3MH5A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
254
structure length
191
Chain Sequence
b'QMPSLAPMLEKVMPSVVSINVEGSTTKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGYENFIQTDAAINRGNSGGALVNLNGELIGINTAIIGFAIPSNMVKNLTSQMVEYGQVKRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
molecule tags Hydrolase
source organism Escherichia coli
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
total genus 43
structure length 191
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A01
1C4V2 3MU5A 3RDZA 5GJ4B 4CH2B 2VWNA 3GCNA 1OSSA 1C1RA 1TPPA 4B1TA 1K1IA 3BTQE 3GY5A 4JK6A 1SQTA 5AFYH 4X6MA 2H9TH 1O3LA 3FFGA 2SFAA 1WAYB 1C1NA 3TGIE 1H8IH 2F9PA 1F0SA 1BMLA 4D9QA 1SHHB 1XUHA 4KTCA 3RP2A 3MNBA 1FI8A 4Z6AH 2G4UA 1UTMA 1HAVA 1BCUH 5A8XA 2R3YA 5ETXA 3S9BA 1NRPH 4XOJA 1AU8A 3RXLA 4F49A 2H6MA 2ZU3A 3SJKA 3HGPA 1P02A 8ESTE 2EI6A 3UWIA 3URDA 1QRXA 3D65E 1ZSKA 4MPWA 3M7QA 1O2LA 1O5GH 3RM2H 1O38A 1LDTT 2F3CE 3Q3XA 3MNSA 1OXGA 2GTBA 4ABGA 2XYAA 1C2HA 2BLVA 1AVXA 1BTZA 3M3VA 4ESTE 2BVRH 3IG6B 1F5RA 3OTJE 1MQ5A 2BD3A 4BOHA 8GCHF 2FLRH 2J92A 2BY8X 1MMJN 1CSOE 2ZGHA 2ZCKP 3JZ2B 5EW1H 1MTNC 1K21H 3SI3H 1GHVH 5FX5A 5GCHG 3T28A 3FZZA 1E38B 2A4QA 3H7TA 3SNEA 1FV9A 1IQEA 4U30A 4CBNA 3ZVEA 4MNWA 1GJ8B 1A5HA 3SJOA 1O2VA 1OP0A 1BRCE 3V3MA 1HAZB 5JBTA 3HGNA 1JBUH 2FOHA 5K7RA 1XVMA 2FOAA 2TRMA 1A1RA 1C5TA 1T8LA 3RC6A 4XDEA 3P6ZB 4JZEH 1SGYE 3Q00A 1O3AA 1S84A 1YCPK 2AS9A 3MMGA 1O2ZA 2P94A 1GMDF 3SQEE 1W3CA 2BDIA 5C1YA 5FCRA 2Z3CA 1SL3A 4CRFA 2XWBI 2EI7A 2TGTA 3MOCA 3ZVDA 3KL6A 3VB3A 3E6PH 2BY6X 5IYTA 1AVWA 1H9HE 3OX7U 5JDUB 2PV9B 1GMHG 2FEQH 4ZMAH 1CA8B 4FUEA 3ZZ7A 2O9QA 1EASA 1ELEE 2A4GA 1BTUA 2ZHWH 1RJXB 3SJ9A 1NS3A 3LJOA 2GCTC 3UWJH 1ZR0A 3KCGH 1S0QA 1IQMA 3QX5H 1FN8A 1HJ8A 3VFEA 4ZHMU 2ALPA 1BJUA 2WPLS 4UONA 2J4IA 1V2OT 4Y8ZA 1CBWB 3RXFA 3STJA 3LKWA 1C9TA 1D9IA 2NU0E 3LGVA 2TPIZ 2ZTZA 1O2PA 2C8YB 2A7CA 1C2LA 1C5VA 2BLQA 3BEFB 1AI8H 3BTEE 3T5FH 1ETRH 2WV5A 4RKOB 2GDDA 1Y8TA 1BUIA 2ZPSA 1V2PT 1TAWA 4A1XA 1OS8A 1FPHH 2VNTA 1ELDE 2FOCA 5TJXA 3E90B 1NU7B 1O2JA 1T8NA 3F9HA 3GISB 1BMAA 1GBIA 1GMCF 2P3UB 2FOBA 3BTDE 1BBRK 3LPRA 4A1TA 2A32A 1TOMH 5AF9H 1C2DA 4O9VA 2FI3E 8KME2 3PLPA 2ZHQH 4MDSA 2ZFPH 4BAMB 1MAYA 3RXIA 2FX4A 1C1UH 1YYY1 1C2MA 1O3PB 2TGAA 4E7RG 1AB9C 1O36A 4FUGA 2RDLA 1GBMA 4DW2U 1KLJH 2FLBH 1O3NA 2WUCA 2BLOA 3C1KA 2P3FH 2ZPRA 3RXKA 3NCLA 1YCPM 2J2UA 2GVFA 3ATMA 1TGCA 5DK1A 1ELAA 2EA3A 5JBAS 1KSNA 2C3SA 3PMHB 4TWYA 4UD9H 1PPFE 1ZJKA 2BD7A 4MVNA 1HAIH 3RXGA 1CHOG 1O5AB 5A09A 1LQEA 1W14U 2OINA 3A88A 2BLWA 2FYQA 1TRYA 5L2YH 2ZC9H 4YESB 2FO9A 1O5EH 3NKKA 3PMJA 4E05H 1RTLA 4H42U 1LPGB 1HAHH 4NIWA 5F03A 4ZKRU 2Y80A 2OC0A 1DM4B 5EU8A 3GDVA 1YPLH 4FUDA 1L2EA 1YBWA 4UE7H 2TGDA 5JBBS 3U8OH 1O3KA 1A3BH 3HK3B 2FDAA 1A3EH 2BXUH 4CRDA 3FANA 2W7SA 5E0HA 1QL8A 2PKAA 1LMWB 4OS1A 1BZXE 1P03A 3QTOH 1SLXB 1HXEH 2ODYB 3A8BA 4JZIA 3U98H 2Y7ZA 3VGCB 2BZAA 1J9CH 4VGCB 4AZ2B 2VH6A 2Z9JA 4MNVA 4AG2A 2A31A 1G36A 1SOZA 1GI8B 1VCWA 2EI8A 2GV6A 2I6SA 3LU9B 1UK4A 3ITIA 3NK8A 1QBOA 2AGIX 3BG8A 3GDSA 1EZXC 1T4UH 1AKSB 1JOUB 3A85A 1DT2A 3GICB 5GDSH 3RLWH 4HGCA 1NU9A 4ISIH 1GHYH 1Z8JB 3A82A 4GSOA 4MQAA 1OOKB 4Z0KA 3B23B 2HNTE 3UIRA 1EB2A 3LC3A 2G00A 1C4U2 3KEEA 1Q3XA 1DOJA 4O3UA 4AX9H 1QQUA 4Y6DA 2C4FH 1P10A 4X2WA 1MAXA 2BY9X 1J15A 2O8UA 2KAIB 1UTOA 2OBQA 4BXWA 1AY6H 3QGNB 1YPHE 2ODQA 1Z6EA 2P93A 2YNBA 4X8SH 1YM0A 2PKSC 2DE8A 2GCTB 2B7DH 1LPZB 3ZZ6A 1K9OE 5ESTE 1O2OA 1TGSZ 1GI5A 5FBIA 1DPOA 4BTUB 3TJUA 5DG6A 4B2AA 1NM6A 4D8NA 1GBAA 4NIVA 3ZZ5A 1D3PB 2DUCA 4WVPE 2ZDKA 2FOEA 1SGIB 2NWNA 1RD3B 1QRWA 2JETC 1QA0A 1O2SA 2ASUB 3ZZ4A 1L1GA 1HJ9A 4ZKOU 4JZFH 3H5CB 4CRGA 2BX3A 2YNAA 1QIXB 2ZU5A 1FIWA 4MG3A 1QA7A 3A83A 1CT0E 2K1QA 1VGCB 4YT7H 2IN2A 2VB0A 4DCDA 4YM9A 4IMQA 4B71A 1F5LA 3M3SA 4OS4A 3WY8A 4IW4E 3QLPH 1O3HA 4H6TA 4IN1A 1GJDB 2WUBA 3E16B 4UEHH 3ZZBA 1Z8GA 4WMFA 1LHFH 2Y6TA 1QB6A 1MKXK 2CF8H 4LZ1H 5HXFA 2A7HA 2SGFE 1OWEA 3E3TA 4BAOB 1C5YB 1PQ7A 3P70B 1UCYH 2SGPE 3AW0A 4X8VH 1DITH 1NY22 3PTBA 3SI4H 2ZF0H 4YLUA 4Y10E 1C4Y2 1BBRE 2Z7FE 1N6YA 2W3KA 4Y79A 4E7NA 2VWMA 4MPVA 1SGTA 1NC6A 2M5TA 4D7GA 3B8JA 1TGBA 1GG6C 4NIXA 3STIA 3TH3H 1ETTH 3SUEA 1IQFA 2ZHEH 2ZU4A 2G55A 5DP9A 1C1MA 4LK4A 4Q7YA 4Y7AA 4K3JA 1V2WT 3RU4D 4D9RA 2FOMB 1AMHA 2V35A 1DFPA 3M3TA 3F9EA 1TGNA 1AIXH 1W7XH 1EX3A 1MBMA 2V6NA 3M36A 2ZO3H 1AQ7A 3A80A 4ISLA 2QIQA 2F9BH 2GMTB 2GDEH 1O2IA 3D62A 1CT4E 2Z3DA 4O03A 4X1PU 3RC4A 1ZGVA 1ZOMA 1Z7KA 1SGFG 4IC6A 2B9LA 2G5VA 1Z71A 1HAPH 3O8DA 1MBQA 1FY4A 4X1RU 3D49H 5DP4A 4I8JA 1PPZA 5DP3A 3TPIZ 3S0NA 1GHWH 1UVOA 4B75A 1UHBB 2XBXA 1TPSA 1CBWC 2OLGA 2WYJA 2VIQA 4RKJB 1P9UA 1GL0E 1TALA 1C2JA 1GJ5H 7LPRA 3QTVH 4A7IB 4FUHA 3B9FH 1SSXA 5C1XA 3MO3A 1RIWB 3CENA 1XKBC 1E0FD 1FQ3A 4X2VA 1DXWA 5C1UA 1AE5A 1P2KA 1ZPBA 2XWAA 2Q6GA 3T25A 3ZV8A 3BEUA 4LOYH 1EQ9A 3ENSB 2F9VA 1NO9H 1JRTA 3SHCH 3QO6A 1HNEE 1WQVH 5C5NA 3TK5A 3V0XA 3BF6H 1PPEE 1FNIA 3QN7A 3SORA 2OQ5A 1U6QA 4NZLA 2A5IA 4CRCA 1UTNA 1UK2A 5EQQA 1HJAB 3MU1A 3SV6A 3O8CA 2ZKSA 2CMYA 2ILNA 3ATLA 3O8RA 1Y3UA 1TX7A 2F83A 3RXEA 1HLTH 