3MH5A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
254
structure length
191
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTTKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGYENFIQTDAAINRGNSGGALVNLNGELIGINTAIIGFAIPSNMVKNLTSQMVEYGQVKRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease do
total genus 43
structure length 191
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A01
1ZSLA 3GISB 2BDYA 1W13U 1ELGA 1Z8JB 3LONA 3Q00A 3SU1A 3CENA 4ZROA 1C1NA 3EQ0H 3TK6A 4A92A 2B0FA 4GVUA 1LKBA 1ZJDA 3QGJA 4GPGA 1JRTA 2HNTC 1O5AB 2BD5A 1EP5A 4XBBA 3BSQA 3ATLA 1O3MA 2ZI2H 3M3VA 3M5LA 4TPIZ 1DUEA 3BTEE 1RJXB 3A89A 1OXGA 2FI4E 1GBCA 4KGAA 1BMNH 2VIDA 3DD2H 1NRPH 2Z9LA 3HGNA 3P92A 4GLYA 4PROA 5AFZH 1SGQE 1P2KA 1MQ5A 1TIOA 1TPAE 3NK8A 4IN2A 4J2YB 1E37B 1O5FH 4MPWA 3G01A 3LH1A 4X8SH 3ELAH 2KAIA 2Z7FE 1GBMA 1N6XA 1MKWK 1WSSH 2ZFQH 1BB0B 2J2UA 1NU9A 5FBIA 2J95A 3KQBA 1A0HB 1OP8A 1XUHA 3FANA 4IS5A 5LPRA 4BOHA 1YKTA 1FPHH 3ESTA 3V13A 1ZTJA 4IC6A 1P05A 1Y3WA 3BV9B 3GYMA 3QN7A 1TE0A 1EZSC 8ESTE 1GPZA 1BHXF 4YOJA 3K2UA 1GG6C 1GHWH 4TWWA 1GHBF 1CA0B 2Q6DA 1CVWH 2JETB 3DHKH 2ZU4A 5GDSH 3SBKA 1EATA 3GCTF 4AFQA 1GHXH 1QQ4A 3MHWU 1O32A 9LPRA 1P3CA 4THNH 2BD8A 1EAXA 4GUXA 1IQFA 1SGCA 1DVAH 1BBRK 1O3AA 2B8OH 5TCAA 1GJ6A 3TLOA 1O5GH 5GIBA 5C1UA 5DP3A 1ANEA 4I8LA 3VGCC 2XC0A 1D6RA 1N8OC 1H4WA 1D3TB 3SNDA 5IYTA 3KL6A 5FAHA 1V2UT 3HK6B 2HVXA 3GDUA 4NIYA 2SGDE 4AN7A 4K2YA 4ISNA 1NROH 4OS4A 2A4OA 4E7RG 2WPHS 2ZU2A 1MBQA 1LHDH 4MPVA 5BRRE 2AIQA 2OQ5A 3PWBA 5GPIB 1TRMA 1SB1H 5CHAC 4Q7XA 5SGAE 2JH0D 5DP7A 4MPXA 2PWXA 1XKBC 2VWMA 5F03A 1BTXA 3LIWA 4I8GA 1EB1H 1TGSZ 5EG4A 2J9NA 1VCWA 3LGIA 2B5TB 4XFQA 1A4WH 1V2OT 5JB9S 1O3IA 4ABEA 1S6HA 1W10U 3MWIU 2J34A 2O8WA 1SGNE 2VINA 3VB6A 2WPLS 3MO9A 2NU3E 1TNIA 1HPGA 2GDDA 1AB9C 1MZDA 1Q2WA 2F3CE 4UD9H 2GKVE 1ZOMA 4NZLA 4INLA 2ZGBH 3P8FA 3PTBA 2WUBA 1QBNA 2GCHF 3MU4A 2Z9IA 3QLPH 4B2CA 3M3SA 1K1NA 1UTMA 2BOKA 3GCTG 5G4BA 2XW9A 3RXBA 1FLEE 3T29A 1AGJA 1BITA 1C5XB 1MTNC 4VGCB 5I25A 3MFJA 3MI4A 1K1JA 2Z9KA 5C67A 4DIIH 4FUCA 4Q2KA 1O2MA 1VITH 2VVVA 4QT8C 5E0GA 3ZZ3A 5F8TA 1L1JA 1FY5A 1SBWA 2FP7B 1AU8A 2QV1A 1V2VT 2H9TH 3SV6A 3O8RA 3AVZA 1P12E 1TA6A 3SUGA 3U8TH 2QCYA 2O8MA 3ZZ9A 1HYLA 4AB9A 4FUGA 4Y7BA 3VB4A 1J16A 1C1MA 1O2WA 1YPHC 2XWAA 4MLFB 3PTNA 4A1XA 2TGTA 2OINA 3T27A 1SHYA 2G4UA 3NUMA 3V12A 3SO3A 1P2OA 3HPTB 4CRBA 1JIMA 1C5UA 1DUAA 1PQ7A 1BBRE 4H4FA 3U9AH 3UOUA 3AAVA 1RD3B 3V0XA 1TPSA 3TK9A 1UHBA 2AS9A 1MD7A 3GYLB 1KXCA 1O2YA 5C1YA 2G5NA 4OS1A 4U30A 3IITA 2ANMH 2ZCKP 3ATKA 2Z94A 3SU0A 1IQJA 3SI3H 1HJAB 1O35A 2STAE 1BDAA 2PUXB 1EJNA 2BD3A 1Y3VA 1E0FD 1GJ8B 1FXYA 2CJIA 4GCHG 1SQAA 1C5QA 1GI7B 3ZVGA 4Q7YA 1TA2A 1UMAH 4ABJA 1GHBG 3BEIB 5A09A 1FNIA 4MQAA 2GT8A 1EKBB 2C4FH 2SNVA 2OTVA 2GV7A 1ELEE 4UONA 2FI5E 2A7JA 1OWEA 4AYYB 1TBRH 3MNSA 3PMBB 4MVNA 1C1WH 2ZCHP 4ZHAA 3SJ9A 1WBGB 1BTUA 4WXIA 5EW1H 5JPMH 4O97A 3S69A 3SNBA 3LJOA 1EX3A 1TX8A 4FU7A 1G3EA 2FOMB 1GG6B 1IQKA 2Y80A 6LPRA 1NFYA 2BLVA 4JMYA 7GCHG 1KXEA 1SGDE 3QGNB 1BHXB 4BNRA 1ZHPA 4JZDH 3RC5A 3RLWH 3AASA 1S84A 4RSPA 4A1TA 2P94A 3SV8A 6CHAB 1PQAA 1C1QA 1TGBA 3RXGA 3SI4H 1O2JA 4BANB 2A45B 2A5AA 2ZPRA 2JKHA 2P93A 4CRCA 2WPMS 1O38A 2Y5FA 2PR3A 4NWLA 1PPFE 3UNRA 3S7HB 3BIUH 4UFFH 5EXNA 4D8NA 2KAIB 2ZHEH 3QX5H 3QO6A 1JMOH 5C5NA 4CH2B 3E3TA 1T4UH 4MNVA 1A5IA 1JBUH 1W7GH 1LVBA 1ZSKA 1KDQB 1GBTA 1SLUB 1XVOA 3RXSA 1S0QA 1C5PA 4CRGA 3OTJE 3TH2H 5CHAB 2FOGA 4ZHLU 4OS7A 1C4Y2 1G3DA 1XVMA 2PKSB 2RA0A 3ZVAA 5F6MA 5HGGA 3ZZDA 1YLCA 2QXJA 5DP4A 4BAKB 2TPIZ 1AFQB 1SGEE 3UPEA 3QZQA 2ZFFH 1OWJA 1GI9B 1DPOA 1RTLA 4Q80A 4AZ2B 2UWLA 3MO6A 1P11E 2D8WA 1BRAA 1GGDC 3F68H 2ZDKA 2FIRH 3ATIA 2BMGB 1B0FA 1C5RA 3P8NA 1HIAA 3U1IB 1TGCA 1K22H 9ESTA 3ENSB 1O5BB 1AHTH 1MAYA 2CMYA 2ODPA 3A7TA 3D65E 4B76A 1Y3UA 5AVDA 2IJOB 2BB4A 3UWIA 1NPMA 7GCHF 1ZPZA 3QDZB 1L1GA 2GCTB 1Z8GA 7KMEH 1D6WA 3KGPA 3UTUH 3SORA 1CBWC 3M5NA 2C3SA 3SNAA 1EAIA 3N7OA 2PUQH 1ETTH 1O2UA 1ZSJA 2G5VA 3M3TA 4YOGA 3HGPA 3SV2H 1IQMA 2WPJS 4NWKA 3ZVFA 4E7NA 4WY3A 3MTYA 2H1UA 2ZGCA 1GI5A 1AMHA 2ZECA 1AZZA 1DWBH 3SHAH 2BY9X 2I6SA 3EAJA 2CV3A 3H7TA 1K9OE 1N1LA 4NFFA 1GBAA 2RA3A 1CQQA 1QRXA 1P06A 4AG2A 2SNWA 2VGCC 1V2KT 1TONA 4CRAA 2D2DA 1KSNA 2ODQA 4E05H 5JYIA 3UREA 1HV7A 3IG6B 1YPMH 1XXDA 1TGNA 1CGHA 4SGAE 1D3PB 1UTOA 3NXPA 4B1TA 1Y5AT 1A7SA 1C5NH 2ZDVH 1YM0A 5BPEA 5E2PA 2WYGA 2LNCA 4UFDH 3BIVH 4I8HA 1L4DA 2NWNA 1DWEH 4D9RA 1C2FA 2P16A 2BY7X 2QXGA 1ELCA 1WQVH 3OYPA 1CT2E 1W0YH 2O8LA 1UCYE 3BG4C 3FP6E 4OGXA 4CREA 1EP6A 4UDWH 3LC3A 2XWBI 3O8BA 2XBXA 1GL1A 2BM2A 2ZFRH 3Q3XA 1FI8A 2GCTC 5A8ZA 2FOBA 3QK1A 4FUFA 3ZZAA 3M7QA 1ELBA 1SL3A 1JIRA 1IQEA 1MTWA 3F6UH 4B2BA 1RTKA 1YCPH 3LGWA 1J17T 1OSSA 3LT3A 2UUFB 1HAYB 2ZTXA 4R0IA 1K1IA 5HYOA 1YCPM 2PKAA 3NWUA 1QFKH 3P6ZB 1TQ0B 4OS5A 1VGCB 1FY8E 3DT0H 2QXHA 4CHAB 1IQNA 1O33A 2FI3E 5A8YA 3T25A 1GHAF 1W2KH 2CN0H 1NZQH 4BTIB 4CBOA 1SQOA 4Y0ZE 5FX6A 2ZGJA 4YOIA 2O8TA 3C27B 3RXTA 5LGOA 2CHAC 1XUJA 4DGJA 2BHGA 1D3DB 4H6SB 4CRDA 1O3CA 1MTVA 3RC4A 1J14A 1CO7E 1C5MD 3ZVDA 2FX4A 