3MH6A

Htra proteases are activated by a conserved mechanism that can be triggered by distinct molecular cues
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
438
structure length
392
Chain Sequence
QMPSLAPMLEKVMPSVVSINVEGSTQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease do
publication title HtrA proteases have a conserved activation mechanism that can be triggered by distinct molecular cues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 84
structure length 392
sequence length 438
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh6A03
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3mh6A04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mh6A01
3ZZDA 2BY9X 3TU7H 1AQ7A 1W12U 1Q31A 4IN2A 4THNH 2PUXB 3GY3A 1V6DA 4XBDA 3Q3YA 1AKSB 1C1NA 4JCNA 1G3BA 2QT5A 1UVPA 1C2MA 1P3EA 3BTGE 3PO1C 1C1MA 4ABAA 3RXTA 1ELGA 1SHHB 2W7SA 1BTUA 1BT7A 3Q77A 2ZGCA 4NIYA 1ACBE 1ARBA 1XVMA 1IU0A 1SGFA 4OS6A 1AE5A 2Y5HA 3TPIZ 4GVUA 3TITA 3HKJB 3BG8A 1OBZA 2CF9H 1WH1A 1TX7A 1UO6A 3A7TA 5FXLA 1TP3A 2EV8A 2ZDMA 1C9TA 1XXDA 1YPHE 3TLOA 3SJKA 1BMNH 1YBOA 3HGPA 2GVFA 2FTLE 3DA9B 1NFXA 2KYLA 1WAYB 2EI8A 3UREA 2CHAB 1WF8A 1QA0A 1GHZA 1QB9A 3BG4B 4NA9H 2HE2A 1C2FA 1O5DH 1C5MD 1N1LA 5LPFA 3QDOA 3T5FH 2B5TB 2PW8H 2EDZA 1C5TA 5FB8C 4JOEA 2A0QB 1BZXE 1X5NA 4X6OA 3KHFA 5FBEA 5J4QA 1RGQA 2Z9KA 2J38A 1EZQA 2GCHF 1V6BA 2A1DB 2GGVB 5CHAB 2HGTH 1ZTJA 2DE9A 2JWEA 3F9HA 5LGOA 1C2JA 2W3KA 3NCLA 3PTBA 1C2HA 4DCDA 1SFIA 2BX3A 1G37A 1VB7A 4JZDH 2VB0A 1DM4B 3RXKA 4X1SU 1BBRK 1MCTA 3PTNA 4GCHF 1SMFE 1UVTH 1L1NA 2VWOA 3M7TA 5DTHA 4YDPA 4FUHA 4TWYA 1OPHB 1G9IE 1G3EA 2OMJA 2F5YA 1W11U 2GV6A 2XWBI 4YESB 3SZNA 1QRWA 1D6RA 4FUFA 3R68A 1HXFH 4DT7B 3RXDA 1MMJN 1UTPA 4F49A 2ZU2A 3ZVDA 2ZC9H 2ZCHP 4YLQH 1UFXA 3A8DA 4PQWA 3LGYA 1Y5BT 1O5BB 3F9FA 4BNRA 2Z3CA 1ZJDA 2HNTE 1GMCF 1FC7A 5EW2H 4DOQA 1N6YA 4BAMB 4GHNA 3DORA 1CA0C 3GCHC 4RN6A 4A1TA 1EUFA 4XSKU 3E3TA 1PPEE 2KJKA 1FMGA 1GG6B 4FUCA 4P0CA 2AMQA 4IMQA 5A8XA 3C27B 3A85A 2KOJA 1XKBC 1N6XA 1C2LA 3SV8A 2GX4A 2J4IA 2EGNA 2BDAA 2P3WA 4UFEH 4NNLA 2J9NA 2OD3B 1RIWB 1C5NH 2FS8A 1GCDA 2ODPA 2H5DA 1SQTA 5HFBA 3SORA 3O8CA 1O5FH 2EA3A 2ZU3A 1MKXK 1NT1A 2OBQA 1S6FA 1WTGH 1VGCB 1SLXB 1TNLA 3BTFE 2VU8E 5FPSA 1Y59T 1ELVA 1DX5M 3RXRA 3ID1A 2VH6A 3QZQA 3SHAH 5A0BA 4UEHH 4P2AB 1A3EH 1L1JA 4Z6AH 2ENOA 1EATA 1WBGB 4MPVA 2FNEA 3ID2A 1SL3A 1V2QT 4Y0ZE 3GSLA 1OYQA 3BN9A 4TY7A 1QGFA 2A4OA 3D65E 1Y3XA 4LOYH 1VITG 1HAVB 1O33A 3U9AH 2G81E 1KLIH 3SV9A 3LC5A 1CU1A 4KTUA 3UNSA 1AE8H 3NUMA 1O3HA 3RL7A 4KGAA 1LTOA 2H2ZA 1VZQH 2PLXA 3EA7A 3ZYDA 1O3BA 1QBNA 2AEIH 5DP4A 1B7XB 4HOPB 4NG9H 2UUKB 4H4FA 2BD9A 4DGJA 1DXPA 2ZZUH 3M5NA 3QJMA 5EXMA 1GQ4A 2L4SA 1RXPA 1W13U 2O8LA 4U32A 4ZXYH 4CRDA 2PDZA 1AY6H 3A82A 1C5YB 1DWDH 3UWIA 3M61U 4BAQB 3QIKA 2FLRH 3LNXA 1O2TA 2BDGA 1TFXA 3BEIB 4N6XA 1M5ZA 1BJUA 3MU5A 2KBSA 2A32A 2XC4A 1LVYA 3V3MA 3E8LA 4GHQA 2F83A 4MNVA 1YC0A 1DT2A 1QBVH 1TQ7B 2BDBA 3KCGH 4HGCA 3KIDU 2QKTA 5EQQA 6CHAC 1BBRH 5T6DA 3PDVA 4Y8XA 2ZHQH 1L6OA 1WHDA 2J95A 2ZHFH 3M7UA 1KXCA 4JOFA 2GMTB 3MO3A 1KXEA 2QAAA 2OZFA 4FU8A 3L3TA 4AB8A 1O2GH 1C4Y2 5H4IB 4X1NU 1LPKB 3T26A 3E0PB 5JBTA 4UD9H 1WOFA 2IWNA 1QRXA 1C5OH 4AGJA 1C9PA 1T4VH 3NFLA 1EPTA 1K22H 1MFGA 1LMWB 1WU1A 2CS5A 2LC7A 5HEDA 2FOAA 4Y7AA 3GCOA 1FN6A 1U3BA 3ZZAA 4FUIA 3EA9A 1NRSH 2SGPE 3LOXA 3QTVH 3SUGA 1B8QA 3QGLA 4D7GA 2C4FH 2Z17A 1GBBA 1HAGE 5ETXA 1QQ4A 1ZPBA 1R6JA 1FPHH 4BTTB 3GY6A 2VGCC 3LPRA 1INCA 3MO9A 2VWNA 1TE0A 4LZ4B 5D13A 1C5VA 1Q2WA 3H7TA 1EAUA 1L1GA 1S83A 2H3LA 1LHFH 3MOCA 4SGAE 1MTWA 1P2KA 2A5KA 1RZXA 1J14A 1TPPA 4Z8JA 3BTWE 4Y7BA 1V2MT 4AORA 1EZXC 1GI2A 3M3VA 3V12A 5GWZA 1O31A 3F6UH 1ZZZA 1C4U2 1SGYE 5HJ1A 1AKSA 2R9PA 4WH6A 3BTEE 2BY7X 3E16B 1RD3B 3K50A 4X6NA 1P01A 4A6LA 1N7TA 2IWQA 1O3AA 1WJLA 3D49H 3PLBA 4BAHB 2KJPA 2PKTA 2P59A 3DFJA 2XBWA 4AZ2B 4YYXA 1F0SA 1GBAA 4R8TB 4X6MA 2BB4A 3SV6A 1DANH 1O3OA 2C8XB 2PGQB 5HF4A 3LGUA 1GHWH 1GMDG 5DP6A 2SGEE 1JBUH 2OS6A 2ZFFH 1BTZA 1BUIA 1GHVH 4K5ZA 4BANB 1K21H 2V90A 1O3JA 2AFQB 2BY6X 3RXUA 2FLBH 2FOBA 4X1QU 2Z9IA 3K9XB 2HPPH 4MVNA 2BLVA 2I1NA 1EB1H 4TWWA 4D76A 3LNYA 1QNJA 4KTCA 1A46H 2F9PA 5SGAE 2THFB 2Z9JA 1X45A 3KL6A 4O3TA 4NZQA 3M3TA 2J94A 2CGAA 3NXPA 3SU5A 1VITF 1N8OB 1Z1IA 1C4V2 1C5QA 2C90B 3RXPA 1GHAF 4AMHA 1ZR0A 2STAE 4D9RA 1T8NA 1GBEA 1UVOA 5CMXH 4NSVA 5HGGA 4ISLA 1O2SA 2EC9H 7ESTE 4AN7A 5HFEA 1CHOG 2LPRA 3U1JB 3RM0H 5K0HA 1Q3PA 2GKVE 1KWAA 3OY5U 4UE7H 1F5RA 1YF4A 1V3XA 1NFYA 4A92A 1ZHMA 1OP0A 3SHCH 4OEOA 2GZ9A 1K1NA 1H9HE 1LVOA 4UONA 4U01A 2WUBA 3SBKA 1O32A 3LH1A 1UEPA 1UHPA 1F5LA 4CHAC 1K1LA 3T27A 2TGAA 1TALA 1T4UH 2A4QA 3TIUA 2Z7FE 2HPQH 1V2LT 3OYPA 1YPHC 3UTUH 1OXGA 1G2LA 2OSGA 1D6WA 1FY8E 3P8OA 2ZTXA 1BHXF 1MFLA 3BTKE 2LUIA 2BVSH 1IHSH 3ATMA 4NMOA 1CBWC 1PPBH 1UTOA 3UFAA 3TH3H 5HFCA 2KPKA 3PWBA 1SGDE 1IQEA 1CA8B 3ZVFA 3B9FH 4ABHA 6LPRA 3KN2A 1ZMNA 4YOJA 5T6GA 2M0TA 2LOBA 3U98H 4HZHA 2KG2A 2W3IA 1UVUH 3LGWA 4CRGA 1TNHA 2BDHA 6CHAB 1P02A 4AFZA 3T28A 1K2I1 2WPKS 2VZ5A 1GCTC 1V2JT 3K6YA 1FAKH 2GZ7A 4YT6H 2W26A 4BTIB 3VXEH 1DY8A 1TA2A 1XKAC 