH 1B5GH 5F8TA 5LPRA 1TPOA 4U30A 3HKJB 1PFXC 3S9AA 4CR9A 2QCYA 4HG6A 1QR3E 1TFXA 1GHVH 3QGJA 1W7XH 4HGCA 4LK4A 1AGJA 1J17T 2ZNKH 4UFDH 2ZQ1A 3A8DA 2UWOA 3RP2A 3URDA 1SSXA 1IQLA 5JBBS 1ELAA 2BVRH 2ZFFH 3HKIB 3SU5A 2EC9H 1LPGB 1FN8A 5HGGA 1WV7H 1FIWA 3ZZBA 3LONA 1P57B 1K1OA 3S7HB 3PWCA 1GHZA 1GVKB 1OWKA 2W26A 5J4QA 1YPEH 3F0PA 4Q7ZA 4K1TA 2B7DH 3S9BA 3FZDA 2CMYA 3KL6A 1GHXH 2HVYB 3VB7A 1B7XB 5EXLA 2R3UA 4TPIZ 4P02A 2PWXA 1V6DA 4AB8A 1O2SA 2PHBA 3RXBA 1WTHD 5JB8S 1C2MA 4Y10E 3WY8A 4Y7BA 1GHWH 4M7GA 2STBE 4CHAC 1UJ1A 5L2ZH 2FIRH 5C1XA 3A89A 5EXNA 3VB6A 1RRKA 2Y7ZA 4OGXA 1ELVA 1FJSA 2PP6A 4RSPA 2OINA 1C2LA 2VU8E 4SGAE 2VJ1A 4WMFA 1BTPA 3SORA 1EKBB 2BY5X 3RXFA 3L33A 1F0SA 1C2JA 3OAAD 2W5EA 1Y3WA 2BY9X 3NPSA 2SGQE 4JZDH 1O2IA 2Z94A 1EPTC 1C5QA 1TIOA 4E7RG 3SU3A 2H9EH 3KYGA 4MPUA 5EXMA 3RDZA 1GHBG 4GCHG 3RXQA 4A1TA 1HAHH 2J5UA 2FDAA 2HRVA 1FIZA 4GLYA 1J16A 2P93A 4ISNA 1XVMA 5E8EH 3ZZ5A 2FOBA 2Q1JA 1O2UA 1O5GH 3RXDA 4INLA 5A8XA 1E79D 4RI0A 3MNXA 1JIRA 1GHAG 3RXRA 3RXUA 3MTYA 1DWDH 1HXEH 2ZFTA 5T1VA 1UTKA 2RG3A 2Y80A 4IW4E 4Y7AA 1CT0E 3RLWH 1C5SA 3MU0A 3PMBB 2YNAA 4I31A 1P9UA 4IMQA 1C4U2 3A7WA 4AC9A 6GCHF 2BTCE 4A6LA 3GCNA 4X2VA 2PKSB 1TGSZ 2Z9IA 2GMTB 1M9UA 1SQRA 3LH3A 5A09A 2BDAA 1A4WH 1B0EA 2Z6BD 1WSSH 1THRH 4UONA 3KEEA 3PM3A 1TE0A 1IQMA 2JETB 5EGMA 2YNBA 4KTUA 1UVOA 1PPEE 4KELA 3F9EA 4ISOA 1GBTA 1P09A 5F6MA 2GP9B 3S7KB 3A82A 3A8AA 1GJ5H 4ESTE 3BG4B 1C9TA 1F5LA 4ISHH 1QA0A 2YMSC 2O9QA 3KHVA 3AW0A 1MQ6A 3OE7D 4YLUA 4XRNA 1W11U 1YP9A 2XBXA 1KDQB 1TBQH 3ZIAD 4MDSA 1JOUB 1BDAA 1K2I1 2FMJA 1G3BA 1T4UH 4X8VH 3ZYEA 2G4TA 4OM9A 5KECA 3UIRA 2GDDA 1FAXA 1WDIA 7LPRA 2PGBB 5B6LA 4NFEA 1KTSB 4THNH 4X6MA 2A31A 2KX4A 3H09A 5DP8A 1MTNC 3ATKA 2F9UA 2YMSD 3V7TA 3E1XB 1SQOA 4JMYA 2OK5A 4Q80A 1GMHG 3O8RA 2W6ID 2AIPA 3TNSA 1F0RA 1HAOH 4DGJA 1TA6A 3TITA 1HV7A 1YM0A 4FXGH 2ZFPH 5FX5A 3HPTB 4RKJB 1MU8B 1SGDE 3OEED 1DM4B 2VGCB 3OEHD 2ZDNA 1C5WB 3E16B 3OSYA 3LGVA 2J97A 2OC0A 1BTHH 1OWHA 2GJGA 2HLDD 2QF0A 5E2PA 2GTBA 4CR5A 1OKXA 6CHAC 3F2FA 5FCRA 8LPRA 1GI3A 3RXKA 3GCHC 1TNGA 3PMJA 4JCNA 5GJ4B 3SHCH 4KP0A 1LHCH 2V35A 1LQDB 5BPEA 1YLCA 1O31A 3VB4A 1W3CA 1WCZA 2ZCKP 1AZ8A 2FI3E 1NFUA 4BAHB 4Q7XA 2SNVA 1P8VC 1G2LA 1SC8U 1YPKH 2WPMS 2KFWA 1PPGE 1FUJA 8KME2 2FI4E 4Y8XA 2XBYA 1OHHD 3ZZDA 1BRBE 1O2TA 4AFZA 2J92A 2FS8A 2WSSD 4OS1A 5FXLA 2J9NA 3STJA 7KMEH 1BIOA 4Z1MD 2FOMB 3QUMP 5EW1H 2SGFE 1GWAA 2FYRA 1S0RA 2CF8H 5E0HA 1MTNB 1SVPA 3QLPH 1H1BA 2FLBH 2EI8A 2LP6A 1BB0B 1MD8A 3ITIA 1BTUA 2Y5FA 4CREA 3FOAA 5J4SA 1QBOA 1GBLA 1Y5AT 1NFXA 1D3PB 2F91A 2AEIH 4AFUA 1EZXC 2GCHF 1DSTA 1GBHA 2VNTA 1P3CA 3NZIA 1WTGH 1O35A 2RDLA 2SGPE 4Y0ZE 2JIZD 1GCTB 5JBTA 1QRZA 5DP3A 4O9VA 2QXJA 1MCTA 2A2XH 2AHME 1ELCA 2OD3B 5A8YA 4O03A 4AG1A 1VITH 1P2IA 1UMAH 2V0BA 1AY6H 3DD2H 2GZ8A 1CBWB 1O2VA 3TJOA 1CBWC 1GPZA 2QGRA 3A7TA 4JZIA 2AMDA 3MU4A 4O3UA 1KXDA 1AUTC 3N7DA 2BD5A 1UCYK 1DY8A 3KCGH 1SGFA 