4YM9A 1WTGH 2P3FH 2ZDAH 5F8ZA 4FVDA 2PTNA 4K8BA 3T5FH 1TX7A 2FOHA 2FS8A 2J94A 1CSOE 4Y8XA 4GHQA 1P2IA 2GVFA 1ZRKA 1ZGVA 1K1MA 1AUTC 3RXLA 5AHGH 2OD3B 3M5OA 5L6NH 2BVXH 4ZKOU 3RXDA 1GVKB 4D7GA 1LTOA 2V35A 1IQGA 2OC7A 1KXBA 2ZGXH 2Y7ZA 1GJCB 4Z6AH 3P8OA 2JH5D 5GJ4B 3TIUA 1KXFA 1SSXA 1F2SE 2FYRA 1UTLM 4J1YA 1DWCH 3B23B 2FPZA 2F91A 3EA7A 2ZHDA 4NSYA 4Y8YA 1GWAA 5CMXH 2BY5X 3SJIA 2BDAA 5E2OA 5AF9H 1LO6A 1V2JT 3A84A 2R2WU 3FZDA 3Q3KA 4TY6A 2BY8X 1V2PT 2Z9JA 4DT7B 1GCDA 3SNCA 2HNTE 5LPFA 4R8TB 1BQYA 2ZPQA 1HXEH 1Q3XA 4D9QA 1C5TA 2A32A 3OU0A 2ZQ2A 1UTNA 3TITA 1ZZZA 2BQ6B 1TOMH 3BN9A 4GCHF 1P2JA 2WINI 1HFDA 1G30B 1LPGB 1EPTC 1BCUH 4ZKNU 4YLQH 1FAXA 1TAWA 3RXHA 3O8CA 3A83A 2TGPZ 2A7CA 1LMWB 1O0DH 1Y59T 1J15A 1GL0E 3VXFH 4H6TA 1VITG 3M35A 1HAVA 3MMGA 2W26A 1O3HA 1FIZA 2W3KA 4K1SA 3RXCA 1DLKB 3ZZ5A 5J4QA 4IN1A 1CA0C 2BOHB 4LZ4B 1CU1A 1S83A 3PYHA 4FUHA 4NIWA 2CGAA 3RXFA 4KELA 5E8EH 1O2TA 1THPB 1LPZB 1HJ8A 2C90B 2V6NA 3SGQE 3SU2A 3VXEH 3R0FA 1UK3A 3K6ZA 1BMMH 3ZZBA 1QURH 2HGTH 1HRTH 3A7ZA 2C8XB 5A0AE 1CHGA 1GBIA 1IAUA 1EZQA 2QYIA 3ZV8A 1GCTB 1KIGH 1O3JA 2GD4B 1Z7KA 2AERH 1OWHA 2R3UA 4X1NU 1C5ZB 1ABIH 4DOQA 3A86A 1OS8A 1QJ6B 2Y5GA 1GGDB 2STBE 2QF3A 2FO9A 2THFB 2GDEH 3SJOA 2W7UA 1HJ9A 2D1JA 1EZXC 2VIOA 3MH5A 1HBTH 2YNAA 1QJ7B 1Y3XA 1ANCA 5T6FA 3HKIB 4FXGH 1P10A 2VU8E 1QL7A 5JDUB 2H6MA 5HMAA 1E36B 2G8TA 3FP7E 1MUEB 2GMTC 1UVSH 1YGCH 1BA8B 3EDXB 1TNHA 1BIOA 1YCPK 2SFAA 3LGYA 1EJAA 1P2QA 4FUDA 4RKOB 5CE1A 1QY6A 3B8JA 1ORFA 2ZNKH 4X6PA 4ZXXH 1GMHF 2J92A 2YNBA 1VZQH 3F9GA 1JWTA 4A7IB 3V3MA 1D3QB 1ABJH 1QJ1B 5E0HA 3LOXA 2ZU5A 4X2XA 4CRFA 1YPJH 3D62A 1QGFA 4Y11E 3URDA 1GJBB 4H42U 1P03A 4NZQA 3MYWA 1C2JA 2UUYA 3RXUA 3E0PB 2PHBA 2JETC 2I6QA 1V2RT 2FTLE 2Y82A 4MNYA 1TWXB 4FUJA 4U01A 4K3JA 4X6MA 3PLKA 4X1PU 4TY7A 3UIRA 1T7CA 2ZFSA 2ZU1A 3PMHB 3A8DA 2H5DA 5T6GA 3ZYEA 1GBHA 1O2IA 1SOZA 3P8GA 5DKMA 2ALPA 1SLVB 3QTOH 3TVJB 1TMBH 4WMDA 4XE4A 1BUIA 1DT2A 4ISLA 5TCCA 1C9PA 2UUKB 1NFUA 1VJAU 1F92A 1C5WB 1CT4E 5EU8A 1C2LA 3GCHB 2BLOA 2BXTH 4B2AA 4FUIA 1GBKA 4DCDA 4AB8A 2ULLA 2VH0A 3RXAA 1L2EA 1YPHE 3ZZCA 2G51A 1IQHA 3H7OA 2XBWA 2H2ZA 3RXPA 3DA9B 4DW2U 1TYNA 4GAWA 2CF8H 1GJ9B 4YLUA 3T2NA 3BTKE 1LVOA 2FLRH 2W7SA 3CP7A 1T8MA 4NIXA 3A82A 4OS2A 3GOVB 5AFYH 2Q6GA 3TPIZ 3E6PH 1GI1A 1GMHG 2VIPA 4MDSA 3KCGH 3SNEA 4K5ZA 4JZFH 3MU8A 3OY6U 2WUCA 1TMTH 1GHVH 3UY9A 4X0WU 1UVOA 3MH4A 3OX7U 1O30A 2G55A 4HZHA 2VIQA 1O5CB 1TNJA 1PFXC 1V2QT 1ZR0A 2XYAA 3A7VA 2WPKS 4ZUHA 2VIVA 4K8YA 2P59A 1SGFG 2FESH 1G36A 1SOTA 2ASUB 1Y5UT 1T31A 1WTHD 4BTUB 1DE7H 1GBFA 5C20A 4FUBA 4F4OC 3TGKE 2AH4X 1UK2A 1A0LA 2SGQE 3UWJH 1X7AC 1H9LB 1FAKH 2QA9E 1GMCF 1PQ5A 1T32A 3RP2A 3KQEA 4NCYA 1GMDF 5EPNA 1IOEA 1B5GH 1ZPCA 4I8KA 3RXQA 6GCHG 1GJAB 1DY8A 4Z0KA 4YT7H 1AZ8A 3NCLA 2HOBA 1QA7A 2WV5A 1QR3E 4LK4A 3TJVA 1V2WT 1NRQH 1MKXH 2XBVA 4FVBA 1OWKA 1SLWB 2ZHFH 1C1UH 2AIPA 4AORA 1OWIA 3KEEA 8LPRA 3BEUA 4KTUA 4ZXYH 5JB8S 1O39A 1EB2A 3T62A 2BVRH 1CGIE 1HAVB 3A85A 1YPGH 3P17H 2HALA 3BTWE 1ELVA 3GY7A 3RLYH 1W11U 3KQDA 1AVWA 4O3UA 1CT0E 3UR6A 3UR9A 5IDKA 2Z6BD 3ZYDA 1NY22 3UOPA 5DP6A 3JZ1B 4WXVA 3NKKA 8GCHG 4YT6H 1A46H 3A8CA 5E0JA 1C2KA 1OKXA 3S9CA 3NZIA 2HNTF 1GBJA 1MU8B 4FU8A 1FY1A 1UTJA 1SGTA 3O8DA 1Z6EA 1FDPA 1TB6H 1C2GA 1AFEH 1W14U 5A8XA 1P09A 5GCHF 1D4PB 4B75A 4JYVH 5FBEA 4M7GA 1NESE 3EA8A 4D7FA 1FQ3A 1HUTH 2GGVB 5EGMA 3M37A 2GX4A 3E91A 5F8XA 1BBRH 1MD8A 2XRCA 3I77A 4NA7A 3URCA 1G2LA 1LQEA 3U8OH 2FOCA 1P02A 1C1TA 3DUXH 2BD9A 2AMQA 2K1QA 2Z3EA 1RFNA 5LH8A 3A81A 3RMMH 5C1XA 4RN6A 1OYTH 2A2XH 1NRNH 1KLTA 3RXOA 4X2YA 3EA9A 4GHTA 3RXEA 1UCYH 1O37A 1C5VA 2Z3CA 2TRMA 2ZWLH 1P9UA 1GI0A 1ZHRA 2ZFTA 2FYQA 3F9FA 1MU6B 3D23A 1O3DA 3GY8A 2RCEA 5DP8A 4XSKU 3SV7A 4CBNA 4A6LA 1HGTH 1OP2A 1V3XA 1ZTKA 2TGAA 2ZCLP 1GDNA 4XDEA 1TRYA 2Y81A 2NU0E 1ELFA 1OYQA 1IQIA 4WWYA 2IPHA 3RXKA 4ABAA 2AFQB 3P95A 4ABHA 1B7XB 2PV9B 4AG1A 4WH8A 1E38B 1FN6A 4JZIA 1SG8B 4B73A 1ZLRA 4WJG2 5FCRA 1SC8U 2BZAA 2HRVA 2YOLA 1UK4A 4AGJA 1MCVA 1UVTH 8GCHF 5HXFA 4B71A 1TNLA 1SMFE 1QRWA 2Z3DA 3U1JB 1GVZA 2VVUA 1DX5M 1AVGH 3TNSA 4DURA 2M5TA 4IMZA 2G81E 1QB9A 1XUFA 3ZZ6A 1NM6A 2J4IA 1GJ7B 2OBOA 2UWPA 2GZ7A 2BLQA 1L0ZA 1AWHB 3PWCA 1DITH 1GMCG 1HAGE 1O3EA 5B6OA 1O2HA 4UEHH 1H1BA 4CH8B 3TJUA 1BZXE 2F9PA 1C4V2 4OS6A 3E90B 2ZO3H 3UQVA 4IBLH 3T26A 4ABGA 1O2GH 1YBWA 1GBLA 2GZ8A 3OSYA 1WOFA 2P3TB 3TH3H 4E06H 4TYDA 1DM4B 1AN1E 3A87A 1AO5A 2FOFA 2C93B 3L6PA 3RXRA 1CE5A 1JOUB 1BTZA 1ANDA 2WPIS 3A7WA 3VEQB 2VIWA 5FPYA 3TK5A 3IWMA 2ZGHA 2FTMA 2AYWA 2TGDA 1V2LT 1LHGH 1RTFB 1VCPA 1MTUA 8KME2 2ILNA 1EOJA 2VH6A 4X8TH 1MTSA 1RXPA 2SGEE 2OC1A 1CA8B 3SQHE 2DUCA 3LU9B 5DGJA 1EQ9A 1RRKA 1BTPA 1NN6A 3OY5U 3BTFE 1WU1A 4IW4E 3PM3A 3JZ2B 2VNTA 2AGGX 2GP9B 2C8YB 1S5SA 2OP9A 3GY3A 1W0ZU 1QB6A 3L3TA 1PPHE 3ZV9A 1FJSA 3BG4B 1P04A 1BMLA 3PO1C 4X1SU 2SGPE 4IC5A 1W12U 1SGFA 2FLBH 1J8AA 2ZHWH 1AIXH 1ESTA 3M61U 2OC0A 4DIHH 1G32B 2XNIA 1MTNB 2BQWB 4VGCC 4ASHA 1PPCE 2AMDA 3KIDU 2XC5A 1PPEE 1GVLA 3VB5A 4MG3A 5L30H 4K69A 3RU4T 3ITIA 3VPKA 4JYUH 1GJDB 3HATH 4ZHMU 1INCA 5T6DA 1O2SA 1YP9A 1FIWA 