3GISB 2BD4A 1WQSA 5JBAS 3PLPA 2EI6A 4H42U 3ATLA 1OZIA 5GCHG 1AB9C 1BIOA 1C1RA 5C1YA 1P3CA 1TWXB 1N6DA 1DICA 2G8TA 3DUXH 4NA7A 1O2NA 1PPHE 1NS3A 2P93A 1ANDA 1EAIA 3MU8A 1VA8A 3BIUH 1O2YA 1QLCA 2H9TH 3QN7A 3UWJH 3RM2H 1GJ9B 1H4WA 1T32A 1SC8U 4NIWA 5FBIA 3WKLA 4K8BA 3RXIA 1AFQB 1GI6A 1O34A 4MTBA 3RXAA 5ESTE 1DUEA 4HOPA 3PROA 5F8ZA 1GJDB 2VGCB 1HBTH 3UIRA 1TNIA 3PDZA 3KQDA 1Z8RA 4XDEA 2JXOA 2A45B 1A5GH 3NFKA 2FESH 4AFSA 2R2WU 3S7HB 3PYHA 2PUQH 1RRKA 1GJ6A 1PPGE 2GP9B 3PWCA 4KFWA 3LJJA 3ID4A 1QL8A 2STBE 3A81A 3O8RA 1S81A 5T6FA 2TGDA 3RL8A 3AASA 3I77A 1DWBH 4G69A 1RTFB 2REYA 3ODFA 3R0FA 4FUDA 4B2BA 3RLYH 1W14U 2VIPA 2QV1A 1C1WH 1T8LA 1HAOH 4Q6HA 3ZZ4A 2GT8A 2PV9B 4Y79A 1C5RA 1GMDF 4B73A 1TPSA 1THPB 2KOMA 4KELA 3GICB 5F03A 4A1VA 2OQUA 2I0IA 1XMNB 2BOKA 1W7XH 1YPLH 2L97A 2BYGA 1YBWA 2P95A 3O46A 1XX9A 2VIOA 4ZXXH 3RU4T 3SNDA 1TQ0B 2QIQA 3SOEA 4L8NA 3LDXH 3RXSA 4SGBE 1GHBG 1XZ9A 2M0ZA 4ESTE 2KOHA 1G30B 5HFFA 4WWYA 1QHRB 4DIHH 2WV4A 4RKOB 3RMNH 1FY3A 4TPIZ 1UHBB 1V2ST 4XHVA 1MTVA 3LGVA 4NGAH 5JBCS 3MI4A 1CHOF 2NWNA 3EA8A 4XE4A 2KJDA 1W0YH 2JOAA 4VGCB 2ZA5A 3SUEA 5A8ZA 4ZHMU 3NZIA 1A0JA 1EOJA 1UK4A 3SNCA 4ABIA 6ESTA 1Y5AT 1O2HA 2A4RA 2PZDA 5C1UA 2SNWA 1V2TT 3RXOA 2VIWA 2GCTC 2KRGA 4FU9A 2YT8A 1LHEH 9LPRA 1THRH 1QRZA 3CS7A 5J4SA 4GPGA 1V2RT 2RDLA 2QA9E 4NCYA 1K28D 1HAXB 1X5QA 3TJNA 3HK3B 3KQBA 1FN8A 3Q76A 1O2JA 4QT8C 1AHTH 2B0FA 2FPZA 2BVXH 4Y0YE 4X6PA 3P95A 4JORA 1Z86A 5G1DA 3SNAA 3TK6A 1NY22 3A7ZA 1HAYB 2Q6DA 1G3CA 5HYOA 3I4WA 1TOMH 2I4SA 2P3UB 3A87A 2I04A 1OS8A 2HGAA 3AW1A 1UK2A 2Y5GA 1ETSH 3HPMA 2AERH 3E91A 4NIXA 3OU0A 1ZSLA 5EQRA 4GUXA 2VWLA 1U39A 1O3PB 2QCYA 2WPLS 2ZPSA 2WPJS 2QKVA 1QAUA 2OCSA 1HAHH 2FDAA 2TRMA 3M35A 2CSSA 5C5OA 2EGKA 5HEYA 7GCHG 1GDQA 1W7GH 3SJ9A 4Z0KA 1NESE 2XYAA 1GHYH 1C1SA 1L4DA 1C1OA 1A4WH 1CBWB 1AZZA 4X8TH 3STJA 2FOCA 1GBCA 5JXBA 2ZWLH 1YLDA 1BRUP 1NTPA 3HKIB 1D4PB 2ZGBH 1WTHD 5DGJA 3QE1A 2BQ6B 2FOMB 2R3UA 3ZYEA 2AINA 4OEPA 2ALVA 1QAVB 1H9LB 3SOSA 4B76A 5EPYA 1RJXB 5ESBA 1OWEA 2H5CA 1P03A 1KXAA 2BXUH 2P3FH 1VCQA 4K3JA 1O2RA 2JETC 2K20A 3ZZ5A 1XUIA 3PMBB 1TRNA 2Y7ZA 1NRNH 4AGKA 1OBYA 3U8OH 3BV9B 3FVFB 3GJ9A 1A5HA 1WSSH 4WH8A 2G5MB 5A09A 1RY4A 3FP7E 1UEZA 1A1RA 1C2IA 4DIIH 2BY5X 1N6FA 3DIWA 2DB5A 4CR5A 1O3CA 1V2NT 1FY4A 2ZDNA 5C2ZA 2BHGA 1W3CA 1UJUA 2ZECA 3LC3A 3NPSA 2XBXA 2BZAA 4X8SH 1C5PA 1HV7A 4K8YA 3O5NA 3E17A 5EYZA 3SI3H 2KAIB 5E2PA 2OGPA 1X5RA 1NU7B 1RS0A 1OP8A 1MD7A 4NMSA 1RTLA 1XUJA 1ZHRA 1QIXB 4B71A 1T31A 1FDPA 1PQ5A 1BOQA 1GHBF 2G55A 3DFLA 2EEKA 3GY4A 1XUGA 3RXJA 2RCZA 1AFEH 2G5NA 4J1YA 1Q3OA 3GOVB 5FX6A 1CO7E 4DW2U 1YCPH 3O8BA 1PQ7A 2PA1A 3MU0A 5FCKA 5C67A 3ENSB 3LGIA 5F8XA 1O3IA 1HB0B 3RLEA 3K65B 3ID3A 1O5CB 2KQFA 1ELFA 4K1EA 3GDUA 4O97A 4ABDA 3P8NA 1SFQB 1O2IA 1HFDA 3BIVH 1MZDA 2WV5A 4REYA 4E3BA 2RA3A 3M36A 1JXPA 3TGKE 1TNGA 2WUCA 1FPCH 1HAZB 2BXTH 2OP9A 3WY8A 2ANYA 2O9QA 3QTOH 2DM8A 5BRRE 2NU4E 1W9EA 1ZHPA 2QKUA 2EI7A 2SGDE 4GHTA 1WI2A 4ZAEA 5TCAA 1QA7A 5HMAA 1V5QA 2W7RA 2V3OH 2H9EH 2ZGJA 3K82A 3ZV8A 3CBZA 5HDYA 2ZTYA 2D92A 1O38A 2BY8X 1EASA 1YPGH 1YYY1 1H1BA 3SQEE 2V3HH 3FY5A 5IDKA 1L2EA 1BRCE 1O35A 4YO9A 1DSTA 2QYIA 2JINA 1SGCA 3OY6U 1P1DA 2XRCA 1C5LH 1OX1A 3QGJA 2VPHA 1WQVH 2UUFB 3QWCH 3SV2H 1AZ8A 3KQEA 1ZYOA 4NMRA 1NN6A 2R0KA 1NM6A 3VB3A 1EP6A 1HXEH 4NWLA 7LPRA 5AVDA 2P8OB 3I18A 1GBMA 2ZHWH 7GCHF 5E21A 3A8CA 3BEUA 2H2BA 4ZUHA 2QC2A 1C1PA 1S0RA 4NFFA 1S85A 1GVLA 1FLEE 4I8KA 4Q2NA 2FP7B 3HPKA 1F92A 1G36A 1HNEE 1MTSA 2PR3A 5HXFA 1P06A 3T25A 2PKSC 4I32A 2MHOA 1CGHA 3MH5A 2ZPMA 1F0RA 4BXWA 2G4UA 5E22A 1EAXA 3BPUA 1GDNA 1QB1A 1O2KA 1YPEH 1PYTD 1SB1H 1YPKH 3ZVGA 1C5UA 1O2UA 4FVBA 1GVKB 3R3GB 2QGRA 2BD7A 4ZHLU 2Z3EA 2LA8A 4E34A 2FX6A 4IMZA 2Y7XA 2BLQA 2CXVA 3V0XA 4JZ1A 1O2XA 1O2LA 4KFVA 1H8DH 5EQSA 1LHGH 3K6ZA 3V13A 1C5ZB 2AIPA 1C1UH 1TGCA 3GCNA 2VSVA 4KP0A 2ZTZA 1SGEE 3HPTB 1V5LA 3RP2A 1OWKA 2XTTB 1J16A 3PO1B 3ATKA 1UM1A 4X1PU 3JZ2B 4CRCA 1AD8H 1Z8IB 1SHYA 1DPOA 1GI5A 2J92A 2WPMS 8GCHG 2H2CA 1JRSA 2ZKSA 3DT0H 2ASUB 2F3CE 4I8LA 3ODDA 5HF1A 3A89A 3F9GA 1UTNA 4CREA 1K9OE 1O2PA 1MC7A 4WMFA 3GY5A 3RXLA 1N6EA 1B5GH 3KF2A 4ABEA 3UOPA 1V2UT 3LJOA 2AGIX 3PMJA 3AVZA 4MDSA 4JK5A 1Z87A 5HETA 3MMGA 5HM2A 4TY6A 2ZQ2A 1ZRKA 3GCTG 2C93B 1SLVB 3F68H 4X2YA 3GY2A 4CRFA 1IQHA 1D3PB 1YPMH 1AUJA 3ESTA 3T2NA 2OC8A 2ZPQA 1OWDA 3OSYA 1VCPA 1A3BH 4RSPA 8LPRA 1P2QA 4B2CA 3BTDE 2D90A 1UJDA 5JDUB 2FYRA 1C1QA 1FXYA 1T7CA 1A7SA 1PPFE 3VEQB 1DWCH 3F9EA 5FPYA 4D9QA 1BTPA 5GIBA 3LH3A 4ISOA 2ZFSA 1QAVA 2BX4A 4I8JA 1TYNA 1NFUA 1DFPA 1LVBA 2K1QA 3OTPA 1VJ9U 2ALPA 1IQIA 3UOUA 3P8FA 4Q2OA 1KLJH 1BRAA 2YNBA 1ZSJA 1XUFA 3E1XB 3TK9A 3GYLB 4K69A 3FAOA 3E6PH 2G4TA 4INHA 1ZOMA 1A0LA 2VVVA 2PSYA 1Z6JH 2IPHA 3RC5A 4MNXA 1NC6A 1UK3A 5LPRA 2V6NA 2JH6D 4H6SB 3RU4E 3UNRA 2SGQE 3EDXB 2BM2A 1BTWA 3PV2A 1EXFA 1ZOKA 2ZIQH 1KIGH 3S9CA 1CA0B 2OPGA 1GBKA 3GCHB 1ELDE 1KDQB 2Y80A 3E0NB 4HTCH 3T62A 2G2LA 3S9AA 3OTJE 3SU4A 4Q7XA 3CYYA 4E7NA 1BE9A 1LCYA 1MTNC 2ZEBA 4XBBA 5H3JA 4X8UH 3K1RA 4IS5A 2FXRA 4X0WU 2HVXA 2KAIA 4XBCA 1H9IE 4E06H 3QO6A 1EOLA 4AG1A 3ZRTA 4DG4A 2GV7A 1OKXA 