1BUIA 3A8CA 2IPQX 2P3TB 1AWFH 3NK8A 2G5NA 4ASHA 1ELGA 1QBNA 1S82A 5KGOA 2RCEA 3T29A 1AFQB 2ZGHA 1VR1H 3GYMA 3UB0A 1EJNA 4I8HA 4O97A 2NWNA 1NT1A 3M7QA 3A83A 2H9TH 2WV5A 4OS7A 4ABBA 1UTJA 2Q6DA 1RFNA 3GYLB 5F8ZA 5C67A 2P59A 1FY4A 5KEDA 3CP7A 2JH5D 2ZKSA 4MPXA 2PUQH 1O5FH 1V2LT 1SGIB 2WYGA 1AHTH 3ZVBA 2O8WA 3MNSA 1KXEA 3DT0H 3DUXH 3MHWU 1C1TA 1ELDE 4F55A 1TAWA 2FOEA 3PV5A 1GGDB 5FAHA 2CF9H 3EE0B 3KQBA 5E0JA 1H9LB 4NZQA 2A5KA 2SGDE 2FTMA 4ZHAA 2ZTZA 2QXGA 3F3BA 2ZDKA 3M7TA 4JZ1A 4MNVA 3ODDA 1V2JT 2ZQ2A 1SLUB 4H4FA 5FBEA 4ABFA 3P17H 3QX5H 5LH8A 2ZHFH 2F43B 1BOQA 3B8JA 1ELEE 1TOCB 4TY7A 2BY6X 4BTIB 1HAVA 2PGQB 4D7FA 5GXPA 1Z71A 1DT2A 1P2JA 2OC7A 3BTEE 2VVUA 4UE7H 2J94A 3EDXB 3ZV8A 3UR6A 1KXBA 2ASUB 5AVDA 2EY4C 4CRAA 5DPAA 4NIWA 1S81A 1SPJA 1TPAE 1K1IA 2SGAA 1XXDA 3L3TA 5JDUB 1O39A 1ANBA 4BXSA 1HAIH 1BHXB 1C1QA 1IAUA 4ABIA 1PPBH 1NROH 2BLOA 3PV4A 3SV7A 1TLDA 2TGTA 3S0NA 1A3BH 2WHXA 1TMBH 1O3LA 1FNIA 3PLBA 1Y3YA 3OU0A 3MQKC 1VJAU 2CV3A 5SGAE 1C4Y2 4SGBE 1SHYA 1G32B 4JK6A 2BB4A 3KF2A 3T27A 2BLVA 2ZCHP 1O2GH 1QTFA 1VCQA 2WV9A 3A8BA 5F8XA 2F83A 2EI7A 1HNEE 4MNXA 1FQ3A 2F9OA 8ESTE 4CRCA 1P02A 1C1MA 5CHAB 1NRNH 3BV9B 1T32A 1O3HA 1XKBC 3WWBA 2BLQA 4DURA 1TOMH 1EX3A 4TWWA 1GBMA 1AZZA 2CXVA 2RA3A 1P04A 4GVUA 1UHBA 3LIWA 5HXFA 2ZI2H 5E2OA 1NBME 3M5NA 2XNIA 4JYVH 2AH4X 2NU0E 1GJDB 2V3MA 4IN1A 1TMUH 1JMOH 4FUJA 2XW9A 1TBRH 2BLWA 3FFGA 2HALA 3ELAH 3GY4A 3PRDA 3AK5A 1FY8E 4K60A 2D1JA 1ELTA 1O37A 1LPKB 3UR9A 2WZQA 2BD8A 2C90B 1VZQH 4M9FA 4Q2KA 3SI3H 2GGVB 4DT4A 2STAE 4IC6A 1O3KA 1EZSC 5T6FA 4U32A 3QN7A 2BXTH 2FWWA 5DO4H 3V13A 2O8TA 1RTFB 3LC5A 1NY22 5IK2D 1ZMLA 2ZGXH 1DPOA 1GMDG 4X2YA 2ZDLA 2ANWA 2ZCLP 3MOCA 1D3QB 4DVAU 5ABWA 1AMHA 1Z8RA 4YXWD 1H8IH 3ZVEA 4FU7A 1GI2A 1ZTLA 1K1NA 1Y8TA 4BAQB 1EATA 3LJOA 3QTVH 2RFKC 2QY0B 2Y6TA 5E0GA 7ESTE 3MFJA 4Y71A 1AB9B 1MH0A 4TPYA 4Y8ZA 1Z1IA 2OC1A 2PUXB 4GUXA 4Y76A 1QURH 1HJ8A 1RS0A 4AX9H 1NN6A 1AIXH 5DP4A 1Z1JA 4B2AA 4XBDA 2EA3A 2HGTH 2FESH 4IBLH 2GDEH 4CH8B 1HJ9A 3E3TA 1YYY1 2AS9A 1GJCB 3ESTA 5GIBA 1ABIH 2ZHEH 1UTNA 1QGFA 2P8OB 2BX4A 3N7OA 5GDSH 1Z6EA 1IQFA 3PLPA 3LGWA 1DY9A 2W3IA 2QAAA 1O3BA 5ESBA 1DSUA 2A7CA 4YOIA 2Z9LA 3TLOA 5FBIA 1ANCA 4WMEA 2H5CA 3AW1A 5C5NA 3JZ1B 2TRMA 5A0CA 1Q31A 1O2LA 3FANA 1FY3A 3PV2A 2V3HH 1PQ8A 1WUNH 1A2CH 3EAJA 3Q3YA 4B75A 3PTNA 1O34A 2I6QA 1BQYA 1SLVB 4INHA 1EJMA 1JXPA 1GVLA 3U98H 1SL3A 1GBAA 1OPHB 4I8JA 4NA8A 5C2ZA 3QZQA 1GBJA 3RXAA 2LELA 1DE7H 1H8DH 5AFZH 3UWIA 1IQJA 1TBZH 4H42U 2B5TB 4K3JA 2K8IA 1EAIA 3HATH 3GCOA 1MTVA 3OX7U 1QJ7B 1A1RA 1P9SA 3SZNA 4BAOB 1Y59T 1IQNA 1C5UA 4X8UH 1T7CA 1Y3UA 1IQIA 2OBOA 1ZJKA 1GI7B 1H8HD 1MAXA 1UHBB 1LVBA 1FX0B 2J95A 4TT3D 3U69H 1AKSB 1QRWA 1ELBA 2XC5A 5CHAC 1V2NT 1W12U 5DP6A 7GCHG 1XM1A 2JH6D 3BG4C 3GY8A 3TNTA 1P01A 1ANEA 1K1JA 1O2PA 1EFRD 1CT4E 3LKWA 4ZKOU 4IN2A 1E1QD 1HAVB 1GI8B 1W7GH 1O2NA 2BZAA 1GBDA 2ZC9H 2ZEBA 4IC5A 3EE7A 3E91A 4RN6A 