2ZFSA 1GBLA 2H1UA 1L4ZA 3KGPA 5FCKA 2UUKB 5C3NA 3PO1B 2ZZUH 2PTNA 1A7SA 1V3XA 4ZKNU 3SJ8A 2XTTB 1C5WB 4I8GA 1EAXA 1RGQA 2ZQ2A 3SUFA 1HIAB 1HRTH 3MH7A 5FBEA 1YLDA 4WJG2 9LPRA 1ZHMA 3TU7H 1V2LT 1N1LA 1GJAB 4BXSA 1Y5BT 1V2JT 3A84A 1IHTH 1GBKA 3T2NA 1OX1A 2XC5A 4HFPB 2VWLA 1GI9B 1PPGE 3VPKA 4I8KA 1PFXC 3FP7E 3QK1A 2PKAB 3HPTB 5C20A 3ZZ9A 1K22H 1NFXA 3LONA 1GI2A 1ID5H 4IC5A 4ABAA 1UJ1A 2DE9A 4J1YA 2FODA 2TGPZ 1TNGA 1JIMA 4X1QU 1MZDA 1GHBF 1O3GA 3PMBB 6ESTA 5C5OA 1G37A 1NT1A 1CHGA 3VXEH 4AN7A 3SZNA 3EYDA 3LC5A 1DDJA 4OS7A 1OYTH 3DUXH 1C1TA 2C8ZB 4K1SA 1UTKA 2OXSA 3VGCC 4K69A 2G8TA 4FU8A 1DICA 2Q1JA 3T29A 3KQBA 1J14A 3KQEA 1SFIA 1NFYA 3EGKH 2CXVA 3M5NA 1AGJA 5E2OA 2BOHB 4AFZA 1TQ0B 2JETB 2AMQA 1SMFE 1EOJA 2A0QB 5F8TA 5GIBA 3NWUA 2F91A 1WV7H 2FS8A 5FXLA 1SGCA 1DLEA 2RG3A 1P11E 2AEIH 4PROA 3ZVBA 3VB5A 2VIPA 1RFNA 5LH8A 1AZ8A 1OP2A 5HGGA 3JZ1B 2AGGX 1P04A 4WXIA 1O5DH 4B74A 5JB9S 1GJ4H 1SGFA 4FUBA 1O2KA 3KIDU 1YPGH 2AGEX 1H1BA 9ESTA 2GT7A 3L6PA 4RSPA 3RXPA 1TLDA 1A5IA 3TJOA 1YLCA 2RA3A 1J16A 4DVAU 1JIRA 3RXQA 1WUNH 2BDAA 3PB1E 2CJIA 1QRZA 4GPGA 2WV4A 1GJCB 1INCA 1OYQA 5J4SA 1Y59T 1UK3A 2FOGA 1WYKA 2BD9A 1GMHF 2FI5E 4A1VA 5H4IB 3ZVGA 4DG4A 2A5AA 1TYNA 1EPTC 1KXAA 5DKMA 1C2EA 3N7OA 1PQAA 3MO9A 4H6SB 5LPFA 4CHAC 4X0WU 3TLOA 1UVPA 1P06A 5DJ7A 7GCHF 5FX6A 2HPQH 2AMPA 1GJ6A 3A8DA 1PYTC 1QB1A 1SBWA 3C27B 5EXLA 3ZZDA 3EAJA 1HXFH 3P8NA 1TBZH 3M7UA 1P9SA 5DP6A 4ZXXH 5ABWA 1ZJDA 1O3MA 4BAKB 2F9NA 5EQSA 1CU1A 3TNTA 1GVZA 5F8ZA 4AB8A 3URCA 1TRNA 3ZYDA 5GCHF 3P8GA 1IQKA 1LVBA 3IITA 1NRQH 2ZTYA 3RXVA 1GGDC 5JYIA 1ZPCA 3NPSA 1LKAA 3R0FA 4K8YA 3RXRA 1W10U 1OWHA 1QQ4A 3RXHA 5GWZA 2RA0A 1HAYB 3RXBA 1SLWB 2R2WU 4X6PA 1PPBH 4ABBA 1DWDH 2BDCA 2G52A 2GP9B 4K5ZA 1N6XA 3RU4E 1SI5H 4CR5A 4Y7BA 1ETSH 1Z1IA 4GAWA 3EA7A 2ZDMA 3T62A 5T3HA 4FUFA 1K1JA 4AOQA 1C9PA 2OC1A 3DD2H 1SFQB 5DO4H 1QURH 2Z3EA 2Q6DA 1Q2WA 1HYLA 3F6UH 2SGEE 2ZFRH 8LPRA 4F4OC 1F0UA 1S83A 1YPJH 4U01A 1C1VH 1X7AC 2AYWA 1E34B 2QXJA 3A8CA 1BBRH 1O3IA 2GZ7A 1GBJA 2ZWLH 3UNSA 2PSXA 4A5TS 1BTWA 3S7HB 1HUTH 1LKBA 1W12U 1Z1JA 2FTMA 3ZZCA 1BMNH 4R0IA 3MI4A 2BD4A 1Z6JH 2D1JA 1BHXB 1QJ1B 2BHGA 3ZVFA 1SVPA 2HALA 2TIOA 3T26A 1DWEH 1MU8B 1C5OH 2FESH 1QBVH 1CQQA 4A92A 3EA9A 1VITH 1MCVA 5LPRA 1ZSLA 4ZKSU 2ZNKH 1NRSH 1OWKA 1SPJA 3TK9A 6CHAB 1GDQA 2PTCE 2XC0A 1TFXA 2ODPA 4WF8A 4Q80A 4NG9H 2F9UA 2I6QA 3PV4A 3D23A 1IQNA 1CE5A 5DP5A 1P2MA 1Y3WA 3MYWA 1NROH 1V2RT 1ZRBA 1CA0B 5DP7A 1B0EA 3RXOA 1GI4A 2GZ9A 1AUTC 2JH6D 1O3OA 1QL9A 1FIZA 3A8AA 1PYTD 3SV2H 3M35A 1NN6A 2LNCA 3UR9A 3SU2A 1O31A 3SBKA 2RCEA 1ZHPA 1TMTH 2OC8A 1TX8A 1NESE 4I8LA 1KXDA 3SU6A 3V13A 5CHAB 1BHXF 4AB9A 1HV7A 2FMJA 2J95A 5A8ZA 4OS2A 4NIYA 1TBQH 2P8OB 1KTSB 3PWCA 4ZAEA 1EATA 5I25A 3MWIU 1LCYA 1TNIA 2O8TA 3AAUA 1MU6B 4KP0A 2Y81A 3ZYEA 3BG4C 2NU3E 2G51A 3F9FA 1XMNB 4X1SU 1C2GA 1ZGIA 1EUFA 1P3CA 2ZDLA 3MU8A 4DIHH 1EAWA 2BM2A 4MNXA 1FY3A 1NRRH 4B2BA 1DUAA 2VIOA 2PWXA 2ZDNA 2ZGCA 2ZFFH 3TNSA 3BTHE 1OWIA 1MKWH 2GV7A 3UR6A 4GUXA 1FY8E 5HM9A 2BY7X 3FZDA 1GI6A 3DFLA 1AZZA 3A86A 1O3CA 3QGJA 2HGTH 2FOFA 1GDUA 1ESAA 1C5SA 4JMYA 2UUYA 1O2YA 5I46H 2BDYA 4Y71A 1J17T 3SUDA 4E06H 1PQ8A 2ZGJA 5C2ZA 4K2YA 2SGAA 5GPIB 1KYNA 2R9PA 2P16A 3RMLH 3ZV9A 1P2IA 1QY6A 2W5EA 2UWPA 1IQJA 1FN6A 2J94A 4NSVA 1WBGB 3PWBA 1O2RA 4TY6A 3SU5A 1O2HA 1ZTKA 2ZU1A 2FYRA 4ZH8A 1ELGA 2ZTXA 4ISNA 4Q7ZA 1K1LA 3A7XA 1UVTH 3SGBE 4FU9A 1S82A 2KAIA 5EODA 3SO3A 1YP9A 5BPEA 3M7TA 1DANH 3ODDA 1LHCH 1JWTA 1IQLA 2XNIA 1NTPA 1TMUH 4X2XA 3UTUH 1O2MA 4DURA 2G81E 3MNXA 2ZPQA 3QUMP 3M5MA 4KTSA 2WINI 1ARBA 1GI3A 2QY0B 1MTUA 2XBVA 2QCYA 1S5SA 1WSSH 2HRVA 4NSYA 2BD5A 2HNTC 1G3BA 1O2WA 2GD4B 2ZDAH 1CGJE 3LGIA 5FHTA 3UUZA 4KKDA 1KLIH 1MKXH 1VZQH 4M7GA 3BTKE 1P12E 1BITA 1OWDA 3A89A 1XXDA 2QC2A 1O3JA 1V2ST 3GDUA 4CRAA 3QZRA 4INHA 2AH4X 1V2VT 1EP6A 1KTTB 3G01A 1GL1A 1GCDA 3V12A 3SNDA 1TNLA 3LGUA 4WH8A 1DSTA 1M9UA 1O5BB 2JH0D 3AASA 5B6OA 2BD2A 1OPHB 1SQOA 4IBLH 3CS7A 1ZYOA 1T31A 3GY8A 4KTUA 3LGTA 2ZU2A 1QJ6B 3RXDA 5BRRE 4J2YB 5FPTA 1KDQB 4B2CA 3QWCH 1HAGE 3ZZ8A 1TIOA 1O35A 1LTOA 4Q2KA 2VGCC 3HKJB 3F9GA 3LIWA 3GYMA 1NFUA 3GY7A 1Z8RA 1H8DH 4WXVA 1TB6H 2G4TA 3UFAA 2H9EH 3EDXB 4YOGA 1ELBA 2VIVA 3BV9B 3S69A 3W95A 4D7FA 3H7OA 1DY9A 1NZQH 3ZZ3A 3GCTF 4XBDA 1T4VH 3MU0A 2OQUA 3SU1A 4FXGH 2A7JA 1F92A 2J34A 1AE8H 3BN9A 4UFEH 1G2LA 1HIAA 1GI7B 3E91A 3BTFE 5L6NH 1JXPA 2LPRA 1L0ZA 3S9CA 1C5RA 4ABEA 4JYUH 1GMCG 4JZ1A 1XUIA 3BTGE 1G30B 1ZPZA 1ELFA 2H2ZA 3OU0A 3RUOA 2WPHS 4X1NU 1PQ5A 4Y0YE 5AFZH 3RC5A 5EXNA 3BTTE 3UNRA 3LT3A 5AVDA 4BAQB 1C5MD 3K9XB 3UY9A 2BVXH 2O8WA 4KELA 4NZQA 4XBCA 4Y11E 2ZEBA 3SV8A 3UPEA 3QDZB 1V2NT 1O37A 2ZQ1A 1FDPA 2SGDE 3K6YA 1ARCA 1BTPA 1KXFA 1CA0C 1FXYA 1O30A 3EA8A 1BRBE 1C5PA 1CGIE 4ABDA 1HFDA 4AFUA 1A61H 4I33A 1YPEH 2BTCE 3FP8E 1THRH 3V7TA 3P8FA 2IPHA 4MTBA 1K1NA 1LVMA 1UTJA 2O8MA 2BQWB 2CHAB 4DJZB 4THNH 2A4RA 5SGAE 1HCGA 3SNBA 1GHXH 1C2IA 1C5NH 1XUKA 4BAHB 4VGCC 3A7WA 3Q3KA 3OSYA 1KXBA 1GI1A 3AAVA 1EP5A 4NGAH 5A0CA 2ANWA 3MH4A 1O5CB 3RMOH 2R3UA 2B0FA 5F8XA 4YLQH 2EC9H 4NA9H 4R8TB 3KQCA 3SUGA 2PUXB 1KDQA 1UMAH 