3SHUA 1UEQA 3QK1A 1UEWA 1C5XB 1E38B 5DPAA 1GJAB 1AUTC 2GDEH 2PHBA 2SGAA 1Z1JA 9ESTA 1E0FD 3M37A 1P05A 1FCFA 2W5EA 1NPMA 2RA0A 4J2YB 1D5GA 5HEBA 3SI4H 1W9QA 1AVXA 4A1XA 4X2VA 2P3TB 4FUGA 2BD5A 1PYTC 1QFKH 2ANWA 2VWRA 2PKAB 2FX4A 3A88A 3ATIA 1ABJH 3CBYA 3VPKA 5A2PA 2TGTA 1GBDA 3W94A 2D1JA 1P11E 3RXHA 2FIRH 3EAJA 3RUOA 4AFQA 2VINA 3STIA 1B0EA 2V0BA 5EZ0A 2PKSB 4NMVA 3IWMA 1EPTC 3GY8A 3FP6E 2QF0A 2XBYA 2BYAX 5AFZH 4MPAA 3BTQE 1UJ1A 4IC6A 2RCEA 1UITA 1P2NA 1TONA 2XC0A 1FV9A 8GCHF 2BQWB 2DLSA 2A31A 2D26C 2OC1A 3I1EA 3T29A 1GHXH 2Y81A 4WXIA 3MH4A 2FN5A 1IQJA 4WMEA 2ZDKA 1DY9A 2CV3A 1IQLA 2NU3E 1DITH 2F9VA 1FQ3A 3SGQE 8KME2 1Y5UT 2Q6GA 3HATH 1ZUBA 3GDVA 4O9VA 1HLTH 3GYMA 3SUZA 3AXAA 1BA8B 2HOBA 3RLWH 4ABJA 3QLPH 1O3EA 5I25A 2TBSA 1Y7NA 4D8NA 1RTKA 4LK4A 4OAJA 2PGBB 1Y3UA 1MD8A 1MQ5A 1ZLRA 1SR5C 3V7TA 1BCUH 3ZVAA 4NFEA 1EJNA 3VXFH 1CGIE 1O2WA 1VAEA 1SLUB 1O5AB 5EODA 2DMZA 1Z8JB 1CT0E 2J34A 3M3SA 2Z6BD 2JH0D 1HAVA 5DP7A 3GY7A 3NGHA 1WIFA 1EB2A 1J8AA 1U6QA 2A7CA 1O30A 1ABIH 1AI8H 1UTLM 5GNDA 1I16A 2OQ5A 1DLKB 2A4GA 4X1RU 3TSVA 4CH8B 2EAQA 1GL0E 2Z9GA 1VR1H 4MLFB 2Q3GA 3A7WA 1LKBA 1F2SE 1K1MA 1QQUA 5ABWA 4FUBA 5DP8A 1TBZH 1YGCH 3KQCA 1KLTA 5F3XA 3RC4A 2D8IA 2PNTA 2CHAC 5A8YA 3P70B 2I6SA 4WYUA 1A2CH 2ZQ1A 1UM7A 5JB9S 2KV8A 2A5IA 3RU4D 1BB0B 1BRBE 2UUYA 4R0IA 1THSH 1SQAA 3A84A 4ISHH 4OS1A 2DJTA 1E36B 1ANEA 2FZZA 1S84A 1SBWA 4FUJA 1V1TA 3LGTA 4OS7A 2EEJA 2DAZA 2A7JA 1VJ6A 2K1ZA 1YCPM 2LNCA 4MPWA 3RMLH 3MO6A 4NMTA 2UZCA 1OSSA 4B2AA 1P12E 2ILNA 3LIWA 5G1EA 1TA6A 1P2OA 4MQAA 1ELCA 1XXFA 2ZFRH 1HAIH 1TMUH 4M7GA 1MZAA 1UCYE 2KAWA 1PPCE 1O2QA 2AMPA 3B8JA 4IC5A 1XVOA 2O8MA 3TH2H 2EEGA 2BVRH 4E35A 3TJUA 3ZZ7A 1MAYA 4LXBH 1Z7KA 2ZU4A 1JIMA 4WMDA 2RRMA 3PV5A 1C2EA 3A8AA 1C5SA 5E11A 5FX5A 3RXMA 1EQ9A 1KEFA 1AMHA 1BMAA 1P2IA 1EJAA 1SGTA 4IGDA 1LDTT 4NZLA 4ISIH 3LKWA 1DE7H 2Z3DA 3IG6B 3SFJA 1YM0A 5L2ZH 4JK6A 2D8WA 1BFEA 3DHKH 1TX6A 3P92A 1RGRA 1DWEH 5E2OA 3DD2H 2NU0E 1FONA 2VIVA 4NXRA 3HK6B 5C20A 4U2WA 1GVZA 5G4BA 4AG2A 1HJ8A 1FAXA 1EX3A 1T8MA 1RIWC 1YCPK 2HLCA 2DKRA 1BTYA 2I6QA 2EEHA 1TQ3A 4IW4E 3JZ1B 3BTME 2PFEA 4Q2QA 4JZEH 1F0TA 4BXSA 4Y10E 5DG6A 3Q3KA 3SV7A 1GJ5H 4MNYA 5T3HA 2FODA 2BOHB 2M0UA 2ZNKH 1GPZA 4YOGA 4MPUA 4CHAB 2R2MB 1GBTA 1V2VT 1F5KU 1SVPA 3S7KB 4BTUB 2FOFA 1SGQE 1JMOH 2WPHS 1FJSA 3RMMH 2I0LA 2AYWA 2ZP0H 1GI8B 2ZCKP 5EOKA 1Q7XA 1UF1A 4ABGA 2EGOA 1PQ8A 3CH8A 2EDVA 2GZVA 4OS2A 4NXPA 3NWUA 2FE5A 3DJ1A 1CQQA 4H11A 3Q3XA 4JOGA 3ZZ3A 5GCHF 5K7RA 1X7AC 5AFYH 1ZGIA 1UMAH 3URCA 2VH0A 2SGFE 2XCNA 4I33A 4ASHA 5DJ7A 1KXDA 2YNAA 3SGAE 1TGNA 1Y3WA 5A2MH 2EXGA 1D3DB 1TPOA 1GCTB 2M5TA 1WI4A 3PB1E 1CT2E 1PJPA 2V35A 4Y6DA 1V62A 2OBOA 3TJVA 1IQFA 1S5SA 2HALA 2TGPZ 4AFUA 3M5MA 1DDJA 1LQDB 1AB9B 1P1EA 3CC0A 1JIRA 1GL1A 3TMHA 2PKAA 1HIAB 1MUEB 2CJIA 2GMTC 3MHWU 3Q00A 4K2YA 2XXLA 3LONA 1UTMA 5EPNA 4E7RG 4ABBA 1FI8A 2HRVA 1TP5A 2AGEX 1XM1A 1SG8B 2WINI 2J2UA 1P8VC 1GBFA 2G5VA 1GBJA 4O06A 3EE0B 7KMEH 3RXGA 1TNJA 1ELBA 2LC6A 1MBQA 5DP5A 1DSUA 2GDDA 1TBQH 2F9UA 2FCFA 4ISNA 1WF7A 4WJG2 4K72A 2BLOA 1BTHH 1YP9A 1XUHA 3KZDA 4HFPB 1QR3E 5JBBS 4A5TS 1NU9A 3MH7A 1DUAA 1DXWA 4NMQA 3SHWA 1WV7H 1HDTH 2OC7A 1IQGA 3MNBA 2O8TA 3C1KA 1ZRBA 2A5AA 1K1PA 1ELTA 4JOJA 2M10A 2ODQA 1DS2E 1KY9A 2ZU5A 3TNSA 3U1IB 1HAPH 1J9CH 5AHGH 1AGJA 1K1OA 3MU1A 4UFFH 1X6DA 3B23B 1ESBA 3RXQA 3M7QA 1GGDC 2FWWA 2R4HA 2FO9A 5EW1H 1SSXA 2AH4X 4A7IB 1P2JA 4E05H 2TPIZ 1F7ZA 1ESTA 4Y11E 5HM9A 4PROA 2P94A 2GD4B 2YUBA 2QG1A 4ZROA 4TYDA 4DURA 1G32B 1SGIB 3SU6A 1ZSKA 1TGSZ 1BHXB 1MAXA 1OP2A 3IITA 2PKUA 3SO3A 3FANA 5E0GA 2ANKH 2Q9VA 1E37B 2BDIA 1LO6A 5JYIA 2BDCA 3A7XA 2IN2A 1MU8B 2NU2E 1W8BH 3PLKA 1GQ5A 2ZG0H 3CENA 5L6NH 2E7KA 2A2QH 2Z9LA 3MNCA 3RDZA 1C2DA 2CN0H 2GT7A 4X2WA 1TGBA 4CBNA 3ZV9A 3VFEA 2BZ6H 1ANBA 1HJAC 2ZF0H 3OX7U 1O3FA 6GCHG 8ESTE 1FIZA 1TABE 1NO9H 2GCTB 1WCZA 4AOQA 3MYWA 1B0FA 4GSOA 3EGHC 1LQEA 2VVCA 3RXVA 4UDWH 1UTJA 5DK1A 3SU1A 4JOPA 4JYVH 2DLUA 4YT7H 2VIDA 2EJYA 1OWIA 1TMBH 4Q7ZA 2IJOB 5L30H 2VRFA 3VB5A 1N8OC 1T8OA 5GXPA 1J17T 5B6OA 1PQAA 1UTQA 3BTTE 5GLJA 3M5OA 1BBRE 1K1JA 2B7DH 4HI3A 5E8EH 3FZDA 1CE5A 3TJOA 2ZU1A 5GPIB 4X2XA 1GWAA 1YLCA 1Y3VA 3L4FD 1MCVA 3LU9B 3KZEA 1P9UA 1CSOE 1GI4A 1HRTH 4NNMA 3QGNB 1EAWA 1UHBA 1NFWA 2ZFQH 4JYTA 2FOEA 2X7ZA 1QY6A 3SU3A 3QZRA 2DC2A 1FNIA 1VITH 5AF9H 4Q7YA 3RXCA 1NRPH 1N7EA 1GHAG 2YT7A 2VWMA 1Q3XA 3O8DA 1IQNA 1U38A 2OLGA 2XW9A 4UU6A 2QXGA 1JOUB 3EGKH 1QB6A 2Y5FA 1PPZA 3B76A 4B74A 2JKHA 5LH8A 4Q2PA 4ABFA 2B9LA 2XNIA 1TOCB 5A0CA 2ZGHA 3CBXA 1NRRH 2AWUA 3M5LA 4JZIA 1G3DA 4INLA 4Y71A 2OQSA 2YUYA 2YOLA 1TPAE 1W0ZU 1VJAU 2ODYB 2JETB 2MX6A 1OWHA 3VB4A 3TSZA 2ZPRA 3PM3A 4NXQA 1W10U 3PMHB 2EEIA 1CHGA 1NRQH 2FS9A 3I29A 1CGJE 2QBWA 1Z71A 3TVJB 4K1TA 5I46H 5I7ZA 2XBVA 3SJOA 2OCVB 3H5CB 4X8VH 1WUNH 2H3MA 3ELAH 4NA8A 1SLWB 3S0NA 1O36A 5GJ4B 2V1WA 1ZMLA 3A86A 3DJAA 1W9OA 4Q80A 3CS0A 4LMMA 2ULLA 2CMYA 1P10A 1XUKA 3VB6A 1O2MA 2Y82A 3KHVA 1S6HA 3R0HA 3KGPA 2QY0B 4YZUA 1ZTLA 1GJCB 3A7YA 1LVMA 4FGMA 1IAUA 2IWOA 4UU5A 1BTXA 1P04A 2PSXA 4Q2KA 4K78A 2BD2A 3TGIE 1AFQC 1BMMH 2VIQA 4GAWA 1P9SA 3VQGA 4Q6SA 