2GD4B 3M37A 4XBBA 3OYPA 3VGCB 1HAYB 4LZ1H 2HPPH 3U8OH 5EQQA 4ZCNA 2BVXH 3TGKE 4NIXA 4NSYA 2R2WU 1L1NA 2ANMH 5A0AE 1Y3XA 1AI8H 1GBFA 3O8CA 1SOZA 3LU9B 1C1UH 2Y5GA 2HNTF 3PLKA 1V2RT 5FPSA 2G8TA 3BF6H 2F3CE 3A7VA 4K69A 1TQ0B 5TCCA 3BTKE 4NA9H 2LNCA 1V2OT 2ZA5A 4NZLA 1LQEA 3GS9A 1K1MA 1QL7A 3KGPA 3AAVA 3A88A 5C1UA 3EQ0H 2H6MA 3ZZAA 4E7NA 2C4FH 6LPRA 1C9PA 3U28C 1C2GA 4YT7H 1UVSH 2ZHDA 3RC6A 1A61H 1V2PT 1ESBA 1ZMJA 2NU3E 4YTAA 4OS2A 3ZZCA 4WWYA 1OX1A 3STIA 1P03A 4LOYH 1VCPA 1BRCE 3ZVAA 1ELFA 2ZHQH 5EODA 2A32A 1DXWA 1WBGB 1ZHRA 3SI4H 1MKWH 1UW7A 1V2ST 3SYJA 1HAZB 5FCKA 1GBBA 3VFEA 1LPZB 2HNTC 1RTKA 1D6WA 1CSOE 2Z3EA 5L6NH 4X6NA 4IMZA 2ZTXA 1WYKA 1C1OA 3LGYA 1GHAF 3NXPA 4MPVA 3RUOA 1T8MA 5IYTA 3IWMA 4XE4A 1W0KD 4CRGA 3BTDE 1V2QT 3Q3XA 2VB0A 2O8MA 4I8KA 3MMGA 3RMNH 2A5AA 1LDTT 4FUEA 1SHHB 2HWLB 3UNQA 2VH6A 1OOKB 5I46H 3RXTA 3F9GA 3RU4T 1S0QA 1F0UA 2KZ4A 1TX6A 3V0XA 1SLWB 1TGBA 1BBRK 4B2BA 3P8FA 1QB1A 4ZXYH 3DSGA 1DS2E 3EA9A 4OS6A 3IG6B 1JRTA 1ZTJA 3BIUH 2Q6GA 2ODYB 2M2AA 1GJBB 2ZWLH 3SUFA 4FVDA 4Y79A 3W1EA 3P70B 3ZZ6A 5ESTE 1C2KA 4B6EA 2TIOA 4NIVA 1C5NH 1MUEB 1ZPCA 2BYAX 2EQNA 2TGAA 3OY5U 3TH2H 2WPIS 3SNBA 1O3NA 1TPSA 2UWPA 2G5VA 4QT8C 1XX9A 1C2EA 3B9FH 1F5KU 2ZGJA 2YOLA 2VWNA 3TJUA 1BMNH 3KQDA 1K21H 2FTLE 5K7RA 1O2WA 1CQQA 1OYQA 2OLGA 1G30B 2VIPA 1EZQA 1NPMA 1EASA 1ETTH 1GBEA 1DFPA 2GV7A 1XXFA 1C5MD 4XOJA 2KR7A 1QQ4A 2TGPZ 1ZGVA 3BTQE 1BZXE 2ZU5A 4JZEH 4K8BA 4Q7YA 3ZZ4A 3D62A 4MVNA 4FUGA 3TJNA 2CGAA 2VIWA 5HMAA 2BD7A 1SGEE 1A5HA 2QXIA 2KM0A 3UUZA 4ASUD 2CJIA 1TABE 4JZFH 3C1KA 2BQ7B 4R8TB 2AMQA 1HDTH 2FP7B 4GSOA 1P06A 4Q63A 1TGTA 2H5DA 1CGIE 4ZKNU 5B6OA 1J15A 1O2KA 3N99A 4XD7D 3DFJA 4K8YA 4DIHH 1LHFH 1K0HA 1SGPE 2XC0A 1NFYA 2FEQH 3BTWE 1O3JA 3ZZ8A 1SGNE 3AVZA 3K6ZA 1QBVH 1LO6A 4Z0KA 4NA7A 3LGUA 4X8TH 5HIYA 1XVOA 1GBCA 1O2OA 2PKAA 1E1RD 3A87A 1V2UT 2WYJA 1GI6A 3W94A 5FX6A 2UUYA 1INCA 3SJ8A 2KAIA 5LPEA 3GY2A 3E8LA 3S69A 2NU1E 5DJ7A 1BMAA 4NWLA 5LGOA 3B23B 4PROA 3TIUA 1RIWC 1YCPM 2Z9GA 5A8ZA 1E36B 3MH7A 1O2QA 3H5CB 4B73A 3CS7A 2BDGA 1QJ1B 1O3PB 4YESB 2BY7X 1SGCA 3RXJA 1GMHF 1XUGA 3H7OA 2F9VA 3P6ZB 1MAYA 1HRTH 5DP7A 4X1QU 1TNJA 1PYTC 1X7AC 5F53A 4NG9H 2JJ1D 1A46H 2ZU4A 2J38A 2Z9KA 2BZ6H 1CGJE 2OQUA 2Y7XA 2CHAB 2BXUH 4D9RA 1O5AB 4X6PA 2OC8A 4VGCB 1RJXB 2FOGA 3VXFH 4BNRA 4WH8A 1QL8A 4A5TS 1QB9A 4FU9A 3UREA 1CU1A 3BEUA 3LC3A 2FOFA 3T26A 3QWCH 1VGCC 2VWOA 1GJ8B 1HJAB 1C4V2 2P3FH 1ESAA 3TK5A 3PO1C 3SNEA 1TRYA 1YPGH 2PKAB 2ZU1A 4YLQH 3HGPA 3SUGA 1ZOMA 1MKXH 2FXRA 4NWKA 1AWHB 1C1WH 1QCPA 4D7GA 1FY5A 3Q77A 1GI5A 2OUAA 2ZPSA 4X1RU 1EP6A 3F1SB 3NUMA 2C8WB 5EW2H 1YY3A 1VITF 2FX6A 3IITA 3A84A 3BTHE 4IS5A 3ZVFA 4ABGA 3E6PH 1EB1H 2ALVA 1OWIA 1VJ9U 1GI0A 1N6YA 5DGJA 4X1PU 1TNIA 1CHOF 1TALA 3RXLA 1AB9C 4Q4LA 1NRQH 4ACBA 3URCA 1S85A 1OWJA 6GCHG 3PTBA 1QA7A 4GPGA 3VXEH 1F92A 1GL0E 2A7HA 1HYLA 1WXRA 4BXWA 1D3TB 1BTYA 1SR5C 3RXVA 1AVXA 2B9LA 2PV9B 2ULLA 