4HI3A 1Y8TA 1ID5H 3MH7A 3VGCB 4IMQA 4YESB 1SGIB 2FZZA 1AD8H 1BMAA 4BXSA 2IOTA 2BD2A 1RIWC 2OCVB 1GHZA 1C5YB 2F83A 1ZHMA 1T8LA 2ZDNA 1ETRH 1BTHH 2ZTZA 3STJA 1C2DA 1P2NA 3QTVH 1SLXB 5ETXA 1AI8H 3C1KA 5L2ZH 1ZGIA 1WCZA 4AYVB 4HGCA 5EQQA 2LPRA 1G37A 1HCGA 2FOEA 1VR1H 2GT7A 3K6YA 3Q76A 1O3BA 3SJKA 2FWWA 1SI5H 4NGAH 1S85A 1RGQA 1KXAA 1HB0B 1KTTB 1S6FA 1P0SH 1E35B 2A0QB 4I33A 3U98H 5C3NA 3BTGE 5JBBS 4CR9A 4INHA 2O9QA 4A1VA 1XUKA 1YPEH 5DK1A 1O31A 3TNTA 2QIQA 3A80A 2ZFPH 1A5GH 2UWOA 4WH6A 2PSXA 2W5EA 3NPSA 4BAQB 4TPYA 5EW2H 1GJ5H 3SU3A 1BTYA 4YTAA 1SPJA 1TALA 1BJVA 1DY9A 3MNBA 5EODA 1O2VA 1THRH 2BY6X 1HLTH 2R0KA 2DE9A 1F5LA 1Z8IB 2OBQA 1NRSH 2BLWA 1IHTH 2P8OB 3TGIE 3RU4E 3BTHE 1ESAA 3GY5A 2QGRA 1A3EH 1SFIA 2OLGA 5FHTA 3T28A 1GMDG 2QN5T 1PYTD 1C1VH 1P57B 3ODFA 1O2PA 3BG8A 2EI7A 1P01A 1MZAA 2GTBA 1FUJA 4X6OA 3I29A 1W8BH 1YYY1 1KY9A 4I32A 1O5EH 1XX9A 2BD7A 4BAOB 1RIWB 1V2NT 2BXUH 1QBOA 3TJNA 3BEFB 3KF2A 1LVYA 1ELTA 1GBDA 1BOQA 2V0BA 2HPQH 1LVMA 1GDUA 1ESBA 3SGAE 2RDLA 1P9SA 2DE8A 3H5CB 1BRBE 3E0NB 5C2ZA 1YPLH 2G4TA 1EUFA 2Q1JA 2ZF0H 4NG9H 1E34B 2F9UA 2C8ZB 2A4GA 1FY3A 1O34A 3E1XB 3SZNA 4WVPE 3M7UA 3ZZ7A 4SGBE 1DOJA 4ABIA 1GI2A 2VWNA 1XUGA 1IQLA 5ESTE 1NTPA 3RU4D 3RXJA 4ZAEA 5GXPA 3TGJE 4AX9H 1GHYH 1LPKB 3FZZA 4X6NA 3DFLA 1T4VH 2R9PA 2H9EH 1BRUP 1THSH 2G00A 4XBCA 3MNCA 1TX6A 5GCHG 5DPAA 5EPYA 1SR5C 5LPEA 1U6QA 3D49H 1A0JA 1ARBA 2AGIX 4BXWA 4LOYH 1L1NA 3PB1E 1QL8A 1YPKH 1F0RA 4K1TA 2R3YA 3K65B 5JBCS 1HNEE 2HWLB 3TH4H 2PW8H 2ZTYA 1YF4A 2XBYA 1XMNB 4MNWA 4TWYA 4GSOA 5J4SA 3E16B 3GY6A 1P3EA 1O2ZA 2VWOA 1O3NA 2QF0A 3AW0A 4WF8A 1O36A 1WYKA 1O2KA 1TABE 2FXRA 1L4ZA 1HAPH 1NU7B 2ZG0H 4Y7AA 1ZMJA 1Z1JA 1MCTA 1Q31A 3BF6H 2Y5HA 1M9UA 2F9BH 2BZ6H 3B9FH 1K21H 2W3IA 1LHFH 7ESTE 3CS7A 3SV9A 1JRSA 3TU7H 3Q77A 2CF9H 4WMFA 1C1SA 4ISIH 3LDXH 4ZKSU 1YC0A 1C5OH 2ZU3A 1AFQC 4KKDA 2IN2A 1DLEA 2GCHG 2PGQB 2PKSC 1VITF 3LPRA 4IGDA 5EOKA 1IHSH 1KYNA 2EC9H 3MU1A 3HKJB 1O2NA 3SJ8A 1ELAA 1A2CH 1Z71A 1FY4A 1DICA 2ZDMA 4O9VA 4Y0YE 3SW2B 4NA8A 1HAZB 3FVFB 1PPZA 2ZIQH 1KDQA 1MBMA 3EE0B 1C1OA 2EI8A 1TRNA 2FODA 4HFPB 4LZ1H 1H8DH 4X8UH 3M5MA 3Q3YA 3VB3A 3WY8A 1MKXK 4NSVA 1TQ7B 2ZDLA 3BTTE 1HAIH 2ALVA 2ZPSA 1QCPA 1V2ST 1K1OA 3A7YA 1QRZA 4JCNA 1PPBH 3AAUA 2OUAA 1QIXB 4Y8ZA 1EZUC 1Y5BT 1O3OA 3UNQA 2QAAA 1MMJN 2JH6D 1ETSH 1QNJA 4DG4A 2PSYA 3TJOA 1AWFH 5H4IB 1GI3A 1O2LA 1TPOA 1PYTC 2CXVA 2QXIA 2FEQH 2QC2A 1DANH 1C2MA 1NO9H 4AOQA 3ZZ4A 4NA9H 4ZKRU 2XCNA 2XTTB 3UFAA 5A0BA 3S9BA 5DJ7A 4X1RU 2OQUA 2F9VA 1BJUA 1UVPA 2EEKA 1SQTA 1HXFH 2FMJA 3KQCA 3SU4A 1F0TA 2EA3A 3RMOH 3RMLH 1PJPA 1F5RA 3LGVA 4NIVA 5K0HA 1S82A 3SUEA 5A0CA 4LXBH 1T8OA 4JK6A 1MQ6A 1KLIH 4F49A 1GCTC 3RMNH 2ZZUH 1TNKA 3HK3B 3GY4A 1H8IH 1AE8H 3RM2H 1C2EA 2BTCE 2P3UB 2BQ7B 1CHOF 1Z8RA 3LJJA 3SOSA 3MOCA 1GI8B 5C5OA 4ZH8A 1ELDE 4MTBA 7LPRA 1ZMNA 4YZUA 2XXLA 3L33A 4Q7ZA 1AUJA 5EQSA 4UE7H 4BAMB 3EYDA 1LHCH 1QBVH 2BVSH 4Y76A 3UQOA 3W95A 2ZA5A 1QA0A 4Y6DA 1TMUH 3PROA 2G52A 5GWZA 1SGYE 3PMJA 4KP0A 3ZZ8A 4ZMAH 5FPSA 4X1QU 1EASA 1SGPE 3A88A 2ANKH 4A5TS 1GBEA 2ESTE 2C8WB 3A8BA 3SU5A 4U32A 1TPPA 1NRRH 2V3HH 2ZQ1A 1HAXB 5EXLA 3ATMA 1V2TT 1AE5A 2O8UA 3EGKH 1DWDH 1HIAB 4K60A 2Y7XA 4ABBA 1MAXA 2FM2A 4Y71A 1EAUA 1EPTA 2PFEA 4KTCA 1PQ8A 2CHAB 2R2MB 2WV4A 1C5SA 3FP8E 1OWDA 3GCOA 1WV7H 1O3LA 1EOLA 3SHCH 3RDZA 1UCYK 1A1RA 1K1PA 1Z1IA 2R0LA 3S9AA 1DXWA 2A7HA 3K9XB 4ESTE 1DSUA 2ZKSA 4INKA 4ISOA 1ZYOA 3GICB 3GDSA 3PMAB 1TBZH 1K28D 4AGKA 1XUIA 3KN2A 2ZHQH 6GCHF 1SGRE 2A4QA 2Q6FA 3SUDA 4XBDA 1C1PA 1A3BH 2PLXA 3GY2A 2AGEX 4CHAC 4XOJA 5ESBA 2TBSA 1O2XA 4X2VA 1VCQA 2PGBB 1H9IE 1O5DH 3UUZA 2A5IA 3CS0A 1ZPBA 1SVPA 2HLCA 3GCHC 2HPPH 2QY0B 3BTDE 4FU9A 3PV4A 5TJXA 2BD4A 2PTCE 2J38A 1O2QA 2TIOA 2NU1E 3ZVCA 2BDBA 3S7KB 1TGTA 3MO3A 1BT7A 2ZEBA 1UVUH 4BAHB 3M7TA 2B7DH 3RXIA 3PO1B 3A8AA 1RS0A 3I78A 1BTWA 5PTPA 3V7TA 1D9IA 1BRCE 2BDCA 2H9HA 5HM2A 1S0RA 1NFWA 1FV9A 5DO4H 1F7ZA 1CBWB 2BYAX 1A5HA 1HJAC 2WYJA 1UHBB 1DSTA 3A7XA 2A5KA 1LCYA 3BTME 4UFGH 1HAOH 1GHAG 4I31A 4JYTA 3RC6A 1C9TA 3STIA 4BTTB 2VJ1A 3BTQE 2AMPA 4WMEA 3E8LA 1YLDA 3KNXA 1Y3YA 2FX6A 1GDQA 1OX1A 1AY6H 2UUJB 3ZVBA 3MNXA 1GBBA 1GI4A 1WUNH 1ARCA 1O3KA 4O3TA 1VJ9U 2ANWA 1TLDA 4OGYA 3R3GB 4ABFA 4K1EA 1MKWH 4MNXA 2EI6A 1AQ7A 1XXFA 1F0UA 1O2OA 2A4RA 4MPUA 3RM0H 4JZEH 4Y79A 5T3HA 1PPGE 1ZMLA 1V6DA 4D76A 2P8OC 3QZRA 1P8VC 1C2HA 1T8NA 3MU0A 1ZJKA 3VB7A 1O3PB 2ODYB 2SGAA 2BX3A 3W94A 5DG6A 1C5LH 4UFEH 5DP5A 4ISHH 2GZ9A 5A2MH 4I7YH 2BDGA 3RXVA 2BX4A 1SFQB 1W3CA 2A2QH 4NFEA 2BDIA 4AFZA 5FXLA 1ACBE 1UTPA 1G3BA 1OOKB 1UJ1A 3SUFA 1W7XH 3RXMA 5FX5A 1CHOG 1EXFA 1HDTH 1LQDB 5JBTA 1C2IA 4I8JA 1FPCH 3LGTA 3SN8A 6ESTA 2A1DB 4KTSA 1F5KU 3LH3A 3GCNA 2GV6A 1CGJE 2OC8A 2P95A 5FCKA 3SQEE 1F0SA 1LDTT 1ZRBA 3ZVEA 6CHAC 1XKAC 1KTSB 4AFUA 1AVXA 2BDHA 1DS2E 5JBAS 1N6YA 2ZC9H 1MH0A 3LGUA 1J9CH 2D26C 3M36A 1LHEH 1NC6A 3GDVA 4CR5A 4YO9A 3F1SB 3U8RH 4FUEA 1ZTLA 2NU4E 1WQSA 1GJ4H 1UTQA 2H5CA 1FZZA 3UNSA 2XCFA 4O03A 1DXPA 5K7RA 2ZP0H 1NFXA 1WAYB 1FN8A 1O3FA 1UO6A 2OXSA 2VVCA 1OPHB 3DFJA 5L2YH 3FFGA 1G3CA 1O3GA 4HTCH 1K2I1 1ANBA 4RKJB 2ANYA 3MH6A 5I46H 3QUMP 4X8VH 1C1RA 4JK5A 2VGCB 1AB9B 1N8OB 1QTFA 1SHHB 1A61H 3QWCH 2F9NA 2FDAA 3SU6A 1VGCC 2Y6TA 4DVAU 1FONA 3VFEA 2RG3A 4AFSA 1AKSA 3P70B 2VWLA 1H9HE 1EJMA 2SGFE 1TFXA 1OP0A 3ODDA 1TNGA 1V2MT 3LC5A 1KXDA 4DY7B 3FAOA 1EPTB 1B0EA 1O2RA 2FS9A 1C4U2 2Z9GA 1EAWA 1QB1A 5ABWA 1UTKA 2AEIH 2V3OH 2XC4A 1P2MA 1Z6JH 4Y10E 1NT1A 3ATWA 1QHRB 3F9EA 3S0NA 1HAHH 2GMTB 5HM9A 4X2WA 5EXMA 1TOCB 3KHVA 2A31A 2B9LA 3PLBA 4ABDA 4U2WA 4B74A 1TBQH 4JZ1A 2NU2E 3SGBE 2PKAB 1K1LA 1KLJH 3MU5A 3F9HA 1G2MA 1NS3A 2FOAA 1S81A 1GI6A 1LKAA 1G9IE 5EQRA 3PLPA 1QQUA 1JXPA 4DJZB 3RUOA 1FMGA 1DFPA 3U69H 5DP9A 5FPTA 3LKWA 2F9OA 1DDJA 1QL9A 2VB0A 3AW1A 1XM1A 1AKSB