2ZI2H 3OY6U 3RXCA 1ZRKA 3PLKA 1SLUB 2AIQA 1DVAH 4TWWA 2AFQB 1Y3YA 2XW9A 3L33A 3U69H 1MD7A 2A5KA 5A0AE 1YGCH 1ZSJA 3PLBA 4I8HA 3NUMA 1KXCA 1JRSA 2XCFA 1LHDH 4AGJA 3NZIA 4ASHA 1F7ZA 2ZGBH 1EKBB 3TH2H 1O0DH 3LGYA 1VCPA 1W0ZU 1RIWC 4IS5A 1K1OA 1ZMJA 1C5XB 3K6ZA 1GBBA 3U1JB 1IQGA 3SOSA 3UQOA 2SNWA 1AFEH 2P59A 3BIUH 1Z8IB 2XXLA 5L2ZH 1ANCA 3GCOA 1GVKB 1NRNH 4ISOA 1YF4A 3SHAH 1LVOA 3IWMA 1B5GH 3FVFB 1UO6A 3AVZA 3LDXH 1O3FA 1FAKH 3I77A 1V6DA 1F2SE 4ZHLU 3SN8A 5DP8A 2P95A 1VR1H 4YOJA 1W11U 3TH4H 1SGNE 2NU1E 1B7XB 2HOBA 1ABIH 1ZLRA 2BXTH 1EB1H 1SGRE 7ESTE 1T32A 4YTAA 1BTXA 1C5UA 1O2QA 1H4WA 1GG6B 3P92A 1P2JA 1A4WH 2GX4A 2OTVA 4JZDH 2UUJB 3UNQA 1C1OA 2GCHG 4WY3A 1THPB 3SGQE 2QV1A 1EJAA 1GBTA 4GVUA 1UTQA 2A2QH 2ZCHP 6GCHF 1GBHA 2BOKA 2TBSA 1SC8U 2BD8A 4HI3A 2J9NA 2ZP0H 5A2MH 2OP9A 5E0GA 4DIIH 3BG4B 1GCTC 4ABJA 5J4QA 4UFGH 1DS2E 1HPGA 3RXUA 1O34A 1O2TA 3MU4A 4AFQA 1A2CH 4Y0ZE 4FVBA 1ESTA 1MD8A 1G2MA 2IJOB 2Z9GA 2OCVB 1YPMH 1T7CA 1IHSH 4AGKA 3E0PB 2VIWA 1D6WA 1T8MA 2ZCLP 1MKWK 3GCHC 2VWOA 2GZ8A 1C5ZB 1QNJA 2Z9KA 3K65B 7GCHG 2UWOA 3O8BA 4LXBH 5EPYA 1SGPE 2BMGB 4U2WA 3DFJA 4CRBA 4IGDA 3SV9A 4D76A 3ELAH 5JB8S 2VINA 1S85A 1VITG 2QXIA 3M5LA 1W8BH 2ZHDA 4ZHAA 5A8YA 2ALVA 3RM0H 1C2FA 4CREA 2XBYA 3A7YA 2C90B 2GKVE 2ZIQH 4X6NA 1EXFA 1GDNA 2F9OA 2W3IA 1VCQA 3KHVA 4GCHF 2QXHA 1LVYA 1EZSC 1O2XA 1FAXA 2FI4E 1XUGA 3RU4T 1F5KU 3SV7A 5E0JA 3PM3A 1GJ9B 1TNKA 4FVDA 1UVSH 2FP7B 2R0KA 2VU8E 4B73A 1KXEA 4Q7XA 2ZFQH 2CGAA 5TCAA 1LHGH 3EQ0H 1EZQA 1EOLA 3FAOA 1A0LA 2ANYA 3M5OA 1O2GH 1UCYE 1DY8A 3K2UA 4BNRA 1YC0A 1ZTLA 3GCHB 3GCTG 4DOQA 3BSQA 4TPIZ 2Y82A 3HATH 1EJNA 3RXAA 2PGBB 1DWBH 2HNTF 3UQVA 2EEKA 5F6MA 2XBWA 3SQHE 2HWLB 1AO5A 3E0NB 5E8EH 2D2DA 2AMDA 5CHAC 1FY1A 2C93B 4UFFH 4UFDH 2FS9A 3LH1A 3S9AA 1J8AA 2Y5HA 1RS0A 2ULLA 2CHAC 1TNHA 3HKIB 4O97A 6LPRA 3E1XB 1BTYA 4AFSA 4DT7B 1IAUA 3UOUA 3TGKE 4HZHA 1HDTH 1AWFH 2QGRA 2FZZA 1G3CA 3I78A 3SGAE 5JBCS 1XX9A 3S7KB 4QT8C 3GY3A 4A6LA 2PHBA 1KLTA 3VB4A 1MQ6A 2VIDA 5HMAA 2VJ1A 1K1PA 1AFQC 2C8WB 4TYDA 4X2YA 2BDBA 5CMXH 2FM2A 4I32A 4I31A 3VXFH 5ESBA 4IMZA 3U8TH 4BTTB 4FUIA 4XFQA 1AKSA 1BMMH 1RXPA 2O8LA 2B8OH 3GY6A 1GBFA 2Z9IA 1BDAA 1AVGH 2GMTC 3VB7A 1QHRB 4AG1A 2BVSH 1O39A 3UOPA 1XXFA 2CF9H 1RRKA 1GHAG 1RTFB 1P8VC 1A0HB 3M61U 3SU3A 1GVLA 7KMEH 3GOVB 1L1NA 2PKSB 3L3TA 1Q31A 6CHAC 3KF2A 1QJ7B 1TQ7B 1XVOA 1TA6A 3GY2A 1ACBE 4WWYA 3RMMH 2FX6A 3KQDA 1SGEE 2QYIA 2BDHA 2NU2E 2GCHF 1W2KH 4ZXYH 1ANDA 4Y8YA 2H5CA 1CGHA 3LJJA 2Z9LA 4K1EA 2VH0A 5LGOA 1WTHD 2OC7A 2OBOA 1QTFA 2ZDVH 1K28D 2SGQE 2Y5FA 1FONA 2B5TB 4NFFA 1AD8H 1ABJH 1TMBH 2QF0A 2AIPA 3RXSA 2Q6FA 1FY5A 2FIRH 4LZ4B 1CO7E 1OP8A 4CHAB 1MH0A 2FXRA 1SB1H 4SGAE 5EG4A 1AUJA 3I29A 5EQRA 4BANB 4GHQA 3CP7A 1GPZA 1ZHRA 2PR3A 3E8LA 1ZZZA 2ESTE 3ATIA 2G5NA 2V0BA 5A0BA 1QR3E 2BQ6B 4I7YH 1GBCA 3RXMA 1EZUC 3BEIB 2R0LA 1XM1A 3PYHA 2XCNA 1BRUP 1GCTB 1TE0A 4MNYA 2ANMH 1AN1E 1ELCA 3BIVH 2JKHA 2FTLE 4DGJA 3P95A 4K1TA 5EOKA 1TPOA 1JMOH 2ZGXH 5FPSA 4ABIA 1VJ9U 1BT7A 1A5GH 1T8OA 3A7TA 1TONA 4Y8XA 4FUJA 4GLYA 3DA9B 1WQSA 2GGVB 3ZVAA 1S81A 2ZA5A 3P8OA 1PPHE 3CS0A 1B0FA 2Z6BD 2STBE 3RXTA 3T27A 2Y5GA 1IQHA 3UREA 1QFKH 3TIUA 3RMNH 2BB4A 2WPJS 3M37A 4MPXA 2ANKH 5FPYA 4NWKA 1YPHC 4X6OA 1G3DA 1Y5AT 1DSUA 1C2KA 1LPKB 1WOFA 2THFB 2SNVA 4ZUHA 1N8OC 1GBEA 1BJVA 4ABHA 3MFJA 3VEQB 3MH6A 1YPKH 1CVWH 3Q3YA 3SU4A 1ESBA 4WH6A 1GMDG 1DWCH 1RTKA 3DHKH 1GBDA 4B76A 2Z94A 1TA2A 1UCYK 1YKTA 2H5DA 1V2MT 2Y7XA 1VGCC 1Y3XA 4KGAA 3LGWA 1H9LB 3MO6A 1C1PA 3OY5U 1HAOH 2W26A 3GY4A 4YO9A 5T6DA 5T6GA 1F0RA 2V3OH 1QL7A 2C8XB 1ZTJA 3PMAB 1GWAA 3MTYA 1TPAE 3ATKA 1W0YH 1L4DA 3A87A 1TBRH 3ZVCA 4H4FA 2ZECA 3RLYH 2WPIS 1YCPH 5C67A 3AW1A 3A7VA 2A4OA 5CE1A 8GCHG 1H9IE 5PTPA 5DGJA 1DE7H 3QZQA 1GJBB 2A2XH 1OWJA 1C1QA 1SGDE 1PJPA 2IOTA 3U1IB 1L1JA 1NFWA 2V3HH 1MCTA 1G3EA 1E37B 3TGJE 4O3TA 1HAXB 1FJSA 4RN6A 3ODFA 1DXPA 2AERH 3A7ZA 4FU7A 2VVCA 4GHTA 1N8OB 1O3DA 4JYVH 3SNAA 1K1MA 1WCZA 1DUEA 1WU1A 1MTVA 3A81A 5T6FA 1D3TB 1V2QT 1KIGH 2FPZA 1IQIA 1TRMA 1W13U 3TK6A 1P2OA 1K2I1 1DLKB 4X8UH 2HPPH 5DPAA 1C5QA 1P57B 1IOEA 2PGQB 3KN2A 1ANBA 5HM2A 5EPNA 2ZFTA 3W94A 4CH8B 4XSKU 1LO6A 3TITA 1V2KT 2FWWA 4DY7B 3MH5A 1BRAA 1P3EA 3PO1C 2P8OC 5EGMA 1ORFA 2PLXA 1A46H 3PROA 1GHAF 3ATWA 1BB0B 3KNXA 1O32A 1LQDB 3SNCA 4ABFA 1BOQA 1D6RA 2VVVA 5EXMA 1HGTH 1TX6A 1HAVB 4CR9A 1EAIA 1ELVA 1SQAA 3HK6B 1O3BA 4INLA 4YT6H 4INKA 1D4PB 1D3QB 1GHZA 2OUAA 5IDKA 1BIOA 4YZUA 4K60A 1Y5UT 1KY9A 2WPKS 3SW2B 1P2NA 3OYPA 3ESTA 2VGCB 1D3DB 5AHGH 1UVUH 1O3EA 2BQ7B 1TABE 1EPTA 3BTME 3DT0H 1QGFA 1AB9B 1EJMA 1OKXA 1UTPA 5JPMH 2CV3A 3MNCA 1V2UT 5GXPA 4JYTA 1AFQB 2W7UA 3PTNA 5G4BA 1MTSA 4NFEA 4TY7A 1BA8B 4MPUA 1C1WH 1S0RA 1G9IE 1CHOF 1MZAA 4FUCA 2JH5D 3EE0B 2XRCA 2BX4A 1MTNB 1A0JA 1P0SH 4AORA 4OGXA 3Q77A 1E35B 1MTWA 1FLEE 3LH3A 1UHBA 1HB0B 2QA9E 2ZHFH 4U32A 4NWLA 1LHEH 2D26C 1E36B 5L30H 3SU0A 3F1SB 4OGYA 4MLFB 4XE4A 3RXJA 3TJNA 2PW8H 3VB6A 1O2NA 3P17H 4UDWH 1GI0A 1QBNA 2PUQH 2YOLA 3GYLB 1DX5M 3U9AH 5HYOA 3TVJB 1GJ7B 2QF3A 2UUFB 1EPTB 4AYYB 2UWLA 1ZMLA 2GT8A 3SJIA 1AWHB 4K8BA 1THSH 3ZZAA 1GHBG 2BY5X 4ZROA 3BTWE 2D8WA 3Q76A 1W7GH 4WMEA 1ELTA 1FPCH 2BYAX 2P3TB 2XC4A 1P05A 1O33A 4HTCH 4JCNA 1O2UA 1PPCE 3F68H 1EAUA 2QXGA 1XKAC 1TNJA 3MHWU 1WTGH 1TWXB 4CBOA 1FZZA 4NA8A 1Y3VA 1O5FH 1QCPA 2WPMS 4SGBE 1CT2E 1P01A 1MUEB 4GCHG 1XUFA 3NXPA 1SLVB 1ANEA 4BTIB 5K0HA 5LPEA 2QN5T 1GGDB 1HBTH 1FMGA 4WMDA 3FP6E 2OD3B 1P09A 2CN0H 2H9HA 4YOIA 1G32B 2STAE 2HVXA 4Y76A 4NA7A 4IN2A 5E2PA 1SGQE 1C5LH 1VJAU 1SG8B 1NPMA 1S6HA 3R3GB 2PFEA 1VITF 2A1DB 2HLCA 1FUJA 2ZG0H 2A45B 3U8RH 1XUJA 1BQYA 2PSYA 1QB9A 3LOXA 5TCCA 2NU4E 1S6FA 1ZMNA 2BDGA 5FAHA 2R2MB 4X8TH 4TPYA 4OS6A 1V2TT 2VVUA 2J38A 1P2QA 1SR5C 4AYVB 1AHTH 4JK5A 2WYGA 1BTHH 2BZ6H 4ISHH 5EW2H 1SHYA 4XBBA 1C1SA 3TJVA 1TGTA 4OS5A 1F0TA 1UTLM 4NCYA 1HJAC 1SOTA 1TOCB 6GCHG 2QAAA