1FPHH 1CA8B 4WJG2 4E05H 2CK3D 1B0FA 3KQ5A 1Y3VA 9LPRA 1FI8A 4AN7A 2WUCA 3TJVA 2G4UA 1NU9A 2W7SA 2J98B 2KCAA 1KTTB 1E38B 2ILNA 4WH6A 1W2KH 3MWIU 4UD9H 4AFQA 1C2HA 2XTTB 1AKSA 1O3FA 1GVZA 2OQ5A 1ZSJA 7GCHF 1CGHA 1GGDC 2G81E 2R9PA 1AU8A 3MI4A 1NESE 2FODA 3EYDA 1Z7KA 3LGIA 1G2MA 1P2NA 2FYQA 5GPIB 1CVWH 2ZPRA 4INKA 1NM6A 2Z3DA 1SOTA 2A5IA 4K1SA 4KGAA 5AFYH 1BTWA 1FV9A 2FOCA 1MKWK 5C20A 3UFAA 1P05A 1HB0B 1K1LA 5CHBA 3MO6A 1K28D 3HK6B 4ABEA 1DICA 3LOXA 3QZRA 4YO9A 1MTWA 1G9IE 1K9OE 1D6RA 1HAXB 2BDBA 3F9FA 2GX4A 1C5VA 3OTJE 3KQCA 1Z8JB 4FUIA 3RXMA 3DFLA 1ZTKA 1BITA 1P12E 3OFND 4D76A 3I77A 1O32A 1EUFA 3G01A 1TRNA 1RIWB 3ZV9A 2XRCA 3A86A 1G3EA 2V7QD 1CE5A 2FO9A 1TX8A 2KAIB 3MU8A 4DJZB 1TNLA 2GV6A 3I78A 4ISIH 3PYHA 1FN6A 4B6FA 3SGBE 2GZ7A 1PPHE 1COWD 4UEHH 2C8YB 4TWYA 1GDQA 1CHGA 3DSPA 1G3CA 1GCTC 5F03A 3RLYH 3MH5A 1ZMNA 2P16A 2R0KA 1UVTH 2O8LA 4NSVA 1QIXB 3ZVCA 1GJ7B 1SG8B 1GJAB 1C5ZB 1S6HA 1YLDA 3SV8A 3UOPA 1DITH 1LKBA 4GCHF 5EU8A 1L1JA 3V3MA 5K0HA 1GMCG 1OP8A 5HIZA 1DUEA 1T4VH 3OY6U 4ZUHA 3FP6E 2LPRA 1JBUH 1T8OA 2M5TA 1NFWA 1TRMA 1UVPA 1W0JD 1HUTH 1DXPA 1YF4A 2FI5E 1YPHC 2GCTC 3P92A 3E0PB 1P2QA 2J98A 2QF4A 2A4OA 4UFFH 1ARCA 2A4RA 5HM9A 4BANB 1DUAA 2A7JA 4LXBH 2AGGX 1GI4A 1ZZZA 6ESTA 2HOBA 2UUKB 1VGCB 3NWUA 3Q76A 1C5LH 1SFIA 3SU4A 5C5OA 5C0UA 4CRBA 2ANYA 2SNWA 1ZPBA 3PMAB 3RXCA 5DSFA 1TPPA 1LMWB 3ENSB 1RTLA 3F2HA 1GBKA 1ZRBA 1NRSH 4YOGA 4YM9A 2WINI 3DA9B 1V2MT 3S9CA 1MBQA 4Y6DA 4JK5A 1KYNA 2BD4A 1O33A 1LVMA 1SGYE 4J1YA 1FY1A 3QDZB 2FM2A 1MQ5A 4I7YH 1L1GA 5EJLA 1Y5BT 4OS4A 4FOUC 1QB6A 1UK2A 1V2TT 1YPMH 4ZAEA 4CH2B 1V3XA 1ZPZA 2P3UB 1AFQC 1IQGA 1YKTA 3ZZ3A 2IJD1 1UCYE 1JIMA 1NRPH 4X6OA 3ATIA 1T31A 1MZDA 1NZQH 3BTFE 1HJAC 4MNWA 4DT7B 3LJJA 2EI6A 2BVSH 4ABHA 1HFDA 1YCPK 2QXHA 1WQSA 3L6PA 1MTUA 4I8LA 1F2SE 1FZZA 4ZHLU 1O3IA 1GDUA 2QN5T 1C1PA 3EGKH 4X2WA 1ANDA 2XNDD 1C5YB 2Y81A 1GHBF 1QZ8A 1WQVH 2R2MB 3TVJB 1OP0A 1O2RA 3SU1A 1PQ5A 1EAXA 1L4ZA 3SUDA 3RU4D 5TJXA 3GOVB 4FUFA 3F68H 1EOJA 1XUJA 3P8OA 1IOEA 1OP2A 2V6NA 2B0FA 1ZRKA 1IQHA 1C5PA 4E06H 1N6XA 2BQWB 1EXFA 1O3CA 4UFEH 5GCHF 2XBWA 4GHQA 1BMFD 3RXHA 1RXPA 2ALPA 1JWTA 5JBAS 5T3HA 1O5DH 3W95A 4X0WU 4I33A 1IQEA 2KCYA 4HTCH 3RC5A 3FO8D 3SBKA 3CNRA 3SN8A 2J4IA 3SV2H 1KIGH 3O8BA 1P10A 3LH1A 4FUBA 1XUHA 1GJ9B 3WW7A 3GICB 3U8TH 4AGJA 1GG6C 4Z6AH 3A85A 2ZDMA 3M5OA 3Q00A 3LGTA 5JBCS 1RD3B 4XDEA 3RMOH 1C1NA 3ZZ7A 1Q2WA 5DP9A 1LVOA 2P95A 3PRBA 2ZZUH 1T8NA 1KXFA 4Y0YE 3KYFA 1DOJA 1ZSKA 1CO7E 1S6FA 2K1QA 2VIDA 4NFFA 4BAMB 3M61U 2ZECA 1KSNA 5FPTA 1O2YA 3MH6A 1QY6A 2V3OH 3MU1A 4WXVA 3TGJE 1GDNA 3SJOA 4K5ZA 1A0HB 1GI1A 1OSSA 2IN2A 2VGCC 4Y8YA 1AO5A 3QGNB 1O3AA 2JJ2D 2TPIZ 3PMHB 1NRRH 3SV6A 4I8GA 1SFQB 1SGTA 1L4DA 2KCPA 1ZYOA 1AUJA 1QRXA 1K22H 1MKXK 3VGCC 2QV1A 4RT1A 3SGQE 1FAKH 1DX5M 2WPDD 5G4BA 2FLRH 2G52A 3QO6A 1HLTH 3CENA 3NKKA 1UVUH 2UUJB 1ZJDA 2XC4A 4MPWA 2W6JD 1CA0C 1G37A 2FOHA 3F0OA 3VB5A 2G55A 