chains in the Genus database with same CATH superfamily
1ZSLA 3GISB 2BDYA 1W13U 1ELGA 1Z8JB 3LONA 3Q00A 3SU1A 3CENA 4ZROA 1C1NA 3F2FA 3EQ0H 3TK6A 4A92A 2B0FA 4GVUA 1LKBA 1ZJDA 3QGJA 4GPGA 1JRTA 2HNTC 1O5AB 2BD5A 1EP5A 4XBBA 3BSQA 3ATLA 1O3MA 2ZI2H 3M3VA 3M5LA 4TPIZ 1DUEA 3BTEE 1RJXB 3A89A 1OXGA 2FI4E 1GBCA 4KGAA 1BMNH 2VIDA 3DD2H 1NRPH 2Z9LA 3HGNA 3P92A 4GLYA 4PROA 5AFZH 1SGQE 1P2KA 1MQ5A 1TIOA 1TPAE 3NK8A 4IN2A 4J2YB 1E37B 1O5FH 4MPWA 3G01A 3LH1A 4X8SH 3MQKC 3ELAH 2KAIA 2Z7FE 1GBMA 1N6XA 1MKWK 1WSSH 2ZFQH 1BB0B 2J2UA 1NU9A 5FBIA 2J95A 3KQBA 1A0HB 1OP8A 1XUHA 3FANA 4IS5A 5LPRA 4BOHA 1YKTA 1FPHH 3ESTA 3V13A 1ZTJA 4IC6A 1P05A 1Y3WA 3BV9B 3GYMA 3QN7A 1TE0A 1EZSC 8ESTE 1GPZA 1BHXF 4YOJA 3K2UA 1GG6C 1GHWH 4TWWA 1GHBF 1CA0B 2Q6DA 1CVWH 2JETB 3DHKH 2ZU4A 5GDSH 3SBKA 1EATA 3GCTF 4AFQA 1GHXH 1QQ4A 3MHWU 1O32A 9LPRA 1P3CA 4THNH 2BD8A 1EAXA 4GUXA 1IQFA 1SGCA 1DVAH 1BBRK 1O3AA 2B8OH 4RI0A 5TCAA 1GJ6A 3TLOA 1O5GH 5GIBA 5C1UA 5DP3A 1ANEA 4I8LA 3VGCC 2XC0A 1D6RA 1N8OC 1H4WA 1D3TB 3SNDA 5IYTA 3KL6A 5FAHA 1V2UT 2F4LA 3HK6B 2HVXA 3GDUA 4NIYA 2SGDE 4AN7A 4K2YA 4ISNA 1NROH 4OS4A 2A4OA 4E7RG 2WPHS 2ZU2A 1MBQA 1LHDH 4MPVA 5BRRE 2AIQA 2OQ5A 3PWBA 5GPIB 4AC9A 1TRMA 1SB1H 5CHAC 4Q7XA 5SGAE 2JH0D 5DP7A 4MPXA 2PWXA 1XKBC 2VWMA 5F03A 1BTXA 3LIWA 4I8GA 1EB1H 1TGSZ 5EG4A 2J9NA 1VCWA 3LGIA 2B5TB 4XFQA 1A4WH 1V2OT 5JB9S 1O3IA 4ABEA 1S6HA 1W10U 3MWIU 2J34A 2O8WA 1SGNE 2VINA 3VB6A 2WPLS 3MO9A 2NU3E 1TNIA 1HPGA 2GDDA 1AB9C 1MZDA 1Q2WA 2F3CE 4UD9H 2GKVE 2YMSB 1ZOMA 4NZLA 4INLA 2ZGBH 3P8FA 3PTBA 2WUBA 1QBNA 2GCHF 3MU4A 2Z9IA 3QLPH 4B2CA 3M3SA 3DSOA 1K1NA 1UTMA 2BOKA 3GCTG 5G4BA 2XW9A 3RXBA 1FLEE 3T29A 1AGJA 2YMSD 1BITA 1C5XB 1MTNC 3GS9A 4VGCB 5I25A 3MFJA 3MI4A 1K1JA 2Z9KA 5C67A 4DIIH 4FUCA 4Q2KA 1O2MA 1VITH 2VVVA 4QT8C 5E0GA 3ZZ3A 5F8TA 1L1JA 1FY5A 1SBWA 2FP7B 1AU8A 2QV1A 1V2VT 2H9TH 5HKKD 3SV6A 3O8RA 3AVZA 1P12E 3AK5A 1TA6A 3SUGA 3U8TH 2QCYA 2O8MA 3ZZ9A 1HYLA 4AB9A 4FUGA 3F0OA 4Y7BA 3VB4A 1J16A 1C1MA 1O2WA 1YPHC 2XWAA 4MLFB 3PTNA 4A1XA 2TGTA 2OINA 3T27A 1SHYA 2G4UA 3NUMA 3V12A 3SO3A 1P2OA 3HPTB 4CRBA 1JIMA 1C5UA 1DUAA 1PQ7A 1BBRE 4H4FA 3U9AH 3UOUA 3AAVA 1RD3B 3V0XA 1TPSA 3TK9A 1UHBA 2AS9A 3PV2A 1MD7A 3GYLB 2HVYB 2J98A 1KXCA 1O2YA 5C1YA 2G5NA 4OS1A 4U30A 3IITA 2ANMH 2ZCKP 3ATKA 2Z94A 3SU0A 1IQJA 3SI3H 1HJAB 1O35A 2STAE 1BDAA 2PUXB 1EJNA 2BD3A 1Y3VA 1E0FD 3KYFA 1GJ8B 1FXYA 2CJIA 4GCHG 1SQAA 1C5QA 1GI7B 3ZVGA 4Q7YA 1TA2A 1UMAH 4ABJA 1GHBG 2J5UA 3BEIB 5A09A 1FNIA 2XOKD 4MQAA 2GT8A 1EKBB 4ACAA 2C4FH 2SNVA 2OTVA 2GV7A 1ELEE 4UONA 2FI5E 2A7JA 1OWEA 4AYYB 1TBRH 3MNSA 3PMBB 4MVNA 1C1WH 2ZCHP 4ZHAA 3SJ9A 1WBGB 1BTUA 4WXIA 3UB0A 5EW1H 5JPMH 4O97A 3S69A 3SNBA 3LJOA 1EX3A 1TX8A 4FU7A 1G3EA 2KCOA 5C94A 2FOMB 1GG6B 1IQKA 2Y80A 6LPRA 1NFYA 2BLVA 4JMYA 7GCHG 3SZEA 1KXEA 1SGDE 3QGNB 1BHXB 4BNRA 1ZHPA 2V7QD 4JZDH 3RC5A 3RLWH 3AASA 1S84A 4RSPA 3F3BA 4A1TA 2P94A 3SV8A 6CHAB 1PQAA 1C1QA 1TGBA 3RXGA 3SI4H 1O2JA 4BANB 2A45B 2A5AA 2ZPRA 2JKHA 2P93A 4CRCA 2WPMS 1O38A 2Y5FA 2PR3A 4NWLA 1PPFE 3UNRA 3S7HB 3BIUH 4UFFH 5EXNA 4D8NA 2KAIB 4FOUC 2ZHEH 3QX5H 3QO6A 1JMOH 5C5NA 5KECA 4CH2B 3E3TA 1T4UH 4MNVA 1A5IA 1JBUH 1W7GH 1LVBA 1ZSKA 1KDQB 1GBTA 1SLUB 1XVOA 3RXSA 1S0QA 1C5PA 4CRGA 3OTJE 3TH2H 5CHAB 2FOGA 4ZHLU 4OS7A 1C4Y2 1G3DA 1XVMA 2PKSB 2RA0A 3ZVAA 5F6MA 5HGGA 3ZZDA 1YLCA 5CDFE 2QXJA 5DP4A 4BAKB 2TPIZ 1AFQB 4RT1A 1SGEE 3UPEA 3QZQA 2ZFFH 1OWJA 1GI9B 1DPOA 1RTLA 4Q80A 4AZ2B 2UWLA 3MO6A 1P11E 2D8WA 1BRAA 2IPQX 1GGDC 2ZDKA 3F68H 2FIRH 3ATIA 1MABB 2BMGB 1B0FA 1C5RA 3P8NA 1HIAA 3U1IB 1TGCA 1K22H 9ESTA 3ENSB 1O5BB 2KCPA 1AHTH 1MAYA 2CMYA 2ODPA 3A7TA 3D65E 4B76A 1Y3UA 5AVDA 2IJOB 2BB4A 3UWIA 1NPMA 7GCHF 1ZPZA 3QDZB 1L1GA 2GCTB 1Z8GA 4XRNA 7KMEH 5B6LA 1D6WA 3KGPA 3UTUH 3SORA 1CBWC 3M5NA 2C3SA 3SNAA 1EAIA 3N7OA 2PUQH 1ETTH 1O2UA 1ZSJA 2G5VA 3M3TA 4YOGA 3HGPA 3SV2H 1IQMA 2WPJS 1COWD 4NWKA 3ZVFA 4E7NA 4WY3A 3MTYA 2H1UA 2ZGCA 1GI5A 1AMHA 2ZECA 1AZZA 1DWBH 3SHAH 2BY9X 2I6SA 3EAJA 2CV3A 3H7TA 1K9OE 1N1LA 4NFFA 1GBAA 2RA3A 1CQQA 1QRXA 1P06A 4AG2A 2SNWA 2VGCC 1V2KT 1TONA 4CRAA 2D2DA 1KSNA 2ODQA 4E05H 5JYIA 3UREA 1HV7A 3IG6B 1YPMH 1XXDA 1TGNA 1CGHA 4SGAE 1D3PB 1UTOA 3NXPA 4B1TA 4YXWD 1Y5AT 1A7SA 1C5NH 2ZDVH 1YM0A 5BPEA 2HLDD 5E2PA 2WYGA 2LNCA 4UFDH 3BIVH 4I8HA 1L4DA 2NWNA 2K8IA 1DWEH 4D9RA 1C2FA 2P16A 2BY7X 2QXGA 1ELCA 1WQVH 3OYPA 4ASUD 1CT2E 1W0YH 