chains in the Genus database with same CATH superfamily
1C4V2 3MU5A 3RDZA 5GJ4B 4CH2B 2VWNA 3GCNA 1OSSA 1C1RA 1TPPA 1OHHD 4B1TA 1K1IA 3BTQE 3GY5A 4JK6A 1SQTA 5AFYH 4X6MA 2H9TH 1O3LA 3FFGA 2SFAA 1WAYB 1C1NA 3TGIE 1H8IH 2F9PA 1F0SA 1BMLA 4D9QA 1SHHB 1XUHA 4KTCA 3RP2A 3MNBA 1FI8A 4Z6AH 2G4UA 1UTMA 1HAVA 1BCUH 5A8XA 2R3YA 5ETXA 3S9BA 1NRPH 4XOJA 1AU8A 3RXLA 4F55A 4F49A 5CDFE 2H6MA 2ZU3A 3SJKA 3HGPA 1P02A 8ESTE 2EI6A 3UWIA 3URDA 1QRXA 3D65E 1ZSKA 3UAIC 4MPWA 3M7QA 1O2LA 1O5GH 3RM2H 1O38A 1LDTT 2F3CE 3Q3XA 3MNSA 1OXGA 2GTBA 3U28C 4ABGA 1C2HA 2XYAA 2BLVA 1AVXA 1BTZA 3M3VA 4ESTE 2BVRH 3IG6B 1F5RA 3OTJE 1MQ5A 2BD3A 4BOHA 8GCHF 2FLRH 2J92A 5DSFA 2BY8X 1MMJN 4P02A 1CSOE 2ZGHA 2ZCKP 3JZ2B 5EW1H 1MTNC 1K21H 3SI3H 1GHVH 5FX5A 5GCHG 3T28A 3FZZA 1E38B 2A4QA 3H7TA 3SNEA 1FV9A 1IQEA 4U30A 4CBNA 3ZVEA 4MNWA 1GJ8B 1A5HA 3SJOA 1O2VA 1OP0A 1BRCE 3V3MA 1HAZB 5JBTA 3HGNA 1JBUH 2FOHA 5K7RA 1XVMA 2FOAA 2TRMA 1A1RA 1C5TA 1T8LA 2YMSB 3RC6A 4P00A 4XDEA 3P6ZB 4JZEH 1SGYE 3Q00A 1O3AA 1S84A 1YCPK 2AS9A 3MMGA 1O2ZA 2P94A 1GMDF 3SQEE 1W3CA 2BDIA 5C1YA 5FCRA 2Z3CA 1SL3A 3W1EA 4CRFA 2XWBI 2EI7A 2TGTA 3MOCA 3ZVDA 3KL6A 3VB3A 3E6PH 2BY6X 5IYTA 1AVWA 1H9HE 3OX7U 5JDUB 2PV9B 1GMHG 2FEQH 4ZMAH 1CA8B 4FUEA 3ZZ7A 4RI0A 2O9QA 1EASA 1ELEE 4TSFD 2A4GA 1BTUA 2ZHWH 1RJXB 3SJ9A 3N7DA 1NS3A 3LJOA 2GCTC 2HVYB 3UWJH 1ZR0A 3KCGH 1S0QA 1IQMA 3QX5H 3SYJA 1FN8A 1HJ8A 3VFEA 4ZHMU 2ALPA 2LP6A 4Z1MD 1BJUA 3PRBA 2WPLS 4UONA 2J4IA 1V2OT 4Y8ZA 1CBWB 3RXFA 3STJA 3LKWA 1C9TA 1D9IA 2NU0E 3LGVA 2TPIZ 2ZTZA 1O2PA 2C8YB 2A7CA 1C2LA 1C5VA 2BLQA 3BEFB 1AI8H 3BTEE 3T5FH 1ETRH 2WV5A 4RKOB 2GDDA 1Y8TA 1BUIA 2ZPSA 1V2PT 1TAWA 4A1XA 1OS8A 1FPHH 2VNTA 2KZ4A 1ELDE 2FOCA 5TJXA 3E90B 1NU7B 1O2JA 1T8NA 5GNDA 4ASUD 3F9HA 3GISB 1BMAA 1GBIA 1NBMD 1GMCF 2P3UB 2FOBA 3BTDE 1BBRK 3LPRA 4A1TA 2A32A 1TOMH 5AF9H 1C2DA 4O9VA 2FI3E 8KME2 3PLPA 2ZHQH 4MDSA 2ZFPH 4BAMB 1MAYA 3RXIA 2FX4A 1C1UH 2KCYA 1YYY1 1C2MA 1O3PB 2TGAA 4E7RG 1AB9C 1O36A 4FUGA 2RDLA 1GBMA 4DW2U 1KLJH 2FLBH 1O3NA 2WUCA 2BLOA 3C1KA 2P3FH 2ZPRA 3RXKA 3NCLA 1YCPM 2J2UA 2GVFA 3ATMA 1TGCA 5DK1A 1ELAA 2EA3A 5JBAS 1KSNA 2C3SA 3PMHB 4TWYA 4UD9H 1PPFE 1ZJKA 2BD7A 4MVNA 1HAIH 3RXGA 1CHOG 1O5AB 3PRDA 5A09A 1LQEA 1W14U 2OINA 3A88A 2BLWA 2FYQA 1TRYA 5L2YH 2ZC9H 4YESB 2FO9A 1O5EH 3NKKA 3PMJA 4E05H 1RTLA 4H42U 1LPGB 1HAHH 4NIWA 5F03A 4ZKRU 2Y80A 2OC0A 1DM4B 5EU8A 3GDVA 1YPLH 4FUDA 1L2EA 1YBWA 4UE7H 2TGDA 5JBBS 3U8OH 1O3KA 1A3BH 3HK3B 2FDAA 1A3EH 2BXUH 4CRDA 3FANA 2W7SA 5E0HA 1QL8A 2PKAA 1LMWB 4OS1A 1BZXE 1P03A 3QTOH 1SLXB 1HXEH 2ODYB 3A8BA 4JZIA 3U98H 2Y7ZA 3VGCB 2BZAA 1J9CH 4VGCB 4AZ2B 2VH6A 2Z9JA 4MNVA 1W0KD 4AG2A 2A31A 1G36A 1SOZA 1GI8B 1VCWA 2EI8A 2GV6A 2I6SA 3LU9B 1UK4A 3ITIA 3NK8A 1QBOA 2AGIX 3BG8A 3GDSA 1EZXC 1T4UH 1AKSB 1JOUB 3OEED 3A85A 2WHXA 2XOKD 2YMSC 1DT2A 3GICB 2K8IA 3F2FA 5GDSH 3RLWH 4HGCA 1NU9A 4ISIH 1GHYH 1Z8JB 5C94A 3A82A 4GSOA 4MQAA 1OOKB 4Z0KA 3B23B 2HNTE 3UIRA 3FKSD 1EB2A 3LC3A 2G00A 4FETA 1C4U2 3KEEA 1Q3XA 1DOJA 4O3UA 4AX9H 1QQUA 4Y6DA 2C4FH 1P10A 4X2WA 1MAXA 2BY9X 1J15A 2O8UA 2KAIB 4Q63A 1UTOA 2OBQA 4BXWA 1AY6H 3QGNB 1YPHE 2ODQA 1Z6EA 2P93A 2YNBA 4X8SH 1YM0A 2PKSC 2DE8A 2GCTB 2B7DH 1LPZB 3ZZ6A 1K9OE 5ESTE 1O2OA 1TGSZ 1GI5A 5FBIA 1DPOA 4BTUB 3TJUA 5DG6A 4B2AA 1NM6A 4D8NA 1GBAA 4NIVA 3ZZ5A 1D3PB 2DUCA 4WVPE 2ZDKA 2FOEA 1SGIB 2NWNA 1RD3B 1QRWA 2JETC 4DT4A 1QA0A 1O2SA 2ASUB 3ZZ4A 1L1GA 5EJLA 1HJ9A 4ZKOU 4JZFH 3H5CB 5CHBA 4CRGA 2BX3A 2YNAA 1QIXB 2ZU5A 1FIWA 4MG3A 1QA7A 3A83A 1CT0E 2K1QA 1VGCB 4YT7H 2IN2A 2VB0A 4DCDA 3OAAD 4YM9A 4IMQA 4B71A 1F5LA 3M3SA 4OS4A 3WY8A 4IW4E 3QLPH 1O3HA 4H6TA 4IN1A 1GJDB 2WUBA 3E16B 4UEHH 3ZZBA 1Z8GA 4WMFA 1LHFH 2Y6TA 1QB6A 1MKXK 2CF8H 4LZ1H 5C0TA 5HXFA 2A7HA 2SGFE 1OWEA 3E3TA 4BAOB 1C5YB 1PQ7A 3P70B 1UCYH 2SGPE 3AW0A 4X8VH 1DITH 1NY22 3PTBA 3SI4H 2ZF0H 4YLUA 4Y10E 1C4Y2 1BBRE 2Z7FE 1N6YA 2W3KA 4Y79A 4E7NA 2VWMA 4MPVA 1SGTA 1NC6A 2M5TA 4D7GA 3B8JA 1TGBA 1GG6C 4NIXA 3STIA 3TH3H 1ETTH 3SUEA 2K0QA 1IQFA 2ZHEH 2ZU4A 2G55A 5DP9A 1C1MA 4LK4A 4Q7YA 4Y7AA 4K3JA 1V2WT 3RU4D 4D9RA 2FOMB 1AMHA 2V35A 1DFPA 3M3TA 3F9EA 1TGNA 1AIXH 1W7XH 1EX3A 1MBMA 2V6NA 3M36A 2ZO3H 1AQ7A 3A80A 4ISLA 2QIQA 2F9BH 2GMTB 2GDEH 1O2IA 3D62A 1CT4E 2Z3DA 4O03A 4X1PU 3RC4A 2L6OA 1ZGVA 1ZOMA 1Z7KA 1SGFG 4IC6A 2B9LA 2G5VA 1Z71A 2KCOA 3O8DA 1MBQA 1HAPH 