2JH0D 2BM2A 1KXAA 1HCGA 1HPGA 2KCOA 2Z3CA 4ZKSU 2PFEA 2CN0H 5DN6D 1GHYH 3BTTE 3E90B 3BEFB 4YOJA 2HPQH 3A81A 3DHKH 4OS5A 2TGDA 3ZVDA 5JYIA 1C2IA 2FOAA 1GMCF 1UCYH 2QIQA 4X8SH 1CT2E 5L30H 1IHSH 2OXSA 3UTUH 3FZZA 1VCWA 3T2NA 1Y5UT 2OCVB 2ZDVH 1BBRE 5EPYA 2PTCE 3MNCA 3SU6A 2A4QA 1O38A 1AVGH 3DCLA 1W14U 2VWMA 2GKVE 1D3DB 4R0IA 3SW2B 1BBRH 1S83A 1D4PB 1THSH 2GCHG 2BD3A 2ODQA 1MABB 3EA8A 1TMTH 1C1VH 2H1UA 2XBVA 1S6LA 4BOHA 1LCYA 4MNYA 1TGCA 2VVVA 1YLNA 2NU2E 1S84A 3BG8A 3BTGE 2AFQB 1C2DA 1DWCH 4H6TA 2SGEE 4AB9A 3KN2A 3O8DA 1PQAA 1FLEE 2P8OC 1MTSA 1ORFA 1HBTH 1KLJH 2FS9A 2WPKS 1WAYB 4KTCA 3R0FA 1O36A 3PROA 1UO6A 1C2FA 1TNKA 2FPZA 3K6YA 1W13U 1T8LA 5C0TA 1BJUA 5HYOA 1OS8A 4F48B 1SQAA 2GCTB 5CDFE 1BRUP 4TYDA 1BRAA 2AERH 3KNXA 1GJ6A 4D9QA 1ID5H 1W0YH 1GJ4H 3AAUA 3SJIA 1O2HA 1A3EH 1SQTA 3UOUA 1KLTA 4F4OC 1DVAH 4K1EA 2A1DB 4ZKRU 1QFKH 2W3KA 1U6QA 5EQSA 4DIIH 1SMFE 2WPJS 3FKSD 1E37B 5A2MH 3SNCA 4ZHMU 5AF9H 3SO3A 3QK1A 1C1SA 4MTBA 2WV4A 4B71A 2BD9A 1KXCA 4A1XA 5JPMH 1TYNA 1SBWA 2PR3A 3ATMA 3ATLA 1XMNB 2NU4E 4U2WA 4RT0A 3RXSA 1TB6H 4ISLA 2QF5A 3K65B 1JRSA 2J2UA 2ZO3H 5TCAA 1TA2A 3TU7H 3U9AH 3P95A 5FPYA 2A0QB 5C17A 1BA8B 1HXFH 1H9IE 1Z8IB 4TSFD 1FPCH 1F0TA 2PSXA 2IOTA 3TK6A 3FN8A 4WMDA 1DWBH 3VEQB 4XFQA 2BX3A 5ETXA 5GWZA 2D26C 3VPKA 2ZF0H 2BQ6B 2OTVA 4LZ4B 3FP7E 1SGQE 4UFGH 5AHGH 3RXGA 2ESTE 4JYUH 3UQOA 1ZGIA 3BN9A 1C5XB 1BCUH 2F4LA 4CBNA 2L74A 1O5EH 1C1RA 3TH4H 3RMLH 3MYWA 4IGDA 1PPZA 3ODFA 5I25A 4ABJA 1O3DA 4GHTA 2F9BH 4U01A 2WPLS 1O3MA 1GI9B 4DY7B 1KDQA 8GCHG 3GISB 1LVYA 2A2QH 5EQRA 3SV9A 1SLXB 3BEIB 4HFPB 1YC0A 3M3SA 3U1IB 4FETA 3K9XB 1UTOA 4WXIA 2FX4A 3T62A 4BTUB 2IPHA 2F9PA 4I32A 2PKSC 1AVWA 1P2KA 2BDHA 2Y5HA 1XUKA 1AE8H 5FHTA 2AIQA 5DP5A 4J2YB 4AZ2B 2VINA 3LT3A 4Y11E 3SZEA 2C8XB 2DE8A 3ATWA 2BD2A 3SNAA 1WU1A 3UNSA 1LHEH 2XYAA 2L6OA 4ZROA 1ZHMA 1XKAC 3ZZ9A 3C27B 1C5TA 2O8UA 4DW2U 3T5FH 3RXIA 1EPTA 1NS3A 4NGAH 9ESTA 3SJKA 5JB9S 1SGRE 1V2VT 4HZHA 1LTOA 1XUIA 1FONA 1OYTH 4H6SB 1Z8GA 2JDID 3SU2A 3GDVA 1J8AA 1BTZA 1UTLM 3KIDU 3PB1E 1GG6B 2ZGBH 3PO1B 2XOKD 1KY9A 3UPEA 4CRDA 1OXGA 1PJPA 1WOFA 4A1VA 4XSKU 5EPNA 1NTPA 2VIOA 3SNDA 3H7TA 2ZDAH 4JYTA 1KMHB 4ZXXH 4MLFB 3BTME 1IHTH 1MCVA 3SOSA 4AYYB 5GNDA 1HIAA 2WPHS 4VGCC 2GT8A 1BMMH 2BDIA 4AGKA 8GCHF 4FUHA 2PW8H 1O3GA 1ARBA 4CHAB 4KKDA 6CHAB 1S5SA 2C8ZB 2ODPA 1BMLA 5A0BA 5EIYA 3RXOA 1YCPH 4UDWH 1AFEH 4K2YA 1G36A 1BJVA 3SGAE 2AYWA 2HLCA 1IQKA 1DLKB 3QTOH 4OGYA 1FXYA 3TH3H 2F9NA 2XCNA 1W8BH 3F6UH 2QE7D 1A5IA 1NO9H 1O5CB 2ZP0H 4F49A 1L2EA 2H9HA 4RKOB 3NCLA 1SI5H 1TNHA 1EAUA 2QA9E 1E34B 1NU7B 1AD8H 1SGFG 3MO9A 5HM2A 2ANKH 3FP8E 2EEKA 2C3SA 4ABDA 1ABJH 3JZ2B 4BTTB 1AN1E 4D8NA 4ZMAH 1YWUA 2VBCA 1YGCH 4AOQA 1BTXA 1H4WA 4KTSA 2A4GA 4YZUA 2IJOB 3LPRA 5EG4A 3HGNA 4B1TA 3M7UA 2K0QA 3N7EA 2RDEA 1VKYA 1YPJH 4AFSA 2G51A 4X1SU 1E35B 2TBSA 1O2ZA 1A7SA 2YMSB 1O3EA 3NRLA 5DK1A 2R0LA 4A7IB 1DLEA 1KLIH 1SKYE 2XXLA 