1H8HD 2O8LA 1UCYE 3BG4C 3FP6E 4OGXA 4CREA 1EP6A 4UDWH 3LC3A 2XWBI 3O8BA 2XBXA 1GL1A 2BM2A 2ZFRH 3Q3XA 1FI8A 2GCTC 5A8ZA 3OEED 2FOBA 3QK1A 4FUFA 3ZZAA 3M7QA 1ELBA 4P02A 1SL3A 1JIRA 1IQEA 1MTWA 3F6UH 4B2BA 1RTKA 1YCPH 3LGWA 1J17T 1OSSA 3LT3A 2UUFB 1HAYB 2ZTXA 4R0IA 1K1IA 5HYOA 1YCPM 2PKAA 3NWUA 1QFKH 3P6ZB 1TQ0B 4OS5A 1VGCB 1FY8E 3DT0H 1H8ED 2QXHA 4CHAB 1IQNA 1O33A 2FI3E 5A8YA 3T25A 1GHAF 1W2KH 2CN0H 3OAAD 1NZQH 4Q4LA 4BTIB 4CBOA 1SQOA 4Y0ZE 5FX6A 2ZGJA 4YOIA 2O8TA 3C27B 4M9FA 3RXTA 5LGOA 2CHAC 1XUJA 4DGJA 2BHGA 1D3DB 4H6SB 5C0TA 4CRDA 1O3CA 1MTVA 3RC4A 1J14A 1CO7E 1C5MD 4P00A 3ZVDA 2FX4A 1SQRA 4YM9A 1WTGH 2P3FH 2ZDAH 5F8ZA 4FVDA 2PTNA 4K8BA 3T5FH 1TX7A 2FOHA 2FS8A 2J94A 1CSOE 4Y8XA 4GHQA 1P2IA 2GVFA 1ZRKA 1ZGVA 1K1MA 1AUTC 3RXLA 3DSGA 5AHGH 2OD3B 3M5OA 5L6NH 2BVXH 4ZKOU 3RXDA 1GVKB 4D7GA 1LTOA 2V35A 1IQGA 2OC7A 1KXBA 3UAIC 2ZGXH 2Y7ZA 2K0QA 1GJCB 4Z6AH 3P8OA 2JH5D 5GJ4B 3TIUA 5IK2D 1KXFA 1SSXA 1F2SE 2FYRA 1UTLM 4J1YA 1DWCH 3B23B 2FPZA 1E79D 2F91A 3EA7A 2ZHDA 4NSYA 4Y8YA 1GWAA 5CMXH 2BY5X 3SJIA 2BDAA 5E2OA 5AF9H 1LO6A 1V2JT 3A84A 2R2WU 3FZDA 3Q3KA 4TY6A 2BY8X 1V2PT 2QE7D 2Z9JA 4DT7B 1GCDA 3SNCA 2HNTE 5LPFA 4R8TB 1BQYA 2ZPQA 1HXEH 1Q3XA 4D9QA 1C5TA 2A32A 3OU0A 2ZQ2A 1UTNA 3TITA 1ZZZA 2BQ6B 1TOMH 3BN9A 4GCHF 1P2JA 2WINI 2RDEA 1HFDA 1G30B 1LPGB 1EPTC 1BCUH 4ZKNU 4YLQH 1FAXA 1TAWA 3RXHA 5EIYA 5KGOA 3O8CA 3A83A 2TGPZ 2A7CA 1LMWB 1O0DH 1Y59T 1J15A 1GL0E 3VXFH 4H6TA 1VITG 3M35A 1HAVA 3MMGA 2W26A 1O3HA 1FIZA 2W3KA 4K1SA 3RXCA 1DLKB 3ZZ5A 5J4QA 4IN1A 1CA0C 2BOHB 4LZ4B 1CU1A 1S83A 3PYHA 4FUHA 4NIWA 2CGAA 3RXFA 4KELA 5E8EH 1O2TA 1THPB 1LPZB 1HJ8A 2C90B 2V6NA 3SGQE 3SU2A 3VXEH 1UW7A 1UK3A 3R0FA 3K6ZA 1BMMH 3ZZBA 1QURH 2HGTH 1HRTH 3A7ZA 2C8XB 5A0AE 1CHGA 1GBIA 1IAUA 1EZQA 2QYIA 3ZV8A 4FETA 1GCTB 1KIGH 1O3JA 2GD4B 1Z7KA 2AERH 1OWHA 2R3UA 4X1NU 1C5ZB 1ABIH 4DOQA 3A86A 1OS8A 1QJ6B 2Y5GA 1GGDB 2STBE 2QF3A 2FO9A 2THFB 2GDEH 3SJOA 2W7UA 1HJ9A 2D1JA 1EZXC 2VIOA 3MH5A 1HBTH 2YNAA 1QJ7B 1Y3XA 1ANCA 5T6FA 3HKIB 4FXGH 1P10A 2VU8E 1QL7A 5JDUB 2H6MA 5HMAA 1E36B 1QZ8A 2G8TA 3FP7E 1MUEB 2GMTC 1UVSH 1YGCH 1BA8B 3EDXB 1TNHA 1BIOA 2AHME 1YCPK 2SFAA 3LGYA 1EJAA 1P2QA 4FUDA 4RKOB 5CE1A 1QY6A 3B8JA 1ORFA 2ZNKH 4X6PA 4ZXXH 1GMHF 2J92A 2YNBA 1VZQH 3F9GA 3FN8A 1JWTA 4A7IB 5HIYA 3V3MA 1D3QB 1ABJH 1QJ1B 5E0HA 3LOXA 3F0PA 2ZU5A 4X2XA 3OEHD 4CRFA 1YPJH 3D62A 4OM9A 1QGFA 4Y11E 3URDA 1GJBB 4H42U 1P03A 4NZQA 4I86A 3MYWA 1C2JA 2UUYA 3RXUA 3E0PB 2PHBA 2JETC 2I6QA 1V2RT 2FTLE 2Y82A 4MNYA 1TWXB 4FUJA 4U01A 4K3JA 4X6MA 3PLKA 4X1PU 4TY7A 3UIRA 1T7CA 2ZFSA 2ZU1A 3PMHB 3A8DA 2H5DA 5T6GA 3ZYEA 1GBHA 1O2IA 1SOZA 3P8GA 5DKMA 2ALPA 1SLVB 3QTOH 3TVJB 1TMBH 4WMDA 4XE4A 1BUIA 1DT2A 4ISLA 5TCCA 1C9PA 2UUKB 1NFUA 1VJAU 1F92A 1C5WB 1CT4E 5EU8A 1C2LA 3GCHB 2BLOA 2BXTH 4B2AA 4FUIA 2JJ2D 1GBKA 4DCDA 4AB8A 2ULLA 2VH0A 3RXAA 1L2EA 1YPHE 3ZZCA 2G51A 1IQHA 3H7OA 2XBWA 2H2ZA 5EJ1A 3RXPA 3DA9B 4DW2U 4HG6A 1TYNA 4GAWA 2CF8H 1GJ9B 4YLUA 1W0KD 3T2NA 3BTKE 1LVOA 2FLRH 2W7SA 3CP7A 1T8MA 4NIXA 3A82A 4OS2A 3GOVB 5AFYH 2Q6GA 3TPIZ 2RFKC 3E6PH 1GI1A 1GMHG 2VIPA 4MDSA 3KCGH 3SNEA 4K5ZA 4JZFH 3MU8A 3OY6U 2WUCA 2F43B 1TMTH 1GHVH 3UY9A 4X0WU 1UVOA 3MH4A 3OX7U 1O30A 2G55A 4HZHA 2VIQA 1O5CB 1TNJA 1PFXC 1V2QT 1ZR0A 2XYAA 3A7VA 2WPKS 4ZUHA 2VIVA 4K8YA 2P59A 1SGFG 2FESH 1G36A 1SOTA 2ASUB 1Y5UT 1T31A 1WTHD 4BTUB 1DE7H 5F53A 1GBFA 5C20A 4FUBA 4F4OC 3TGKE 2AH4X 1YY3A 1UK2A 1A0LA 2SGQE 2KCYA 3UWJH 1X7AC 1H9LB 1FAKH 2QA9E 1GMCF 1PQ5A 1T32A 3RP2A 3KQEA 1WXRA 4NCYA 1GMDF 5EPNA 1IOEA 1B5GH 1ZPCA 4I8KA 3RXQA 6GCHG 1GJAB 1DY8A 4Z0KA 4YT7H 1AZ8A 1S6LA 2HOBA 3NCLA 1QA7A 2WV5A 1QR3E 2WV9A 4LK4A 3TJVA 1V2WT 1NRQH 1MKXH 2XBVA 4FVBA 1OWKA 1SLWB 2ZHFH 1C1UH 5KEDA 2AIPA 4AORA 1OWIA 3KEEA 8LPRA 3BEUA 4KTUA 4ZXYH 5JB8S 1O39A 2WSSD 1EB2A 3T62A 2BVRH 1CGIE 1HAVB 3A85A 1YPGH 3P17H 2HALA 2YMSC 3BTWE 1ELVA 3GY7A 3RLYH 1W11U 3KQDA 1AVWA 4O3UA 1CT0E 3UR6A 3UR9A 5IDKA 2Z6BD 3ZYDA 1NY22 3UOPA 5DP6A 3JZ1B 4WXVA 3NKKA 8GCHG 4YT6H 1A46H 3A8CA 5E0JA 1C2KA 1OKXA 3S9CA 3NZIA 2HNTF 1GBJA 1MU8B 4FU8A 1FY1A 1UTJA 1SGTA 3O8DA 1Z6EA 1FDPA 1TB6H 1C2GA 1AFEH 1W14U 5A8XA 1P09A 5GCHF 1D4PB 4B75A 4JYVH 5FBEA 4M7GA 2JJ1D 1NESE 3EA8A 4F55A 4D7FA 1FQ3A 1HUTH 2GGVB 5EGMA 3M37A 2QF5A 2GX4A 3E91A 5F8XA 1BBRH 1MD8A 2XRCA 3I77A 4NA7A 3URCA 1G2LA 1LQEA 3U8OH 2FOCA 1P02A 1C1TA 3DUXH 2BD9A 2AMQA 2K1QA 2Z3EA 1RFNA 5LH8A 3A81A 3RMMH 5C1XA 4RN6A 1OYTH 2A2XH 1NRNH 1KLTA 5HIZA 4B6FA 3RXOA 4X2YA 3EA9A 4GHTA 3RXEA 1UCYH 1O37A 1C5VA 2Z3CA 2TRMA 2ZWLH 1P9UA 1GI0A 1ZHRA 2V3MA 2ZFTA 2FYQA 3F9FA 2PP6A 1MU6B 3D23A 1O3DA 3GY8A 2RCEA 5DP8A 4XSKU 3SV7A 4CBNA 4A6LA 1HGTH 1OP2A 1V3XA 1ZTKA 2TGAA 2ZCLP 1GDNA 3SYJA 4XDEA 1TRYA 2Y81A 2NU0E 1ELFA 1OYQA 1IQIA 4WWYA 2IPHA 3RXKA 2KCAA 4ABAA 2AFQB 3P95A 4ABHA 1B7XB 2PV9B 4AG1A 4WH8A 1E38B 1FN6A 1WDIA 4JZIA 1SG8B 4B73A 1ZLRA 4WJG2 5FCRA 1SC8U 2BZAA 2HRVA 2YOLA 1UK4A 4AGJA 1MCVA 1UVTH 8GCHF 5HXFA 4B71A 1TNLA 1SMFE 1QRWA 2Z3DA 3U1JB 1GVZA 2VVUA 1DX5M 1AVGH 3TNSA 3NRLA 4DURA 2M5TA 4IMZA 2G81E 1QB9A 1XUFA 3ZZ6A 3DSPA 1NM6A 2J4IA 1GJ7B 