3MH5A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
254
structure length
191
Chain Sequence
b'QMPSLAPMLEKVMPSVVSINVEGSTTKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGYENFIQTDAAINRGNSGGALVNLNGELIGINTAIIGFAIPSNMVKNLTSQMVEYGQVKRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 43
structure length 191
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh5A01
4WXIA 1CO7E 1O3AA 4DIIH 1XUGA 3TNSA 3RXLA 1P0SH 1IOEA 1D3TB 3BTEE 3KQBA 3LPRA 4HTCH 4ZKOU 1NRRH 1KLJH 4ABBA 2FS8A 1DWEH 1P3EA 1GCTB 1N6YA 4GHQA 3SJOA 2J4IA 1LDTT 3VFEA 4NA9H 3MYWA 2GT8A 1ABIH 1C5LH 2VVVA 3SUFA 4WF8A 9LPRA 2BY8X 1BBRH 4BAQB 1A0HB 1W13U 2ZWLH 2UUKB 3GCHC 2OC8A 2ZFRH 1OWJA 3OU0A 2OC7A 1VJAU 2A7CA 1AB9C 3GCOA 1PQ8A 1TE0A 2OLGA 4MQAA 1EAXA 1K1IA 3S7HB 1MKXK 1O2ZA 1SGDE 1FI8A 3QX5H 2A5KA 4H4FA 3SV8A 2CV3A 2OBOA 1HAOH 6GCHF 1K1OA 1DXWA 2BDGA 3DT0H 4ABAA 2C90B 2OXSA 2YOLA 1QBOA 2FXRA 3SI4H 3GOVB 2M5TA 3HK3B 2NU0E 1P2MA 1ABJH 3CP7A 1HAIH 1C5ZB 2G4UA 1C2MA 2ZU3A 4BAKB 1NS3A 1O2XA 4FUGA 1FJSA 4X1NU 3D23A 2GMTC 5DP6A 4B2BA 4K5ZA 5JYIA 3HK6B 1V2TT 2F9OA 3E0NB 1YM0A 1VZQH 1O38A 4CRDA 1HAPH 3PTNA 4UD9H 1NU9A 1ZJKA 3E1XB 3P17H 1MBQA 4F49A 1DICA 2O8UA 1BRBE 3RXBA 1ID5H 3VB7A 4FUJA 3SV6A 4FUFA 3Q3KA 1C5SA 1IQJA 3KL6A 1BHXF 1HJAB 4DT7B 4FUIA 3H5CB 3Q76A 5DP4A 1NRSH 4YOGA 3LC3A 2BVSH 3TJUA 1C5WB 2C3SA 4JZEH 2EEKA 1E34B 4JZ1A 4UFFH 1RGQA 3SJ9A 2A2QH 3MI4A 1GVZA 1TOMH 4UFEH 1C5TA 1GI9B 1C1QA 1EOLA 3SNCA 4MNVA 4WWYA 4KTUA 1FPCH 3SV9A 1ZPZA 3RXFA 4X1RU 1SGPE 2F91A 2HALA 2GX4A 1C9TA 1GJDB 3MNSA 2K1QA 4CHAB 3MO3A 3BEUA 2PWXA 1TNIA 1MTSA 4JK5A 3KQEA 2B9LA 2BMGB 4VGCC 3RXGA 1XKAC 2ZGJA 2Y80A 1G3BA 1HV7A 2TGPZ 4R8TB 3GYMA 3M61U 2BLWA 4CH2B 1O3BA 1BHXB 1YC0A 1GHYH 1GHBG 4X8TH 1S6HA 4DVAU 5C1XA 1LVMA 4A1XA 4ZXXH 3STIA 2Y7ZA 4FVDA 4NIXA 3MU1A 2ZU5A 4D9RA 1GVKB 6GCHG 5AFZH 1AHTH 5EU8A 1V2WT 1ZTJA 3O8DA 5H4IB 2WPJS 4MPXA 4ABHA 1QRWA 1XUIA 2V3HH 2QXGA 1HIAA 2Z9LA 1GJAB 1EASA 3UTUH 1UTOA 1P10A 1SLUB 2Y5GA 4Q7XA 1TQ7B 2ANWA 1BMLA 2JETB 1QB1A 5TCCA 5HM2A 2SGQE 1IQFA 5AF9H 3M7TA 3RC4A 3NWUA 5HM9A 4YTAA 1AFQB 2XC4A 1T8NA 3SUDA 1TNLA 5FBIA 4AORA 4Y11E 1GBLA 3TJVA 3BEFB 2AFQB 1YCPM 1CU1A 3M5LA 1BZXE 1HJAC 1RD3B 4WMEA 3TH4H 3A83A 1G3DA 1H8DH 2C8YB 1UMAH 2WPHS 3WY8A 1TWXB 4HZHA 1EZXC 3PROA 4GVUA 4O9VA 1QJ7B 1SVPA 2ZHEH 4GPGA 5DPAA 1VR1H 2FM2A 3T25A 4CRBA 1Y5BT 1ZZZA 3OSYA 4AFUA 1A46H 1FDPA 3SU6A 2ZCLP 4LZ4B 2XC5A 1VGCB 5LPFA 1W8BH 3LT3A 2FMJA 3GDUA 3MNXA 2A32A 1SOTA 1WTHD 3ZVEA 3ZZAA 1T31A 3DA9B 2F9NA 3ZZDA 2VH6A 4X1QU 5JBBS 3RU4E 5LGOA 2CXVA 2ANMH 4O97A 4M7GA 4MDSA 1A61H 2BB4A 2I6QA 1UHBA 1VITH 2ZF0H 3P8GA 4NG9H 4X1PU 4UONA 2OP9A 3LOXA 3MU4A 1CE5A 4A7IB 1K1PA 5LPRA 1GI8B 1AWFH 3U69H 2JKHA 5HYOA 2VNTA 1QCPA 1O3LA 1SG8B 1TYNA 3EDXB 1DUAA 2BM2A 3SJ8A 4ZHLU 2XWAA 8GCHF 3T5FH 3PYHA 1H4WA 1HJ9A 1ZPCA 1G37A 3TIUA 1O5DH 1MAYA 1J9CH 4Z6AH 1UTPA 1V6DA 1DY8A 2VJ1A 1IHTH 1P9SA 1T8OA 1P2OA 4Y0YE 1UTMA 4E05H 4NIVA 3M35A 1ELTA 2ZDNA 3BTKE 4AX9H 2KAIB 3R3GB 3MH5A 3T28A 1AFQC 1K1LA 3SJKA 1Y5AT 1K28D 8LPRA 4WMDA 1WAYB 1Y5UT 1JIRA 1HAYB 1IQNA 3BSQA 1YPEH 1MQ6A 5F6MA 3RXMA 1HXFH 1OPHB 2XCFA 3URDA 3QDZB 3EAJA 1GGDB 1EP6A 2H5DA 2FODA 1Z8IB 1GMHG 1O2LA 4MNYA 1DT2A 2NU4E 2ZU2A 1O3GA 1PPCE 2ZHQH 3F68H 1JIMA 3PO1B 3A87A 4HFPB 1DPOA 4WY3A 3ODDA 2R2MB 1O5FH 4O3TA 1PPHE 3KN2A 4ISLA 4RKOB 1C9PA 1Y3WA 3LGWA 4YT6H 3MU8A 3DHKH 4IW4E 1O2MA 1C2LA 1SMFE 1HNEE 2P95A 4U01A 1DUEA 2VVUA 3NZIA 2A4RA 4IN1A 1VITG 4YT7H 1Y8TA 1F5KU 1FIWA 1B0EA 1KY9A 1LMWB 2BVXH 3GY7A 4X1SU 1W14U 1EXFA 2A31A 4R0IA 3K6YA 1WQSA 3E0PB 1C2EA 2BOKA 2OC1A 3ENSB 1CVWH 2OC0A 1JMOH 2P8OB 2XBWA 1HAVB 1UO6A 4AGKA 2HGTH 2TGDA 4BTTB 1ZJDA 8ESTE 2HNTE 2BLVA 3HATH 1A5GH 1LPZB 1ARCA 2WV4A 5C2ZA 3SV2H 1JRTA 3M36A 3TK9A 2ZQ1A 1EX3A 2GCTB 2ZDLA 1V2LT 4KGAA 1SGEE 3H7OA 1GHAG 3BTFE 1NN6A 2HWLB 1G32B 3SU5A 1P03A 1SGFG 1ELVA 7ESTE 3A7XA 1SFQB 3RP2A 3A86A 5JB9S 1P2NA 4CH8B 1CQQA 1GMDG 5E0JA 1O5CB 2PKAA 1OYTH 2PLXA 2V0BA 1ANBA 2ESTE 1ZYOA 2XXLA 4B71A 1BTWA 1GGDC 3SZNA 4Y76A 1TX6A 5L2ZH 3FP6E 1C1PA 3BTDE 4AB9A 1F92A 2OINA 5E2PA 3ZZ3A 3TNTA 2YNAA 1O2JA 5FAHA 1FAKH 1L2EA 2ZU4A 4CRGA 4H6SB 1ELEE 3BIUH 1GBJA 1SB1H 1P11E 3QGNB 3U8RH 1P57B 1AY6H 2STAE 3F9FA 2BXTH 1SGNE 2Q6GA 1GDQA 1EOJA 1FY3A 3LONA 2GCHF 1DDJA 1DXPA 1W7GH 6LPRA 1P05A 1UTLM 3MFJA 2A5IA 4Y7BA 1NC6A 1C2JA 3NCLA 2TBSA 1SPJA 4NA7A 5EQRA 3JZ2B 4U32A 3SGAE 3KEEA 1ZGIA 1O35A 2QYIA 1P3CA 2Z7FE 1O3HA 1C2FA 2BDHA 1QJ6B 1YCPK 2A5AA 1ELAA 7KMEH 2BD9A 1GHZA 1P02A 3EA9A 2Z3DA 1D6RA 1DSTA 2FTLE 3QTOH 3A8CA 5L30H 3TJNA 1MTNC 3P70B 3PLPA 1E0FD 2OD3B 3DUXH 5DGJA 3P8OA 1A5IA 3A7WA 4QT8C 3ZVDA 3TITA 3I77A 2O8WA 2STBE 1A0JA 1CHOF 1LTOA 1SGIB 1L1NA 3A85A 1K2I1 3MNBA 2SGFE 2G00A 4GLYA 1FZZA 2GD4B 1GJ7B 2PUXB 3ESTA 1FY1A 5ETXA 3PMHB 2R2WU 1TGCA 3GCHB 1S81A 1ZSKA 2B0FA 2PR3A 5A0BA 2W5EA 4Y7AA 1RXPA 4HGCA 5JB8S 5TCAA 2J38A 2CHAC 4RN6A 4NWKA 1C5RA 2FI3E 1FMGA 2R3UA 4LK4A 4AFZA 1LVOA 1V2NT 1UVOA 2FI4E 1Y3XA 2LPRA 2W3IA 2BHGA 3CS0A 1DWCH 2FOMB 1YLDA 2ZTXA 3GDSA 2XBVA 1O2IA 1TONA 2BDYA 5GXPA 2ODQA 3PLKA 1SQTA 1T4UH 