1FDPA 3DSOA 1CA0B 4BAKB 3TPIZ 1QHRB 3M3VA 3GY7A 1YPLH 3TK9A 3VG8A 3M5LA 3GDUA 4AYVB 1LKAA 4AG2A 3P8GA 1K1PA 3UY9A 2BHGA 2H2ZA 2Z9JA 1OWEA 3BIVH 2W7UA 5DG6A 4A92A 5T6DA 2ZU3A 1QL9A 4DG4A 3GDSA 4DOQA 1NC6A 2VVCA 1GMDF 1A0LA 3U1JB 4GAWA 4B2CA 1YBWA 1QNJA 1LHDH 1EJAA 4FU8A 1FMGA 1HGTH 3A7XA 1SB1H 2PSYA 2OBQA 3Q3KA 1O0DH 3HK3B 2ZFRH 4MQAA 3U8RH 1BT7A 1LHGH 1MD7A 2XCFA 2DE9A 4NIYA 1N8OB 2ZG0H 1BHXF 4FUDA 3T25A 4B76A 2J34A 3GY6A 1HAPH 5PTPA 4WVPE 1EOLA 2JKHA 4WF8A 1P0SH 3T28A 2WUBA 1AQ7A 2GT7A 2XWAA 1F5RA 1MMJN 1TONA 1P3EA 2ZFQH 4WY3A 2OP9A 2SFAA 3PWBA 1TWXB 2BOHB 2Y82A 3UNRA 1EQ9A 5L2YH 1MBMA 5EJ1A 1O2JA 1C5RA 2DUCA 1ZLRA 1N1LA 1P2MA 1ZSLA 1A5GH 2HNTE 2G00A 3I29A 3RM0H 1V2KT 3MH4A 3SQEE 4TY6A 3RC4A 5T6GA 2VWLA 4YT6H 1MU6B 1W0ZU 1DANH 3FVFB 3M3TA 1P11E 2RA0A 1H9HE 1DWEH 4FUCA 1A0JA 2BDYA 2AMPA 1EZUC
chains in the Genus database with same CATH topology
3K2UA 2I6SA 3E0NB 3M35A 1W10U 5LPFA 3A80A 3FAOA 2VIVA 1TGNA 2QF3A 3SUEA 1G3DA 4O3TA 3SQHE 4ABAA 1O2MA 1O3OA 1VITG 1ZR0A 1C5OH 2XWBI 2Q6FA 5CE1A 2PTNA 2AGIX 5EOKA 4MG3A 2FZZA 3RXPA 2JETC 3GY5A 1YPHE 1ZHPA 2THFB 3ZVGA 5C1YA 1MZAA 4B74A 2ZPQA 5CMXH 1Q3XA 1UK3A 2GMTC 1O5BB 3SJ9A 1EB2A 4HI3A 2ZU2A 1ACBE 2BMGB 2ZTYA 3CS0A 2GZ9A 3RM2H 1RGQA 4CRFA 3MO3A 3VB3A 4X2XA 1CHOG 1O30A 1PPCE 1THPB 1PYTD 2BOKA 1AE5A 2BY8X 2ZHWH 1UTMA 3D23A 1XUFA 3MNBA 1TX7A 3BSQA 1EP5A 2VH0A 3M5MA 3UQVA 5C3NA 1UTPA 1N8OC 3GCTG 1V2WT 1GL1A 2D2DA 1UTQA 4FVBA 4CBOA 1O2XA 5H4IB 3KQEA 1GBIA 2R3YA 1PPFE 3GY3A 1J14A 2A45B 1PQ7A 2Z7FE 1D9IA 3D65E 3UWJH 2QC2A 1HAGE 1DDJA 2P94A 1EPTB 2ZIQH 3A7YA 3SU0A 4ZH8A 1HIAB 1E0FD 5BRRE 3RXEA 2D8WA 2ZFSA 3RMMH 3AASA 2UUFB 3A7ZA 1Z6JH 1OWDA 3R3GB 3F9HA 3P8NA 3MU5A 2ZGCA 2GVFA 1J9CH 3RU4E 3V12A 1EAWA 2UWLA 3LDXH 1TQ7B 4AORA 4NCYA 3TGIE 1QJ6B 1L0ZA 5GCHG 2QYIA 2AGEX 2VIQA 2CHAC 3ZYDA 1GCDA 1P2OA 3GCTF 1ETRH 5IDKA 1F7ZA 4X1NU 2HVXA 3EA7A 5DKMA 3SHAH 1ETSH 4DCDA 4XBCA 3D49H 1ESTA 3M36A 2PLXA 3GCHB 1QQUA 2C93B 2BDCA 1UK4A 2B8OH 1B5GH 5F8TA 5LPRA 1TPOA 4U30A 3HKJB 1PFXC 3S9AA 4CR9A 2QCYA 1QR3E 1TFXA 1GHVH 3QGJA 1W7XH 4HGCA 4LK4A 1AGJA 1J17T 2ZNKH 4UFDH 2ZQ1A 3A8DA 2UWOA 3RP2A 3URDA 1SSXA 1IQLA 5JBBS 1ELAA 2BVRH 2ZFFH 3HKIB 3SU5A 2EC9H 1LPGB 1FN8A 5HGGA 1WV7H 1FIWA 3ZZBA 3LONA 1P57B 1K1OA 3S7HB 3PWCA 1GHZA 1GVKB 1OWKA 2W26A 5J4QA 1YPEH 4Q7ZA 4K1TA 2B7DH 3S9BA 3FZDA 2CMYA 3KL6A 1GHXH 3VB7A 1B7XB 5EXLA 2R3UA 4TPIZ 2PWXA 1V6DA 4AB8A 1O2SA 2PHBA 3RXBA 1WTHD 5JB8S 1C2MA 4Y10E 3WY8A 4Y7BA 1GHWH 4M7GA 2STBE 4CHAC 1UJ1A 5L2ZH 2FIRH 5C1XA 3A89A 5EXNA 3VB6A 1RRKA 2Y7ZA 4OGXA 1ELVA 1FJSA 4RSPA 2OINA 1C2LA 2VU8E 4SGAE 2VJ1A 4WMFA 1BTPA 3SORA 1EKBB 2BY5X 3RXFA 3L33A 1F0SA 1C2JA 2W5EA 1Y3WA 2BY9X 3NPSA 2SGQE 4JZDH 1O2IA 2Z94A 1EPTC 1C5QA 1TIOA 4E7RG 3SU3A 2H9EH 4MPUA 5EXMA 3RDZA 1GHBG 4GCHG 3RXQA 4A1TA 1HAHH 2FDAA 2HRVA 1FIZA 4GLYA 1J16A 2P93A 4ISNA 1XVMA 5E8EH 3ZZ5A 2FOBA 2Q1JA 1O2UA 1O5GH 3RXDA 4INLA 5A8XA 3MNXA 