1P09A 1ID5H 1ZJKA 1C1TA 2B8OH 3ITIA 4JYUH 4XFQA 1GI0A 1C5WB 1WFVA 1FY5A 1K1IA 2TIOA 2SFAA 1ELAA 1Z8GA 4F8KA 1CT4E 2ZCLP 4OGXA 3N7OA 3AW0A 4ZKNU 3SU0A 3F1SB 2AGGX 2RG3A 2ANMH 2FI3E 2UWPA 1V2KT 3PMAB 2C8WB 4Q3HA 1O5GH 1TNKA 2C8YB 3AAUA 2WL7A 1MKXH 2KL1A 2BDYA 4XOJA 2JH5D 1GGDB 1FC6A 2FYQA 5E1YA 1BITA 2XC5A 2QF3A 1IQMA 1AVWA 4B75A 2CSJA 1FY1A 1VCWA 1YKTA 3NKKA 1KTSB 3P17H 2AWXA 1TGTA 1HIAA 3RXFA 3A7VA 1RFNA 5EXNA 1AVGH 2W7UA 6GCHF 1HJ9A 2R0LA 1QURH 2EHRA 1AU8A 1BMLA 1ZTKA 1TLDA 4YLUA 1TRMA 4Y76A 4GLYA 5E0HA 1E35B 3FP8E 2XWAA 4NIVA 1WFGA 5GDSH 3UPEA 3BTHE 1F0UA 1IQKA 2BD8A 2XCFA 4KKDA 3A8BA 1K32A 1NTEA 1KXBA 4FVDA 1D9IA 1SOTA 4WF8A 1DLEA 1EZSC 2NU1E 1O5EH 1ZGVA 5FCRA 1O3LA 1QL7A 1TMTH 2Q1JA 1MH0A 1LPGB 3TK5A 5PTPA 2BMGB 2FI5E 1D3QB 1O3GA 1TB6H 1HJAB 3HVQC 1HCGA 5EU8A 4O03A 1RGWA 2F9OA 3ZVBA 3EGGC 1MKWK 2HNTF 4VGCC 1MQ6A 2IOTA 1LHCH 1WHAA 4ZKRU 4AB9A 2GTBA 2VSPA 3L33A 3MH6A 1SOZA 4RKJB 3UR6A 1ZPZA 2PWXA 4I7YH 1AWFH 1GI7B 4JMYA 3TSWA 4JL7A 3SJ8A 2H6MA 4GVDA 4BAKB 3RMOH 1V2WT 4JOHA 1SPJA 5F8TA 5EGMA 4MNWA 3UNQA 1L4ZA 3RXEA 2Z94A 3BF6H 2ZPLA 4NWKA 3SU2A 4DJZB 2A2XH 1GMHG 3HGNA 3A83A 5DKMA 3KEEA 1I92A 3DJ3A 1SGNE 2ZFTA 4H6TA 1WG6A 2FM2A 1EP5A 1TX8A 1H8IH 3FZZA 3W95A 2ZDVH 2HE4A 1N7FA 1CVWH 1O3MA 2O8UA 4FU7A 1GJBB 4K60A 2M0VA 1GI9B 2OC0A 2Y6TA 3LT3A 4CH2B 3UUZA 4IN1A 2FEQH 1QJ7B 3ATWA 3BEFB 1V2PT 4WVPE 2F9BH 1TBRH 2OINA 4OGYA 4CRBA 1HGTH 2ZFPH 3MTYA 2DE8A 3S69A 3VQFA 5EG4A 2GZ8A 3UY9A 2WYJA 2FI4E 2WPIS 1U37A 2KA9A 1AWHB 1G9OA 4WYTA 3SNEA 1J15A 3VGCC 2BD3A 3UQVA 5E6PB 1O2OA 4ZKSU 1GBLA 5C3NA 3GCTF 1GBIA 1N99A 4EDJA 4B1TA 1ZMJA 4JOKA 1O3DA 4CRAA 5F67A 1BQYA 2D2DA 1AIXH 3MWIU 5L2YH 3UQOA 1GJ8B 3RC6A 4BOHA 4U30A 1EKBB 1EZUC 1P57B 1QJ6B 1QTFA 2ZHDA 1EJMA 1O37A 2UWOA 4UFGH 4D7FA 2WYGA 3ZZ8A 1TAWA 1QJ1B 4CR9A 1OYTH 1GJ7B 1M9UA 5JB8S 2VNTA 4AX9H 1UCYK 4KTSA 4YM9A 1Y8TA 2VVUA 4TPYA 4Y8ZA 4ZH8A 2OUAA 3QJNA 3UR9A 1PDRA 4CBOA 3ZVCA 3MNSA 3BSQA 1Y3YA 1FZZA 2OTVA 3U8TH 4NMPA 1IHJA 2P16A 3EQ0H 1ARCA 1E34B 3S9BA 1OBXA 1O2ZA 1NF3C 1IU2A 4I8GA 2DUCA 2FTMA 2FOHA 4MG3A 3RXBA 2JILA 5DP9A 1WYKA 3BG4C 1GJ4H 2L4TA 2AWWA 3AAVA 3SN8A 3K2UA 1DOJA 3TGJE 2HNTC 5DO4H 1MKWH 1NROH 2BQ7B 2JIKA 1BDAA 1OOKB 2W4FA 2F9NA 3NK8A 1OWJA 2JREA 2G00A 5CHAC 4K1SA 1AO5A 1YPJH 1ESAA 3TNTA 3A80A 3SNBA 4RI0A 3SGBE 1A5IA 1LHDH 3MFJA 2H9HA 3G01A 4AYYB 3P8GA 5A0AE 2R3YA 4R2ZA 1O3KA 2QXIA 1SGFG 2QXHA 3QX5H 1GDUA 4DY7B 4Z33A 1AN1E 3FFGA 4ZMAH 1JRTA 3VB7A 5FPTA 5HFDA 1S82A 5FAHA 5TJXA 4MPXA 3U8RH 4K75A 2G52A 2GCHG 3TH4H 2VJ1A 4FXGH 4Y8YA 1O2VA 2F0AA 1ZPCA 2FOGA 1UTKA 3EYDA 4I8HA 1ELEE 2Q6FA 1X8SA 4WXVA 1SQOA 4LZ1H 5E0JA 1O3NA 2BLWA 1MTNB 2UWLA 4UFDH 1MBMA 3SQHE 2KPLA 1O39A 1FIWA 2ZGXH 4GCHG 3ZZBA 1GI3A 1LPZB 2ZDLA 3KNXA 4OS4A 2EDPA 4NSYA 3WKMA 1C2KA 2H1UA 1GG6C 2CF8H 4JZFH 3PS4A 2QXJA 3SUDA 3GDSA 4INKA 1HUTH 1A61H 1TIOA 1G2MA 3ZZ6A 1KYNA 4O3UA 3ZVEA 1C2GA 4K76A 1DVAH 3SJIA 1UJVA 1GMHF 3SUFA 2I6VA 4OS5A 3CP7A 4FUEA 2A7HA 5DP3A 3ZZ9A 1IOEA 3SW2B 1SGPE 2AS9A 1GMCG 3R69A 1MTUA 2ZDAH 1T2MA 1VGCC 5C1XA 3E90B 5LPEA 1ETRH 1BJVA 1ORFA 1W2KH 1KSNA 4IBLH 2HWLB 4YOIA 1D3TB 1UCYH 4I31A 1LKAA 1S0QA 4WY3A 1QL9A 1FC9A 1MU6B 2SNVA 1P0SH 2P8OC 5TCCA 4DVAU 1ETTH 3U69H 3ZZCA 2BTCE 1Z6EA 2AIQA 5EXLA 1EPTB 1QCPA 3D62A 1C1VH 5B6LA 2YTWA 2PTNA 3H7OA 1KTTB 3L6PA 3MU4A 1V2OT 5JPMH 3URDA 2ZI2H 3MNXA 3P6ZB 1UVSH 1JWTA 1KDQA 1PFXC 1TRYA 1HYLA 2IWPA 4YTAA 1A0HB 3QUMP 2O2TA 1ANCA 1KXFA 1QBOA 2F91A 5BPEA 1NZQH 2O8WA 1IHTH 4ZKOU 3QDZB 3I78A 2ESTE 3GGEA 3PV4A 5IYTA 1FUJA 1SI5H 1P2MA 2G51A 2QN5T 2AMDA 4AYVB 2UUJB 3JXTA 4K6YA 1O0DH 1GM1A 4GVCA 2PTCE 1SGRE 4ZHAA 5CE1A 1L0ZA 5C5NA 1GI1A 2FMJA 3VGCB 2ZHEH 2C8ZB 2C3SA 1GBHA 1HPGA 4F4OC 2OXSA 5FHTA 4BAOB 5F6MA 3D23A 2ZO3H 2M3MA
chains in the Genus database with same CATH superfamily
3ZZDA 2BY9X 3TU7H 1AQ7A 1W12U 1Q31A 4IN2A 4THNH 2PUXB 3VG8A 3GY3A 1V6DA 4XBDA 3Q3YA 1AKSB 1C1NA 4JCNA 5HIYA 1G3BA 2QT5A 1UVPA 4AC9A 1C2MA 1P3EA 3BTGE 3PO1C 1C1MA 4ABAA 3RXTA 4XD7D 1ELGA 1SHHB 2W7SA 3U28C 1BTUA 1BT7A 3Q77A 2ZGCA 4NIYA 1ACBE 1ARBA 1XVMA 1IU0A 1SGFA 4OS6A 5F53A 1AE5A 2Y5HA 3TPIZ 4GVUA 3TITA 3HKJB 3BG8A 1OBZA 2CF9H 1WH1A 1TX7A 1UO6A 3A7TA 5FXLA 1TP3A 2EV8A 2ZDMA 1C9TA 1XXDA 1YPHE 3TLOA 3SJKA 1BMNH 1YBOA 3HGPA 2GVFA 2FTLE 3DA9B 1NFXA 2KYLA 1WAYB 2EI8A 3UREA 2CHAB 1WF8A 1QA0A 1GHZA 1QB9A 3BG4B 4NA9H 2HE2A 1C2FA 1O5DH 1C5MD 1N1LA 5LPFA 3QDOA 3T5FH 2B5TB 2PW8H 2EDZA 1C5TA 5FB8C 4JOEA 4TSFD 2A0QB 1BZXE 1X5NA 4X6OA 3KHFA 5FBEA 5J4QA 1RGQA 2Z9KA 2J38A 1EZQA 2GCHF 1V6BA 2A1DB 2GGVB 5CHAB 2HGTH 1YY3A 1ZTJA 2DE9A 2JWEA 3F9HA 5LGOA 1C2JA 2W3KA 3NCLA 3PTBA 1C2HA 4DCDA 4RT1A 1SFIA 2BX3A 1G37A 1VB7A 4JZDH 2VB0A 1DM4B 3RXKA 4X1SU 4P02A 1BBRK 1MCTA 3PTNA 4GCHF 1SMFE 1UVTH 1L1NA 2VWOA 3M7TA 5DTHA 4YDPA 4FUHA 4TWYA 1OPHB 1G9IE 1G3EA 4P00A 2OMJA 2F5YA 1W11U 2EQNA 2GV6A 2XWBI 4YESB 3SZNA 1QRWA 1D6RA 4FUFA 3R68A 1HXFH 4DT7B 3RXDA 2J98A 1MMJN 1UTPA 4F49A 2ZU2A 3ZVDA 2ZC9H 2ZCHP 4YLQH 1UFXA 3A8DA 4PQWA 3LGYA 1Y5BT 1O5BB 3F9FA 4BNRA 2Z3CA 1ZJDA 2HNTE 5KGOA 1YWUA 1GMCF 1FC7A 5EW2H 4DOQA 1N6YA 4BAMB 4GHNA 3DORA 1CA0C 3GCHC 4RN6A 