1LVYA 2WINI 2UWLA 5AVDA 2ZGHA 2IN2A 4I31A 2GMTB 3QUMP 4OGYA 5GIBA 4SGBE 1KDQB 4K60A 3GYLB 2A7HA 1YF4A 2PHBA 4ISIH 4GSOA 1EJMA 4HI3A 2BY9X 2EI8A 5ABWA 1PPFE 1BOQA 4I8LA 3RC5A 8KME2 4TWYA 3SW2B 2AGGX 2WYGA 1E35B 3M5NA 1O2VA 4KTSA 1TOCB 3GY2A 1G3EA 2NU3E 5E2OA 1GI5A 3BTWE 4I7YH 1Z8GA 1ZHMA 1SQOA 1TX7A 1AVXA 1GBTA 1EPTC 5EW2H 1C1UH 1A1RA 2TGAA 4I32A 3P6ZB 4Q80A 5K0HA 3TPIZ 5A09A 2SNVA 3MU0A 1SGRE 3EA8A 3A88A 1OSSA 1KIGH 4JZDH 3RU4T 1O2PA 4Y8XA 5EPYA 2GVFA 1UTJA 1K9OE 1CHOG 2FESH 1KSNA 2ANYA 2VH0A 3LU9B 4JYTA 4OS2A 2IJOB 2ZGXH 3ATMA 2J34A 3TLOA 2QN5T 3PWCA 1PYTC 5BPEA 3T2NA 3IITA 4OS1A 1ORFA 3RXOA 4VGCB 4AGJA 1TB6H 1TLDA 3RXRA 1C1RA 4GCHG 3M3TA 1YPJH 1XUJA 4YESB 2BTCE 1TPPA 5DKMA 1YPGH 3A7YA 2BQWB 4BAHB 1NRPH 2ZFSA 3UNSA 3M5OA 4MG3A 2ALPA 2FYRA 2PGBB 5SGAE 1GHBF 1MTVA 2Z9IA 2G81E 2GZ7A 3BTGE 2RA3A 1SL3A 4E06H 2YNBA 1ZPBA 1IQIA 1XUFA 2CMYA 1BJVA 1GJCB 1UTKA 1Z6EA 2OQUA 1KYNA 2Z3CA 2ZGCA 5A0AE 4X8UH 3CENA 1V2UT 2V6NA 1MTWA 1FNIA 2P93A 4AOQA 3BTHE 1EUFA 1MUEB 1OKXA 5CMXH 2Z9JA 1HAVA 1EZSC 4MNXA 4KELA 1C1TA 2ZO3H 2XC0A 3P8FA 1ESTA 1QL8A 1AN1E 3SNDA 2FOFA 2PTNA 1O3PB 4CR9A 1S5SA 2BY7X 2UWPA 3MOCA 4KP0A 1LVBA 1SI5H 2O9QA 2Z9GA 1UVUH 3Q3XA 3M3VA 1F2SE 4CBOA 1O34A 1QBVH 3V7TA 5C20A 1AO5A 4K1EA 1ZLRA 2J2UA 2ZNKH 3FANA 2J95A 4ABFA 1QURH 4B73A 1D3PB 3C1KA 1UVPA 1N8OC 3G01A 4X6MA 2H9EH 2ZQ2A 2WPIS 1C2IA 1O3MA 5T6DA 2WYJA 1L1GA 4MPWA 2ZPQA 1THRH 1F5RA 4NZLA 2Z9KA 1ESBA 3HGPA 2ILNA 5AHGH 5C5OA 4AFQA 1MMJN 1O5AB 1C5PA 4JK6A 1SLVB 5L2YH 1CBWB 5LH8A 5F03A 1O3DA 2H6MA 1MCTA 1O2HA 3PM3A 3RMNH 3BTTE 1C1MA 3BG8A 3HPTB 3OY5U 4B2AA 1GBMA 3ZVAA 5BRRE 1ELCA 3P92A 1GWAA 3MH4A 1VCWA 1TRNA 2O8MA 4B2CA 3SGQE 1P9UA 1ZR0A 4BAOB 1BRCE 3L3TA 3VB4A 1QA7A 2PFEA 2SGPE 3Q3YA 2BDBA 1E38B 1F7ZA 4MNWA 1UCYE 1KXDA 4Y6DA 1Z8JB 3MU5A 1NFUA 2BVRH 2ZFQH 2VWLA 2FOBA 1T8LA 2GDDA 2ZFFH 1H9LB 5FCKA 3UUZA 5A0CA 4FUHA 3S69A 2CGAA 3ZVCA 4X2VA 4DURA 4FUCA 1ETRH 1AI8H 1FUJA 1SLXB 5PTPA 3RXKA 3EE0B 3PB1E 2AMPA 4NIWA 2AMQA 3E8LA 4YOIA 2VGCB 2BQ7B 3HGNA 3LH3A 2HPPH 4MTBA 3M5MA 1O32A 4FU9A 4YZUA 1FAXA 5B6OA 4ZMAH 5HXFA 2Q6FA 1SSXA 4OGXA 3RXAA 2OCVB 3AAVA 1OOKB 3JZ1B 1BTYA 1GCDA 1GHWH 2GP9B 4IN2A 5ESTE 2TPIZ 2B7DH 4E7NA 1H9IE 3LIWA 3MH6A 3ZZBA 1AZZA 2JH0D 1GMHF 1CSOE 1DITH 1NRQH 1NM6A 1CT4E 4AYYB 1LQDB 1V2ST 1QRXA 2R0LA 3RXCA 1TPOA 1GG6B 3BG4C 3E16B 1ZSLA 4NSVA 3FFGA 2A1DB 2OBQA 3ZZ7A 4DG4A 3UR6A 1GI0A 1S6FA 1C5NH 1O3NA 1ZOMA 1EAUA 1CBWC 3S9CA 3BF6H 1DLKB 1ARBA 3A7ZA 3RXSA 1XMNB 2P3TB 3MWIU 3SQHE 1B0FA 1VITF 1WV7H 1HYLA 3FAOA 3TGIE 1YPLH 4RSPA 1KDQA 3BEIB 4JZIA 2PKSC 1PYTD 3NUMA 1ELGA 4SGAE 3TH3H 1T4VH 1RFNA 1RTKA 5JBCS 4K1SA 4ZXYH 3KF2A 1BMNH 1OP2A 2EA3A 1AD8H 3ELAH 3Q00A 1EAIA 2SGAA 5T3HA 1GJ9B 2G5NA 1BIOA 4FU8A 2R3YA 4NCYA 2F9UA 5T6FA 4H42U 1GJ8B 1Y3VA 4XFQA 4INHA 3LKWA 3ZYEA 2SGEE 2FOEA 3MMGA 1SHYA 1PQ5A 1D4PB 1GHAF 3URCA 1A4WH 1NPMA 1RRKA 1S0RA 3RXQA 2ZPRA 3I29A 3GY3A 1KXEA 2QF3A 3ZZ9A 1U6QA 2BD7A 1L0ZA 4X2YA 1J17T 2VGCC 5J4QA 2HNTC 3FP8E 3KQDA 1W0YH 3SNEA 1GJBB 2QGRA 3BN9A 1AIXH 1GMDF 4UFGH 2H9TH 1RS0A 5DK1A 1GBBA 1ELBA 1TNHA 2G51A 1DY9A 5I46H 3HKJB 1NTPA 1C4Y2 1A0LA 1AGJA 5DJ7A 3QO6A 4CRFA 2P94A 3AAUA 1GBHA 1UK3A 2BX4A 1D9IA 1GDNA 2HVXA 1GG6C 1SC8U 5I25A 1TGSZ 4D76A 3BTQE 1QNJA 5A8ZA 2J94A 4CR5A 1FN8A 1IQLA 3SHCH 3EA7A 3T26A 3TJOA 2ZDAH 3H7TA 3UPEA 3VPKA 1C1SA 4I8HA 2XW9A 2OQ5A 4TYDA 1CA0C 4ESTE 5TJXA 1NESE 2R9PA 1LO6A 1GBCA 2Y6TA 2DUCA 1KTTB 4X8VH 3EYDA 1BTXA 4NIYA 1K21H 3ZV9A 3GCTG 1D6WA 4ISNA 1Z1JA 3FVFB 1UTNA 4ISOA 1MTNB 3CS7A 4JYUH 2FWWA 2IPHA 1KXAA 2EI7A 1HAXB 1ETSH 4MPVA 4A6LA 1WCZA 2FI5E 1K1JA 2HPQH 1SQAA 2BLOA 1J15A 3TU7H 3BIVH 3K65B 1D3DB 3PMJA 3LGTA 4IC5A 1LKBA 1C5UA 1O2SA 1SGCA 3PMAB 5GDSH 1THPB 4JCNA 1NFXA 1A3EH 3RU4D 1ESAA 3SU1A 1EZQA 2ZTZA 2RCEA 2BDIA 2FEQH 3K9XB 1S85A 1GI3A 1MKWK 4ABIA 3SV7A 5FPSA 5J4SA 1LHCH 4RKJB 4IC6A 2GGVB 3RLYH 4BXSA 2CHAB 1LHFH 3SOSA 1MAXA 2A4QA 4FUDA 4Q7ZA 1O3OA 2D26C 4F4OC 4UFDH 2FO9A 4YLUA 3ZZ4A 4A1VA 1G2MA 3SBKA 1NFYA 1BRAA 1C5MD 2ZEBA 1TBZH 1OWKA 2BD3A 4IMQA 3I78A 1WU1A 1AE5A 3B23B 5C1UA 1K1MA 1T8MA 2AMDA 3MO6A 3GICB 1AU8A 3U98H 1B7XB 1SHHB 3U8TH 1GI1A 1MU6B 4XSKU 2ASUB 4AG1A 5L6NH 1FIZA 3E90B 1NRNH 1GJ5H 1C5QA 3KIDU 5EG4A 2QY0B 2FZZA 1H9HE 3RUOA 3A89A 2C8WB 1WYKA 1J14A 3P95A 1MCVA 1P04A 4ABJA 2Y82A 3ATLA 1QTFA 3ATKA 1NFWA 5FBEA 1PPZA 1GDUA 1DSUA 3U1IB 2PSXA 2HRVA 3F9HA 5EOKA 1TBQH 2P16A 1CHGA 1O5GH 1INCA 3F6UH 1QA0A 1SOZA 1EPTB 4MPUA 1YYY1 2VINA 6CHAC 1ZMNA 1O2NA 5EGMA 5DO4H 4YOJA 2OTVA 2G8TA 2WV5A 1AVGH 1O3EA 1MQ5A 2ALVA 2ZHWH 3TGKE 2ZFPH 4Q2KA 3SN8A 3ATWA 3SU3A 4Y71A 4NFEA 3MH7A 5G4BA 1O0DH 2PUQH 3SU4A 1K1NA 1FXYA 1T7CA 2ZCHP 2HOBA 1GBEA 2XBYA 5A8YA 1TABE 5A2MH 2QAAA 2IOTA 5EXNA 2D8WA 1GI6A 1HAZB 1YLCA 4IMZA 1O37A 5CE1A 1XXFA 1O2TA 4GCHF 2CN0H 3B9FH 2QIQA 4DCDA 1V2RT 4JMYA 3M37A 1UCYH 3UQVA 2P3FH 1GHXH 2ZIQH 1GMCG 2ZPSA 2BD8A 3V3MA 1ANEA 1MZAA 2FTMA 3ZYDA 3S9AA 2NWNA 1J8AA 3A80A 1NROH 4UE7H 2HLCA 3V0XA 4X2XA 5K7RA 1BBRK 3ZVGA 2FS9A 1BUIA 4XBCA 2AGIX 2WPLS 4THNH 1C4V2 3K2UA 4IBLH 1AUTC 1O3CA 1LHGH 1TA2A 4I8KA 1C5YB 4A5TS 