2OBOA 2UWPA 2GZ7A 2BLQA 1L0ZA 2KZ4A 1AWHB 3PWCA 1DITH 1GMCG 1HAGE 1KMHB 1O3EA 5B6OA 1O2HA 4UEHH 1H1BA 4CH8B 3TJUA 1BZXE 2F9PA 1C4V2 4OS6A 3E90B 2ZO3H 3UQVA 4IBLH 3T26A 4ABGA 1O2GH 1YBWA 1GBLA 2GZ8A 3OE7D 3OSYA 1WOFA 2P3TB 3TH3H 4E06H 4TYDA 1DM4B 1AN1E 3A87A 1AO5A 2FOFA 2C93B 3L6PA 3RXRA 1CE5A 1JOUB 1BTZA 1ANDA 2WPIS 3W1EA 3A7WA 3VEQB 2VIWA 5FPYA 3TK5A 3IWMA 2ZGHA 2FTMA 2AYWA 2TGDA 1V2LT 1LHGH 1RTFB 1VCPA 1MTUA 8KME2 2ILNA 1EOJA 2VH6A 2W6JD 4X8TH 1MTSA 1RXPA 2SGEE 2OC1A 1CA8B 3SQHE 2DUCA 2JIZD 3LU9B 5DGJA 1EQ9A 1RRKA 1BTPA 1NN6A 3OY5U 3BTFE 1WU1A 4IW4E 3PM3A 3JZ2B 2VNTA 2AGGX 2GP9B 2C8YB 1S5SA 2OP9A 3GY3A 1W0ZU 1QB6A 3L3TA 1PPHE 2LP6A 3ZV9A 1YLNA 1FJSA 3BG4B 1P04A 1BMLA 3PO1C 4X1SU 2SGPE 4IC5A 1W12U 1SGFA 2FLBH 1J8AA 2ZHWH 1AIXH 1ESTA 3M61U 2OC0A 4DIHH 1G32B 1MTNB 2BQWB 2XNIA 4VGCC 2WHXA 4ASHA 1PPCE 2AMDA 4XD7D 3KIDU 2XC5A 3FKSD 1PPEE 1GVLA 3VB5A 4MG3A 3WWBA 5L30H 4K69A 3RU4T 3ITIA 4RT0A 3VPKA 5DSFA 4JYUH 1GJDB 3HATH 4ZHMU 1INCA 5T6DA 1O2SA 1YP9A 1FIWA 4HI3A 1Y8TA 4Q63A 1ID5H 3MH7A 3VGCB 4IMQA 4YESB 2L74A 1SGIB 2FZZA 1AD8H 1BMAA 4BXSA 2IOTA 2BD2A 1RIWC 2OCVB 1GHZA 1C5YB 2F83A 1ZHMA 1T8LA 2ZDNA 1ETRH 1BTHH 3CNRA 2ZTZA 4Z1MD 3STJA 1C2DA 1P2NA 4TSFD 3PRBA 3QTVH 1SLXB 5ETXA 1AI8H 3C1KA 5L2ZH 1ZGIA 1WCZA 4AYVB 4HGCA 5EQQA 2LPRA 1G37A 1HCGA 2FOEA 1VR1H 2GT7A 3K6YA 3Q76A 1O3BA 3SJKA 2FWWA 1SI5H 4NGAH 1S85A 1RGQA 1KXAA 1HB0B 1KTTB 1S6FA 1P0SH 1E35B 2A0QB 4I33A 3U98H 5C3NA 2CK3D 3BTGE 5JBBS 4CR9A 4INHA 2O9QA 4A1VA 1XUKA 1YPEH 5DK1A 1O31A 3TNTA 2QIQA 3A80A 2ZFPH 1A5GH 2UWOA 4WH6A 2PSXA 2W5EA 3NPSA 4BAQB 4TPYA 5EW2H 1GJ5H 1EFRD 3SU3A 1BTYA 4YTAA 1SPJA 1TALA 1BJVA 5DN6D 1DY9A 3MNBA 5EODA 1O2VA 1THRH 2BY6X 1HLTH 2R0KA 2DE9A 1F5LA 1Z8IB 2OBQA 1NRSH 2BLWA 1IHTH 2P8OB 3TGIE 3RU4E 3BTHE 5EJLA 1ESAA 3GY5A 2QGRA 1A3EH 1SFIA 2OLGA 5FHTA 3T28A 1GMDG 2QN5T 1PYTD 1C1VH 1P57B 3ODFA 1O2PA 3BG8A 2EI7A 1P01A 1MZAA 2GTBA 1FUJA 4X6OA 3I29A 1W8BH 1YYY1 1KY9A 4I32A 1O5EH 1XX9A 2BD7A 3N7EA 4BAOB 1RIWB 1V2NT 2KX4A 2BXUH 1QBOA 3TJNA 3BEFB 3KF2A 1LVYA 1ELTA 1GBDA 1BOQA 2V0BA 2HPQH 1LVMA 1GDUA 1ESBA 3SGAE 2RDLA 1P9SA 3WW7A 2DE8A 3H5CB 1BRBE 3E0NB 5C2ZA 1YPLH 4DT4A 2G4TA 1EUFA 2Q1JA 2ZF0H 4NG9H 1E34B 2F9UA 2C8ZB 2A4GA 1FY3A 1O34A 3E1XB 3SZNA 4WVPE 3M7UA 3ZZ7A 4SGBE 1DOJA 4ABIA 1GI2A 2VWNA 1XUGA 1IQLA 2L6OA 1NTPA 5ESTE 3RU4D 4ZAEA 3RXJA 5GXPA 4AX9H 1GHYH 3TGJE 3F2HA 1LPKB 3FZZA 4X6NA 3DFLA 1T4VH 2R9PA 2H9EH 1BRUP 1THSH 2G00A 4XBCA 3MNCA 1TX6A 5GCHG 5DPAA 5EPYA 3PV5A 1SR5C 5LPEA 1U6QA 3D49H 1A0JA 1ARBA 2AGIX 4BXWA 2LELA 4LOYH 1L1NA 3PB1E 1QL8A 1YPKH 1F0RA 4K1TA 2R3YA 3K65B 5JBCS 1HNEE 2HWLB 3TH4H 2PW8H 2ZTYA 1YF4A 2XBYA 1XMNB 2XNDD 4MNWA 4GSOA 4TWYA 3E16B 3GY6A 1P3EA 1O2ZA 5J4SA 2VWOA 1O3NA 2QF0A 3AW0A 4WF8A 1O36A 1WYKA 1O2KA 1TABE 2FXRA 1L4ZA 1HAPH 1NU7B 2ZG0H 3N99A 1ZMJA 4Y7AA 1Z1JA 1MCTA 1Q31A 3BF6H 2Y5HA 1M9UA 2F9BH 2BZ6H 3B9FH 1K21H 2W3IA 1LHFH 7ESTE 3CS7A 3SV9A 1JRSA 3TU7H 3Q77A 2CF9H 4WMFA 1C1SA 4ISIH 3LDXH 4ZKSU 1YC0A 1C5OH 2ZU3A 1AFQC 4KKDA 2IN2A 1DLEA 2GCHG 2PGQB 2PKSC 1VITF 3LPRA 4IGDA 5EOKA 1IHSH 1KYNA 2EC9H 3MU1A 3HKJB 1O2NA 3SJ8A 1ELAA 1A2CH 1Z71A 1FY4A 1DICA 2ZDMA 4O9VA 4Y0YE 3SW2B 4NA8A 1HAZB 3FVFB 1PPZA 2ZIQH 1KDQA 1MBMA 3EE0B 1C1OA 2EI8A 1TRNA 2FODA 4HFPB 4LZ1H 5GNDA 1H8DH 1W0JD 3KYGA 4X8UH 3M5MA 3Q3YA 3VB3A 3WY8A 2QF4A 1MKXK 4NSVA 1TQ7B 2ZDLA 3BTTE 1HAIH 2ALVA 2ZPSA 1QCPA 1V2ST 1K1OA 3A7YA 3U28C 1QRZA 4JCNA 1PPBH 3AAUA 2OUAA 1QIXB 4Y8ZA 1EZUC 1Y5BT 1O3OA 3UNQA 2QAAA 1MMJN 2JH6D 1ETSH 1QNJA 4DG4A 2PSYA 3TJOA 1AWFH 5H4IB 1GI3A 1O2LA 1TPOA 1PYTC 2CXVA 2QXIA 2KR7A 2FEQH 2QC2A 1DANH 1C2MA 1NO9H 4AOQA 3FOAA 3ZZ4A 4NA9H 4ZKRU 2XCNA 2XTTB 3UFAA 5A0BA 3S9BA 5DJ7A 4X1RU 2OQUA 2F9VA 1BJUA 1UVPA 2EEKA 1SQTA 1HXFH 2FMJA 3KQCA 3SU4A 1F0TA 2EA3A 3F2GA 2JDID 3RMOH 1PJPA 1F5RA 3LGVA 4NIVA 3RMLH 5C17A 5K0HA 1S82A 3SUEA 1YWUA 4LXBH 1T8OA 5A0CA 1E1RD 4JK6A 1MQ6A 1KLIH 4F49A 1GCTC 3RMNH 2ZZUH 1TNKA 3HK3B 3GY4A 1H8IH 1AE8H 3RM2H 1C2EA 2BTCE 2P3UB 2BQ7B 1CHOF 1Z8RA 3LJJA 3SOSA 3MOCA 1GI8B 5C5OA 4ZH8A 1ELDE 4MTBA 7LPRA 1ZMNA 4YZUA 2XXLA 3L33A 4Q7ZA 1AUJA 1SKYE 5EQSA 4UE7H 4BAMB 3EYDA 1LHCH 1QBVH 2BVSH 4Y76A 3UQOA 3W95A 2ZA5A 1QA0A 4Y6DA 1TMUH 3PROA 2G52A 5GWZA 1SGYE 3PMJA 3N7DA 4KP0A 3ZZ8A 4ZMAH 5FPSA 4X1QU 1EASA 1SGPE 3A88A 2WZQA 5T1VA 4ACBA 2ANKH 4A5TS 1NBME 1GBEA 2ESTE 3EE7A 2C8WB 3A8BA 3SU5A 2KM0A 4U32A 3ZIAD 3KQ5A 1TPPA 1NRRH 2V3HH 2ZQ1A 1HAXB 5EXLA 1BMFD 3ATMA 1V2TT 1AE5A 2O8UA 3EGKH 1DWDH 1HIAB 4K60A 2Y7XA 4ABBA 1MAXA 2FM2A 4Y71A 1EAUA 1EPTA 2PFEA 4KTCA 1PQ8A 2CHAB 2R2MB 2WV4A 1C5SA 3FP8E 4F48B 1OWDA 3GCOA 1WV7H 1O3LA 1EOLA 3SHCH 4ZCNA 3RDZA 1UCYK 1A1RA 1K1PA 1Z1IA 2R0LA 3S9AA 1DXWA 2A7HA 3K9XB 4ESTE 1DSUA 2ZKSA 4INKA 4ISOA 1ZYOA 3GICB 3GDSA 3PMAB 1TBZH 1K28D 4AGKA 1XUIA 3KN2A 2ZHQH 6GCHF 1SGRE 2A4QA 2Q6FA 3SUDA 4XBDA 1C1PA 1A3BH 1NBMD 2PLXA 2AGEX 3GY2A 4CHAC 4XOJA 5ESBA 2TBSA 1O2XA 4X2VA 1VCQA 2PGBB 1H9IE 1O5DH 3UUZA 2A5IA 3CS0A 1ZPBA 1SVPA 2HLCA 3GCHC 2HPPH 1OHHD 2QY0B 3BTDE 4FU9A 3PV4A 5TJXA 2BD4A 5FL7D 2PTCE 2J38A 1O2QA 2TIOA 3H09A 2NU1E 3ZVCA 