4A1TA 1EUFA 4XSKU 3E3TA 1PPEE 2KJKA 1FMGA 1GG6B 4FUCA 4P0CA 2AMQA 4IMQA 5A8XA 3C27B 3A85A 3F2FA 2KOJA 1XKBC 1N6XA 1C2LA 3SV8A 2GX4A 2J4IA 2EGNA 2BDAA 2P3WA 4UFEH 4NNLA 2J9NA 2OD3B 3SZEA 1RIWB 2AHME 1C5NH 2FS8A 1GCDA 2ODPA 2H5DA 1SQTA 5HFBA 3SORA 3O8CA 4TT3D 1O5FH 2EA3A 2ZU3A 1MKXK 1NT1A 2OBQA 1S6FA 1WTGH 1VGCB 1SLXB 1TNLA 2J97A 3BTFE 1W0JD 2VU8E 5FPSA 1Y59T 1ELVA 1DX5M 3RXRA 3ID1A 2VH6A 3QZQA 3SHAH 5A0BA 4UEHH 4P2AB 1A3EH 1L1JA 4Z6AH 2ENOA 1EATA 1WBGB 4MPVA 2FNEA 3ID2A 1SL3A 1V2QT 4Y0ZE 3GSLA 1OYQA 3BN9A 4TY7A 1QGFA 3FO8D 2A4OA 3D65E 1Y3XA 4LOYH 1VITG 1HAVB 1O33A 3U9AH 2G81E 1KLIH 3SV9A 3LC5A 1CU1A 4KTUA 3UNSA 1AE8H 3NUMA 1O3HA 3RL7A 4KGAA 1LTOA 2H2ZA 1VZQH 2PLXA 3EA7A 3ZYDA 1O3BA 1QBNA 2AEIH 5DP4A 1B7XB 4HOPB 4NG9H 2UUKB 4H4FA 2BD9A 4DGJA 1DXPA 2ZZUH 3M5NA 3QJMA 5EXMA 1GQ4A 2L4SA 1RXPA 1W13U 2O8LA 2RFKC 4U32A 4ZXYH 4CRDA 2PDZA 1AY6H 3A82A 1C5YB 1DWDH 3UWIA 3M61U 4BAQB 3QIKA 2FLRH 3LNXA 1O2TA 2BDGA 1TFXA 3BEIB 4N6XA 1M5ZA 1BJUA 3MU5A 2KBSA 2A32A 2XC4A 1LVYA 3V3MA 3E8LA 4GHQA 2F83A 4MNVA 1YC0A 1DT2A 1QBVH 1TQ7B 2BDBA 3KCGH 4HGCA 3KIDU 2QKTA 5EQQA 6CHAC 1BBRH 5T6DA 3PDVA 4Y8XA 2ZHQH 1L6OA 1WHDA 2J95A 2ZHFH 3M7UA 1KXCA 4JOFA 2GMTB 3MO3A 1KXEA 2QAAA 2OZFA 4FU8A 3L3TA 4AB8A 1O2GH 1C4Y2 5H4IB 4X1NU 1LPKB 3T26A 3E0PB 5JBTA 4UD9H 1WOFA 2IWNA 1QRXA 1C5OH 4AGJA 1C9PA 1T4VH 3NFLA 1EPTA 1K22H 1MFGA 1LMWB 1WU1A 2CS5A 2LC7A 5HEDA 2FOAA 1K0HA 4Y7AA 3GCOA 1FN6A 1U3BA 3ZZAA 4FUIA 5EIYA 3EA9A 1NRSH 2SGPE 1S6LA 3LOXA 3QTVH 3SUGA 1B8QA 3QGLA 5HKKD 4FETA 2L6OA 4D7GA 2C4FH 2Z17A 1GBBA 1HAGE 5ETXA 1QQ4A 1ZPBA 1R6JA 1FPHH 4BTTB 3GY6A 2VGCC 3LPRA 1INCA 3MO9A 3AK5A 3ZIAD 2VWNA 1TE0A 4LZ4B 5D13A 1C5VA 1Q2WA 3H7TA 1EAUA 1L1GA 1S83A 2H3LA 1LHFH 5EJLA 3MOCA 3WWFA 4SGAE 1MTWA 1P2KA 2A5KA 1RZXA 1J14A 1TPPA 2CK3D 4Z8JA 4JJ0A 3BTWE 4Y7BA 1V2MT 4AORA 1EZXC 1GI2A 3M3VA 3V12A 5GWZA 1O31A 3F6UH 1ZZZA 1C4U2 1SGYE 5HJ1A 1AKSA 2R9PA 4WH6A 3BTEE 2BY7X 4HG6A 3E16B 1RD3B 3K50A 4X6NA 1P01A 4A6LA 1N7TA 2IWQA 1O3AA 5FL7D 1WJLA 3D49H 3PLBA 4BAHB 2KJPA 2PKTA 2P59A 3DFJA 2XBWA 4AZ2B 4YYXA 1F0SA 1GBAA 4R8TB 4X6MA 2BB4A 3SV6A 1DANH 1O3OA 5HIZA 2C8XB 2PGQB 5HF4A 3LGUA 1GHWH 1GMDG 5DP6A 2SGEE 1JBUH 2OS6A 2ZFFH 1BTZA 1BUIA 1GHVH 4K5ZA 4BANB 1K21H 2V90A 1O3JA 2AFQB 2BY6X 3RXUA 2FLBH 2FOBA 4X1QU 2Z9IA 3K9XB 2HPPH 4MVNA 2BLVA 2I1NA 1EB1H 3CNRA 4TWWA 4D76A 3LNYA 1QNJA 4KTCA 1A46H 2F9PA 5SGAE 2THFB 2Z9JA 1X45A 3KL6A 4O3TA 4NZQA 3M3TA 2J94A 2CGAA 3NXPA 3SU5A 1VITF 1N8OB 1Z1IA 1C4V2 1C5QA 2C90B 3RXPA 1GHAF 4AMHA 1ZR0A 2STAE 4D9RA 1T8NA 1GBEA 3F3BA 1UVOA 5CMXH 4NSVA 5HGGA 4ISLA 3OE7D 4Z1MD 1O2SA 2EC9H 7ESTE 4AN7A 5C17A 5HFEA 1CHOG 2LPRA 3U1JB 3RM0H 5K0HA 1Q3PA 2GKVE 1KWAA 3OY5U 4UE7H 5DN6D 1F5RA 1YF4A 1V3XA 1NFYA 4A92A 1ZHMA 1OP0A 3SHCH 2WZQA 4OEOA 2GZ9A 1K1NA 1H9HE 1LVOA 4UONA 4U01A 2WUBA 3SBKA 1O32A 3LH1A 1UEPA 3WWBA 1UHPA 1F5LA 4CHAC 1K1LA 3T27A 2TGAA 1TALA 1T4UH 2A4QA 3TIUA 2Z7FE 2HPQH 1V2LT 3OYPA 1YPHC 3UTUH 1OXGA 1G2LA 2OSGA 1D6WA 1FY8E 3P8OA 2ZTXA 1BHXF 1MFLA 3BTKE 2LUIA 2BVSH 1IHSH 3ATMA 4NMOA 1CBWC 1PPBH 1UTOA 3UFAA 3TH3H 5HFCA 2KPKA 2QE7D 3PWBA 1SGDE 1IQEA 1CA8B 1E1RD 3ZVFA 3B9FH 4ABHA 6LPRA 3KN2A 2HLDD 1ZMNA 4YOJA 5T6GA 2M0TA 2LOBA 3U98H 4HZHA 2KG2A 2W3IA 1UVUH 3LGWA 1COWD 4CRGA 1TNHA 2BDHA 6CHAB 1P02A 4AFZA 3T28A 1K2I1 2WPKS 2VZ5A 1GCTC 1V2JT 3K6YA 1FAKH 2GZ7A 4YT6H 2W26A 4BTIB 3VXEH 1DY8A 1TA2A 1XKAC 3GISB 2BD4A 1WQSA 5JBAS 3PLPA 2EI6A 4H42U 3ATLA 1OZIA 5GCHG 1AB9C 1BIOA 1C1RA 5C1YA 1P3CA 1TWXB 1N6DA 1DICA 2G8TA 3DUXH 4NA7A 1O2NA 1PPHE 1NS3A 2P93A 1ANDA 4Q4LA 1EAIA 3MU8A 1VA8A 3BIUH 5C94A 1O2YA 1QLCA 2H9TH 3QN7A 3UWJH 3RM2H 1GJ9B 1H4WA 1T32A 1SC8U 4NIWA 5FBIA 3WKLA 4K8BA 3RXIA 1AFQB 1GI6A 1O34A 4MTBA 3RXAA 5ESTE 1DUEA 4HOPA 3PROA 5F8ZA 1GJDB 2VGCB 1HBTH 3UIRA 1TNIA 3PDZA 3KQDA 1Z8RA 4XDEA 2JXOA 2A45B 3OFND 1A5GH 3NFKA 1YLNA 2FESH 4AFSA 2R2WU 3S7HB 3PYHA 2PUQH 1RRKA 1GJ6A 1PPGE 2GP9B 3PWCA 4KFWA 3LJJA 3ID4A 1QL8A 2STBE 3A81A 3O8RA 1S81A 5T6FA 2TGDA 3RL8A 3AASA 3I77A 1DWBH 4G69A 1RTFB 2REYA 3ODFA 3R0FA 4FUDA 2EY4C 4B2BA 3RLYH 1W14U 2VIPA 2QV1A 1C1WH 1T8LA 1HAOH 4Q6HA 3ZZ4A 2GT8A 2PV9B 4Y79A 1C5RA 1GMDF 4B73A 1TPSA 1THPB 2KOMA 4KELA 3GICB 5F03A 4A1VA 2OQUA 2I0IA 1XMNB 2BOKA 1W7XH 1YPLH 2L97A 2BYGA 1YBWA 2P95A 3O46A 1XX9A 2VIOA 4ZXXH 3RU4T 3SNDA 1TQ0B 2QIQA 4F55A 3SOEA 4L8NA 3LDXH 4ACBA 3RXSA 4SGBE 1GHBG 1XZ9A 2M0ZA 4ESTE 2KOHA 1G30B 5HFFA 4WWYA 1QHRB 4DIHH 2WV4A 4RKOB 3RMNH 1FY3A 4TPIZ 1UHBB 1V2ST 4XHVA 1MTVA 3LGVA 1SKYE 4NGAH 5JBCS 5DSFA 3MI4A 1CHOF 2NWNA 3EA8A 1UW7A 4XE4A 2KJDA 1W0YH 2JOAA 4VGCB 2ZA5A 3SUEA 5A8ZA 4ZHMU 3NZIA 1A0JA 1EOJA 1UK4A 3SNCA 4ABIA 6ESTA 1Y5AT 1O2HA 2A4RA 2PZDA 5C1UA 2SNWA 1V2TT 3RXOA 2VIWA 2YMSD 2GCTC 2KRGA 4FU9A 2YT8A 3PRBA 1LHEH 9LPRA 1THRH 1QRZA 3CS7A 5J4SA 4GPGA 2KCPA 1V2RT 2RDLA 2QA9E 4NCYA 1K28D 1HAXB 2KM0A 1X5QA 3TJNA 3HK3B 3KQBA 3KDKA 1FN8A 3Q76A 1O2JA 4QT8C 1AHTH 1WDIA 2B0FA 2BVXH 2FPZA 4Y0YE 4X6PA 3P95A 4JORA 1Z86A 5G1DA 3SNAA 3TK6A 1NY22 3A7ZA 1HAYB 2Q6DA 1G3CA 3DSPA 5HYOA 3I4WA 1TOMH 2I4SA 2P3UB 3A87A 2I04A 1OS8A 2HGAA 3AW1A 1UK2A 2Y5GA 1ETSH 2QF5A 3HPMA 