2NU2E 2FOCA 2GDEH 1FONA 4BXWA 1GI7B 3AASA 2FOAA 1QL7A 4TY7A 4FUEA 2P59A 3RM0H 2RG3A 5EQQA 1QQ4A 2AERH 3LC5A 4KKDA 4ZHMU 1SGTA 1DE7H 2A2XH 1G9IE 1TRYA 3T27A 6ESTA 2ZDMA 1XM1A 1TMBH 5ESBA 2PSYA 1NO9H 2W3KA 3NPSA 1DANH 2G4TA 3SNAA 3UNQA 2EC9H 3SU2A 3SHAH 1IQEA 1C1OA 3E6PH 3UR9A 2PGQB 1C1WH 1V2OT 3MHWU 2KAIA 3KGPA 1N8OB 2ZKSA 1P12E 3S7KB 1B5GH 1GBDA 2BZ6H 1HRTH 1O2KA 1FLEE 1QFKH 1W3CA 3UQOA 2LNCA 2NU1E 3LGUA 1A7SA 1O3JA 3K6ZA 2H9HA 3LJJA 2ODPA 2XBXA 1SLWB 5FX5A 2QXHA 1ETTH 2TRMA 2VU8E 1HXEH 3RXPA 3MNCA 2DE8A 3L33A 2VWMA 3ZZ8A 2I6SA 1LKAA 2JH6D 4WVPE 4NSYA 3GY6A 2BY5X 4DGJA 4ZUHA 5EXMA 1BTPA 1G2LA 4BANB 1TGTA 2QF0A 3N7OA 2Q1JA 3RLWH 1Y59T 1F5LA 4FXGH 1P2QA 1T32A 4IGDA 3R0FA 1SGFA 1KLIH 3FZZA 3A8DA 4AYVB 1O2QA 1SGYE 2BDCA 1DWDH 4Y8ZA 1YPHE 1YBWA 4FU7A 5DP8A 1O2YA 4LZ1H 1FY4A 3KQCA 1UK4A 3TVJB 1MTUA 3VB5A 4Q7YA 1V2VT 1MH0A 4X6PA 2D1JA 1TA6A 4ZKSU 4WJG2 4K69A 2SNWA 2BYAX 1GL0E 1TGBA 1N6XA 1DWBH 2GTBA 3AW0A 1S83A 4BTIB 2UUFB 3A82A 3TH2H 1Z7KA 4K2YA 5FX6A 1XUKA 1Z6JH 1WTGH 1HUTH 2W7UA 3PLBA 4I8GA 5T6GA 2A4OA 2H5CA 3B8JA 3EGKH 5IYTA 3VGCC 1V2QT 5FPTA 1CT2E 3UIRA 3W94A 1TFXA 2VIWA 3PTBA 2Z3EA 1HBTH 1O2RA 5F8TA 1Y3UA 2VB0A 1NU7B 2BD2A 3SI3H 5C1YA 1K22H 1LQEA 3DD2H 1V3XA 7GCHF 3BG4B 3UWIA 4INKA 3VXEH 4DW2U 4YO9A 4BAMB 2VIVA 2FYQA 1HDTH 1BMAA 4AFSA 3P8NA 2FPZA 3UREA 3SORA 1C4U2 2BY6X 4KTCA 1FQ3A 2A45B 4ASHA 2V3OH 4NWLA 3V12A 1JOUB 4CRAA 2B5TB 2HNTF 2F9PA 1W2KH 2ULLA 2AIPA 2V35A 5DP7A 2XTTB 5FHTA 1VJ9U 1GBFA 1CGHA 3PWBA 2PKSB 1EP5A 1KXCA 4GAWA 5AFYH 4MVNA 3LGYA 3M7UA 3SQEE 1EZUC 4O03A 1GCTC 2PKAB 1MKXH 3GY5A 1O36A 2Y7XA 1GI4A 1CT0E 1FV9A 1O3KA 4U30A 3TGJE 3QZQA 2ZDVH 1RIWB 5E0HA 2BDAA 2J92A 3D62A 1ZRKA 1KXBA 1XUHA 2RDLA 5CHAB 1QGFA 1EPTA 1ANCA 1KXFA 2GT7A 3A8BA 4AG2A 5EODA 3OYPA 3RMLH 2THFB 2BQ6B 1AZ8A 2Z6BD 1C5XB 1UK2A 2XCNA 1LHDH 2UUJB 1ZTKA 5DP3A 1BTUA 5DP5A 1C5VA 1EAWA 1THSH 1PQ7A 2BZAA 3OX7U 4GUXA 4XBDA 3VXFH 5DP9A 1IQHA 1BA8B 1TALA 4ZKRU 2CJIA 4A1TA 2PV9B 1HAHH 1AKSB 1Z8RA 1LPKB 2PW8H 1YPKH 2O8LA 1NT1A 2UUYA 1C2HA 4U2WA 1GHVH 2ZZUH 4K3JA 7GCHG 1GPZA 3NK8A 3A81A 4WH6A 1HGTH 5DG6A 3ZVFA 2OUAA 2BXUH 3F9GA 1CA8B 2QC2A 4K8YA 1GBAA 2WPKS 1CA0B 4BOHA 1TQ0B 4DJZB 4YM9A 3E91A 3KNXA 4WXVA 4FUBA 2XYAA 5JBTA 3S0NA 5GCHF 1QL9A 4A92A 1P01A 2AS9A 1O5BB 1PQAA 3TK5A 3RXHA 2C8XB 4Z0KA 4AZ2B 1OP8A 3QWCH 2QCYA 2D2DA 3GCTF 3EQ0H 1P2KA 2Y5HA 1O5EH 4CHAC 2FIRH 1IQGA 1O2WA 1C2GA 3SUEA 1GI2A 4B1TA 4D9QA 3RXTA 2ZFTA 1XX9A 2SGDE 1RIWC 5JDUB 5C67A 1O33A 3VB3A 2F83A 2GZ8A 1TBRH 4YLQH 1OWIA 1DX5M 5CHAC 2ZI2H 1OXGA 1W11U 2QXJA 2ZC9H 4OS5A 1KTSB 1BBRE 2ZHFH 3SGBE 2O8TA 2DE9A 4Y10E 1PPEE 1FY5A 1TPAE 3STJA 3KCGH 3RXUA 3HKIB 1BITA 1TAWA 1YPMH 2QXIA 1Q2WA 4X6NA 2CF8H 4MLFB 1DM4B 1TX8A 1A3BH 2FOHA 1TPSA 1M9UA 3QZRA 3IG6B 2BOHB 2RA0A 4ZAEA 2AEIH 3ATIA 1LPGB 5F8ZA 1V2PT 2ZTYA 1V2JT 1ZHPA 2JETC 1CGJE 2VWNA 2C93B 3AVZA 1QJ1B 1AE8H 1WBGB 4K1TA 1BMMH 1E37B 1BJUA 3Q77A 1N1LA 1QQUA 3O8BA 1F0UA 1AFEH 4WMFA 1F0SA 4K8BA 2SFAA 3SJIA 1LCYA 4D8NA 2QV1A 2XWBI 4INLA 3RXDA 1V2KT 1MD7A 1SGQE 2ZGBH 2C4FH 1DS2E 1BTZA 3DFLA 1WSSH 1L1JA 4LOYH 1OP0A 1X7AC 3RMMH 1XKBC 2GV7A 5F8XA 2G5VA 1XXDA 5GPIB 5IDKA 4B75A 3GCNA 5GJ4B 3RXJA 4ABEA 1G3CA 2GZ9A 3FZDA 4CRCA 3L6PA 2Z94A 5FCRA 5EQSA 1S82A 1NZQH 4CBNA 4J2YB 3M3SA 1VGCC 4Y0ZE 2VIDA 3D65E 5GCHG 2WUBA 1WOFA 2W7SA 1OX1A 4DOQA 1HB0B 1HJ8A 1HFDA 3QTVH 1YP9A 4JZFH 3RM2H 1ZHRA 2ZDKA 1NY22 6CHAB 1EB1H 2ZA5A 1Z1IA 3OY6U 3U9AH 2VWOA 3SU0A 1L4DA 3M7QA 2BD5A 1HPGA 2ZCKP 1FY8E 1AUJA 1L4ZA 1VCQA 1ZSJA 4FVBA 3SUGA 4Y79A 1P06A 1DOJA 1ZMLA 2G55A 3FP7E 4NZQA 1AMHA 4BNRA 1BQYA 2F3CE 2ODYB 4XE4A 1P09A 1UTQA 1EB2A 1BDAA 1EJNA 8GCHG 4ZH8A 1GBIA 2F9VA 1YGCH 2FX4A 1O2GH 1ZTLA 1MD8A 3LGIA 5LPEA 1GMCF 2FLBH 4XBBA 4OS4A 3W95A 5HMAA 1IHSH 1JXPA 3ZZ5A 1WUNH 3U1JB 1PPGE 2AIQA 4UEHH 1A5HA 1W7XH 4ZHAA 4CREA 1XVOA 1QR3E 3SNBA 3U8OH 3MO9A 1UCYK 2CF9H 5E0GA 3NKKA 4DY7B 1C2DA 3C27B 1AQ7A 3O8CA 1QBNA 1EKBB 3RDZA 2B8OH 1OWHA 3LH1A 4TPYA 4IS5A 1P2IA 2AYWA 3A7TA 3D49H 1O2OA 3UFAA 1C2KA 1G36A 1OYQA 5FXLA 3RXIA 4ZROA 3F9EA 2AGEX 3GDVA 4B76A 3UWJH 4X0WU 3MTYA 1GL1A 1LHEH 2A0QB 2XRCA 1ZGVA 2J9NA 1Z71A 3S9BA 3QGJA 1TGNA 1E36B 1SR5C 2R0KA 1HLTH 1W0ZU 2ZP0H 1AWHB 1ELDE 1JWTA 3BTME 4B74A 2H2ZA 1MBMA 1F0RA 2WPMS 1O31A 3PO1C 1XVMA 2ZU1A 3NXPA 1UJ1A 3ZVBA 1MZDA 1QY6A 1MU8B 2BD4A 4ABDA 2ANKH 1EJAA 1V2MT 4TWWA 1HCGA 3ZZCA 4NGAH 1GJ6A 1OWEA 1CGIE 1ZRBA 1ZMJA 2W26A 3AW1A 3BV9B 2PTCE 2Q6DA 1H1BA 3GISB 3LGVA 5A8XA 1SBWA 2ZECA 1DVAH 1BRUP 4TPIZ 5JBAS 1EQ9A 3ODFA 2H1UA 2UWOA 2FOGA 4AB8A 3LJOA 4D7GA 1PJPA 1AKSA 1UVSH 2VIPA 1G30B 3V13A 2FLRH 2XNIA 2ZG0H 2GKVE 1HIAB 4BTUB 1OS8A 1TIOA 1RTLA 2P8OC 1O30A 1FN6A 4LXBH 3GY8A 1A2CH 1W12U 1OWDA 3RXVA 5JPMH 3UNRA 3LDXH 3E3TA 4TY6A 3F1SB 3A7VA 4I8JA 1J16A 4X2WA 1BT7A 1FPHH 2A7JA 1MKWH 1TMTH 4WH8A 1P8VC 3VEQB 3IWMA 4X6OA 4ZKNU 1YKTA 4AN7A 3QN7A 2GCTC 1ELFA 1GVLA 3UOPA 2FP7B 5EPNA 1DFPA 4ISHH 3UY9A 1F0TA 1WQVH 2Y5FA 5GWZA 2TGTA 1UVTH 1GBKA 2A4GA 2VVCA 1BB0B 4PROA 2GV6A 1AB9B 1KLTA 5FPYA 2VIQA 4E7RG 1ANDA 1AVWA 2TIOA 1O3IA 3SO3A 1C1NA 4GHTA 1QRZA 2JH5D 5HGGA 4XOJA 3UOUA 4JYVH 1ACBE 4O3UA 1DLEA 1S0QA 4UDWH 1IQMA 4I33A 1QB9A 5EW1H 1TNGA 3GY4A 1QB6A 1SFIA 1O3FA 1YPHC 3RC6A 1TNKA 2Y81A 9ESTA 3VGCB 1JBUH 3QK1A 3RMOH 2BX3A 2EI6A 1RTFB 3ZZ6A 1W10U 1PPBH 3O8RA 1TNJA 3OTJE 1C1VH 1RJXB 3A84A 3KHVA 2VIOA 3T62A 3RXEA 4NFFA 1PFXC 1S84A 5E8EH 1UHBB 1EATA 4OS7A 2WUCA 1TMUH 2FDAA 3A8AA 5C3NA 1C5OH 2GCHG 1IAUA 4Y8YA 1IQKA 4XDEA 1JRSA 1P2JA 1YCPH 1D3QB 2ZHDA 3T29A 4ABGA 3ITIA 7LPRA 3QLPH 1H8IH 5EXLA 2AH4X 3DFJA 4J1YA 4H6TA 2QA9E 1BCUH 4X8SH 4NA8A 2F9BH 2FX6A 1VCPA 2G52A 1GJ4H 2C8ZB 1Y3YA 5C5NA 2P3UB 1Q3XA 3PMBB 1HAGE 1BTHH 3ZV8A 1O2UA 1O39A 3TK6A 1QIXB 4OS6A 4DIHH 2BLQA 3VB6A 4D7FA 1TRMA 1QHRB 1Q31A 3PV4A