1FY4A 4X1RU 3D49H 5DP4A 4I8JA 1PPZA 5DP3A 3TPIZ 3S0NA 2KCAA 1GHWH 1UVOA 4B75A 1UHBB 2XBXA 1TPSA 1CBWC 2OLGA 2WYJA 2VIQA 4RKJB 1P9UA 1GL0E 1TALA 1C2JA 1GJ5H 7LPRA 3QTVH 4A7IB 2QF4A 4FUHA 3B9FH 1SSXA 5C1XA 3MO3A 1RIWB 3CENA 1XKBC 1E0FD 1FQ3A 4X2VA 1DXWA 5C1UA 1AE5A 1P2KA 1ZPBA 2XWAA 2Q6GA 3T25A 3ZV8A 3BEUA 4LOYH 1EQ9A 3ENSB 2F9VA 1FX0B 1NO9H 1JRTA 3SHCH 3QO6A 3KYGA 1HNEE 1WQVH 5C5NA 3TK5A 3V0XA 3BF6H 1PPEE 1FNIA 3QN7A 3SORA 2OQ5A 1U6QA 4NZLA 2A5IA 4XD7D 1UTNA 4CRCA 1UK2A 5EQQA 1HJAB 3MU1A 3SV6A 3O8CA 2ZKSA 2CMYA 2ILNA 3ATLA 3O8RA 1Y3UA 1TX7A 2F83A 3RXEA 1K0HA 1HLTH 1COWD 2ZFSA 1GBLA 2H1UA 1L4ZA 3KGPA 5FCKA 2UUKB 3OEHD 5C3NA 3PO1B 2ZZUH 2PTNA 1A7SA 2PP6A 1V3XA 4ZKNU 3SJ8A 2XTTB 1C5WB 4I8GA 1EAXA 1RGQA 2ZQ2A 3SUFA 1HIAB 1HRTH 3MH7A 5EIYA 5FBEA 1YLDA 4WJG2 9LPRA 1ZHMA 3TU7H 1V2LT 1N1LA 1GJAB 4BXSA 1Y5BT 1V2JT 3A84A 1IHTH 1GBKA 3T2NA 1OX1A 2XC5A 4HFPB 2VWLA 1GI9B 1PPGE 3VPKA 4I8KA 3NRLA 1PFXC 3FP7E 3QK1A 2PKAB 5EJZA 3HPTB 5C20A 3ZZ9A 1K22H 1NFXA 3LONA 1GI2A 1ID5H 4IC5A 4ABAA 1UJ1A 2DE9A 4J1YA 2FODA 2TGPZ 1TNGA 1JIMA 4X1QU 1MZDA 1GHBF 1O3GA 3PMBB 6ESTA 5C5OA 1G37A 1NT1A 1CHGA 3VXEH 4AN7A 3SZNA 3EYDA 3LC5A 1DDJA 4OS7A 1OYTH 3DUXH 1C1TA 2C8ZB 4K1SA 1UTKA 2OXSA 3VGCC 4K69A 2G8TA 4FU8A 1DICA 2Q1JA 3T29A 3KQBA 1J14A 2WV9A 3KQEA 1SFIA 1NFYA 3EGKH 4F48B 2CXVA 3M5NA 1AGJA 5E2OA 2BOHB 4AFZA 1TQ0B 2JETB 2AMQA 1SMFE 1EOJA 2A0QB 5F8TA 5GIBA 3NWUA 2F91A 1WV7H 2FS8A 5FXLA 5DN6D 1SGCA 1DLEA 2RG3A 1P11E 2AEIH 2WSSD 4RT1A 4PROA 3ZVBA 3VB5A 2VIPA 1RFNA 5LH8A 1AZ8A 1EFRD 1OP2A 5HGGA 3JZ1B 2AGGX 1P04A 4WXIA 1O5DH 4B74A 5JB9S 1GJ4H 1SGFA 4FUBA 1O2KA 3KIDU 1YPGH 2AGEX 1H1BA 9ESTA 2GT7A 3L6PA 4RSPA 3RXPA 1TLDA 1A5IA 3TJOA 1YLCA 2RA3A 1J16A 4DVAU 1JIRA 3RXQA 1WUNH 2BDAA 3PB1E 2CJIA 1QRZA 4GPGA 2WV4A 1GJCB 1INCA 1OYQA 5J4SA 1Y59T 1UK3A 2FOGA 1WYKA 2BD9A 1GMHF 2FI5E 4A1VA 5H4IB 3ZVGA 4DG4A 2A5AA 1TYNA 1EPTC 1KXAA 5DKMA 1C2EA 4B6EA 3N7OA 1PQAA 3MO9A 4H6SB 5LPFA 4CHAC 4X0WU 3TLOA 1UVPA 1P06A 5DJ7A 7GCHF 5FX6A 2HPQH 2AMPA 1GJ6A 3A8DA 1PYTC 1QB1A 1SBWA 3C27B 5EXLA 3ZZDA 3EAJA 1HXFH 3P8NA 1TBZH 3M7UA 1P9SA 5DP6A 4ZXXH 5ABWA 1ZJDA 1O3MA 3DCLA 4BAKB 2F9NA 5EQSA 1CU1A 3TNTA 1GVZA 5F8ZA 4AB8A 3URCA 1TRNA 1YLNA 1YY3A 3ZYDA 5GCHF 3P8GA 1IQKA 1LVBA 3IITA 1NRQH 2ZTYA 3RXVA 1GGDC 5JYIA 1ZPCA 3NPSA 1LKAA 3R0FA 4K8YA 3RXRA 1W10U 1OWHA 1QQ4A 3RXHA 5GWZA 2RA0A 1HAYB 3RXBA 1SLWB 2R2WU 4X6PA 1PPBH 4ABBA 1DWDH 2BDCA 2G52A 2GP9B 4K5ZA 1N6XA 2JJ2D 3RU4E 1SI5H 4CR5A 4Y7BA 4B6FA 1ETSH 1Z1IA 4GAWA 3EA7A 2ZDMA 3T62A 5T3HA 4FUFA 1K1JA 4AOQA 1C9PA 2OC1A 3DD2H 1SFQB 5DO4H 1QURH 2Z3EA 2Q6DA 1Q2WA 1HYLA 3F6UH 1E1QD 2SGEE 2ZFRH 8LPRA 4F4OC 1F0UA 1S83A 1YPJH 1H8ED 4U01A 1C1VH 1X7AC 2AYWA 3H09A 1E34B 2QXJA 3A8CA 1BBRH 1O3IA 2GZ7A 1GBJA 2ZWLH 3UNSA 2PSXA 4A5TS 1BTWA 3S7HB 1HUTH 1LKBA 1W12U 2XNDD 1Z1JA 2FTMA 3ZZCA 1BMNH 4R0IA 3MI4A 2BD4A 1Z6JH 2D1JA 1BHXB 1QJ1B 2BHGA 3ZVFA 1SVPA 2HALA 2TIOA 3T26A 1DWEH 1MU8B 1C5OH 2FESH 1QBVH 1CQQA 4A92A 3EA9A 5C17A 1VITH 1MCVA 5LPRA 1ZSLA 4ZKSU 2ZNKH 1NRSH 1OWKA 1SPJA 3TK9A 6CHAB 1GDQA 2PTCE 2XC0A 1TFXA 2ODPA 4WF8A 4Q80A 4NG9H 2F9UA 2KR7A 5EJ1A 2I6QA 3PV4A 3D23A 1IQNA 1CE5A 5DP5A 1P2MA 1Y3WA 3MYWA 1NROH 1V2RT 1ZRBA 1CA0B 5DP7A 1B0EA 3RXOA 1GI4A 2GZ9A 1AUTC 2JH6D 1O3OA 1QL9A 3PV2A 2F43B 1FIZA 3A8AA 1PYTD 3SV2H 3M35A 1NN6A 2LNCA 3UR9A 4ZCNA 3SU2A 1O31A 3SBKA 2RCEA 1ZHPA 1TMTH 2OC8A 1TX8A 1NESE 4I8LA 1KXDA 3SU6A 3V13A 5CHAB 1BHXF 4AB9A 1HV7A 2FMJA 2J95A 3CNRA 5A8ZA 4OS2A 4NIYA 3F2HA 1TBQH 2P8OB 1KTSB 3PWCA 4ZAEA 1EATA 5I25A 3MWIU 1LCYA 1TNIA 2O8TA 3AAUA 1MU6B 4KP0A 2Y81A 3ZYEA 3BG4C 2NU3E 2G51A 3F9FA 1XMNB 4X1SU 1C2GA 1ZGIA 1EUFA 1P3CA 2ZDLA 3MU8A 4DIHH 1EAWA 2BM2A 4M9FA 4MNXA 1FY3A 1NRRH 4B2BA 1DUAA 2VIOA 2PWXA 2ZDNA 2ZGCA 2ZFFH 3TNSA 3BTHE 1OWIA 1MKWH 2GV7A 3UR6A 4GUXA 1FY8E 5HM9A 2BY7X 3FZDA 1GI6A 3DFLA 1AZZA 3A86A 1O3CA 3QGJA 2HGTH 2FOFA 1GDUA 1ESAA 1C5SA 4JMYA 2UUYA 1O2YA 5I46H 2BDYA 4Y71A 1J17T 3SUDA 4E06H 1PQ8A 2ZGJA 1MABB 5C2ZA 4K2YA 2SGAA 5GPIB 1KYNA 2R9PA 2P16A 3RMLH 3ZV9A 1P2IA 1QY6A 2W5EA 2UWPA 1IQJA 1FN6A 2J94A 4NSVA 1WBGB 3PWBA 1O2RA 3N7EA 4TY6A 3SU5A 1O2HA 1ZTKA 2ZU1A 3ZIAD 2FYRA 2IJD1 4ZH8A 1ELGA 2ZTXA 1BMFD 3KQ5A 4ISNA 4Q7ZA 1K1LA 3A7XA 1UVTH 3SGBE 4FU9A 1S82A 2KAIA 5EODA 3SO3A 1YP9A 3PV5A 5BPEA 3M7TA 3WWBA 1DANH 3ODDA 1LHCH 1JWTA 1IQLA 2XNIA 1NTPA 1TMUH 4X2XA 3UTUH 1O2MA 4DURA 2G81E 3MNXA 2ZPQA 3QUMP 5HKKD 3M5MA 4KTSA 2WINI 1ARBA 1GI3A 2QY0B 1MTUA 2KCPA 2XBVA 2QCYA 1S5SA 1WSSH 2HRVA 4NSYA 2BD5A 2HNTC 1G3BA 2J98B 1O2WA 2GD4B 2ZDAH 1CGJE 1KMHB 3LGIA 5FHTA 3UUZA 4KKDA 1KLIH 1MKXH 1VZQH 4M7GA 3BTKE 1P12E 4HG6A 1BITA 1OWDA 3A89A 1XXDA 2QC2A 1O3JA 1V2ST 3GDUA 4CRAA 2RDEA 3QZRA 4INHA 2AH4X 1V2VT 1EP6A 1KTTB 3G01A 1GL1A 1GCDA 3V12A 3SNDA 1TNLA 3LGUA 4WH8A 1DSTA 1M9UA 1O5BB 2JH0D 2F4LA 3AASA 5B6OA 2BD2A 1OPHB 1SQOA 4IBLH 5F53A 3CS7A 1ZYOA 1T31A 3GY8A 4KTUA 2RFKC 3LGTA 2ZU2A 1QJ6B 3RXDA 5BRRE 4J2YB 5FPTA 1KDQB 4B2CA 3QWCH 1HAGE 3ZZ8A 1TIOA 1O35A 1LTOA 4Q2KA 2VGCC 3HKJB 5B6LA 3F9GA 3LIWA 3GYMA 1NFUA 3F0OA 3GY7A 1Z8RA 1H8DH 4WXVA 1TB6H 3MQKC 2G4TA 3UFAA 