1JIRA 1GHAG 3RXRA 3RXUA 3MTYA 1DWDH 1HXEH 2ZFTA 1UTKA 2RG3A 2Y80A 4IW4E 4Y7AA 1CT0E 3RLWH 1C5SA 3MU0A 3PMBB 2YNAA 4I31A 1P9UA 4IMQA 1C4U2 3A7WA 6GCHF 2BTCE 4A6LA 3GCNA 4X2VA 2PKSB 1TGSZ 2Z9IA 2GMTB 1M9UA 3LH3A 5A09A 2BDAA 1A4WH 1B0EA 2Z6BD 1WSSH 1THRH 4UONA 3KEEA 3PM3A 1TE0A 1IQMA 2JETB 5EGMA 2YNBA 4KTUA 1UVOA 1PPEE 4KELA 3F9EA 4ISOA 1GBTA 1P09A 5F6MA 2GP9B 3S7KB 3A82A 3A8AA 1GJ5H 4ESTE 3BG4B 1C9TA 1F5LA 4ISHH 1QA0A 2O9QA 3KHVA 3AW0A 1MQ6A 4YLUA 1W11U 2XBXA 1YP9A 1KDQB 1TBQH 4MDSA 1JOUB 1BDAA 1K2I1 2FMJA 1G3BA 1T4UH 4X8VH 3ZYEA 2G4TA 3UIRA 2GDDA 1FAXA 7LPRA 2PGBB 4NFEA 1KTSB 4THNH 4X6MA 2A31A 5DP8A 1MTNC 3ATKA 2F9UA 3V7TA 3E1XB 1SQOA 4JMYA 4Q80A 1GMHG 3O8RA 3TNSA 2AIPA 1F0RA 1HAOH 4DGJA 1TA6A 3TITA 1HV7A 1YM0A 4FXGH 2ZFPH 5FX5A 3HPTB 4RKJB 1MU8B 1SGDE 1DM4B 2VGCB 2ZDNA 1C5WB 3E16B 3OSYA 3LGVA 2OC0A 1BTHH 1OWHA 2QF0A 5E2PA 2GTBA 4CR5A 1OKXA 6CHAC 8LPRA 5FCRA 1GI3A 3RXKA 3GCHC 1TNGA 3PMJA 4JCNA 5GJ4B 3SHCH 4KP0A 1LHCH 2V35A 1LQDB 5BPEA 1YLCA 1O31A 3VB4A 1W3CA 1WCZA 2ZCKP 1AZ8A 2FI3E 1NFUA 4BAHB 4Q7XA 2SNVA 1P8VC 1G2LA 1SC8U 1YPKH 2WPMS 1PPGE 1FUJA 8KME2 2FI4E 4Y8XA 2XBYA 3ZZDA 1BRBE 1O2TA 4AFZA 2J92A 2FS8A 4OS1A 5FXLA 2J9NA 3STJA 7KMEH 1BIOA 2FOMB 3QUMP 5EW1H 2SGFE 1GWAA 2FYRA 1S0RA 2CF8H 5E0HA 1MTNB 1SVPA 3QLPH 1H1BA 2FLBH 2EI8A 1BB0B 1MD8A 3ITIA 1BTUA 2Y5FA 4CREA 5J4SA 1QBOA 1GBLA 1Y5AT 1NFXA 1D3PB 2F91A 2AEIH 4AFUA 1EZXC 2GCHF 1DSTA 1GBHA 2VNTA 1P3CA 3NZIA 1WTGH 1O35A 2RDLA 2SGPE 4Y0ZE 1GCTB 5JBTA 1QRZA 5DP3A 4O9VA 2QXJA 1MCTA 2A2XH 1ELCA 2OD3B 5A8YA 4O03A 4AG1A 1VITH 1P2IA 1UMAH 2V0BA 1AY6H 3DD2H 2GZ8A 1CBWB 1O2VA 3TJOA 1CBWC 1GPZA 2QGRA 3A7TA 4JZIA 2AMDA 3MU4A 4O3UA 1KXDA 1AUTC 2BD5A 1UCYK 1DY8A 3KCGH 1SGFA 1BUIA 3A8CA 2P3TB 1AWFH 3NK8A 2G5NA 4ASHA 1ELGA 1QBNA 1S82A 2RCEA 3T29A 1AFQB 2ZGHA 1VR1H 3GYMA 1EJNA 4I8HA 4O97A 2NWNA 1NT1A 3M7QA 3A83A 2H9TH 2WV5A 4OS7A 4ABBA 1UTJA 2Q6DA 1RFNA 3GYLB 5F8ZA 5C67A 2P59A 1FY4A 3CP7A 2JH5D 2ZKSA 4MPXA 2PUQH 1O5FH 1V2LT 1SGIB 2WYGA 1AHTH 3ZVBA 2O8WA 3MNSA 1KXEA 3DT0H 3DUXH 3MHWU 1C1TA 1ELDE 1TAWA 2FOEA 1GGDB 5FAHA 2CF9H 3EE0B 3KQBA 5E0JA 1H9LB 4NZQA 2A5KA 2SGDE 2FTMA 4ZHAA 2ZTZA 2QXGA 4JZ1A 2ZDKA 3M7TA 4MNVA 3ODDA 1V2JT 2ZQ2A 1SLUB 4H4FA 5FBEA 4ABFA 3P17H 3QX5H 5LH8A 2ZHFH 1BOQA 3B8JA 1ELEE 1TOCB 4TY7A 2BY6X 4BTIB 1HAVA 2PGQB 4D7FA 5GXPA 1Z71A 1DT2A 1P2JA 2OC7A 3BTEE 2VVUA 4UE7H 2J94A 3EDXB 3ZV8A 3UR6A 1KXBA 2ASUB 5AVDA 4CRAA 5DPAA 4NIWA 1S81A 1SPJA 1TPAE 1K1IA 2SGAA 1XXDA 3L3TA 5JDUB 1O39A 1ANBA 4BXSA 1HAIH 1BHXB 1C1QA 1IAUA 4ABIA 1PPBH 1NROH 2BLOA 3PV4A 3SV7A 1TLDA 2TGTA 3S0NA 1A3BH 1TMBH 1O3LA 1FNIA 3PLBA 1Y3YA 3OU0A 1VJAU 2CV3A 5SGAE 1C4Y2 4SGBE 1SHYA 1G32B 4JK6A 2BB4A 3KF2A 3T27A 2BLVA 2ZCHP 1O2GH 1QTFA 1VCQA 3A8BA 5F8XA 2F83A 2EI7A 1HNEE 4MNXA 1FQ3A 2F9OA 8ESTE 4CRCA 1P02A 1C1MA 5CHAB 1NRNH 3BV9B 1T32A 1O3HA 1XKBC 2BLQA 4DURA 1TOMH 1EX3A 4TWWA 1GBMA 1AZZA 2CXVA 2RA3A 1P04A 4GVUA 