chains in the Genus database with same CATH superfamily
4WXIA 1CO7E 1O3AA 4DIIH 1XUGA 3TNSA 3RXLA 1P0SH 1IOEA 1D3TB 3BTEE 3KQBA 3LPRA 4HTCH 4ZKOU 1NRRH 1KLJH 4ABBA 2FS8A 1DWEH 1P3EA 1GCTB 1N6YA 4GHQA 3SJOA 2J4IA 1LDTT 3PV2A 3VFEA 4NA9H 3MYWA 4TT3D 2GT8A 1ABIH 1C5LH 2VVVA 1COWD 3SUFA 4WF8A 9LPRA 2BY8X 1BBRH 4BAQB 1A0HB 1W13U 2ZWLH 2UUKB 3GCHC 2OC8A 2ZFRH 1OWJA 3OU0A 2OC7A 1VJAU 3U28C 2A7CA 1AB9C 3GCOA 1PQ8A 1TE0A 2OLGA 4MQAA 1EAXA 1K1IA 3S7HB 1MKXK 1O2ZA 1SGDE 1FI8A 3QX5H 2A5KA 1YLNA 4H4FA 3SV8A 2CV3A 2OBOA 1HAOH 6GCHF 1K1OA 1DXWA 2BDGA 3DT0H 4ABAA 2C90B 2OXSA 2YOLA 1QBOA 2FXRA 4RT1A 3SI4H 3GOVB 2M5TA 3HK3B 2NU0E 1P2MA 1ABJH 3CP7A 1HAIH 1C5ZB 2G4UA 1C2MA 2ZU3A 4BAKB 1NS3A 1O2XA 4FUGA 1FJSA 4X1NU 3D23A 2L6OA 2GMTC 1KMHB 5DP6A 4B2BA 4K5ZA 5JYIA 3HK6B 1V2TT 2F9OA 3E0NB 1YM0A 1VZQH 1O38A 4CRDA 1HAPH 3PTNA 4UD9H 1NU9A 1ZJKA 3E1XB 3P17H 1MBQA 4F49A 1DICA 4I86A 2O8UA 1BRBE 3RXBA 1ID5H 3VB7A 2EY4C 4FUJA 3SV6A 4FUFA 3Q3KA 1C5SA 1IQJA 3KL6A 1BHXF 1HJAB 4DT7B 4FUIA 3H5CB 3Q76A 5DP4A 1NRSH 4YOGA 3LC3A 2BVSH 3TJUA 1C5WB 2C3SA 4JZEH 2EEKA 1E34B 4JZ1A 4UFFH 1FX0B 1RGQA 3SJ9A 2A2QH 3MI4A 1GVZA 1TOMH 4UFEH 1C5TA 1GI9B 1C1QA 1EOLA 3SNCA 4MNVA 4WWYA 4KTUA 1FPCH 3SV9A 1ZPZA 3RXFA 4X1RU 1SGPE 2F91A 2HALA 2GX4A 1C9TA 1GJDB 3MNSA 2K1QA 4CHAB 3MO3A 3BEUA 2PWXA 1TNIA 1MTSA 4JK5A 3KQEA 2LP6A 2B9LA 2BMGB 4VGCC 3RXGA 1XKAC 2ZGJA 1YY3A 2Y80A 1G3BA 1HV7A 2TGPZ 4R8TB 4P00A 3GYMA 3M61U 2BLWA 4CH2B 1O3BA 1BHXB 1YC0A 1GHYH 1GHBG 4X8TH 1S6HA 4DVAU 5C1XA 1LVMA 4A1XA 4XD7D 4ZXXH 3STIA 2Y7ZA 4FVDA 4NIXA 3MU1A 2ZU5A 4D9RA 1GVKB 6GCHG 5AFZH 1AHTH 5EU8A 1V2WT 1ZTJA 3O8DA 5H4IB 2WPJS 4MPXA 4ABHA 1QRWA 5DSFA 1XUIA 2V3HH 2QXGA 1HIAA 2Z9LA 1GJAB 1EASA 3UTUH 1UTOA 3F2GA 1P10A 1SLUB 2Y5GA 4Q7XA 1TQ7B 2ANWA 1BMLA 2JETB 1QB1A 5TCCA 5HM2A 2SGQE 1IQFA 5AF9H 3M7TA 3RC4A 3NWUA 5HM9A 4YTAA 1AFQB 2XC4A 1T8NA 3SUDA 1TNLA 5FBIA 4AORA 4Y11E 1GBLA 3TJVA 3BEFB 2AFQB 1YCPM 2V7QD 1CU1A 3M5LA 1BZXE 1HJAC 1RD3B 4WMEA 3N7EA 3TH4H 3A83A 1G3DA 1H8DH 2C8YB 3DSPA 1UMAH 2WPHS 3WY8A 1TWXB 4HZHA 1EZXC 3PROA 4GVUA 4O9VA 1QJ7B 1SVPA 2ZHEH 4GPGA 5DPAA 1VR1H 2FM2A 3T25A 4CRBA 1Y5BT 1ZZZA 3OSYA 2KZ4A 4AFUA 1A46H 1FDPA 3EE7A 3SU6A 2ZCLP 4LZ4B 2XC5A 1VGCB 5LPFA 1W8BH 3LT3A 2FMJA 3GDUA 3MNXA 2A32A 1SOTA 1WTHD 3ZVEA 3ZZAA 1T31A 3DA9B 2F9NA 4OM9A 3ZZDA 2VH6A 4X1QU 5JBBS 3RU4E 5LGOA 2CXVA 2ANMH 4O97A 4M7GA 4MDSA 2I6QA 1A61H 2BB4A 1UHBA 1VITH 2ZF0H 3P8GA 4NG9H 4X1PU 4UONA 2OP9A 3LOXA 3MU4A 1CE5A 4A7IB 1K1PA 5LPRA 1GI8B 1AWFH 3U69H 2JKHA 5HYOA 2VNTA 1QCPA 1O3LA 1SG8B 1TYNA 3EDXB 1DUAA 2BM2A 3SJ8A 4ZHLU 2XWAA 8GCHF 3T5FH 3PYHA 1H4WA 1HJ9A 1ZPCA 1G37A 3TIUA 1O5DH 2KCPA 1MAYA 1J9CH 4Z6AH 1UTPA 1V6DA 1DY8A 2VJ1A 1IHTH 3KYGA 1P9SA 1T8OA 1P2OA 4Y0YE 1UTMA 4E05H 4NIVA 3M35A 1ELTA 3KQ5A 2ZDNA 3BTKE 4AX9H 2KAIB 3R3GB 3MH5A 3T28A 1AFQC 1K1LA 3SJKA 1Y5AT 1K28D 8LPRA 4WMDA 1WAYB 1Y5UT 1JIRA 1HAYB 1IQNA 1W0KD 3BSQA 1YPEH 1MQ6A 5F6MA 3RXMA 1HXFH 1OPHB 2XCFA 3URDA 3QDZB 5KECA 3EAJA 1GGDB 1EP6A 2H5DA 1MABB 3SYJA 2FODA 1Z8IB 1GMHG 1O2LA 4MNYA 1DT2A 2NU4E 2ZU2A 1O3GA 1PPCE 2ZHQH 1NBME 3F68H 1JIMA 3PO1B 3A87A 4HFPB 1DPOA 4WY3A 3ODDA 2R2MB 1O5FH 4O3TA 1PPHE 3KN2A 4ISLA 3PRBA 4RKOB 1C9PA 1Y3WA 2J98B 3LGWA 4YT6H 3MU8A 2YMSC 3DHKH 4IW4E 1O2MA 5C17A 1C2LA 1SMFE 1HNEE 2P95A 4U01A 1DUEA 2VVUA 3NZIA 2A4RA 4IN1A 1VITG 4YT7H 1Y8TA 1F5KU 1FIWA 5DN6D 1B0EA 1KY9A 1LMWB 2BVXH 3GY7A 4X1SU 1W14U 1EXFA 2A31A 4R0IA 3K6YA 1WQSA 3E0PB 1C2EA 2BOKA 2OC1A 3CNRA 3ENSB 1CVWH 2OC0A 1JMOH 2P8OB 2XBWA 1HAVB 1UO6A 4AGKA 2HGTH 2TGDA 4BTTB 1ZJDA 8ESTE 2HNTE 2BLVA 3HATH 1A5GH 1LPZB 1ARCA 2WV4A 5C2ZA 3SV2H 1JRTA 1WDIA 3M36A 3TK9A 2ZQ1A 1EX3A 2GCTB 2ZDLA 1V2LT 4KGAA 1SGEE 3H7OA 1GHAG 3BTFE 1NN6A 2HWLB 1G32B 3SU5A 1P03A 1SGFG 1ELVA 7ESTE 3A7XA 1SFQB 3RP2A 3A86A 5JB9S 1P2NA 4CH8B 1CQQA 1GMDG 5E0JA 3W1EA 1O5CB 2PKAA 1OYTH 2PLXA 2V0BA 1ANBA 2ESTE 1ZYOA 2XXLA 4B71A 1BTWA 1GGDC 3SZNA 4Y76A 1TX6A 5L2ZH 3FP6E 1C1PA 3BTDE 4AB9A 2AHME 1F92A 2JJ1D 2OINA 5E2PA 3ZZ3A 3TNTA 2YNAA 1O2JA 5FAHA 1FAKH 1L2EA 2ZU4A 4CRGA 4H6SB 1ELEE 3BIUH 1GBJA 1E1RD 1SB1H 1P11E 3QGNB 3U8RH 1P57B 1AY6H 2STAE 3F9FA 2BXTH 1SGNE 2Q6GA 1GDQA 1EOJA 1FY3A 3LONA 2GCHF 1DDJA 1DXPA 2KFWA 1W7GH 6LPRA 1P05A 1UTLM 1VKYA 3MFJA 2A5IA 4Y7BA 1NC6A 1C2JA 3NCLA 2TBSA 1SPJA 4NA7A 5EQRA 3JZ2B 4U32A 3SGAE 3KEEA 1ZGIA 1O35A 2QYIA 1P3CA 2Z7FE 1O3HA 1C2FA 2BDHA 1QJ6B 1YCPK 