2H9EH 3EDXB 3F3BA 4YOGA 1ELBA 2VIVA 3BV9B 3S69A 3W95A 4D7FA 3H7OA 1DY9A 1NZQH 3ZZ3A 3GCTF 4XBDA 1T4VH 3MU0A 2OQUA 3SU1A 4FXGH 2A7JA 1F92A 2J34A 1AE8H 3BN9A 4UFEH 1G2LA 1HIAA 2IPQX 1GI7B 3E91A 3BTFE 5L6NH 1JXPA 2LPRA 1L0ZA 3S9CA 1C5RA 4ABEA 4JYUH 1GMCG 4JZ1A 1XUIA 3BTGE 1G30B 1ZPZA 1ELFA 2H2ZA 3OU0A 3RUOA 3UB0A 2WPHS 4X1NU 1PQ5A 4Y0YE 5AFZH 3RC5A 5EXNA 3BTTE 3UNRA 3LT3A 5AVDA 4BAQB 1C5MD 3K9XB 3UY9A 2BVXH 2O8WA 4KELA 4NZQA 4XBCA 4Y11E 2ZEBA 3SV8A 3UPEA 3OTPA 1V2NT 3QDZB 1O37A 2ZQ1A 1FDPA 2SGDE 3K6YA 1ARCA 1BTPA 1KXFA 1CA0C 1FXYA 1O30A 3EA8A 1BRBE 1C5PA 1CGIE 2HLDD 1HFDA 4ABDA 4AFUA 1A61H 4I33A 1YPEH 2BTCE 3FP8E 1THRH 3V7TA 3P8FA 2IPHA 4MTBA 2EQNA 1K1NA 1LVMA 1UTJA 2O8MA 2OK5A 2BQWB 2CHAB 4DJZB 4THNH 2A4RA 5SGAE 1HCGA 3SNBA 1GHXH 1C2IA 1C5NH 1XUKA 4BAHB 4VGCC 3A7WA 3Q3KA 3OSYA 1KXBA 1GI1A 3DSPA 3AAVA 1EP5A 4NGAH 5A0CA 2LELA 2ANWA 3MH4A 1O5CB 3RMOH 2R3UA 2B0FA 5F8XA 4YLQH 2EC9H 4NA9H 4R8TB 1E79D 3KQCA 3SUGA 4ACBA 2PUXB 1KDQA 5HIYA 1UMAH 2ZI2H 3OY6U 3RXCA 1ZRKA 3PLKA 2J97A 1SLUB 2AIQA 1DVAH 4TWWA 2AFQB 1Y3YA 2XW9A 3L33A 3U69H 1MD7A 2A5KA 5A0AE 4YXWD 1YGCH 1ZSJA 3PLBA 4I8HA 3NUMA 1KXCA 1JRSA 2XCFA 1LHDH 4AGJA 3NZIA 4ASHA 1F7ZA 2ZGBH 1EKBB 3TH2H 1O0DH 2GJGA 3LGYA 1VCPA 1W0ZU 1RIWC 4IS5A 1K1OA 1ZMJA 4FOUC 1C5XB 3K6ZA 1GBBA 3U1JB 1IQGA 3SOSA 3UQOA 2SNWA 1AFEH 2P59A 3BIUH 1Z8IB 2XXLA 5L2ZH 1ANCA 2J98A 1GVKB 3GCOA 1NRNH 4ISOA 1YF4A 3SHAH 1LVOA 3IWMA 1B5GH 3FVFB 1UO6A 3AVZA 3LDXH 1O3FA 1FAKH 3I77A 1V6DA 1F2SE 4ZHLU 3SN8A 5DP8A 2W6ID 2P95A 1VR1H 4YOJA 1W11U 3TH4H 3OFND 1SGNE 2NU1E 1B7XB 2HOBA 3DSGA 1ABIH 1ZLRA 4ACAA 2BXTH 1EB1H 1SGRE 7ESTE 2QF5A 1T32A 4YTAA 1BTXA 1C5UA 1O2QA 1H4WA 1GG6B 3P92A 1P2JA 4TT3D 1A4WH 2GX4A 2OTVA 4JZDH 2UUJB 2EY4C 3UNQA 1C1OA 2GCHG 4WY3A 1SKYE 1THPB 3SGQE 2QV1A 1EJAA 1GBTA 4GVUA 1UTQA 2A2QH 2ZCHP 6GCHF 1GBHA 2BOKA 2TBSA 1SC8U 2BD8A 4HI3A 2J9NA 2ZP0H 5A2MH 2OP9A 5E0GA 3WW7A 4DIIH 3BG4B 1GCTC 4ABJA 5J4QA 4UFGH 1DS2E 1HPGA 3VG8A 3RXUA 1O34A 1O2TA 3MU4A 4AFQA 1A2CH 4Y0ZE 4FVBA 1ESTA 1MD8A 1G2MA 2IJOB 2W6JD 2Z9GA 1QZ8A 2OCVB 1YPMH 1T7CA 1IHSH 4AGKA 3E0PB 2VIWA 2AHME 1D6WA 1T8MA 3OE7D 2ZCLP 1MKWK 3GCHC 2VWOA 2GZ8A 1C5ZB 1QNJA 2Z9KA 3K65B 7GCHG 2UWOA 3O8BA 4LXBH 5EPYA 1SGPE 2BMGB 4U2WA 3DFJA 4CRBA 4IGDA 3SV9A 4D76A 3ELAH 5JB8S 2VINA 1S85A 1VITG 2QXIA 3M5LA 1W8BH 3EE7A 2ZHDA 4ZHAA 5A8YA 2ALVA 3RM0H 1E1RD 1C2FA 4CREA 2XBYA 3A7YA 2C90B 2GKVE 2ZIQH 4X6NA 2YMSD 1EXFA 1GDNA 2F9OA 5FL7D 2W3IA 1VCQA 3KHVA 4GCHF 2QXHA 1LVYA 1EZSC 1O2XA 1FAXA 3SZEA 2FI4E 1XUGA 3RU4T 1F5KU 3SV7A 5E0JA 3PM3A 1GJ9B 1TNKA 2CK3D 4FVDA 1UVSH 2FP7B 2R0KA 2VU8E 4B73A 1KXEA 4Q7XA 2ZFQH 2CGAA 5TCAA 1LHGH 3EQ0H 1UW7A 1EZQA 3AK5A 1EOLA 3FAOA 1A0LA 2ANYA 3M5OA 1O2GH 1UCYE 1DY8A 2VBCA 3K2UA 4BNRA 1YC0A 1ZTLA 3GCHB 3GCTG 4DOQA 3BSQA 4TPIZ 2Y82A 3HATH 1EJNA 3RXAA 2PGBB 1DWBH 2HNTF 3UQVA 2EEKA 5F6MA 2XBWA 3SQHE 2HWLB 1AO5A 3E0NB 5E8EH 2D2DA 2AMDA 5CHAC 1FY1A 2C93B 4UFFH 4UFDH 2FS9A 3LH1A 3S9AA 1J8AA 2Y5HA 1RS0A 2ULLA 2CHAC 1TNHA 3HKIB 4O97A 6LPRA 3E1XB 1BTYA 4AFSA 4DT7B 1IAUA 3UOUA 3TGKE 4HZHA 1HDTH 1AWFH 2QGRA 2FZZA 1G3CA 3I78A 3SGAE 5JBCS 1XX9A 3S7KB 4QT8C 3GY3A 4A6LA 2PHBA 1YWUA 1KLTA 3VB4A 1MQ6A 2VIDA 5HMAA 2JJ1D 2VJ1A 1K1PA 1AFQC 2C8WB 4TYDA 4X2YA 2BDBA 5CMXH 2FM2A 4I32A 4I31A 3VXFH 5ESBA 4IMZA 3U8TH 4BTTB 1W0JD 4FUIA 4XFQA 1AKSA 1BMMH 1RXPA 2O8LA 2B8OH 1SQRA 3GY6A 1GBFA 2Z9IA 1BDAA 1AVGH 2GMTC 3VB7A 1QHRB 3DSOA 2BVSH 4AG1A 1O39A 3UOPA 1XXFA 2CF9H 1RRKA 2KM0A 1GHAG 1RTFB 1P8VC 1A0HB 3FN8A 3M61U 1GVLA 3SU3A 7KMEH 3GOVB 1L1NA 2PKSB 3L3TA 2WPDD 1Q31A 6CHAC 3KF2A 1QJ7B 4RT0A 1TQ7B 5C0UA 1XVOA 1TA6A 3GY2A 1ACBE 4WWYA 3RMMH 2FX6A 3KQDA 1SGEE 2QYIA 2BDHA 2NU2E 2GCHF 1W2KH 4ZXYH 1ANDA 4Y8YA 2H5CA 1CGHA 3LJJA 2Z9LA 4K1EA 2VH0A 5LGOA 1WTHD 2OC7A 2OBOA 1QTFA 2ZDVH 1K28D 2SGQE 2Y5FA 1FONA 2B5TB 4NFFA 1AD8H 1ABJH 1TMBH 2QF0A 2AIPA 3RXSA 2Q6FA 1FY5A 2FIRH 4LZ4B 1CO7E 1OP8A 4CHAB 1MH0A 2FXRA 1SB1H 4SGAE 5EG4A 1AUJA 3I29A 5EQRA 4BANB 4GHQA 3CP7A 1GPZA 1ZHRA 2PR3A 3E8LA 1ZZZA 2ESTE 3ATIA 2G5NA 2V0BA 5A0BA 1QR3E 2BQ6B 4I7YH 1GBCA 3RXMA 1EZUC 3BEIB 2R0LA 1XM1A 3PYHA 2XCNA 1BRUP 1GCTB 1TE0A 4MNYA 2ANMH 1AN1E 1ELCA 3BIVH 2JKHA 2FTLE 4DGJA 3P95A 4K1TA 5EOKA 1TPOA 1JMOH 2ZGXH 5FPSA 4ABIA 1VJ9U 5KEDA 1BT7A 1A5GH 1T8OA 3A7TA 1TONA 4Y8XA 4FUJA 4GLYA 3DA9B 1WQSA 2GGVB 3ZVAA 1S81A 2ZA5A 3P8OA 1PPHE 3CS0A 1B0FA 2Z6BD 2STBE 3RXTA 3T27A 2Y5GA 1IQHA 3UREA 1QFKH 3TIUA 3RMNH 2BB4A 2WPJS 3M37A 5KECA 4MPXA 2ANKH 5FPYA 4NWKA 1YPHC 4X6OA 1G3DA 1Y5AT 1DSUA 1C2KA 1LPKB 1WOFA 2THFB 2SNVA 4ZUHA 1N8OC 1GBEA 1BJVA 4XRNA 3FO8D 4ABHA 3MFJA 3VEQB 3MH6A 1YPKH 1CVWH 3Q3YA 3SU4A 1ESBA 4WH6A 1GMDG 1DWCH 2JDID 1RTKA 5KGOA 3DHKH 1GBDA 4B76A 2Z94A 1TA2A 1UCYK 2JIZD 1YKTA 2H5DA 1V2MT 2Y7XA 1VGCC 1Y3XA 4KGAA 3LGWA 1H9LB 3MO6A 1C1PA 3OY5U 1HAOH 2W26A 3GY4A 4YO9A 5T6DA 5T6GA 1F0RA 2V3OH 1QL7A 2C8XB 1ZTJA 2L74A 3PMAB 1GWAA 3MTYA 1TPAE 3ATKA 2KX4A 1W0YH 1L4DA 3A87A 1TBRH 3ZVCA 3F0PA 4H4FA 2ZECA 3RLYH 1WXRA 2WPIS 1YCPH 5C67A 3AW1A 3A7VA 2A4OA 5CE1A 8GCHG 1H9IE 5PTPA 5DGJA 1DE7H 3QZQA 1GJBB 2A2XH 1OWJA 1C1QA 1SGDE 