2BDBA 3S7KB 1TGTA 3MO3A 5CHBA 1BT7A 2ZEBA 1UVUH 4BAHB 3M7TA 2B7DH 3RXIA 3PO1B 3A8AA 1RS0A 3I78A 1BTWA 5PTPA 3V7TA 1D9IA 1BRCE 2BDCA 2H9HA 5HM2A 1S0RA 2OK5A 1NFWA 1FV9A 5DO4H 1F7ZA 1CBWB 2BYAX 1A5HA 2J98B 1HJAC 2WYJA 1UHBB 3VG8A 1DSTA 3A7XA 2A5KA 1LCYA 3BTME 4UFGH 1HAOH 1GHAG 4I31A 4JYTA 3RC6A 1C9TA 3STIA 4BTTB 2VJ1A 3BTQE 2AMPA 4WMEA 3E8LA 1YLDA 3KNXA 1Y3YA 2FX6A 1GDQA 1OX1A 1AY6H 2UUJB 3ZVBA 3MNXA 1GBBA 1GI4A 1WUNH 1ARCA 1O3KA 4O3TA 1VJ9U 2ANWA 1TLDA 4OGYA 3R3GB 4ABFA 3WWFA 4K1EA 2EY4C 1MKWH 4MNXA 2EI6A 1AQ7A 1XXFA 1F0UA 1O2OA 2A4RA 4MPUA 3RM0H 4JZEH 4Y79A 5T3HA 1PPGE 1ZMLA 1V6DA 4D76A 1K0HA 2P8OC 3QZRA 1P8VC 1C2HA 1T8NA 3MU0A 1ZJKA 3DCLA 3VB7A 1O3PB 2ODYB 2SGAA 2BX3A 3W94A 5DG6A 1C5LH 4UFEH 5DP5A 4ISHH 2GZ9A 2GJGA 4TT3D 5A2MH 4I7YH 2BDGA 3RXVA 2BX4A 1SFQB 1W3CA 2J97A 2KFWA 2A2QH 4NFEA 5C0UA 2BDIA 4AFZA 5FXLA 1FX0B 1ACBE 1UTPA 1G3BA 1OOKB 1UJ1A 3PRDA 3SUFA 1W7XH 3RXMA 5FX5A 1CHOG 1EXFA 1HDTH 1LQDB 5JBTA 1C2IA 4I8JA 1FPCH 3LGTA 3SN8A 6ESTA 2A1DB 4KTSA 1F5KU 3LH3A 3GCNA 2GV6A 1CGJE 2OC8A 2P95A 5FCKA 3SQEE 1F0SA 1LDTT 1ZRBA 3ZVEA 6CHAC 1XKAC 1KTSB 4AFUA 1AVXA 2BDHA 2W6ID 1DS2E 5JBAS 1N6YA 2ZC9H 1MH0A 3LGUA 1J9CH 3FO8D 2D26C 3M36A 1LHEH 1NC6A 3OFND 3GDVA 4CR5A 4YO9A 3F1SB 3U8RH 4FUEA 1ZTLA 2NU4E 2WPDD 1WQSA 1GJ4H 1UTQA 2H5CA 1FZZA 3UNSA 2XCFA 2IJD1 4O03A 1DXPA 5K7RA 2ZP0H 1NFXA 1WAYB 1FN8A 1O3FA 1UO6A 2OXSA 2VVCA 1OPHB 3DFJA 5L2YH 2VBCA 3FFGA 1G3CA 1O3GA 4HTCH 1K2I1 1ANBA 4RKJB 2ANYA 2EQNA 2M2AA 3MH6A 5I46H 3QUMP 4X8VH 1C1RA 4JK5A 2VGCB 1AB9B 1N8OB 1QTFA 1SHHB 1A61H 3QWCH 2F9NA 2FDAA 3SU6A 1VGCC 2Y6TA 4DVAU 1FONA 3VFEA 2RG3A 4AFSA 1AKSA 3P70B 2VWLA 1H9HE 1EJMA 2SGFE 1TFXA 1OP0A 3ODDA 1TNGA 1V2MT 3LC5A 1KXDA 3OTPA 3FAOA 4DY7B 1EPTB 1B0EA 1O2RA 2FS9A 1C4U2 2Z9GA 1EAWA 1QB1A 5ABWA 1UTKA 2AEIH 2V3OH 2XC4A 1P2MA 1Z6JH 4Y10E 1NT1A 3ATWA 1QHRB 3F9EA 3S0NA 1HAHH 2GMTB 5HM9A 1E1QD 4X2WA 5EXMA 1TOCB 3KHVA 2A31A 2B9LA 3PLBA 4ABDA 4U2WA 4B74A 1TBQH 4JZ1A 4B6EA 2NU2E 3SGBE 2PKAB 1K1LA 1KLJH 3MU5A 3F9HA 1G2MA 1NS3A 1VKYA 5EJZA 2FOAA 1S81A 1GI6A 1LKAA 1G9IE 5EQRA 3PLPA 1QQUA 1JXPA 4DJZB 3RUOA 1FMGA 1DFPA 3U69H 5DP9A 5FPTA 3LKWA 2F9OA 1DDJA 1QL9A 2VB0A 3AW1A 1XM1A 1AKSB
chains in the Genus database with same CATH topology
1ZSLA 3GISB 2BDYA 1W13U 1ELGA 1Z8JB 3LONA 3Q00A 3SU1A 3CENA 4ZROA 1C1NA 3EQ0H 3TK6A 4A92A 2B0FA 4GVUA 1LKBA 1ZJDA 3QGJA 4GPGA 1JRTA 2HNTC 1O5AB 2BD5A 1EP5A 4XBBA 3BSQA 3ATLA 1O3MA 2ZI2H 3M3VA 3M5LA 4TPIZ 1DUEA 3BTEE 1RJXB 3A89A 1OXGA 2FI4E 1GBCA 4KGAA 1BMNH 2VIDA 3DD2H 1NRPH 2Z9LA 3HGNA 3P92A 4GLYA 4PROA 5AFZH 1SGQE 1P2KA 1MQ5A 1TIOA 1TPAE 3NK8A 4IN2A 4J2YB 1E37B 1O5FH 4MPWA 3G01A 3LH1A 4X8SH 3ELAH 2KAIA 2Z7FE 1GBMA 1N6XA 1MKWK 1WSSH 2ZFQH 1BB0B 2J2UA 1NU9A 5FBIA 2J95A 3KQBA 1A0HB 1OP8A 1XUHA 3FANA 4IS5A 5LPRA 4BOHA 1YKTA 1FPHH 3ESTA 3V13A 1ZTJA 4IC6A 1P05A 1Y3WA 3BV9B 3GYMA 3QN7A 1TE0A 1EZSC 8ESTE 1GPZA 1BHXF 4YOJA 3K2UA 1GG6C 1GHWH 4TWWA 1GHBF 1CA0B 2Q6DA 1CVWH 2JETB 3DHKH 2ZU4A 5GDSH 3SBKA 1EATA 3GCTF 4AFQA 1GHXH 1QQ4A 3MHWU 1O32A 9LPRA 1P3CA 4THNH 2BD8A 1EAXA 4GUXA 1IQFA 1SGCA 1DVAH 1BBRK 1O3AA 2B8OH 5TCAA 1GJ6A 3TLOA 1O5GH 5GIBA 5C1UA 5DP3A 1ANEA 4I8LA 3VGCC 2XC0A 1D6RA 1N8OC 1H4WA 1D3TB 3SNDA 5IYTA 3KL6A 5FAHA 1V2UT 3HK6B 2HVXA 3GDUA 4NIYA 2SGDE 4AN7A 4K2YA 4ISNA 1NROH 4OS4A 2A4OA 4E7RG 2WPHS 2ZU2A 1MBQA 1LHDH 4MPVA 5BRRE 2AIQA 2OQ5A 3PWBA 5GPIB 1TRMA 1SB1H 5CHAC 4Q7XA 5SGAE 2JH0D 5DP7A 4MPXA 2PWXA 1XKBC 2VWMA 5F03A 1BTXA 3LIWA 4I8GA 1EB1H 1TGSZ 5EG4A 2J9NA 1VCWA 3LGIA 2B5TB 4XFQA 1A4WH 1V2OT 5JB9S 1O3IA 4ABEA 1S6HA 1W10U 3MWIU 2J34A 2O8WA 1SGNE 2VINA 3VB6A 2WPLS 3MO9A 2NU3E 1TNIA 1HPGA 2GDDA 1AB9C 1MZDA 1Q2WA 2F3CE 4UD9H 2GKVE 1ZOMA 4NZLA 4INLA 2ZGBH 3P8FA 3PTBA 2WUBA 1QBNA 2GCHF 3MU4A 2Z9IA 3QLPH 4B2CA 3M3SA 1K1NA 1UTMA 2BOKA 3GCTG 5G4BA 2XW9A 3RXBA 1FLEE 3T29A 1AGJA 1BITA 1C5XB 1MTNC 4VGCB 5I25A 3MFJA 3MI4A 1K1JA 2Z9KA 5C67A 4DIIH 4FUCA 4Q2KA 1O2MA 1VITH 2VVVA 4QT8C 5E0GA 3ZZ3A 5F8TA 1L1JA 1FY5A 1SBWA 2FP7B 1AU8A 2QV1A 1V2VT 2H9TH 3SV6A 3O8RA 3AVZA 1P12E 1TA6A 3SUGA 3U8TH 2QCYA 2O8MA 3ZZ9A 1HYLA 4AB9A 4FUGA 4Y7BA 3VB4A 1J16A 1C1MA 1O2WA 1YPHC 2XWAA 4MLFB 3PTNA 4A1XA 2TGTA 2OINA 3T27A 1SHYA 2G4UA 3NUMA 3V12A 3SO3A 1P2OA 3HPTB 4CRBA 1JIMA 1C5UA 1DUAA 1PQ7A 1BBRE 4H4FA 3U9AH 3UOUA 3AAVA 1RD3B 3V0XA 1TPSA 3TK9A 1UHBA 2AS9A 1MD7A 3GYLB 1KXCA 1O2YA 5C1YA 2G5NA 4OS1A 4U30A 3IITA 2ANMH 2ZCKP 3ATKA 2Z94A 3SU0A 1IQJA 3SI3H 1HJAB 1O35A 2STAE 1BDAA 2PUXB 1EJNA 2BD3A 1Y3VA 1E0FD 1GJ8B 1FXYA 2CJIA 4GCHG 1SQAA 1C5QA 1GI7B 3ZVGA 4Q7YA 1TA2A 1UMAH 4ABJA 1GHBG 3BEIB 5A09A 1FNIA 4MQAA 2GT8A 1EKBB 2C4FH 2SNVA 2OTVA 2GV7A 1ELEE 4UONA 2FI5E 2A7JA 1OWEA 4AYYB 1TBRH 3MNSA 3PMBB 4MVNA 1C1WH 2ZCHP 4ZHAA 3SJ9A 1WBGB 1BTUA 4WXIA 5EW1H 5JPMH 4O97A 3S69A 3SNBA 3LJOA 1EX3A 1TX8A 4FU7A 1G3EA 2FOMB 1GG6B 1IQKA 2Y80A 6LPRA 1NFYA 2BLVA 4JMYA 7GCHG 1KXEA 1SGDE 3QGNB 1BHXB 4BNRA 1ZHPA 4JZDH 3RC5A 3RLWH 3AASA 1S84A 4RSPA 4A1TA 2P94A 3SV8A 6CHAB 1PQAA 1C1QA 1TGBA 3RXGA 3SI4H 1O2JA 4BANB 2A45B 2A5AA 2ZPRA 2JKHA 2P93A 4CRCA 2WPMS 1O38A 2Y5FA 2PR3A 