2A5AA 1ELAA 2W6ID 2BD9A 7KMEH 1GHZA 1P02A 3EA9A 2Z3DA 1D6RA 1DSTA 2FTLE 3QTOH 3A8CA 5L30H 3TJNA 1MTNC 3P70B 3PLPA 1E0FD 2OD3B 3DUXH 5DGJA 3P8OA 1A5IA 3A7WA 4QT8C 2L74A 3ZVDA 3TITA 3I77A 2O8WA 2STBE 1A0JA 1CHOF 1LTOA 1SGIB 1L1NA 3A85A 1K2I1 3MNBA 2SGFE 3NRLA 2G00A 4GLYA 5T1VA 1FZZA 3N99A 2GD4B 1GJ7B 2PUXB 3ESTA 1FY1A 5ETXA 3PMHB 2R2WU 1TGCA 3GCHB 1S81A 1ZSKA 2B0FA 2LELA 2PR3A 5A0BA 2W5EA 4Y7AA 1RXPA 4HGCA 5JB8S 5TCAA 2J38A 2CHAC 4RN6A 4NWKA 1C5RA 2FI3E 1FMGA 2R3UA 4LK4A 4AFZA 1LVOA 1V2NT 1UVOA 2FI4E 1Y3XA 2LPRA 2W3IA 2BHGA 3CS0A 1DWCH 2FOMB 1YLDA 2ZTXA 3GDSA 2XBVA 1O2IA 1TONA 2BDYA 5GXPA 2ODQA 3PLKA 1SQTA 1T4UH 1LVYA 2WINI 2UWLA 5AVDA 1H8ED 2ZGHA 2IN2A 4I31A 2GMTB 3QUMP 4OGYA 4XRNA 4SGBE 5GIBA 1KDQB 4K60A 3GYLB 2A7HA 1YF4A 2PHBA 4ISIH 4GSOA 1EJMA 4HI3A 2BY9X 2EI8A 5ABWA 1PPFE 1BOQA 4I8LA 3RC5A 4ACBA 8KME2 4TWYA 3SW2B 2AGGX 2WYGA 1E35B 3M5NA 1O2VA 4KTSA 1TOCB 2YMSD 3GY2A 1G3EA 2NU3E 5E2OA 1GI5A 3BTWE 4I7YH 1Z8GA 1ZHMA 1SQOA 1TX7A 1AVXA 1GBTA 1EPTC 3ZIAD 5EW2H 1C1UH 1A1RA 2TGAA 4I32A 3P6ZB 2XNDD 4Q80A 5K0HA 3TPIZ 5A09A 2SNVA 3MU0A 1SGRE 3EA8A 3A88A 1OSSA 3DCLA 1KIGH 4JZDH 3RU4T 1O2PA 4Y8XA 5EPYA 2GVFA 1UTJA 1K9OE 1CHOG 3FN8A 2FESH 1KSNA 2ANYA 2VH0A 3LU9B 4JYTA 4OS2A 2IJOB 2ZGXH 3ATMA 2J34A 3TLOA 2QN5T 4HG6A 3PWCA 1PYTC 5BPEA 3T2NA 3IITA 4OS1A 1ORFA 3RXOA 4VGCB 4AGJA 1TB6H 1TLDA 3WW7A 3RXRA 1C1RA 4GCHG 3M3TA 1YPJH 1XUJA 4YESB 2BTCE 1TPPA 5DKMA 2KCYA 1YPGH 3A7YA 2BQWB 4BAHB 1NRPH 2J98A 2ZFSA 3M5OA 3UNSA 4MG3A 2ALPA 2FYRA 2J5UA 2PGBB 5C94A 5SGAE 1GHBF 1MTVA 5EIYA 3F2HA 2Z9IA 2G81E 2GZ7A 3BTGE 2RA3A 1SL3A 4E06H 2YNBA 4ZCNA 1ZPBA 1IQIA 1XUFA 2CMYA 1BJVA 1GJCB 1UTKA 1Z6EA 2OQUA 1KYNA 2Z3CA 2ZGCA 5A0AE 4X8UH 3CENA 1V2UT 2V6NA 1MTWA 1FNIA 2P93A 4AOQA 3BTHE 1EUFA 1MUEB 1OKXA 5CMXH 2Z9JA 1HAVA 1EZSC 4MNXA 4KELA 1C1TA 2ZO3H 2XC0A 3P8FA 1ESTA 1QL8A 1AN1E 3SNDA 2FOFA 2PTNA 1O3PB 4CR9A 1S5SA 2BY7X 2UWPA 3MOCA 4KP0A 1LVBA 1SI5H 2O9QA 2Z9GA 1UVUH 3Q3XA 3M3VA 1F2SE 4CBOA 1O34A 1QBVH 3V7TA 5C20A 1AO5A 4K1EA 1ZLRA 2J2UA 2ZNKH 3FANA 2J95A 5C0UA 4ABFA 1QURH 4B73A 1D3PB 3C1KA 1UVPA 1N8OC 3G01A 4X6MA 2H9EH 2ZQ2A 2WPIS 1C2IA 1O3MA 5T6DA 2WYJA 1L1GA 4MPWA 2WSSD 2ZPQA 1THRH 1SKYE 1F5RA 4NZLA 2Z9KA 1ESBA 3HGPA 2ILNA 5AHGH 5C5OA 4AFQA 1MMJN 1O5AB 1C5PA 4JK6A 2V3MA 4B6FA 1SLVB 5L2YH 1CBWB 5LH8A 5F03A 1O3DA 2H6MA 1MCTA 5KEDA 1O2HA 3PM3A 3RMNH 3BTTE 1C1MA 3BG8A 3HPTB 3OY5U 4B2AA 1GBMA 3ZVAA 5BRRE 1ELCA 3P92A 1GWAA 3MH4A 1VCWA 1TRNA 2JJ2D 2O8MA 4B2CA 3SGQE 1P9UA 1ZR0A 4BAOB 1BRCE 3L3TA 3VB4A 1QA7A 2PFEA 2SGPE 3Q3YA 2BDBA 1E38B 1F7ZA 4MNWA 1UCYE 1KXDA 4Y6DA 1Z8JB 3MU5A 1NFUA 2BVRH 2ZFQH 2VWLA 2FOBA 1T8LA 2GDDA 2ZFFH 1H9LB 5FCKA 3UUZA 5A0CA 4FUHA 3S69A 2CGAA 3ZVCA 4X2VA 4DURA 4FUCA 1ETRH 1AI8H 1FUJA 1SLXB 5PTPA 3RXKA 3EE0B 3PB1E 4P02A 2AMPA 1WXRA 4NIWA 2AMQA 3E8LA 4YOIA 2VGCB 2BQ7B 3HGNA 3LH3A 2HPPH 4MTBA 3M5MA 1O32A 4FU9A 4YZUA 1FAXA 5B6OA 4ZMAH 5HXFA 2Q6FA 1SSXA 4OGXA 3RXAA 2OCVB 3AAVA 1OOKB 3JZ1B 1BTYA 1GCDA 1GHWH 2GP9B 4IN2A 5ESTE 2TPIZ 2B7DH 4E7NA 1H9IE 3LIWA 3MH6A 3ZZBA 1AZZA 2JH0D 1GMHF 1CSOE 1DITH 1NRQH 1NM6A 5CDFE 1CT4E 2QF4A 4AYYB 1LQDB 1V2ST 1QRXA 2R0LA 3RXCA 1TPOA 2K8IA 1GG6B 3BG4C 3E16B 1ZSLA 4NSVA 3FFGA 2A1DB 2OBQA 1EFRD 3ZZ7A 4DG4A 3UR6A 1GI0A 1S6FA 2YMSB 1C5NH 1O3NA 1ZOMA 2PP6A 1EAUA 1CBWC 3S9CA 1E1QD 3BF6H 1DLKB 1ARBA 3A7ZA 3RXSA 1XMNB 2P3TB 3MWIU 3SQHE 1B0FA 1VITF 1WV7H 3FOAA 1HYLA 3FAOA 3TGIE 1YPLH 4RSPA 1KDQA 3BEIB 2KX4A 4JZIA 2PKSC 1PYTD 3NUMA 1ELGA 4SGAE 3TH3H 1T4VH 1RFNA 1RTKA 5JBCS 4K1SA 4ZXYH 3KF2A 1BMNH 1OP2A 2EA3A 1AD8H 3ELAH 3Q00A 1W0JD 4F55A 1EAIA 2SGAA 5T3HA 1GJ9B 2G5NA 1OHHD 1BIOA 4FU8A 2R3YA 4NCYA 2F9UA 5T6FA 4H42U 1GJ8B 1Y3VA 4XFQA 4INHA 3LKWA 3ZYEA 2SGEE 2FOEA 3MMGA 1SHYA 1PQ5A 1D4PB 1GHAF 3URCA 1A4WH 1NPMA 1RRKA 1S0RA 3RXQA 2ZPRA 3I29A 3GY3A 1KXEA 2QF3A 3ZZ9A 1U6QA 2BD7A 1L0ZA 4X2YA 1J17T 2VGCC 5J4QA 2HNTC 3FP8E 3KQDA 1K0HA 1W0YH 3SNEA 1GJBB 2QGRA 3BN9A 1AIXH 1GMDF 4UFGH 2H9TH 1RS0A 5DK1A 1GBBA 1ELBA 1TNHA 2G51A 1DY9A 5I46H 3HKJB 1NTPA 1C4Y2 1A0LA 1AGJA 2IJD1 5DJ7A 3QO6A 3PV5A 4CRFA 2P94A 3AAUA 1GBHA 1UK3A 2BX4A 1D9IA 1GDNA 2HVXA 1GG6C 3DSGA 1SC8U 4Z1MD 5I25A 1TGSZ 4D76A 3BTQE 1QNJA 3N7DA 5A8ZA 2J94A 4CR5A 1FN8A 1IQLA 3SHCH 3EA7A 3T26A 3TJOA 2ZDAH 3H7TA 3UPEA 3VPKA 1C1SA 4I8HA 2XW9A 2OQ5A 4TYDA 1CA0C 4ESTE 5TJXA 1NESE 2R9PA 1LO6A 1GBCA 5IK2D 2Y6TA 3WWFA 2DUCA 1KTTB 2KCAA 2XOKD 4X8VH 3EYDA 1BTXA 4NIYA 1K21H 3ZV9A 3GCTG 1D6WA 4ISNA 1Z1JA 3FVFB 1UTNA 4ISOA 1MTNB 3CS7A 4JYUH 2FWWA 2IPHA 1KXAA 2EI7A 1HAXB 1ETSH 4MPVA 4A6LA 1WCZA 2FI5E 1K1JA 2HPQH 1SQAA 2BLOA 1J15A 3TU7H 3BIVH 3K65B 1D3DB 3PMJA 3LGTA 4IC5A 1LKBA 1C5UA 1O2SA 1SGCA 3PMAB 5GDSH 1THPB 4JCNA 1NFXA 1A3EH 3RU4D 1ESAA 3SU1A 1EZQA 2ZTZA 2RCEA 2BDIA 2FEQH 3K9XB 1S85A 1GI3A 1MKWK 4ABIA 3SV7A 5FPSA 5J4SA 1LHCH 4RKJB 4IC6A 2GGVB 3RLYH 4BXSA 2CHAB 1LHFH 3SOSA 1MAXA 2A4QA 4FUDA 4Q7ZA 1O3OA 2D26C 4F4OC 4UFDH 2FO9A 4YLUA 3ZZ4A 4A1VA 1G2MA 3SBKA 1NFYA 1BRAA 1C5MD 5GNDA 2ZEBA 1TBZH 1OWKA 2BD3A 4IMQA 3I78A 1WU1A 1AE5A 3B23B 5C1UA 1K1MA 1T8MA 2AMDA 3MO6A 3GICB 1AU8A 