1PJPA 2IOTA 3U1IB 1L1JA 1NFWA 2V3HH 1MCTA 4Q4LA 1G3EA 1E37B 3TGJE 4O3TA 2KFWA 1HAXB 1FJSA 4RN6A 3ODFA 1DXPA 2AERH 3A7ZA 2M2AA 4FU7A 2VVCA 4GHTA 1N8OB 1O3DA 4JYVH 3SNAA 1K1MA 1WCZA 1DUEA 1WU1A 1MTVA 2V7QD 3A81A 5T6FA 1D3TB 1V2QT 1KIGH 1NBME 2FPZA 1IQIA 1TRMA 1W13U 3TK6A 1P2OA 1K2I1 1DLKB 2WZQA 2HPPH 4X8UH 5DPAA 1C5QA 1P57B 3WWFA 1IOEA 2PGQB 3KN2A 1ANBA 1WDIA 5EPNA 5HM2A 2ZFTA 3W94A 4CH8B 4XSKU 1LO6A 3TITA 1V2KT 2FWWA 4DY7B 3MH5A 1BRAA 1P3EA 3PO1C 2P8OC 5EGMA 1ORFA 2PLXA 1A46H 3PROA 1GHAF 3ATWA 1BB0B 3KNXA 3F2GA 1O32A 1LQDB 3SNCA 4ABFA 1BOQA 1D6RA 2VVVA 5EXMA 1HGTH 1TX6A 1HAVB 4CR9A 1EAIA 1ELVA 4AC9A 1SQAA 3HK6B 1O3BA 4INLA 4YT6H 4INKA 1D4PB 1D3QB 1GHZA 2OUAA 5IDKA 1BIOA 4YZUA 4K60A 1Y5UT 1KY9A 2WPKS 3SW2B 1P2NA 3OYPA 3ESTA 2VGCB 1D3DB 5AHGH 1UVUH 1O3EA 2BQ7B 1TABE 1VKYA 1EPTA 3BTME 3DT0H 1QGFA 1AB9B 1EJMA 1OKXA 1S6LA 1UTPA 5JPMH 2CV3A 3MNCA 1V2UT 5GXPA 4JYTA 1AFQB 2W7UA 3PTNA 5G4BA 1MTSA 4NFEA 4TY7A 1BA8B 4MPUA 1C1WH 1S0RA 3GS9A 4OM9A 1G9IE 1CHOF 1MZAA 4FUCA 2JH5D 3EE0B 2XRCA 2BX4A 1MTNB 1A0JA 1P0SH 4AORA 4OGXA 3Q77A 1E35B 1MTWA 5HIZA 1FLEE 3LH3A 2QE7D 3KYFA 1UHBA 1HB0B 2QA9E 2ZHFH 4U32A 4NWLA 1LHEH 2D26C 1E36B 5L30H 3SU0A 3F1SB 4OGYA 4MLFB 4XE4A 3RXJA 3TJNA 2PW8H 3VB6A 1O2NA 3P17H 4UDWH 1GI0A 1QBNA 2PUQH 2YOLA 3GYLB 1DX5M 3U9AH 5HYOA 2J5UA 3TVJB 1GJ7B 2QF3A 3FOAA 2UUFB 1EPTB 4AYYB 2UWLA 1ZMLA 2GT8A 3SJIA 1AWHB 4K8BA 1THSH 3ZZAA 1GHBG 2BY5X 4ZROA 3BTWE 2D8WA 3Q76A 1W7GH 4WMEA 1ELTA 1FPCH 2BYAX 2P3TB 2XC4A 1P05A 1O33A 4HTCH 4JCNA 1O2UA 1PPCE 3F68H 1EAUA 2QXGA 1XKAC 1TNJA 3MHWU 1WTGH 1TWXB 4CBOA 1FZZA 4NA8A 1Y3VA 1O5FH 1QCPA 2WPMS 4SGBE 1CT2E 1P01A 1MUEB 4GCHG 1XUFA 3NXPA 1SLVB 1ANEA 4BTIB 5K0HA 5LPEA 2QN5T 1GGDB 1HBTH 1FMGA 4WMDA 3FP6E 2OD3B 1P09A 2CN0H 2H9HA 4YOIA 1G32B 2STAE 2HVXA 2V3MA 4Y76A 4NA7A 4IN2A 3N99A 5E2PA 1SGQE 1C5LH 1VJAU 1SG8B 1NPMA 1S6HA 3R3GB 2PFEA 1VITF 2A1DB 2HLCA 1FUJA 2ZG0H 2A45B 4I86A 3U8RH 5T1VA 1XUJA 1BQYA 2PSYA 1QB9A 3LOXA 5TCCA 2NU4E 1S6FA 1ZMNA 2BDGA 5FAHA 2R2MB 4X8TH 5IK2D 4TPYA 4OS6A 1V2TT 2VVUA 2J38A 1P2QA 1SR5C 4AYVB 1AHTH 4JK5A 2WYGA 1BTHH 2BZ6H 4ISHH 1H8HD 5EW2H 1SHYA 4XBBA 1C1SA 3TJVA 1TGTA 4OS5A 1F0TA 1UTLM 4NCYA 1HJAC 1SOTA 1TOCB 6GCHG 2QAAA
chains in the Genus database with same CATH topology
1C4V2 3MU5A 3RDZA 5GJ4B 4CH2B 2VWNA 3GCNA 1OSSA 1C1RA 1TPPA 4B1TA 1K1IA 3BTQE 3GY5A 4JK6A 1SQTA 5AFYH 4X6MA 2H9TH 1O3LA 3FFGA 2SFAA 1WAYB 1C1NA 3TGIE 1H8IH 2F9PA 1F0SA 1BMLA 4D9QA 1SHHB 1XUHA 4KTCA 3RP2A 3MNBA 1FI8A 4Z6AH 2G4UA 1UTMA 1HAVA 1BCUH 5A8XA 2R3YA 5ETXA 3S9BA 1NRPH 4XOJA 1AU8A 3RXLA 4F49A 2H6MA 2ZU3A 3SJKA 3HGPA 1P02A 8ESTE 2EI6A 3UWIA 3URDA 1QRXA 3D65E 1ZSKA 4MPWA 3M7QA 1O2LA 1O5GH 3RM2H 1O38A 1LDTT 2F3CE 3Q3XA 3MNSA 1OXGA 2GTBA 4ABGA 2XYAA 1C2HA 2BLVA 1AVXA 1BTZA 3M3VA 4ESTE 2BVRH 3IG6B 1F5RA 3OTJE 1MQ5A 2BD3A 4BOHA 8GCHF 2FLRH 2J92A 2BY8X 1MMJN 1CSOE 2ZGHA 2ZCKP 3JZ2B 5EW1H 1MTNC 1K21H 3SI3H 1GHVH 5FX5A 5GCHG 3T28A 3FZZA 1E38B 2A4QA 3H7TA 3SNEA 1FV9A 1IQEA 4U30A 4CBNA 3ZVEA 4MNWA 1GJ8B 1A5HA 3SJOA 1O2VA 1OP0A 1BRCE 3V3MA 1HAZB 5JBTA 3HGNA 1JBUH 2FOHA 5K7RA 1XVMA 2FOAA 2TRMA 1A1RA 1C5TA 1T8LA 3RC6A 4XDEA 3P6ZB 4JZEH 1SGYE 3Q00A 1O3AA 1S84A 1YCPK 2AS9A 3MMGA 1O2ZA 2P94A 1GMDF 3SQEE 1W3CA 2BDIA 5C1YA 5FCRA 2Z3CA 1SL3A 4CRFA 2XWBI 2EI7A 2TGTA 3MOCA 3ZVDA 3KL6A 3VB3A 3E6PH 2BY6X 5IYTA 1AVWA 1H9HE 3OX7U 5JDUB 2PV9B 1GMHG 2FEQH 4ZMAH 1CA8B 4FUEA 3ZZ7A 2O9QA 1EASA 1ELEE 2A4GA 1BTUA 2ZHWH 1RJXB 3SJ9A 1NS3A 3LJOA 2GCTC 3UWJH 1ZR0A 3KCGH 1S0QA 1IQMA 3QX5H 1FN8A 1HJ8A 3VFEA 4ZHMU 2ALPA 1BJUA 2WPLS 4UONA 2J4IA 1V2OT 4Y8ZA 1CBWB 3RXFA 3STJA 3LKWA 1C9TA 1D9IA 2NU0E 3LGVA 2TPIZ 2ZTZA 1O2PA 2C8YB 2A7CA 1C2LA 1C5VA 2BLQA 3BEFB 1AI8H 3BTEE 3T5FH 1ETRH 2WV5A 4RKOB 2GDDA 1Y8TA 1BUIA 2ZPSA 1V2PT 1TAWA 4A1XA 1OS8A 1FPHH 2VNTA 1ELDE 2FOCA 5TJXA 3E90B 1NU7B 1O2JA 1T8NA 3F9HA 3GISB 1BMAA 1GBIA 1GMCF 2P3UB 2FOBA 3BTDE 1BBRK 3LPRA 4A1TA 2A32A 1TOMH 5AF9H 1C2DA 4O9VA 2FI3E 8KME2 3PLPA 2ZHQH 4MDSA 2ZFPH 4BAMB 1MAYA 3RXIA 2FX4A 1C1UH 1YYY1 1C2MA 1O3PB 2TGAA 4E7RG 1AB9C 1O36A 4FUGA 2RDLA 1GBMA 4DW2U 1KLJH 2FLBH 1O3NA 2WUCA 2BLOA 3C1KA 2P3FH 2ZPRA 3RXKA 3NCLA 1YCPM 2J2UA 2GVFA 3ATMA 1TGCA 5DK1A 1ELAA 2EA3A 5JBAS 1KSNA 2C3SA 3PMHB 4TWYA 4UD9H 1PPFE 1ZJKA 2BD7A 4MVNA 1HAIH 3RXGA 1CHOG 1O5AB 5A09A 1LQEA 1W14U 2OINA 3A88A 2BLWA 2FYQA 1TRYA 5L2YH 2ZC9H 4YESB 2FO9A 1O5EH 3NKKA 3PMJA 4E05H 1RTLA 4H42U 1LPGB 1HAHH 4NIWA 5F03A 4ZKRU 2Y80A 2OC0A 1DM4B 5EU8A 3GDVA 1YPLH 4FUDA 1L2EA 1YBWA 4UE7H 2TGDA 5JBBS 3U8OH 1O3KA 1A3BH 3HK3B 2FDAA 1A3EH 2BXUH 4CRDA 3FANA 2W7SA 5E0HA 1QL8A 2PKAA 1LMWB 4OS1A 1BZXE 1P03A 3QTOH 1SLXB 1HXEH 2ODYB 3A8BA 4JZIA 3U98H 2Y7ZA 3VGCB 2BZAA 1J9CH 4VGCB 4AZ2B 2VH6A 2Z9JA 4MNVA 4AG2A 2A31A 1G36A 1SOZA 1GI8B 1VCWA 2EI8A 2GV6A 2I6SA 3LU9B 1UK4A 3ITIA 3NK8A 1QBOA 2AGIX 3BG8A 3GDSA 1EZXC 1T4UH 1AKSB 1JOUB 3A85A 1DT2A 3GICB 5GDSH 3RLWH 4HGCA 1NU9A 4ISIH 1GHYH 1Z8JB 3A82A 4GSOA 4MQAA 1OOKB 4Z0KA 3B23B 2HNTE 3UIRA 1EB2A 3LC3A 2G00A 1C4U2 3KEEA 1Q3XA 1DOJA 4O3UA 4AX9H 1QQUA 4Y6DA 2C4FH 1P10A 4X2WA 1MAXA 2BY9X 1J15A 