1UHBA 3LIWA 5HXFA 2ZI2H 5E2OA 3M5NA 4JYVH 2XNIA 2AH4X 2NU0E 1GJDB 4IN1A 1TMUH 1JMOH 4FUJA 2XW9A 1TBRH 2BLWA 3FFGA 2HALA 3ELAH 3GY4A 1FY8E 4K60A 2D1JA 1ELTA 1O37A 1LPKB 3UR9A 2BD8A 2C90B 1VZQH 4Q2KA 3SI3H 2GGVB 2STAE 4IC6A 1O3KA 1EZSC 5T6FA 4U32A 3QN7A 2BXTH 2FWWA 5DO4H 3V13A 2O8TA 1RTFB 3LC5A 1NY22 1ZMLA 2ZGXH 1DPOA 1GMDG 4X2YA 2ZDLA 2ANWA 2ZCLP 3MOCA 1D3QB 4DVAU 5ABWA 1AMHA 1Z8RA 1H8IH 3ZVEA 4FU7A 1GI2A 1ZTLA 1K1NA 1Y8TA 4BAQB 1EATA 3LJOA 3QTVH 2QY0B 2Y6TA 5E0GA 7ESTE 3MFJA 4Y71A 1AB9B 1MH0A 4TPYA 4Y8ZA 1Z1IA 2OC1A 2PUXB 4GUXA 4Y76A 1QURH 1HJ8A 1RS0A 4AX9H 1NN6A 1AIXH 5DP4A 1Z1JA 4B2AA 4XBDA 2EA3A 2HGTH 2FESH 4IBLH 2GDEH 4CH8B 1HJ9A 3E3TA 1YYY1 2AS9A 1GJCB 3ESTA 5GIBA 1ABIH 2ZHEH 1UTNA 1QGFA 2P8OB 2BX4A 3N7OA 5GDSH 1Z6EA 1IQFA 3PLPA 3LGWA 1DY9A 2W3IA 2QAAA 1O3BA 5ESBA 1DSUA 2A7CA 4YOIA 2Z9LA 3TLOA 5FBIA 1ANCA 4WMEA 2H5CA 3AW1A 5C5NA 3JZ1B 2TRMA 5A0CA 1Q31A 1O2LA 3FANA 1FY3A 2V3HH 1PQ8A 1WUNH 1A2CH 3EAJA 3Q3YA 4B75A 3PTNA 1O34A 2I6QA 1BQYA 1SLVB 4INHA 1EJMA 1JXPA 1GVLA 3U98H 1SL3A 1GBAA 1OPHB 4I8JA 4NA8A 5C2ZA 3QZQA 1GBJA 3RXAA 1DE7H 1H8DH 5AFZH 3UWIA 1IQJA 1TBZH 4H42U 2B5TB 4K3JA 1EAIA 3HATH 3GCOA 1MTVA 3OX7U 1QJ7B 1A1RA 1P9SA 3SZNA 4BAOB 1Y59T 1IQNA 1C5UA 4X8UH 1T7CA 1Y3UA 1IQIA 2OBOA 1ZJKA 1GI7B 1UHBB 1MAXA 1LVBA 2J95A 3U69H 1AKSB 1QRWA 1ELBA 2XC5A 5CHAC 1V2NT 1W12U 5DP6A 7GCHG 1XM1A 2JH6D 3BG4C 3GY8A 3TNTA 1P01A 1ANEA 1K1JA 1O2PA 1CT4E 3LKWA 4ZKOU 4IN2A 4IC5A 1HAVB 1GI8B 1W7GH 1O2NA 2BZAA 1GBDA 2ZC9H 2ZEBA 3E91A 4RN6A 2GD4B 3M37A 4XBBA 3OYPA 3VGCB 1HAYB 4LZ1H 2HPPH 3U8OH 5EQQA 3TGKE 2BVXH 4NIXA 4NSYA 2R2WU 1L1NA 2ANMH 5A0AE 1Y3XA 1AI8H 1GBFA 3O8CA 1SOZA 3LU9B 1C1UH 2Y5GA 2HNTF 3PLKA 1V2RT 5FPSA 2G8TA 3BF6H 2F3CE 3A7VA 4K69A 1TQ0B 5TCCA 3BTKE 4NA9H 2LNCA 1V2OT 2ZA5A 4NZLA 1LQEA 3KGPA 1K1MA 1QL7A 3AAVA 3A88A 5C1UA 3EQ0H 2H6MA 3ZZAA 4E7NA 2C4FH 6LPRA 1C9PA 1C2GA 4YT7H 1UVSH 2ZHDA 3RC6A 1A61H 1V2PT 1ESBA 1ZMJA 2NU3E 4YTAA 4OS2A 3ZZCA 4WWYA 1OX1A 3STIA 1P03A 4LOYH 1VCPA 1BRCE 3ZVAA 1ELFA 2ZHQH 5EODA 2A32A 1DXWA 1WBGB 1ZHRA 3SI4H 1MKWH 1V2ST 1HAZB 5FCKA 1GBBA 3VFEA 1LPZB 2HNTC 1RTKA 1D6WA 1CSOE 2Z3EA 5L6NH 4X6NA 4IMZA 2ZTXA 1WYKA 1C1OA 3LGYA 1GHAF 3NXPA 4MPVA 3RUOA 1T8MA 5IYTA 3IWMA 4XE4A 4CRGA 3BTDE 1V2QT 3Q3XA 2VB0A 2O8MA 4I8KA 3MMGA 3RMNH 2A5AA 1LDTT 4FUEA 1SHHB 2HWLB 3UNQA 2VH6A 1OOKB 5I46H 3RXTA 3F9GA 3RU4T 1S0QA 1F0UA 1TX6A 3V0XA 1SLWB 1TGBA 1BBRK 4B2BA 3P8FA 1QB1A 4ZXYH 1DS2E 3EA9A 4OS6A 3IG6B 1JRTA 1ZTJA 3BIUH 2Q6GA 2ODYB 2ZWLH 1GJBB 3SUFA 4FVDA 4Y79A 3P70B 3ZZ6A 5ESTE 1C2KA 2TIOA 4NIVA 1C5NH 1MUEB 1ZPCA 2BYAX 2TGAA 3OY5U 3TH2H 2WPIS 3SNBA 1O3NA 1TPSA 2UWPA 2G5VA 4QT8C 1XX9A 1C2EA 3B9FH 1F5KU 2ZGJA 2YOLA 2VWNA 3TJUA 1BMNH 3KQDA 1K21H 2FTLE 5K7RA 1O2WA 1CQQA 1OYQA 2OLGA 1G30B 2VIPA 1EZQA 1NPMA 1EASA 1ETTH 1GBEA 1DFPA 2GV7A 1XXFA 1C5MD 4XOJA 1QQ4A 2TGPZ 1ZGVA 3BTQE 1BZXE 2ZU5A 4JZEH 4K8BA 4Q7YA 3ZZ4A 3D62A 4MVNA 4FUGA</