3U98H 1B7XB 1SHHB 3U8TH 1GI1A 1MU6B 4XSKU 2ASUB 4AG1A 5L6NH 1FIZA 3E90B 1NRNH 1GJ5H 1C5QA 3KIDU 4ASUD 5EG4A 2QY0B 2FZZA 1H9HE 3RUOA 3A89A 2C8WB 1WYKA 1J14A 3P95A 1MCVA 1P04A 4ABJA 2Y82A 3ATLA 1QTFA 3ATKA 1NFWA 5FBEA 1PPZA 1GDUA 1DSUA 2M2AA 3U1IB 2PSXA 2HRVA 3F9HA 5EOKA 1TBQH 2P16A 1CHGA 1O5GH 5C0TA 1INCA 3F6UH 1QA0A 1SOZA 1EPTB 3GS9A 4MPUA 1YYY1 2VINA 1NBMD 6CHAC 1ZMNA 1O2NA 5EGMA 5DO4H 5HIZA 4YOJA 2GJGA 2G8TA 2OTVA 2WV5A 1AVGH 1O3EA 1MQ5A 2ALVA 2ZHWH 3TGKE 2ZFPH 4Q2KA 3SN8A 3ATWA 3SU3A 4Y71A 4NFEA 3MH7A 5G4BA 1O0DH 2PUQH 3SU4A 1K1NA 1FXYA 1T7CA 2ZCHP 2HOBA 2IPQX 1GBEA 2XBYA 5A8YA 1TABE 5A2MH 2QAAA 2IOTA 5EXNA 2D8WA 1GI6A 1HAZB 1YLCA 4IMZA 1O37A 5CE1A 1XXFA 1O2TA 4GCHF 2CN0H 3B9FH 2QIQA 4DCDA 1V2RT 4JMYA 3M37A 1UCYH 3UQVA 2P3FH 1GHXH 2ZIQH 1GMCG 2ZPSA 2BD8A 3V3MA 1ANEA 1MZAA 2FTMA 3ZYDA 3S9AA 2NWNA 1J8AA 3A80A 1NROH 4UE7H 2HLCA 3V0XA 4X2XA 5HKKD 1BBRK 5K7RA 3ZVGA 2FS9A 1BUIA 4XBCA 2AGIX 2WPLS 4THNH 1C4V2 3K2UA 4IBLH 1AUTC 1O3CA 1LHGH 1TA2A 4I8KA 1C5YB 4A5TS 2NU2E 2FOCA 2GDEH 2KM0A 1FONA 4BXWA 1GI7B 3AASA 2KR7A 2FOAA 1QL7A 4TY7A 4FUEA 2P59A 3RM0H 1QZ8A 2RG3A 5EQQA 1QQ4A 2AERH 3LC5A 4KKDA 4ZHMU 1SGTA 1DE7H 2A2XH 1G9IE 1TRYA 3T27A 6ESTA 2ZDMA 1XM1A 1TMBH 5ESBA 2PSYA 1NO9H 2W3KA 3NPSA 1DANH 2G4TA 3SNAA 3UNQA 2EC9H 2WHXA 3SU2A 3OTPA 3SHAH 3FO8D 1IQEA 1C1OA 3E6PH 3UR9A 2PGQB 1C1WH 1V2OT 3MHWU 2KAIA 3KGPA 1N8OB 2ZKSA 1P12E 3S7KB 1B5GH 1GBDA 2BZ6H 3F2FA 1HRTH 1O2KA 1FLEE 1QFKH 1W3CA 3UQOA 2LNCA 2NU1E 3LGUA 1A7SA 1O3JA 3K6ZA 2H9HA 3LJJA 2F4LA 2ODPA 2XBXA 1SLWB 5FX5A 2QXHA 1ETTH 2TRMA 2VU8E 1HXEH 3RXPA 3MNCA 2DE8A 3L33A 2VWMA 3ZZ8A 2I6SA 1LKAA 2JH6D 4WVPE 4NSYA 3GY6A 2BY5X 4FETA 4DGJA 4ZUHA 5EXMA 1BTPA 1G2LA 4BANB 1TGTA 2QF0A 3N7OA 2Q1JA 3RLWH 1Y59T 1F5LA 4FXGH 1P2QA 1T32A 4IGDA 3R0FA 1SGFA 1KLIH 3FZZA 3A8DA 4AYVB 1O2QA 1SGYE 2BDCA 1DWDH 4Y8ZA 1YPHE 1YBWA 4FU7A 5DP8A 1O2YA 4LZ1H 1FY4A 3KQCA 1UK4A 2RDEA 3TVJB 1MTUA 3VB5A 4Q7YA 1V2VT 1MH0A 4X6PA 2D1JA 1TA6A 4ZKSU 4WJG2 4K69A 2SNWA 2BYAX 1GL0E 1TGBA 1N6XA 1DWBH 2GTBA 3AW0A 1S83A 4BTIB 2UUFB 3A82A 3TH2H 1Z7KA 4K2YA 5FX6A 1XUKA 1Z6JH 1WTGH 1HUTH 2W7UA 3PLBA 4I8GA 5T6GA 2A4OA 2H5CA 3B8JA 3EGKH 5IYTA 3VGCC 1V2QT 5FPTA 1CT2E 3UIRA 3W94A 1TFXA 2VIWA 3PTBA 2Z3EA 1HBTH 1O2RA 2W6JD 5F8TA 1Y3UA 2VB0A 1NU7B 2HLDD 2BD2A 3SI3H 5C1YA 1K22H 1LQEA 5CHBA 3DD2H 1V3XA 7GCHF 3BG4B 3UWIA 4DT4A 4INKA 3VXEH 4DW2U 4YO9A 4BAMB 2VIVA 2FYQA 2WV9A 3DSOA 1HDTH 1SQRA 5HIYA 1BMAA 4AFSA 3P8NA 2FPZA 3UREA 3SORA 1C4U2 2BY6X 4KTCA 1FQ3A 2A45B 4ASHA 5EJ1A 2V3OH 4NWLA 4FOUC 3V12A 1JOUB 4CRAA 2B5TB 2HNTF 2F9PA 1W2KH 2ULLA 2AIPA 2V35A 5DP7A 2XTTB 5FL7D 5FHTA 1VJ9U 4ACAA 1GBFA 1YWUA 1CGHA 3PWBA 2PKSB 1EP5A 1KXCA 2JDID 4GAWA 5AFYH 4MVNA 3LGYA 3M7UA 3SQEE 1EZUC 4O03A 1GCTC 2PKAB 3OEHD 1MKXH 3GY5A 1O36A 2Y7XA 1GI4A 1CT0E 1FV9A 1O3KA 4U30A 3TGJE 3QZQA 2ZDVH 1RIWB 5E0HA 2BDAA 2J92A 3D62A 1ZRKA 1KXBA 1XUHA 2RDLA 5CHAB 1QGFA 1EPTA 1ANCA 1KXFA 2GT7A 3A8BA 4AG2A 3AK5A 5EODA 3OYPA 3RMLH 2THFB 4Q4LA 2BQ6B 1AZ8A 2Z6BD 1C5XB 1UK2A 2XCNA 1LHDH 2UUJB 3FKSD 2WPDD 1ZTKA 5DP3A 1BTUA 5DP5A 1C5VA 1EAWA 1THSH 1PQ7A 2BZAA 3OEED 3OX7U 4GUXA 4XBDA 3VXFH 5DP9A 1IQHA 1BA8B 1TALA 4ZKRU 2CJIA 4A1TA 2PV9B 1HAHH 1AKSB 1Z8RA 1LPKB 2PW8H 1YPKH 2O8LA 1NT1A 2UUYA 1C2HA 4U2WA 1GHVH 2ZZUH 4K3JA 7GCHG 1GPZA 3NK8A 3SZEA 3A81A 4WH6A 1HGTH 5DG6A 3ZVFA 2OUAA 2BXUH 3F9GA 1CA8B 2QC2A 4K8YA 1GBAA 2CK3D 2WPKS 1CA0B 4BOHA 1TQ0B 4DJZB 4YM9A 2J97A 4B6EA 1E79D 3E91A 3KNXA 4WXVA 4FUBA 3PRDA 2XYAA 5JBTA 3S0NA 5GCHF 2HVYB 1QL9A 4A92A 1P01A 2AS9A 1O5BB 1PQAA 4RT0A 3TK5A 3RXHA 2C8XB 4Z0KA 4AZ2B 1OP8A 3QWCH 2QCYA 2D2DA 3GCTF 3EQ0H 1P2KA 2Y5HA 1O5EH 4CHAC 2FIRH 1IQGA 1O2WA 1C2GA 3SUEA 1GI2A 3OAAD 4B1TA 4D9QA 3F0PA 3RXTA 2ZFTA 1XX9A 2SGDE 1RIWC 5JDUB 5C67A 1O33A 3VB3A 2F83A 2GZ8A 1TBRH 4YLQH 1OWIA 1DX5M 5CHAC 2VBCA 2ZI2H 1OXGA 1W11U 2QXJA 2ZC9H 4OS5A 1KTSB 5F53A 1BBRE 2ZHFH 3SGBE 2O8TA 5EJZA 2DE9A 4Y10E 1PPEE 1FY5A 1TPAE 3STJA 3KCGH 3RXUA 3HKIB 1BITA 1TAWA 1YPMH 2QXIA 5B6LA 1Q2WA 4X6NA 2CF8H 4MLFB 1DM4B 3OFND 1TX8A 1A3BH 2FOHA 1TPSA 2K0QA 1M9UA 3QZRA 3IG6B 3VG8A 2BOHB 2RA0A 4ZAEA 2AEIH 3ATIA 1LPGB 5F8ZA 1V2PT 2ZTYA 1V2JT 1ZHPA 2JETC 1CGJE 2VWNA 2C93B 3AVZA 1QJ1B 1AE8H 1WBGB 4K1TA 1BMMH 1E37B 1BJUA 2QF5A 3Q77A 1N1LA 1QQUA 3O8BA 1F0UA 1AFEH 4WMFA 1F0SA 4K8BA 2SFAA 3SJIA 1LCYA 4D8NA 2QV1A 2XWBI 4INLA 3RXDA 2WZQA 1V2KT 1MD7A 1SGQE 2ZGBH 2C4FH 1DS2E 1BTZA 3DFLA 1WSSH 1L1JA 4LOYH 1OP0A 1X7AC 3RMMH 1XKBC 2GV7A 5F8XA 2G5VA 1XXDA 5GPIB 5IDKA 4B75A 3GCNA 5GJ4B 2KCOA 3RXJA 4ABEA 1G3CA 2GZ9A 3FZDA 4CRCA 3L6PA 2Z94A 5FCRA 5EQSA 1S82A 1NZQH 4CBNA 4J2YB 3M3SA 1VGCC 4Y0ZE 2VIDA 3D65E 3KYFA 5GCHG 2WUBA 1WOFA 2W7SA 1OX1A 2F43B 1HB0B 4DOQA 1HJ8A 1HFDA 3QTVH 1YP9A 4JZFH 3RM2H 1ZHRA 2ZDKA 1NY22 6CHAB 1EB1H 2EQNA 2ZA5A 1Z1IA 3OY6U 3H09A 3U9AH 2VWOA 3SU0A 1L4DA 3M7QA 2BD5A 1HPGA 2ZCKP 1FY8E 1AUJA 3F0OA 1L4ZA 1VCQA 1ZSJA 4FVBA 3SUGA 4Y79A 1P06A 3F3BA 1DOJA 1ZMLA 2G55A 3FP7E 4NZQA 2OK5A 1AMHA 4BNRA 1BQYA 2F3CE 2ODYB 5KGOA 4XE4A 1P09A 3MQKC 1UTQA 4AC9A 1EB2A 1BDAA 1EJNA 8GCHG 4ZH8A 1GBIA 2F9VA 