2O8UA 2KAIB 1UTOA 2OBQA 4BXWA 1AY6H 3QGNB 1YPHE 2ODQA 1Z6EA 2P93A 2YNBA 4X8SH 1YM0A 2PKSC 2DE8A 2GCTB 2B7DH 1LPZB 3ZZ6A 1K9OE 5ESTE 1O2OA 1TGSZ 1GI5A 5FBIA 1DPOA 4BTUB 3TJUA 5DG6A 4B2AA 1NM6A 4D8NA 1GBAA 4NIVA 3ZZ5A 1D3PB 2DUCA 4WVPE 2ZDKA 2FOEA 1SGIB 2NWNA 1RD3B 1QRWA 2JETC 1QA0A 1O2SA 2ASUB 3ZZ4A 1L1GA 1HJ9A 4ZKOU 4JZFH 3H5CB 4CRGA 2BX3A 2YNAA 1QIXB 2ZU5A 1FIWA 4MG3A 1QA7A 3A83A 1CT0E 2K1QA 1VGCB 4YT7H 2IN2A 2VB0A 4DCDA 4YM9A 4IMQA 4B71A 1F5LA 3M3SA 4OS4A 3WY8A 4IW4E 3QLPH 1O3HA 4H6TA 4IN1A 1GJDB 2WUBA 3E16B 4UEHH 3ZZBA 1Z8GA 4WMFA 1LHFH 2Y6TA 1QB6A 1MKXK 2CF8H 4LZ1H 5HXFA 2A7HA 2SGFE 1OWEA 3E3TA 4BAOB 1C5YB 1PQ7A 3P70B 1UCYH 2SGPE 3AW0A 4X8VH 1DITH 1NY22 3PTBA 3SI4H 2ZF0H 4YLUA 4Y10E 1C4Y2 1BBRE 2Z7FE 1N6YA 2W3KA 4Y79A 4E7NA 2VWMA 4MPVA 1SGTA 1NC6A 2M5TA 4D7GA 3B8JA 1TGBA 1GG6C 4NIXA 3STIA 3TH3H 1ETTH 3SUEA 1IQFA 2ZHEH 2ZU4A 2G55A 5DP9A 1C1MA 4LK4A 4Q7YA 4Y7AA 4K3JA 1V2WT 3RU4D 4D9RA 2FOMB 1AMHA 2V35A 1DFPA 3M3TA 3F9EA 1TGNA 1AIXH 1W7XH 1EX3A 1MBMA 2V6NA 3M36A 2ZO3H 1AQ7A 3A80A 4ISLA 2QIQA 2F9BH 2GMTB 2GDEH 1O2IA 3D62A 1CT4E 2Z3DA 4O03A 4X1PU 3RC4A 1ZGVA 1ZOMA 1Z7KA 1SGFG 4IC6A 2B9LA 2G5VA 1Z71A 1HAPH 3O8DA 1MBQA 1FY4A 4X1RU 3D49H 5DP4A 4I8JA 1PPZA 5DP3A 3TPIZ 3S0NA 1GHWH 1UVOA 4B75A 1UHBB 2XBXA 1TPSA 1CBWC 2OLGA 2WYJA 2VIQA 4RKJB 1P9UA 1GL0E 1TALA 1C2JA 1GJ5H 7LPRA 3QTVH 4A7IB 4FUHA 3B9FH 1SSXA 5C1XA 3MO3A 1RIWB 3CENA 1XKBC 1E0FD 1FQ3A 4X2VA 1DXWA 5C1UA 1AE5A 1P2KA 1ZPBA 2XWAA 2Q6GA 3T25A 3ZV8A 3BEUA 4LOYH 1EQ9A 3ENSB 2F9VA 1NO9H 1JRTA 3SHCH 3QO6A 1HNEE 1WQVH 5C5NA 3TK5A 3V0XA 3BF6H 1PPEE 1FNIA 3QN7A 3SORA 2OQ5A 1U6QA 4NZLA 2A5IA 4CRCA 1UTNA 1UK2A 5EQQA 1HJAB 3MU1A 3SV6A 3O8CA 2ZKSA 2CMYA 2ILNA 3ATLA 3O8RA 1Y3UA 1TX7A 2F83A 3RXEA 1HLTH 2ZFSA 1GBLA 2H1UA 1L4ZA 3KGPA 5FCKA 2UUKB 5C3NA 3PO1B 2ZZUH 2PTNA 1A7SA 1V3XA 4ZKNU 3SJ8A 2XTTB 1C5WB 4I8GA 1EAXA 1RGQA 2ZQ2A 3SUFA 1HIAB 1HRTH 3MH7A 5FBEA 1YLDA 4WJG2 9LPRA 1ZHMA 3TU7H 1V2LT 1N1LA 1GJAB 4BXSA 1Y5BT 1V2JT 3A84A 1IHTH 1GBKA 3T2NA 1OX1A 2XC5A 4HFPB 2VWLA 1GI9B 1PPGE 3VPKA 4I8KA 1PFXC 3FP7E 3QK1A 2PKAB 3HPTB 5C20A 3ZZ9A 1K22H 1NFXA 3LONA 1GI2A 1ID5H 4IC5A 4ABAA 1UJ1A 2DE9A 4J1YA 2FODA 2TGPZ 1TNGA 1JIMA 4X1QU 1MZDA 1GHBF 1O3GA 3PMBB 6ESTA 5C5OA 1G37A 1NT1A 1CHGA 3VXEH 4AN7A 3SZNA 3EYDA 3LC5A 1DDJA 4OS7A 1OYTH 3DUXH 1C1TA 2C8ZB 4K1SA 1UTKA 2OXSA 3VGCC 4K69A 2G8TA 4FU8A 1DICA 2Q1JA 3T29A 3KQBA 1J14A 3KQEA 1SFIA 1NFYA 3EGKH 2CXVA 3M5NA 1AGJA 5E2OA 2BOHB 4AFZA 1TQ0B 2JETB 2AMQA 1SMFE 1EOJA 2A0QB 5F8TA 5GIBA 3NWUA 2F91A 1WV7H 2FS8A 5FXLA 1SGCA 1DLEA 2RG3A 1P11E 2AEIH 4PROA 3ZVBA 3VB5A 2VIPA 1RFNA 5LH8A 1AZ8A 1OP2A 5HGGA 3JZ1B 2AGGX 1P04A 4WXIA 1O5DH 4B74A 5JB9S 1GJ4H 1SGFA 4FUBA 1O2KA 3KIDU 1YPGH 2AGEX 1H1BA 9ESTA 2GT7A 3L6PA 4RSPA 3RXPA 1TLDA 1A5IA 3TJOA 1YLCA 2RA3A 1J16A 4DVAU 1JIRA 3RXQA 1WUNH 2BDAA 3PB1E 2CJIA 1QRZA 4GPGA 2WV4A 1GJCB 1INCA 1OYQA 5J4SA 1Y59T 1UK3A 2FOGA 1WYKA 2BD9A 1GMHF 2FI5E 4A1VA 5H4IB 3ZVGA 4DG4A 2A5AA 1TYNA 1EPTC 1KXAA 5DKMA 1C2EA 3N7OA 1PQAA 3MO9A 4H6SB 5LPFA 4CHAC 4X0WU 3TLOA 1UVPA 1P06A 5DJ7A 7GCHF 5FX6A 2HPQH 2AMPA 1GJ6A 3A8DA 1PYTC 1QB1A 1SBWA 3C27B 5EXLA 3ZZDA 3EAJA 1HXFH 3P8NA 1TBZH 3M7UA 1P9SA 5DP6A 4ZXXH 5ABWA 1ZJDA 1O3MA 4BAKB 2F9NA 5EQSA 1CU1A 3TNTA 1GVZA 5F8ZA 4AB8A 3URCA 1TRNA 3ZYDA 5GCHF 3P8GA 1IQKA 1LVBA 3IITA 1NRQH 2ZTYA 3RXVA 1GGDC 5JYIA 1ZPCA 3NPSA 1LKAA 3R0FA 4K8YA 3RXRA 1W10U 1OWHA 1QQ4A 3RXHA 5GWZA 2RA0A 1HAYB 3RXBA 1SLWB 2R2WU 4X6PA 1PPBH 4ABBA 1DWDH 2BDCA 2G52A 2GP9B 4K5ZA 1N6XA 3RU4E 1SI5H 4CR5A 4Y7BA 1ETSH 1Z1IA 4GAWA 3EA7A 2ZDMA 3T62A 5T3HA 4FUFA 1K1JA 4AOQA 1C9PA 2OC1A 3DD2H 1SFQB 5DO4H 1QURH 2Z3EA 2Q6DA 1Q2WA 1HYLA 3F6UH 2SGEE 2ZFRH 8LPRA 4F4OC 1F0UA 1S83A 1YPJH 4U01A 1C1VH 1X7AC 2AYWA 1E34B 2QXJA 3A8CA 1BBRH 1O3IA 2GZ7A 1GBJA 2ZWLH 3UNSA 2PSXA 4A5TS 1BTWA 3S7HB 1HUTH 1LKBA 1W12U 1Z1JA 2FTMA 3ZZCA 1BMNH 4R0IA 3MI4A 2BD4A 1Z6JH 2D1JA 1BHXB 1QJ1B 2BHGA 3ZVFA 1SVPA 2HALA 2TIOA 3T26A 1DWEH 1MU8B 1C5OH 2FESH 1QBVH 1CQQA 4A92A 3EA9A 1VITH 1MCVA 5LPRA 1ZSLA 4ZKSU 2ZNKH 1NRSH 1OWKA 1SPJA 3TK9A 6CHAB 1GDQA 2PTCE 2XC0A 1TFXA 2ODPA 4WF8A 4Q80A 4NG9H 2F9UA 2I6QA 3PV4A 3D23A 1IQNA 1CE5A 5DP5A 1P2MA 1Y3WA 3MYWA 1NROH 1V2RT 1ZRBA 1CA0B 5DP7A 1B0EA 3RXOA 1GI4A 2GZ9A 1AUTC 2JH6D 1O3OA 1QL9A 1FIZA 3A8AA 1PYTD 3SV2H 3M35A 1NN6A 2LNCA 3UR9A 3SU2A 1O31A 3SBKA 2RCEA 1ZHPA 1TMTH 2OC8A 1TX8A 1NESE 4I8LA 1KXDA 3SU6A 3V13A 5CHAB 1BHXF 4AB9A 1HV7A 2FMJA 2J95A 5A8ZA 4OS2A 4NIYA 1TBQH 2P8OB 1KTSB 3PWCA 4ZAEA 1EATA 5I25A 3MWIU 1LCYA 1TNIA 2O8TA 3AAUA 1MU6B 4KP0A 2Y81A 3ZYEA 3BG4C 2NU3E 2G51A 3F9FA 1XMNB 4X1SU 1C2GA 1ZGIA 1EUFA 1P3CA 2ZDLA 3MU8A 4DIHH 1EAWA 2BM2A 4MNXA 1FY3A 1NRRH 4B2BA 1DUAA 2VIOA 2PWXA 2ZDNA 2ZGCA 2ZFFH 3TNSA 3BTHE 1OWIA 1MKWH 2GV7A 3UR6A 4GUXA 1FY8E 5HM9A 2BY7X 3FZDA 1GI6A 3DFLA 1AZZA 3A86A 1O3CA 3QGJA 2HGTH 2FOFA 1GDUA 1ESAA 1C5SA 4JMYA 2UUYA 1O2YA 5I46H 2BDYA 4Y71A 1J17T 3SUDA 4E06H 1PQ8A 2ZGJA 5C2ZA 4K2YA 2SGAA 5GPIB 1KYNA 2R9PA 2P16A 3RMLH 3ZV9A 1P2IA 1QY6A 2W5EA 2UWPA 1IQJA 1FN6A 2J94A 4NSVA 1WBGB 3PWBA 1O2RA 4TY6A 3SU5A 1O2HA 1ZTKA