2AERH 3E91A 4NIXA 3OU0A 1ZSLA 5EQRA 4GUXA 2VWLA 1U39A 1O3PB 2QCYA 2WPLS 2ZPSA 2WPJS 2QKVA 1QAUA 2OCSA 1HAHH 2FDAA 4F48B 2TRMA 3M35A 2CSSA 5C5OA 2EGKA 5HEYA 7GCHG 1GDQA 1W7GH 3F2HA 3SJ9A 4Z0KA 1NESE 2XYAA 1GHYH 1C1SA 1L4DA 1C1OA 1A4WH 1CBWB 1AZZA 4X8TH 3STJA 2FOCA 1GBCA 5JXBA 2ZWLH 1YLDA 1BRUP 1NTPA 3HKIB 1D4PB 2ZGBH 2V7QD 1WTHD 5DGJA 5T1VA 3QE1A 2BQ6B 2FOMB 2R3UA 3ZYEA 2AINA 4OEPA 2ALVA 1QAVB 1H9LB 3KYGA 3SOSA 4B76A 5EPYA 1OHHD 1RJXB 5ESBA 1OWEA 2H5CA 1P03A 1W0KD 1KXAA 2BXUH 2P3FH 1VCQA 4K3JA 1O2RA 2JETC 2K20A 3ZZ5A 1XUIA 3PMBB 1TRNA 2Y7ZA 1NRNH 4AGKA 1OBYA 3U8OH 3BV9B 3FVFB 3GJ9A 1A5HA 1WSSH 4WH8A 2G5MB 5A09A 1RY4A 3FP7E 3UAIC 1UEZA 1A1RA 1C2IA 4DIIH 2BY5X 1N6FA 3DIWA 2DB5A 4CR5A 1O3CA 2HVYB 1V2NT 2JIZD 1FY4A 2ZDNA 5C2ZA 2BHGA 1W3CA 1UJUA 2ZECA 3LC3A 3NPSA 2XBXA 2BZAA 4X8SH 1C5PA 1HV7A 4K8YA 3O5NA 3E17A 5EYZA 3SI3H 2KAIB 5E2PA 2OGPA 1X5RA 1NU7B 1RS0A 1OP8A 1MD7A 4NMSA 1RTLA 1XUJA 1ZHRA 1QIXB 4B71A 1T31A 1FDPA 1PQ5A 1BOQA 2WV9A 2KZ4A 1GHBF 2G55A 3DFLA 2EEKA 3GY4A 1XUGA 3RXJA 2RCZA 1AFEH 2G5NA 4J1YA 1Q3OA 3GOVB 5FX6A 1CO7E 4DW2U 1YCPH 3O8BA 1PQ7A 2PA1A 3MU0A 5FCKA 5C67A 3ENSB 2WPDD 5C0UA 3LGIA 5F8XA 1O3IA 1HB0B 3RLEA 3K65B 3ID3A 5CDFE 1O5CB 2KQFA 1ELFA 4K1EA 3GDUA 2IPQX 4O97A 4ABDA 3P8NA 1SFQB 1O2IA 1HFDA 3BIVH 1MZDA 2WV5A 4REYA 4E3BA 2RA3A 3M36A 1JXPA 3TGKE 1TNGA 2WUCA 2GJGA 1FPCH 1HAZB 2BXTH 2OP9A 2XOKD 3WY8A 2ANYA 4YXWD 2O9QA 3QTOH 2DM8A 5BRRE 2NU4E 1W9EA 5EJZA 1ZHPA 2QKUA 2EI7A 2SGDE 2YMSC 1WI2A 4GHTA 4ZAEA 5TCAA 1QA7A 5HMAA 1V5QA 2W7RA 2V3OH 2H9EH 2ZGJA 3K82A 3ZV8A 3CBZA 5HDYA 2ZTYA 2D92A 1O38A 2BY8X 1EASA 1YPGH 1YYY1 1H1BA 3SQEE 2V3HH 3FY5A 5IDKA 1L2EA 2LP6A 1BRCE 1O35A 4YO9A 1DSTA 2QYIA 2JINA 1SGCA 3OY6U 1P1DA 2XRCA 2PP6A 1C5LH 1OX1A 3QGJA 2VPHA 1WQVH 2UUFB 3QWCH 3SV2H 1AZ8A 3KQEA 1ZYOA 4NMRA 1NN6A 2R0KA 1NM6A 3VB3A 3NCVA 1EP6A 1HXEH 4NWLA 7LPRA 5AVDA 3SYJA 2P8OB 3I18A 1GBMA 2ZHWH 7GCHF 5E21A 3A8CA 3BEUA 2H2BA 4ZUHA 2QC2A 1C1PA 1S0RA 4NFFA 1S85A 1GVLA 1FLEE 4I8KA 4Q2NA 2FP7B 3OAAD 3HPKA 1F92A 1G36A 1HNEE 1MTSA 2PR3A 5HXFA 1P06A 3T25A 2PKSC 4I32A 1BMFD 2MHOA 1CGHA 3MH5A 2K8IA 2ZPMA 1F0RA 4BXWA 2G4UA 5E22A 1EAXA 3BPUA 1GDNA 1QB1A 2KCAA 1O2KA 1YPEH 1PYTD 1SB1H 1YPKH 3KQ5A 3ZVGA 1C5UA 1O2UA 4FVBA 1WXRA 1GVKB 3R3GB 2QGRA 4FOUC 1NBMD 2BD7A 4ZHLU 2Z3EA 2LA8A 4E34A 2FX6A 4IMZA 2Y7XA 2BLQA 2CXVA 1QZ8A 3V0XA 4JZ1A 1O2XA 1O2LA 4KFVA 1H8DH 5EQSA 1LHGH 3K6ZA 3V13A 1C5ZB 2AIPA 1C1UH 1TGCA 3GCNA 2VSVA 4KP0A 2ZTZA 1SGEE 3HPTB 1V5LA 3RP2A 1OWKA 2XTTB 1J16A 3PO1B 3ATKA 1UM1A 3H09A 3JZ2B 4X1PU 4CRCA 1AD8H 1Z8IB 1SHYA 1DPOA 1GI5A 2J92A 2WPMS 8GCHG 2H2CA 1JRSA 2ZKSA 3DT0H 2ASUB 2F3CE 4I8LA 3F0PA 3ODDA 5HF1A 3A89A 3F9GA 1UTNA 4CREA 1K9OE 1O2PA 1MC7A 4WMFA 3GY5A 3RXLA 1N6EA 1B5GH 3KF2A 4ABEA 4Q63A 3UOPA 1V2UT 3LJOA 2AGIX 2KR7A 3PMJA 3AVZA 4MDSA 4JK5A 1Z87A 5HETA 3MMGA 5HM2A 4TY6A 2ZQ2A 1ZRKA 3GCTG 2C93B 3PRDA 1SLVB 3F68H 2K0QA 4X2YA 3GY2A 4CRFA 1IQHA 1D3PB 1YPMH 1AUJA 3ESTA 3T2NA 2OC8A 2ZPQA 1OWDA 3OSYA 1VCPA 1A3BH 4RSPA 8LPRA 1P2QA 2KCOA 4B2CA 3BTDE 2D90A 1UJDA 5JDUB 2FYRA 1C1QA 1FXYA 1T7CA 1A7SA 1PPFE 3UB0A 3VEQB 1DWCH 3F9EA 3DSGA 5FPYA 4D9QA 3OEHD 1BTPA 5GIBA 3LH3A 4ISOA 2ZFSA 1QAVA 2BX4A 4I8JA 4M9FA 1TYNA 1NFUA 1DFPA 1LVBA 2K1QA 3OTPA 1VJ9U 5IL9A 2ALPA 1IQIA 3UOUA 3P8FA 4Q2OA 1KLJH 1BRAA 5EJ1A 4OM9A 2YNBA 1ZSJA 1XUFA 3E1XB 3TK9A 2F43B 3GYLB 4K69A 3FAOA 3E6PH 2G4TA 4INHA 1ZOMA 1A0LA 2VVVA 2PSYA 1Z6JH 2IPHA 3RC5A 4MNXA 1NC6A 1UK3A 5LPRA 2V6NA 2JH6D 4H6SB 3RU4E 3UNRA 2SGQE 3EDXB 2BM2A 1BTWA 3PV2A 1EXFA 1ZOKA 2ZIQH 1KIGH 3S9CA 1CA0B 2OPGA 1GBKA 3GCHB 1ELDE 1KDQB 2Y80A 3E0NB 4HTCH 3T62A 2G2LA 3S9AA 3OTJE 3SU4A 4Q7XA 3CYYA 1MABB 4E7NA 1BE9A 1LCYA 1MTNC 2ZEBA 4XBBA 5H3JA 4X8UH 3K1RA 2JSNA 4IS5A 2FXRA 4X0WU 2HVXA 2KAIA 4XBCA 1H9IE 4E06H 3QO6A 1EOLA 4AG1A 3ZRTA 4DG4A 2GV7A 1OKXA 3SHUA 1UEQA 3QK1A 1UEWA 1C5XB 1E38B 5DPAA 1GJAB 1AUTC 2GDEH 2PHBA 2SGAA 1Z1JA 9ESTA 1E0FD 5KEDA 3M37A 1P05A 1FCFA 2W5EA 1NPMA 2RA0A 4J2YB 1D5GA 5HEBA 3SI4H 1W9QA 1AVXA 4A1XA 4X2VA 2P3TB 4FUGA 2BD5A 1PYTC 1QFKH 2ANWA 4ZCNA 2VWRA 2PKAB 2FX4A 3A88A 2JDID 3ATIA 1ABJH 3CBYA 3VPKA 5A2PA 2TGTA 1GBDA 3W94A 2D1JA 1P11E 3RXHA 2FIRH 3EAJA 3RUOA 4AFQA 2VINA 3STIA 1B0EA 2V0BA 5EZ0A 2PKSB 4NMVA 3IWMA 1EPTC 3GY8A 2OK5A 3FP6E 2QF0A 2XBYA 2BYAX 5AFZH 4MPAA 3BTQE 3GS9A 3OEED 1UJ1A 4IC6A 2RCEA 1UITA 1P2NA 4RT0A 1TONA 2XC0A 1FV9A 8GCHF 2BQWB 2DLSA 2A31A 2D26C 2OC1A 3I1EA 3T29A 1GHXH 2Y81A 4WXIA 3MH4A 2FN5A 1IQJA 4WMEA 2ZDKA 1DY9A 2CV3A 1IQLA 2NU3E 1DITH 2F9VA 1FQ3A 3SGQE 8KME2 1Y5UT 2Q6GA 3HATH 1ZUBA 3GDVA 4O9VA 1HLTH 3GYMA 3SUZA 3AXAA 1BA8B 2HOBA 3RLWH 4ABJA 3QLPH 1O3EA 5I25A 2TBSA 1Y7NA 4D8NA 1RTKA 4LK4A 4OAJA 2PGBB 1Y3UA 1MD8A 1MQ5A 1ZLRA 1SR5C 3V7TA 1BCUH 3ZVAA 4NFEA 1EJNA 3VXFH 1CGIE 1O2WA 1VAEA 1SLUB 1O5AB 5EODA 2DMZA 1Z8JB 1CT0E 2J34A 3M3SA 2Z6BD 2JH0D 1HAVA 1FX0B 5DP7A 3GY7A 3NGHA 1WIFA 1EB2A 1J8AA 1U6QA 2A7CA 1O30A 1ABIH 1AI8H 1UTLM 5GNDA 1I16A 2OQ5A 1DLKB 2A4GA 4X1RU 3TSVA 4CH8B 2EAQA 1GL0E 2M2AA 2Z9GA 1VR1H 1KMHB 4MLFB 2Q3GA 3A7WA 1LKBA 1F2SE 1K1MA 1QQUA 5ABWA 4FUBA 5DP8A 1TBZH 1YGCH 3KQCA 1KLTA 2WSSD 