1YGCH 2FX4A 1O2GH 1ZTLA 1MD8A 3LGIA 5LPEA 1GMCF 2FLBH 4XBBA 3OE7D 4OS4A 3W95A 5HMAA 1IHSH 1JXPA 3ZZ5A 1WUNH 3U1JB 1PPGE 2AIQA 4UEHH 1A5HA 1W7XH 4ZHAA 4CREA 1XVOA 1QR3E 3SNBA 3U8OH 3MO9A 1UCYK 2CF9H 5E0GA 3NKKA 4DY7B 1C2DA 3C27B 1AQ7A 3O8CA 1QBNA 1EKBB 3RDZA 2B8OH 1OWHA 3LH1A 4TPYA 4IS5A 1P2IA 2AYWA 3A7TA 3D49H 1O2OA 3UFAA 1C2KA 1G36A 1OYQA 5FXLA 3RXIA 4ZROA 3F9EA 2AGEX 3GDVA 4B76A 3UWJH 4X0WU 3MTYA 1GL1A 1LHEH 2A0QB 2XRCA 1ZGVA 2J9NA 1Z71A 3S9BA 3QGJA 1TGNA 1E36B 1SR5C 2R0KA 1HLTH 1W0ZU 2ZP0H 1AWHB 1ELDE 1JWTA 3BTME 4B74A 2H2ZA 1MBMA 1F0RA 2WPMS 1O31A 3PO1C 1XVMA 2ZU1A 3NXPA 1UJ1A 3ZVBA 1MZDA 1QY6A 1MU8B 2BD4A 4ABDA 2ANKH 1EJAA 1V2MT 4TWWA 1HCGA 3ZZCA 4NGAH 2QE7D 1GJ6A 1OWEA 1BMFD 1CGIE 1ZRBA 1ZMJA 2W26A 3AW1A 3BV9B 2PTCE 2Q6DA 1H1BA 3GISB 3LGVA 5A8XA 1SBWA 2ZECA 1DVAH 1BRUP 4TPIZ 5JBAS 1EQ9A 3ODFA 2H1UA 2UWOA 2FOGA 4AB8A 3LJOA 4D7GA 1PJPA 1AKSA 1UVSH 2VIPA 1G30B 3V13A 2FLRH 2XNIA 2ZG0H 2GKVE 1HIAB 4BTUB 1OS8A 1TIOA 1RTLA 2P8OC 1O30A 1FN6A 4LXBH 3GY8A 1A2CH 1W12U 4M9FA 1OWDA 5EJLA 3RXVA 5JPMH 3UNRA 3LDXH 3E3TA 4TY6A 3F1SB 4YXWD 3A7VA 4I8JA 1J16A 4X2WA 1BT7A 1FPHH 2A7JA 1MKWH 1TMTH 4WH8A 1P8VC 3VEQB 3IWMA 4X6OA 4ZKNU 1YKTA 4AN7A 3QN7A 2GCTC 1ELFA 1GVLA 3UOPA 2FP7B 5EPNA 1DFPA 4ISHH 3UY9A 1F0TA 1WQVH 2Y5FA 5GWZA 1H8HD 2TGTA 1UVTH 1GBKA 2A4GA 2VVCA 1BB0B 4PROA 2GV6A 1AB9B 2RFKC 1KLTA 5FPYA 2VIQA 4E7RG 1ANDA 1AVWA 2TIOA 1O3IA 3SO3A 1C1NA 4GHTA 1QRZA 2JH5D 5HGGA 4XOJA 3UOUA 4JYVH 1ACBE 4O3UA 1DLEA 1S0QA 4UDWH 1IQMA 4I33A 1QB9A 5EW1H 1TNGA 3GY4A 1QB6A 1SFIA 1O3FA 1YPHC 3RC6A 1TNKA 2Y81A 9ESTA 3VGCB 1JBUH 4TSFD 3QK1A 3RMOH 2BX3A 2EI6A 1RTFB 3ZZ6A 1W10U 1PPBH 3O8RA 1TNJA 3OTJE 1C1VH 1RJXB 3A84A 3KHVA 2VIOA 3T62A 3RXEA 4NFFA 1PFXC 1S84A 5E8EH 1UHBB 3UB0A 1EATA 4OS7A 2WUCA 1TMUH 2FDAA 3A8AA 3WWBA 5C3NA 1C5OH 2GCHG 1IAUA 4Y8YA 1IQKA 4XDEA 1JRSA 1P2JA 1YCPH 1D3QB 2ZHDA 3T29A 4ABGA 3ITIA 7LPRA 3QLPH 1H8IH 5EXLA 2AH4X 3DFJA 4J1YA 4H6TA 4RI0A 2QA9E 1BCUH 4Q63A 1S6LA 4X8SH 4NA8A 2F9BH 2FX6A 1VCPA 2G52A 1GJ4H 2C8ZB 1Y3YA 5C5NA 2P3UB 1Q3XA 3PMBB 1HAGE 1BTHH 3ZV8A 1O2UA 1O39A 3TK6A 1QIXB 4OS6A 4DIHH 2BLQA 3VB6A 1UW7A 4D7FA 1TRMA 1QHRB 4F48B 3UAIC 2JIZD 1Q31A 3PV4A
chains in the Genus database with same CATH topology
4WXIA 1CO7E 1O3AA 4DIIH 1XUGA 3TNSA 3RXLA 1P0SH 1IOEA 1D3TB 3BTEE 3KQBA 3LPRA 4HTCH 4ZKOU 1NRRH 1KLJH 4ABBA 2FS8A 1DWEH 1P3EA 1GCTB 1N6YA 4GHQA 3SJOA 2J4IA 1LDTT 3VFEA 4NA9H 3MYWA 2GT8A 1ABIH 1C5LH 2VVVA 3SUFA 4WF8A 9LPRA 2BY8X 1BBRH 4BAQB 1A0HB 1W13U 2ZWLH 2UUKB 3GCHC 2OC8A 2ZFRH 1OWJA 3OU0A 2OC7A 1VJAU 2A7CA 1AB9C 3GCOA 1PQ8A 1TE0A 2OLGA 4MQAA 1EAXA 1K1IA 3S7HB 1MKXK 1O2ZA 1SGDE 1FI8A 3QX5H 2A5KA 4H4FA 3SV8A 2CV3A 2OBOA 1HAOH 6GCHF 1K1OA 1DXWA 2BDGA 3DT0H 4ABAA 2C90B 2OXSA 2YOLA 1QBOA 2FXRA 3SI4H 3GOVB 2M5TA 3HK3B 2NU0E 1P2MA 1ABJH 3CP7A 1HAIH 1C5ZB 2G4UA 1C2MA 2ZU3A 4BAKB 1NS3A 1O2XA 4FUGA 1FJSA 4X1NU 3D23A 2GMTC 5DP6A 4B2BA 4K5ZA 5JYIA 3HK6B 1V2TT 2F9OA 3E0NB 1YM0A 1VZQH 1O38A 4CRDA 1HAPH 3PTNA 4UD9H 1NU9A 1ZJKA 3E1XB 3P17H 1MBQA 4F49A 1DICA 2O8UA 1BRBE 3RXBA 1ID5H 3VB7A 4FUJA 3SV6A 4FUFA 3Q3KA 1C5SA 1IQJA 3KL6A 1BHXF 1HJAB 4DT7B 4FUIA 3H5CB 3Q76A 5DP4A 1NRSH 4YOGA 3LC3A 2BVSH 3TJUA 1C5WB 2C3SA 4JZEH 2EEKA 1E34B 4JZ1A 4UFFH 1RGQA 3SJ9A 2A2QH 3MI4A 1GVZA 1TOMH 4UFEH 1C5TA 1GI9B 1C1QA 1EOLA 3SNCA 4MNVA 4WWYA 4KTUA 1FPCH 3SV9A 1ZPZA 3RXFA 4X1RU 1SGPE 2F91A 2HALA 2GX4A 1C9TA 1GJDB 3MNSA 2K1QA 4CHAB 3MO3A 3BEUA 2PWXA 1TNIA 1MTSA 4JK5A 3KQEA 2B9LA 2BMGB 4VGCC 3RXGA 1XKAC 2ZGJA 2Y80A 1G3BA 1HV7A 2TGPZ 4R8TB 3GYMA 3M61U 2BLWA 4CH2B 1O3BA 1BHXB 1YC0A 1GHYH 1GHBG 4X8TH 1S6HA 4DVAU 5C1XA 1LVMA 4A1XA 4ZXXH 3STIA 2Y7ZA 4FVDA 4NIXA 3MU1A 2ZU5A 4D9RA 1GVKB 6GCHG 5AFZH 1AHTH 5EU8A 1V2WT 1ZTJA 3O8DA 5H4IB 2WPJS 4MPXA 4ABHA 1QRWA 1XUIA 2V3HH 2QXGA 1HIAA 2Z9LA 1GJAB 1EASA 3UTUH 1UTOA 1P10A 1SLUB 2Y5GA 4Q7XA 1TQ7B 2ANWA 1BMLA 2JETB 1QB1A 5TCCA 5HM2A 2SGQE 1IQFA 5AF9H 3M7TA 3RC4A 3NWUA 5HM9A 4YTAA 1AFQB 2XC4A 1T8NA 3SUDA 1TNLA 5FBIA 4AORA 4Y11E 1GBLA 3TJVA 3BEFB 2AFQB 1YCPM 1CU1A 3M5LA 1BZXE 1HJAC 1RD3B 4WMEA 3TH4H 3A83A 1G3DA 1H8DH 2C8YB 1UMAH 2WPHS 3WY8A 1TWXB 4HZHA 1EZXC 3PROA 4GVUA 4O9VA 1QJ7B 1SVPA 2ZHEH 4GPGA 5DPAA 1VR1H 2FM2A 3T25A 4CRBA 1Y5BT 1ZZZA 3OSYA 4AFUA 1A46H 1FDPA 3SU6A 2ZCLP 4LZ4B 2XC5A 1VGCB 5LPFA 1W8BH 3LT3A 2FMJA 3GDUA 3MNXA 2A32A 1SOTA 1WTHD 3ZVEA 3ZZAA 1T31A 3DA9B 2F9NA 3ZZDA 2VH6A 4X1QU 5JBBS 3RU4E 5LGOA 2CXVA 2ANMH 4O97A 4M7GA 4MDSA 1A61H 2BB4A 2I6QA 1UHBA 1VITH 2ZF0H 3P8GA 4NG9H 4X1PU 4UONA 2OP9A 3LOXA 3MU4A 1CE5A 4A7IB 1K1PA 5LPRA 1GI8B 1AWFH 3U69H 2JKHA 5HYOA 2VNTA 1QCPA 1O3LA 1SG8B 1TYNA 3EDXB 1DUAA 2BM2A 3SJ8A 4ZHLU 2XWAA 8GCHF 3T5FH 3PYHA 1H4WA 1HJ9A 1ZPCA 1G37A 3TIUA 1O5DH 1MAYA 1J9CH 4Z6AH 1UTPA 1V6DA 1DY8A 2VJ1A 1IHTH 1P9SA 1T8OA 1P2OA 4Y0YE 1UTMA 4E05H 4NIVA 3M35A 1ELTA 2ZDNA 3BTKE 4AX9H 2KAIB 3R3GB 3MH5A 3T28A 1AFQC 1K1LA 3SJKA 1Y5AT 1K28D 8LPRA 4WMDA 1WAYB 1Y5UT 1JIRA 1HAYB 1IQNA 3BSQA 1YPEH 1MQ6A 5F6MA 3RXMA 1HXFH 1OPHB 2XCFA 3URDA 3QDZB 3EAJA 1GGDB 1EP6A 2H5DA 2FODA 1Z8IB 1GMHG 1O2LA 4MNYA 