4NWLA 1PPFE 3UNRA 3S7HB 3BIUH 4UFFH 5EXNA 4D8NA 2KAIB 2ZHEH 3QX5H 3QO6A 1JMOH 5C5NA 4CH2B 3E3TA 1T4UH 4MNVA 1A5IA 1JBUH 1W7GH 1LVBA 1ZSKA 1KDQB 1GBTA 1SLUB 1XVOA 3RXSA 1S0QA 1C5PA 4CRGA 3OTJE 3TH2H 5CHAB 2FOGA 4ZHLU 4OS7A 1C4Y2 1G3DA 1XVMA 2PKSB 2RA0A 3ZVAA 5F6MA 5HGGA 3ZZDA 1YLCA 2QXJA 5DP4A 4BAKB 2TPIZ 1AFQB 1SGEE 3UPEA 3QZQA 2ZFFH 1OWJA 1GI9B 1DPOA 1RTLA 4Q80A 4AZ2B 2UWLA 3MO6A 1P11E 2D8WA 1BRAA 1GGDC 3F68H 2ZDKA 2FIRH 3ATIA 2BMGB 1B0FA 1C5RA 3P8NA 1HIAA 3U1IB 1TGCA 1K22H 9ESTA 3ENSB 1O5BB 1AHTH 1MAYA 2CMYA 2ODPA 3A7TA 3D65E 4B76A 1Y3UA 5AVDA 2IJOB 2BB4A 3UWIA 1NPMA 7GCHF 1ZPZA 3QDZB 1L1GA 2GCTB 1Z8GA 7KMEH 1D6WA 3KGPA 3UTUH 3SORA 1CBWC 3M5NA 2C3SA 3SNAA 1EAIA 3N7OA 2PUQH 1ETTH 1O2UA 1ZSJA 2G5VA 3M3TA 4YOGA 3HGPA 3SV2H 1IQMA 2WPJS 4NWKA 3ZVFA 4E7NA 4WY3A 3MTYA 2H1UA 2ZGCA 1GI5A 1AMHA 2ZECA 1AZZA 1DWBH 3SHAH 2BY9X 2I6SA 3EAJA 2CV3A 3H7TA 1K9OE 1N1LA 4NFFA 1GBAA 2RA3A 1CQQA 1QRXA 1P06A 4AG2A 2SNWA 2VGCC 1V2KT 1TONA 4CRAA 2D2DA 1KSNA 2ODQA 4E05H 5JYIA 3UREA 1HV7A 3IG6B 1YPMH 1XXDA 1TGNA 1CGHA 4SGAE 1D3PB 1UTOA 3NXPA 4B1TA 1Y5AT 1A7SA 1C5NH 2ZDVH 1YM0A 5BPEA 5E2PA 2WYGA 2LNCA 4UFDH 3BIVH 4I8HA 1L4DA 2NWNA 1DWEH 4D9RA 1C2FA 2P16A 2BY7X 2QXGA 1ELCA 1WQVH 3OYPA 1CT2E 1W0YH 2O8LA 1UCYE 3BG4C 3FP6E 4OGXA 4CREA 1EP6A 4UDWH 3LC3A 2XWBI 3O8BA 2XBXA 1GL1A 2BM2A 2ZFRH 3Q3XA 1FI8A 2GCTC 5A8ZA 2FOBA 3QK1A 4FUFA 3ZZAA 3M7QA 1ELBA 1SL3A 1JIRA 1IQEA 1MTWA 3F6UH 4B2BA 1RTKA 1YCPH 3LGWA 1J17T 1OSSA 3LT3A 2UUFB 1HAYB 2ZTXA 4R0IA 1K1IA 5HYOA 1YCPM 2PKAA 3NWUA 1QFKH 3P6ZB 1TQ0B 4OS5A 1VGCB 1FY8E 3DT0H 2QXHA 4CHAB 1IQNA 1O33A 2FI3E 5A8YA 3T25A 1GHAF 1W2KH 2CN0H 1NZQH 4BTIB 4CBOA 1SQOA 4Y0ZE 5FX6A 2ZGJA 4YOIA 2O8TA 3C27B 3RXTA 5LGOA 2CHAC 1XUJA 4DGJA 2BHGA 1D3DB 4H6SB 4CRDA 1O3CA 1MTVA 3RC4A 1J14A 1CO7E 1C5MD 3ZVDA 2FX4A 4YM9A 1WTGH 2P3FH 2ZDAH 5F8ZA 4FVDA 2PTNA 4K8BA 3T5FH 1TX7A 2FOHA 2FS8A 2J94A 1CSOE 4Y8XA 4GHQA 1P2IA 2GVFA 1ZRKA 1ZGVA 1K1MA 1AUTC 3RXLA 5AHGH 2OD3B 3M5OA 5L6NH 2BVXH 4ZKOU 3RXDA 1GVKB 4D7GA 1LTOA 2V35A 1IQGA 2OC7A 1KXBA 2ZGXH 2Y7ZA 1GJCB 4Z6AH 3P8OA 2JH5D 5GJ4B 3TIUA 1KXFA 1SSXA 1F2SE 2FYRA 1UTLM 4J1YA 1DWCH 3B23B 2FPZA 2F91A 3EA7A 2ZHDA 4NSYA 4Y8YA 1GWAA 5CMXH 2BY5X 3SJIA 2BDAA 5E2OA 5AF9H 1LO6A 1V2JT 3A84A 2R2WU 3FZDA 3Q3KA 4TY6A 2BY8X 1V2PT 2Z9JA 4DT7B 1GCDA 3SNCA 2HNTE 5LPFA 4R8TB 1BQYA 2ZPQA 1HXEH 1Q3XA 4D9QA 1C5TA 2A32A 3OU0A 2ZQ2A 1UTNA 3TITA 1ZZZA 2BQ6B 1TOMH 3BN9A 4GCHF 1P2JA 2WINI 1HFDA 1G30B 1LPGB 1EPTC 1BCUH 4ZKNU 4YLQH 1FAXA 1TAWA 3RXHA 3O8CA 3A83A 2TGPZ 2A7CA 1LMWB 1O0DH 1Y59T 1J15A 1GL0E 3VXFH 4H6TA 1VITG 3M35A 1HAVA 3MMGA 2W26A 1O3HA 1FIZA 2W3KA 4K1SA 3RXCA 1DLKB 3ZZ5A 5J4QA 4IN1A 1CA0C 2BOHB 4LZ4B 1CU1A 1S83A 3PYHA 4FUHA 4NIWA 2CGAA 3RXFA 4KELA 5E8EH 1O2TA 1THPB 1LPZB 1HJ8A 2C90B 2V6NA 3SGQE 3SU2A 3VXEH 3R0FA 1UK3A 3K6ZA 1BMMH 3ZZBA 1QURH 2HGTH 1HRTH 3A7ZA 2C8XB 5A0AE 1CHGA 1GBIA 1IAUA 1EZQA 2QYIA 3ZV8A 1GCTB 1KIGH 1O3JA 2GD4B 1Z7KA 2AERH 1OWHA 2R3UA 4X1NU 1C5ZB 1ABIH 4DOQA 3A86A 1OS8A 1QJ6B 2Y5GA 1GGDB 2STBE 2QF3A 2FO9A 2THFB 2GDEH 3SJOA 2W7UA 1HJ9A 2D1JA 1EZXC 2VIOA 3MH5A 1HBTH 2YNAA 1QJ7B 1Y3XA 1ANCA 5T6FA 3HKIB 4FXGH 1P10A 2VU8E 1QL7A 5JDUB 2H6MA 5HMAA 1E36B 2G8TA 3FP7E 1MUEB 2GMTC 1UVSH 1YGCH 1BA8B 3EDXB 1TNHA 1BIOA 1YCPK 2SFAA 3LGYA 1EJAA 1P2QA 4FUDA 4RKOB 5CE1A 1QY6A 3B8JA 1ORFA 2ZNKH 4X6PA 4ZXXH 1GMHF 2J92A 2YNBA 1VZQH 3F9GA 1JWTA 4A7IB 3V3MA 1D3QB 1ABJH 1QJ1B 5E0HA 3LOXA 2ZU5A 4X2XA 4CRFA 1YPJH 3D62A 1QGFA 4Y11E 3URDA 1GJBB 4H42U 1P03A 4NZQA 3MYWA 1C2JA 2UUYA 3RXUA 3E0PB 2PHBA 2JETC 2I6QA 1V2RT 2FTLE 2Y82A 4MNYA 1TWXB 4FUJA 4U01A 4K3JA 4X6MA 3PLKA 4X1PU 4TY7A 3UIRA 1T7CA 2ZFSA 2ZU1A 3PMHB 3A8DA 2H5DA 5T6GA 3ZYEA 1GBHA 1O2IA 1SOZA 3P8GA 5DKMA 2ALPA 1SLVB 3QTOH 3TVJB 1TMBH 4WMDA 4XE4A 1BUIA 1DT2A 4ISLA 5TCCA 1C9PA 2UUKB 1NFUA 1VJAU 1F92A 1C5WB 1CT4E 5EU8A 1C2LA 3GCHB 2BLOA 2BXTH 4B2AA 4FUIA 1GBKA 4DCDA 4AB8A 2ULLA 2VH0A 3RXAA 1L2EA 1YPHE 3ZZCA 2G51A 1IQHA 3H7OA 2XBWA 2H2ZA 3RXPA 3DA9B 4DW2U 1TYNA 4GAWA 2CF8H 1GJ9B 4YLUA 3T2NA 3BTKE 1LVOA 2FLRH 2W7SA 3CP7A 1T8MA 4NIXA 3A82A 4OS2A 3GOVB 5AFYH 2Q6GA 3TPIZ 3E6PH 1GI1A 1GMHG 2VIPA 4MDSA 3KCGH 3SNEA 4K5ZA 4JZFH 3MU8A 3OY6U 2WUCA 1TMTH 1GHVH 3UY9A 4X0WU 1UVOA 3MH4A 3OX7U 1O30A 2G55A 4HZHA 2VIQA 1O5CB 1TNJA 1PFXC 1V2QT 1ZR0A 2XYAA 3A7VA 2WPKS 4ZUHA 2VIVA 4K8YA 2P59A 1SGFG 2FESH 1G36A 1SOTA 2ASUB 1Y5UT 1T31A 1WTHD 4BTUB 1DE7H 1GBFA 5C20A 4FUBA 4F4OC 3TGKE 2AH4X 1UK2A 1A0LA 2SGQE 3UWJH 1X7AC 1H9LB 1FAKH 2QA9E 1GMCF 1PQ5A 1T32A 3RP2A 3KQEA 4NCYA 1GMDF 5EPNA 1IOEA 1B5GH 1ZPCA 4I8KA 3RXQA 6GCHG 1GJAB 1DY8A 4Z0KA 4YT7H 1AZ8A 3NCLA 2HOBA 1QA7A 2WV5A 1QR3E 4LK4A 3TJVA 1V2WT 1NRQH 1MKXH 2XBVA 4FVBA 1OWKA 1SLWB 2ZHFH 1C1UH 2AIPA 4AORA 1OWIA 3KEEA 8LPRA 3BEUA 4KTUA 4ZXYH 5JB8S 1O39A 1EB2A 3T62A 2BVRH 1CGIE 1HAVB 3A85A 1YPGH 3P17H 2HALA 3BTWE 1ELVA 3GY7A 3RLYH 1W11U 3KQDA 1AVWA 4O3UA 1CT0E 3UR6A 3UR9A 5IDKA 2Z6BD 3ZYDA 1NY22 3UOPA 5DP6A 3JZ1B 4WXVA 3NKKA 8GCHG 4YT6H 1A46H 3A8CA 5E0JA 1C2KA 1OKXA 3S9CA 3NZIA 2HNTF 1GBJA 1MU8B 4FU8A 1FY1A 1UTJA 1SGTA 3O8DA 1Z6EA</