5F3XA 3RC4A 2D8IA 2PNTA 2CHAC 5A8YA 3P70B 2I6SA 4WYUA 1A2CH 2ZQ1A 1UM7A 2KFWA 5JB9S 2KV8A 2A5IA 3RU4D 1BB0B 1BRBE 2UUYA 4R0IA 1THSH 1SQAA 3A84A 4ISHH 4OS1A 2WHXA 2DJTA 1E36B 1ANEA 2FZZA 1S84A 1SBWA 2KCYA 4FUJA 1V1TA 3LGTA 4OS7A 2EEJA 2DAZA 2A7JA 1VJ6A 2K1ZA 1YCPM 2LNCA 3N7DA 4MPWA 3RMLH 3N7EA 3MO6A 4NMTA 2UZCA 1OSSA 4B2AA 1P12E 2ILNA 3LIWA 5G1EA 1TA6A 1P2OA 4MQAA 1ELCA 1XXFA 2ZFRH 1HAIH 1TMUH 4M7GA 1MZAA 1UCYE 2KAWA 1PPCE 1O2QA 2AMPA 3B8JA 4IC5A 1XVOA 2O8MA 3TH2H 2EEGA 2BVRH 4E35A 3TJUA 3ZZ7A 1MAYA 4LXBH 1Z7KA 2ZU4A 5CHBA 1JIMA 4WMDA 2RRMA 3PV5A 1C2EA 3A8AA 1EFRD 1C5SA 5E11A 5FX5A 3RXMA 1EQ9A 1KEFA 1AMHA 1BMAA 1P2IA 1EJAA 1SGTA 4IGDA 1LDTT 4NZLA 4ISIH 3DSOA 3LKWA 1DE7H 2RDEA 2Z3DA 3IG6B 3SFJA 1YM0A 5L2ZH 4JK6A 2D8WA 1BFEA 3DHKH 1TX6A 3P92A 1RGRA 1DWEH 5E2OA 2L74A 3DD2H 2NU0E 1FONA 2VIVA 4NXRA 3HK6B 5C20A 4U2WA 1GVZA 5G4BA 4AG2A 1HJ8A 1FAXA 4B6FA 1EX3A 1T8MA 1RIWC 1YCPK 3FOAA 2HLCA 2DKRA 1BTYA 2I6QA 2EEHA 1TQ3A 4IW4E 3JZ1B 3BTME 2PFEA 4Q2QA 4JZEH 1F0TA 4BXSA 4Y10E 5DG6A 3Q3KA 3SV7A 1GJ5H 4MNYA 5T3HA 2FODA 2BOHB 2M0UA 2ZNKH 1GPZA 4YOGA 4MPUA 4CHAB 2R2MB 1GBTA 1V2VT 4XRNA 1F5KU 1SVPA 3S7KB 4BTUB 2FOFA 1SGQE 1JMOH 2WPHS 1FJSA 1H8HD 3RMMH 2I0LA 2AYWA 2ZP0H 1GI8B 2ZCKP 5EOKA 1Q7XA 2JJ2D 1UF1A 4ABGA 2EGOA 1PQ8A 3CH8A 2EDVA 2GZVA 4OS2A 4NXPA 3NWUA 2FE5A 3DJ1A 1CQQA 4H11A 3Q3XA 4JOGA 3ZZ3A 5GCHF 5K7RA 1X7AC 5AFYH 1ZGIA 1UMAH 3URCA 2VH0A 2SGFE 2XCNA 4I33A 4ASHA 5DJ7A 1KXDA 2YNAA 3SGAE 1TGNA 1Y3WA 5A2MH 2EXGA 1D3DB 1TPOA 1GCTB 2M5TA 1WI4A 3PB1E 1CT2E 1PJPA 2V35A 4Y6DA 1V62A 1NBME 2OBOA 3TJVA 1IQFA 1S5SA 2HALA 2TGPZ 4AFUA 3M5MA 1DDJA 1LQDB 1AB9B 1P1EA 3CC0A 1JIRA 1GL1A 3TMHA 2PKAA 1HIAB 1MUEB 2CJIA 2GMTC 3MHWU 3Q00A 4K2YA 2XXLA 3LONA 1UTMA 5EPNA 4E7RG 4ABBA 1FI8A 2HRVA 1TP5A 2AGEX 1XM1A 1SG8B 2WINI 2J2UA 1P8VC 1GBFA 2G5VA 1GBJA 4O06A 3EE0B 7KMEH 3RXGA 1TNJA 1ELBA 2LC6A 1MBQA 5DP5A 1DSUA 2GDDA 3NRLA 1TBQH 3KDGA 2FCFA 2F9UA 1WF7A 4ISNA 4WJG2 4K72A 2BLOA 1BTHH 1YP9A 1XUHA 3KZDA 4HFPB 1QR3E 5JBBS 4A5TS 1NU9A 3MH7A 1DUAA 1DXWA 4NMQA 3SHWA 1WV7H 1HDTH 2OC7A 1IQGA 2LELA 3MNBA 2O8TA 3C1KA 1ZRBA 2A5AA 1K1PA 1ELTA 4JOJA 2M10A 2ODQA 1DS2E 1KY9A 2ZU5A 3TNSA 3U1IB 1HAPH 1J9CH 5AHGH 1AGJA 1K1OA 3MU1A 4UFFH 1X6DA 3B23B 1ESBA 3RXQA 3M7QA 4FLNA 1GGDC 2R4HA 2FO9A 2FWWA 1SSXA 5EW1H 2AH4X 4A7IB 1P2JA 4E05H 2TPIZ 1F7ZA 1ESTA 1SQRA 4Y11E 5HM9A 4PROA 2P94A 2GD4B 2YUBA 2QG1A 4ZROA 4TYDA 4DURA 1G32B 1SGIB 3SU6A 1ZSKA 1TGSZ 1BHXB 1MAXA 1OP2A 3IITA 2PKUA 3SO3A 3FANA 5E0GA 2ANKH 2Q9VA 1E37B 2BDIA 1LO6A 5JYIA 2BDCA 3A7XA 2IN2A 1MU8B 2NU2E 1W8BH 3PLKA 1GQ5A 2ZG0H 3CENA 5L6NH 2E7KA 2A2QH 2Z9LA 3MNCA 3RDZA 1C2DA 2CN0H 2GT7A 4X2WA 1TGBA 2QF4A 4CBNA 3ZV9A 3VFEA 2BZ6H 1ANBA 1HJAC 2ZF0H 3OX7U 1O3FA 6GCHG 8ESTE 1FIZA 1TABE 1NO9H 2GCTB 1WCZA 4AOQA 3MYWA 1B0FA 4GSOA 3EGHC 1LQEA 2VVCA 3RXVA 4UDWH 1UTJA 5DK1A 3SU1A 4JOPA 4JYVH 2DLUA 4YT7H 2VIDA 2EJYA 1OWIA 1TMBH 4Q7ZA 2IJOB 5L30H 2VRFA 5IK2D 3VB5A 1N8OC 1T8OA 5GXPA 1J17T 5B6OA 1PQAA 1UTQA 3BTTE 5GLJA 3M5OA 1BBRE 1K1JA 2B7DH 4HI3A 5E8EH 3FZDA 1CE5A 3TJOA 2ZU1A 5GPIB 4X2XA 1GWAA 1YLCA 1Y3VA 3L4FD 3EE7A 1MCVA 3LU9B 3KZEA 1P9UA 1CSOE 1GI4A 1HRTH 4NNMA 3QGNB 1EAWA 1UHBA 1NFWA 2ZFQH 4JYTA 2FOEA 2X7ZA 1QY6A 3SU3A 3QZRA 2DC2A 1FNIA 1VITH 2IJD1 5AF9H 4Q7YA 3RXCA 1NRPH 1N7EA 1GHAG 2YT7A 2VWMA 1Q3XA 1E1QD 3O8DA 1IQNA 1U38A 2OLGA 2XW9A 4UU6A 2QXGA 3GABA 1JOUB 3EGKH 1QB6A 2J5UA 2Y5FA 1PPZA 3B76A 4B74A 2JKHA 5LH8A 4Q2PA 4ABFA 2B9LA 2XNIA 1TOCB 5A0CA 2ZGHA 3CBXA 1NRRH 2AWUA 3M5LA 4I86A 4JZIA 1G3DA 4INLA 4Y71A 2OQSA 2YUYA 2YOLA 1TPAE 1W0ZU 1VJAU 2ODYB 2JETB 2MX6A 1OWHA 3VB4A 3TSZA 2ZPRA 3PM3A 4NXQA 1W10U 3PMHB 2EEIA 1CHGA 1NRQH 2FS9A 3I29A 1CGJE 2QBWA 1Z71A 3TVJB 4K1TA 4ACAA 5I46H 5I7ZA 2XBVA 3SJOA 2OCVB 3H5CB 4X8VH 1WUNH 2H3MA 3ELAH 4NA8A 1SLWB 3S0NA 1O36A 5GJ4B 2V1WA 1ZMLA 3A86A 3DJAA 1W9OA 4JJ3A 4Q80A 3CS0A 4LMMA 2ULLA 2CMYA 1P10A 1XUKA 3VB6A 1O2MA 2Y82A 3KHVA 1S6HA 3R0HA 3KGPA 2QY0B 4YZUA 3F2GA 1ZTLA 1GJCB 3A7YA 1LVMA 4FGMA 1IAUA 2IWOA 4UU5A 1BTXA 1P04A 2PSXA 4Q2KA 4K78A 2BD2A 3TGIE 1AFQC 1BMMH 2VIQA 2VBCA 4GAWA 1P9SA 3VQGA 4Q6SA 1P09A 1ID5H 1ZJKA 1C1TA 2B8OH 3ITIA 4JYUH 4XFQA 1GI0A 1C5WB 1WFVA 1FY5A 1K1IA 2TIOA 2SFAA 1ELAA 1Z8GA 4F8KA 1CT4E 2ZCLP 4OGXA 3N7OA 3AW0A 4ZKNU 3SU0A 3F1SB 2AGGX 2RG3A 2ANMH 2F4LA 2FI3E 2UWPA 1V2KT 3PMAB 2C8WB 4Q3HA 1O5GH 1TNKA 2C8YB 3AAUA 2WL7A 1MKXH 2KL1A 2BDYA 4XOJA 2JH5D 1GGDB 1FC6A 4B6EA 2FYQA 5E1YA 1BITA 2XC5A 2QF3A 1IQMA 1AVWA 4B75A 2CSJA 1FY1A 1VCWA 1YKTA 3NKKA 1KTSB 3P17H 2AWXA 1TGTA 1HIAA 3RXFA 3A7VA 1RFNA 3WW7A 5EXNA 1AVGH 5ILBA 2W7UA 6GCHF 1HJ9A 2R0LA 1QURH 2EHRA 2YMSB 1AU8A 1BMLA 1ZTKA 1TLDA 4YLUA 1TRMA 4Y76A 4GLYA 5E0HA 1E35B 3FP8E 2XWAA 4NIVA 1WFGA 5GDSH 3UPEA 3BTHE 1F0UA 1IQKA 2BD8A 3DCLA 2XCFA 4KKDA 3A8BA 1K32A 5C0TA 1NTEA 1KXBA 4FVDA 1D9IA 1SOTA 4WF8A 1DLEA 1EZSC 2NU1E 1O5EH 1ZGVA 2XNDD 1VKYA 1O3LA 1QL7A 5FCRA 1TMTH 2Q1JA 1MH0A 1LPGB 3TK5A 5PTPA 2BMGB 2FI5E 1D3QB 1O3GA 1TB6H 1HJAB 3HVQC 1HCGA 5EU8A 4O03A 1RGWA 2F9OA 3ZVBA 3EGGC 1MKWK 2HNTF 4VGCC 2GEFA 1MQ6A 2IOTA 1LHCH 1WHAA 4ZKRU 4AB9A 2GTBA 2VSPA 3L33A 3MH6A 