1DT2A 2NU4E 2ZU2A 1O3GA 1PPCE 2ZHQH 3F68H 1JIMA 3PO1B 3A87A 4HFPB 1DPOA 4WY3A 3ODDA 2R2MB 1O5FH 4O3TA 1PPHE 3KN2A 4ISLA 4RKOB 1C9PA 1Y3WA 3LGWA 4YT6H 3MU8A 3DHKH 4IW4E 1O2MA 1C2LA 1SMFE 1HNEE 2P95A 4U01A 1DUEA 2VVUA 3NZIA 2A4RA 4IN1A 1VITG 4YT7H 1Y8TA 1F5KU 1FIWA 1B0EA 1KY9A 1LMWB 2BVXH 3GY7A 4X1SU 1W14U 1EXFA 2A31A 4R0IA 3K6YA 1WQSA 3E0PB 1C2EA 2BOKA 2OC1A 3ENSB 1CVWH 2OC0A 1JMOH 2P8OB 2XBWA 1HAVB 1UO6A 4AGKA 2HGTH 2TGDA 4BTTB 1ZJDA 8ESTE 2HNTE 2BLVA 3HATH 1A5GH 1LPZB 1ARCA 2WV4A 5C2ZA 3SV2H 1JRTA 3M36A 3TK9A 2ZQ1A 1EX3A 2GCTB 2ZDLA 1V2LT 4KGAA 1SGEE 3H7OA 1GHAG 3BTFE 1NN6A 2HWLB 1G32B 3SU5A 1P03A 1SGFG 1ELVA 7ESTE 3A7XA 1SFQB 3RP2A 3A86A 5JB9S 1P2NA 4CH8B 1CQQA 1GMDG 5E0JA 1O5CB 2PKAA 1OYTH 2PLXA 2V0BA 1ANBA 2ESTE 1ZYOA 2XXLA 4B71A 1BTWA 1GGDC 3SZNA 4Y76A 1TX6A 5L2ZH 3FP6E 1C1PA 3BTDE 4AB9A 1F92A 2OINA 5E2PA 3ZZ3A 3TNTA 2YNAA 1O2JA 5FAHA 1FAKH 1L2EA 2ZU4A 4CRGA 4H6SB 1ELEE 3BIUH 1GBJA 1SB1H 1P11E 3QGNB 3U8RH 1P57B 1AY6H 2STAE 3F9FA 2BXTH 1SGNE 2Q6GA 1GDQA 1EOJA 1FY3A 3LONA 2GCHF 1DDJA 1DXPA 1W7GH 6LPRA 1P05A 1UTLM 3MFJA 2A5IA 4Y7BA 1NC6A 1C2JA 3NCLA 2TBSA 1SPJA 4NA7A 5EQRA 3JZ2B 4U32A 3SGAE 3KEEA 1ZGIA 1O35A 2QYIA 1P3CA 2Z7FE 1O3HA 1C2FA 2BDHA 1QJ6B 1YCPK 2A5AA 1ELAA 7KMEH 2BD9A 1GHZA 1P02A 3EA9A 2Z3DA 1D6RA 1DSTA 2FTLE 3QTOH 3A8CA 5L30H 3TJNA 1MTNC 3P70B 3PLPA 1E0FD 2OD3B 3DUXH 5DGJA 3P8OA 1A5IA 3A7WA 4QT8C 3ZVDA 3TITA 3I77A 2O8WA 2STBE 1A0JA 1CHOF 1LTOA 1SGIB 1L1NA 3A85A 1K2I1 3MNBA 2SGFE 2G00A 4GLYA 1FZZA 2GD4B 1GJ7B 2PUXB 3ESTA 1FY1A 5ETXA 3PMHB 2R2WU 1TGCA 3GCHB 1S81A 1ZSKA 2B0FA 2PR3A 5A0BA 2W5EA 4Y7AA 1RXPA 4HGCA 5JB8S 5TCAA 2J38A 2CHAC 4RN6A 4NWKA 1C5RA 2FI3E 1FMGA 2R3UA 4LK4A 4AFZA 1LVOA 1V2NT 1UVOA 2FI4E 1Y3XA 2LPRA 2W3IA 2BHGA 3CS0A 1DWCH 2FOMB 1YLDA 2ZTXA 3GDSA 2XBVA 1O2IA 1TONA 2BDYA 5GXPA 2ODQA 3PLKA 1SQTA 1T4UH 1LVYA 2WINI 2UWLA 5AVDA 2ZGHA 2IN2A 4I31A 2GMTB 3QUMP 4OGYA 5GIBA 4SGBE 1KDQB 4K60A 3GYLB 2A7HA 1YF4A 2PHBA 4ISIH 4GSOA 1EJMA 4HI3A 2BY9X 2EI8A 5ABWA 1PPFE 1BOQA 4I8LA 3RC5A 8KME2 4TWYA 3SW2B 2AGGX 2WYGA 1E35B 3M5NA 1O2VA 4KTSA 1TOCB 3GY2A 1G3EA 2NU3E 5E2OA 1GI5A 3BTWE 4I7YH 1Z8GA 1ZHMA 1SQOA 1TX7A 1AVXA 1GBTA 1EPTC 5EW2H 1C1UH 1A1RA 2TGAA 4I32A 3P6ZB 4Q80A 5K0HA 3TPIZ 5A09A 2SNVA 3MU0A 1SGRE 3EA8A 3A88A 1OSSA 1KIGH 4JZDH 3RU4T 1O2PA 4Y8XA 5EPYA 2GVFA 1UTJA 1K9OE 1CHOG 2FESH 1KSNA 2ANYA 2VH0A 3LU9B 4JYTA 4OS2A 2IJOB 2ZGXH 3ATMA 2J34A 3TLOA 2QN5T 3PWCA 1PYTC 5BPEA 3T2NA 3IITA 4OS1A 1ORFA 3RXOA 4VGCB 4AGJA 1TB6H 1TLDA 3RXRA 1C1RA 4GCHG 3M3TA 1YPJH 1XUJA 4YESB 2BTCE 1TPPA 5DKMA 1YPGH 3A7YA 2BQWB 4BAHB 1NRPH 2ZFSA 3UNSA 3M5OA 4MG3A 2ALPA 2FYRA 2PGBB 5SGAE 1GHBF 1MTVA 2Z9IA 2G81E 2GZ7A 3BTGE 2RA3A 1SL3A 4E06H 2YNBA 1ZPBA 1IQIA 1XUFA 2CMYA 1BJVA 1GJCB 1UTKA 1Z6EA 2OQUA 1KYNA 2Z3CA 2ZGCA 5A0AE 4X8UH 3CENA 1V2UT 2V6NA 1MTWA 1FNIA 2P93A 4AOQA 3BTHE 1EUFA 1MUEB 1OKXA 5CMXH 2Z9JA 1HAVA 1EZSC 4MNXA 4KELA 1C1TA 2ZO3H 2XC0A 3P8FA 1ESTA 1QL8A 1AN1E 3SNDA 2FOFA 2PTNA 1O3PB 4CR9A 1S5SA 2BY7X 2UWPA 3MOCA 4KP0A 1LVBA 1SI5H 2O9QA 2Z9GA 1UVUH 3Q3XA 3M3VA 1F2SE 4CBOA 1O34A 1QBVH 3V7TA 5C20A 1AO5A 4K1EA 1ZLRA 2J2UA 2ZNKH 3FANA 2J95A 4ABFA 1QURH 4B73A 1D3PB 3C1KA 1UVPA 1N8OC 3G01A 4X6MA 2H9EH 2ZQ2A 2WPIS 1C2IA 1O3MA 5T6DA 2WYJA 1L1GA 4MPWA 2ZPQA 1THRH 1F5RA 4NZLA 2Z9KA 1ESBA 3HGPA 2ILNA 5AHGH 5C5OA 4AFQA 1MMJN 1O5AB 1C5PA 4JK6A 1SLVB 5L2YH 1CBWB 5LH8A 5F03A 1O3DA 2H6MA 1MCTA 1O2HA 3PM3A 3RMNH 3BTTE 1C1MA 3BG8A 3HPTB 3OY5U 4B2AA 1GBMA 3ZVAA 5BRRE 1ELCA 3P92A 1GWAA 3MH4A 1VCWA 1TRNA 2O8MA 4B2CA 3SGQE 1P9UA 1ZR0A 4BAOB 1BRCE 3L3TA 3VB4A 1QA7A 2PFEA 2SGPE 3Q3YA 2BDBA 1E38B 1F7ZA 4MNWA 1UCYE 1KXDA 4Y6DA 1Z8JB 3MU5A 1NFUA 2BVRH 2ZFQH 2VWLA 2FOBA 1T8LA 2GDDA 2ZFFH 1H9LB 5FCKA 3UUZA 5A0CA 4FUHA 3S69A 2CGAA 3ZVCA 4X2VA 4DURA 4FUCA 1ETRH 1AI8H 1FUJA 1SLXB 5PTPA 3RXKA 3EE0B 3PB1E 2AMPA 4NIWA 2AMQA 3E8LA 4YOIA 2VGCB 2BQ7B 3HGNA 3LH3A 2HPPH 4MTBA 3M5MA 1O32A 4FU9A 4YZUA 1FAXA 5B6OA 4ZMAH 5HXFA 2Q6FA 1SSXA 4OGXA 3RXAA 2OCVB 3AAVA 1OOKB 3JZ1B 1BTYA 1GCDA 1GHWH 2GP9B 4IN2A 5ESTE 2TPIZ 2B7DH 4E7NA 1H9IE 3LIWA 3MH6A 3ZZBA 1AZZA 2JH0D 1GMHF 1CSOE 1DITH 1NRQH 1NM6A 1CT4E 4AYYB 1LQDB 1V2ST 1QRXA 2R0LA 3RXCA 1TPOA 1GG6B 3BG4C 3E16B 1ZSLA 4NSVA 3FFGA 2A1DB 2OBQA 3ZZ7A 4DG4A 3UR6A 1GI0A 1S6FA 1C5NH 1O3NA 1ZOMA 1EAUA 1CBWC 3S9CA 3BF6H 1DLKB 1ARBA 3A7ZA 3RXSA 1XMNB 2P3TB 3MWIU 3SQHE 1B0FA 1VITF 1WV7H 1HYLA 3FAOA 3TGIE 1YPLH 4RSPA 1KDQA 3BEIB 4JZIA 2PKSC 1PYTD 3NUMA 1ELGA 4SGAE 3TH3H 1T4VH 1RFNA 1RTKA 5JBCS 4K1SA 4ZXYH 3KF2A 1BMNH 1OP2A 2EA3A 1AD8H 3ELAH 3Q00A 1EAIA 2SGAA 5T3HA 1GJ9B 2G5NA 1BIOA 4FU8A 2R3YA 4NCYA 2F9UA 5T6FA 4H42U 1GJ8B 1Y3VA 4XFQA 4INHA 3LKWA 3ZYEA 2SGEE 2FOEA 3MMGA 1SHYA 1PQ5A 1D4PB 1GHAF 3URCA 1A4WH 1NPMA 1RRKA 1S0RA 3RXQA 2ZPRA 3I29A 3GY3A 1KXEA 2QF3A 3ZZ9A 1U6QA 2BD7A 1L0ZA 4X2YA 1J17T 2VGCC 5J4QA 2HNTC 3FP8E 3KQDA 1W0YH 3SNEA 1GJBB 2QGRA 3BN9A 1AIXH 1GMDF 4UFGH 2H9TH 1RS0A 5DK1A 1GBBA 1ELBA 1TNHA 2G51A 1DY9A 5I46H 3HKJB 1NTPA 1C4Y2 1A0LA 1AGJA 5DJ7A 3QO6A 4CRFA 2P94A 3AAUA 1GBHA 1UK3A 2BX4A 1D9IA 1GDNA 2HVXA 1GG6C