1SOZA 4RKJB 3UR6A 1ZPZA 2PWXA 4I7YH 1AWFH 1GI7B 4JMYA 3TSWA 4JL7A 3SJ8A 2H6MA 4GVDA 4BAKB 3RMOH 2JJ1D 1V2WT 4JOHA 1SPJA 5F8TA 5EGMA 4MNWA 3UNQA 1L4ZA 3RXEA 2Z94A 3FKSD 3BF6H 2ZPLA 3N99A 4NWKA 3SU2A 4DJZB 2A2XH 1GMHG 3HGNA 3A83A 5DKMA 3KEEA 1I92A 3DJ3A 1SGNE 2ZFTA 4H6TA 1WG6A 2FM2A 1EP5A 3MQKC 1TX8A 1H8IH 3FZZA 3W95A 2ZDVH 2HE4A 1N7FA 1CVWH 1O3MA 2O8UA 2W6JD 4FU7A 1GJBB 4K60A 2M0VA 1GI9B 2OC0A 2Y6TA 3LT3A 4CH2B 3UUZA 4IN1A 2FEQH 1QJ7B 3ATWA 3BEFB 1V2PT 4WVPE 2F9BH 1TBRH 2OINA 4OGYA 4CRBA 4DT4A 1HGTH 2V3MA 2ZFPH 3MTYA 3FN8A 2DE8A 3S69A 3VQFA 5EG4A 2GZ8A 3UY9A 2WYJA 2FI4E 2WPIS 1U37A 2KA9A 1AWHB 1G9OA 4WYTA 3SNEA 1J15A 3VGCC 2BD3A 3UQVA 5E6PB 1O2OA 4ZKSU 1GBLA 5C3NA 3GCTF 1GBIA 1N99A 4EDJA 4B1TA 1ZMJA 4JOKA 1O3DA 4CRAA 5F67A 1BQYA 2D2DA 1AIXH 3MWIU 5L2YH 3UQOA 1GJ8B 3RC6A 4BOHA 4U30A 1EKBB 1EZUC 1P57B 1QJ6B 1QTFA 2ZHDA 1EJMA 1O37A 2UWOA 4UFGH 4D7FA 2WYGA 3ZZ8A 1TAWA 1QJ1B 4CR9A 1OYTH 1GJ7B 1M9UA 5JB8S 2VNTA 4AX9H 1UCYK 4KTSA 4YM9A 2W6ID 1Y8TA 2VVUA 4TPYA 4Y8ZA 4ZH8A 2OUAA 3QJNA 3UR9A 1PDRA 2J98B 4CBOA 3ZVCA 3MNSA 3BSQA 1Y3YA 1FZZA 2OTVA 3U8TH 4NMPA 1IHJA 2P16A 3EQ0H 1ARCA 1E34B 3S9BA 1OBXA 1O2ZA 1NF3C 1IU2A 4I8GA 2DUCA 2FTMA 2FOHA 4MG3A 3RXBA 2JILA 5DP9A 1WYKA 3BG4C 1GJ4H 2L4TA 2AWWA 3AAVA 3SN8A 3K2UA 1DOJA 3TGJE 2HNTC 5DO4H 1MKWH 1NROH 2BQ7B 2JIKA 1BDAA 1OOKB 2W4FA 2F9NA 3NK8A 5B42A 1OWJA 2JREA 2G00A 5CHAC 4K1SA 1AO5A 1YPJH 1ESAA 3KYFA 3TNTA 3A80A 3SNBA 4RI0A 3SGBE 5KECA 1A5IA 1LHDH 3MFJA 2H9HA 3G01A 4AYYB 3F0OA 3P8GA 5A0AE 2R3YA 4R2ZA 1O3KA 2QXIA 1SGFG 2QXHA 3QX5H 1GDUA 1H8ED 4DY7B 4Z33A 1AN1E 3FFGA 4ZMAH 1JRTA 3VB7A 5FPTA 5HFDA 1S82A 5FAHA 5TJXA 4MPXA 3U8RH 4K75A 2G52A 2GCHG 3TH4H 2VJ1A 4FXGH 4Y8YA 1O2VA 2F0AA 1ZPCA 2FOGA 1UTKA 3EYDA 4I8HA 1ELEE 2Q6FA 4ASUD 1X8SA 4WXVA 1SQOA 4LZ1H 2KX4A 5E0JA 1O3NA 2BLWA 1MTNB 2UWLA 4UFDH 1MBMA 3SQHE 2KPLA 1O39A 1FIWA 2ZGXH 4GCHG 3ZZBA 1E79D 1GI3A 1LPZB 2ZDLA 3KNXA 4OS4A 2EDPA 1X9ZA 4NSYA 3WKMA 1C2KA 2H1UA 1GG6C 2CF8H 4JZFH 3PS4A 2QXJA 3SUDA 3GDSA 4INKA 1HUTH 1A61H 1TIOA 1G2MA 3ZZ6A 1KYNA 4O3UA 3ZVEA 1C2GA 4K76A 1DVAH 3SJIA 1UJVA 1GMHF 3SUFA 2I6VA 4OS5A 3CP7A 4FUEA 2A7HA 5DP3A 3ZZ9A 1IOEA 3SW2B 1SGPE 2AS9A 1GMCG 3R69A 1MTUA 2ZDAH 1T2MA 1VGCC 5C1XA 3E90B 5LPEA 1ETRH 1BJVA 1ORFA 1W2KH 1KSNA 4IBLH 2HWLB 4YOIA 1D3TB 1UCYH 4I31A 1LKAA 1S0QA 4WY3A 1QL9A 1FC9A 1MU6B 2SNVA 1P0SH 2P8OC 5TCCA 4DVAU 1ETTH 3U69H 3ZZCA 2BTCE 1Z6EA 2AIQA 5EXLA 1EPTB 1QCPA 3D62A 1C1VH 5B6LA 2YTWA 2PTNA 3H7OA 1KTTB 3L6PA 3MU4A 1V2OT 5JPMH 3URDA 2ZI2H 3MNXA 3P6ZB 1UVSH 1JWTA 1KDQA 1PFXC 1TRYA 1HYLA 2IWPA 4YTAA 1A0HB 3QUMP 2O2TA 1ANCA 1KXFA 1QBOA 2F91A 5BPEA 1NZQH 2O8WA 1IHTH 4ZKOU 3QDZB 3I78A 2ESTE 3GGEA 3PV4A 5IYTA 3W1EA 1FUJA 1SI5H 1P2MA 2G51A 2QN5T 2AMDA 4AYVB 2UUJB 3JXTA 4K6YA 1O0DH 1GM1A 4GVCA 2PTCE 1SGRE 4ZHAA 5CE1A 1L0ZA 5C5NA 1GI1A 2FMJA 3VGCB 2ZHEH 2C8ZB 2C3SA 1GBHA 1HPGA 4F4OC 2OXSA 5FHTA 4BAOB 5F6MA 3D23A 2ZO3H 2M3MA
chains in the Genus database with same CATH topology
3ZZDA 2BY9X 3TU7H 1AQ7A 1W12U 1Q31A 4IN2A 4THNH 2PUXB 3GY3A 1V6DA 4XBDA 3Q3YA 1AKSB 1C1NA 4JCNA 1G3BA 2QT5A 1UVPA 1C2MA 1P3EA 3BTGE 3PO1C 1C1MA 4ABAA 3RXTA 1ELGA 1SHHB 2W7SA 1BTUA 1BT7A 3Q77A 2ZGCA 4NIYA 1ACBE 1ARBA 1XVMA 1IU0A 1SGFA 4OS6A 1AE5A 2Y5HA 3TPIZ 4GVUA 3TITA 3HKJB 3BG8A 1OBZA 2CF9H 1WH1A 1TX7A 1UO6A 3A7TA 5FXLA 1TP3A 2EV8A 2ZDMA 1C9TA 1XXDA 1YPHE 3TLOA 3SJKA 1BMNH 1YBOA 3HGPA 2GVFA 2FTLE 3DA9B 1NFXA 2KYLA 1WAYB 2EI8A 3UREA 2CHAB 1WF8A 1QA0A 1GHZA 1QB9A 3BG4B 4NA9H 2HE2A 1C2FA 1O5DH 1C5MD 1N1LA 5LPFA 3QDOA 3T5FH 2B5TB 2PW8H 2EDZA 1C5TA 5FB8C 4JOEA 2A0QB 1BZXE 1X5NA 4X6OA 3KHFA 5FBEA 5J4QA 1RGQA 2Z9KA 2J38A 1EZQA 2GCHF 1V6BA 2A1DB 2GGVB 5CHAB 2HGTH 1ZTJA 2DE9A 2JWEA 3F9HA 5LGOA 1C2JA 2W3KA 3NCLA 3PTBA 1C2HA 4DCDA 1SFIA 2BX3A 1G37A 1VB7A 4JZDH 2VB0A 1DM4B 3RXKA 4X1SU 1BBRK 1MCTA 3PTNA 4GCHF 1SMFE 1UVTH 1L1NA 2VWOA 3M7TA 5DTHA 4YDPA 4FUHA 4TWYA 1OPHB 1G9IE 1G3EA 2OMJA 2F5YA 1W11U 2GV6A 2XWBI 4YESB 3SZNA 1QRWA 1D6RA 4FUFA 3R68A 1HXFH 4DT7B 3RXDA 1MMJN 1UTPA 4F49A 2ZU2A 3ZVDA 2ZC9H 2ZCHP 4YLQH 1UFXA 3A8DA 4PQWA 3LGYA 1Y5BT 1O5BB 3F9FA 4BNRA 2Z3CA 1ZJDA 2HNTE 1GMCF 1FC7A 5EW2H 4DOQA 1N6YA 4BAMB 4GHNA 3DORA 1CA0C 3GCHC 4RN6A 4A1TA 1EUFA 4XSKU 3E3TA 1PPEE 2KJKA 1FMGA 1GG6B 4FUCA 4P0CA 2AMQA 4IMQA 5A8XA 3C27B 3A85A 2KOJA 1XKBC 1N6XA 1C2LA 3SV8A 2GX4A 2J4IA 2EGNA 2BDAA 2P3WA 4UFEH 4NNLA 2J9NA 2OD3B 1RIWB 1C5NH 2FS8A 1GCDA 2ODPA 2H5DA 1SQTA 5HFBA 3SORA 3O8CA 1O5FH 2EA3A 2ZU3A 1MKXK 1NT1A 2OBQA 1S6FA 1WTGH 1VGCB 1SLXB 1TNLA 3BTFE 2VU8E 5FPSA 1Y59T 1ELVA 1DX5M 3RXRA 3ID1A 2VH6A 3QZQA 3SHAH 5A0BA 4UEHH 4P2AB 1A3EH 1L1JA 4Z6AH 2ENOA 1EATA 1WBGB 4MPVA 2FNEA 3ID2A 1SL3A 1V2QT 4Y0ZE 3GSLA 1OYQA 3BN9A 4TY7A 1QGFA 2A4OA 3D65E 1Y3XA 4LOYH 1VITG 1HAVB 1O33A 3U9AH 2G81E 1KLIH 3SV9A 3LC5A 1CU1A 4KTUA 3UNSA 1AE8H 3NUMA 1O3HA 3RL7A 4KGAA 1LTOA 2H2ZA 1VZQH 2PLXA 3EA7A 3ZYDA 1O3BA 1QBNA 2AEIH 5DP4A 1B7XB 4HOPB 4NG9H 2UUKB 4H4FA 2BD9A 4DGJA 1DXPA 2ZZUH 3M5NA 3QJMA 5EXMA 1GQ4A 2L4SA 1RXPA 1W13U 2O8LA 4U32A 4ZXYH 4CRDA 2PDZA 1AY6H 3A82A 1C5YB 1DWDH 3UWIA 3M61U 4BAQB 3QIKA 2FLRH 3LNXA 1O2TA