3MHBA

Crystal structure of staphylococcal nuclease variant delta+phs l38a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mhbA00
2EY6A 1SNDA 2EY1A 3SR1A 4J1MA 4EQOA 1KAAA 5DAUA 1U9RA 3U9OA 5JAVA 3H6MA 5J1ZA 5DEHA 2F0LA 3HZXA 3NK9A 4PMCA 2KHSA 5KYIA 1F2ZA 4DF7A 5IODA 1IHZA 3ITPA 1KABA 5IIFA 1SYGA 1SNMA 4S3SA 4K5XA 5EKKA 3SK6A 3D4WA 4K14A 1EY5A 4B9WA 3ERQA 5KGUA 5ISRA 1KDAA 1TT2A 3D8GA 3MXPA 4WORA 2PZWA 5CV5A 2F0DA 2SOBA 1EY9A 3RUZA 4QB4A 2EY2A 2RDFA 5J39A 4NP5A 5F2DA 3TP7A 3OMCA 4K5VA 4KJOA 5CGKA 2PW5A 4KY6A 3E5SA 1AEXA 3MEHA 4K2KA 5I6WA 1NUCA 2OXPA 2ENBA 3SK5A 3NUCA 4QMGA 1STAA 2EYJA 3BDCA 4IZ8A 4LAAA 5EGTA 4K6DA 4OL7A 3VA5A 4KTAA 4K5WA 4NKLA 1A3TA 5IGFA 4RKBA 2EYLA 1SYCA 2F0IA 1SYFA 5C5MA 3HEJA 5C4HA 1STHA 2PZUA 2F0NA 5IGCA 2F3WA 1EYAA 1EZ6A 3QB3A 4K2LA 5CV4A 4ZUJA 5E1FA 5IGEA 1EZ8A 3BDLA 3EJIA 4NMZA 2PYKA 3R3OA 4HMJA 1SYDA 2F0FA 2F0OA 5JOBA 2F0SA 5KYLA 4KD3A 4N9TA 4K8IA 3SHLA 5EKLA 1A2TA 3QOLA 3T16A 1ENAA 4J6HA 4KY5A 3TMEA 1JORA 2EYMA 1A3VA 1A3UA 1SNOA 2PZTA 3C1EA 5HGTA 1KDBA 2EYOA 4TRDA 1EY0A 3OWFA 1SNPA 5CV9A 1STYA 5E3FA 2F0EA 4EQNA 2RBMA 1F2MA 3MVVA 4KJNA 4G57A 5I6YA 3QOJA 5KIXA 4NDXA 4WRDA 4KD4A 5C4ZA 4KV6A 2F0GA 4K8JA 3S9WA 3MHBA 1II3A 2F0PA 4IALA 1EYCA 2F0TA 2F3VA 1RKNA 3C1FA 5I9PA 1EY6A 3P75A 5K5PA 1TQOA 1SYEA 3SK8A 1STGA 4KHVA 5CV8A 3T13A 4F7XA 5CV6A 1TR5A 4EVOA 2F0UA 3OSOA 3PMFA 4HMIA 4DU9A 5KEEA 3D4DA 2EYHA 4F8MA 1SNQA 1KDCA 5IGBA 2PQEA 2QDBA 1EY8A 1NSNS 1JOKA 2EYFA 5J22A 5CV7A 3TP6A 2EYPA 2PW7A 2F0KA 4E6IA 5C6AA 2F0MA 2LKVA 1JOQA 1F2YA 1STBA 3LX0A 4IUNA 5M9OA 3NQTA 4HTHA 3EVQA 1ENCA 1A2UA 2NUCA 3NP8A 3TP5A 5I9OA 2O4XA 1SYBA 3NXWA 5IOCA 1EYDA 2F0QA 2F0JA 2OEOA 4I65A 3V2TA 3DHQA 5IGDA 2EY5A 1EQVA 2HQEA 2KQ3A 4PMBA 5C5LA 4R8NA 5KRUA 3TP8A 5CC4A 2F0WA 4H7BA 3SK4A 4ME5A 4ODGA 4QF4A 4PNYA 2SNSA 1EY7A 3SXHA 5C3XA 4ZUIA 3DMUA 5HURA 3MZ5A 3NHHA 2F0HA 1STNA 2SNMA 3P1HA 4MIUA 5NUCA 4RKLA 4DFAA 4DGZA 5C3WA 2RKSA 4EQPA 3D6CA 3OMGA 1SNCA 2WACA 1EY4A 2M00A 4ID6A 1JOOA 4KY7A 4ZQ3A 5CR3A 4YIJA 4B9XA 5IGGA 4N9PA 3EROA 2F0VA 2OF1A 2EXZA
chains in the Genus database with same CATH superfamily
2EY6A 1YNJD 4WJ4A 4J1MA 3GV6A 1AZPA 2E74C 1U9RA 2NVYH 3GTKH 2G5DA 2ES2A 1AZQA 5T1GA 4B3SL 3CC7A 4DF7A 3HOVH 3G4SA 1IHZA 1D1KA 5FO8B 1TWHH 2Q2HA 3KLRA 4K14A 3BDOA 1D6EC 4BA1I 1SROA 4PQXA 4UP9A 2HDMA 3JC66 5ELNA 3R2IA 4J8QA 3NE5B 1X3FA 4R4QA 2JA5B 1V1PB 4JI5L 4ZYSA 1OXSC 2E2HH 4OWTB 1PTOB 3FRPB 2LS01 5CYUA 3H0GG 1WTRA 1PH3A 3J81j 1VQ5A 5DM73 5C4XB 1VQMA 2B2YA 1B7YB 1C48A 1VQLA 2L5TA 1VQCA 3I8ZA 4JI8L 5C4HA 1S5CD 1TWGB 1WCMB 5EBCA 4K8IA 3SHLA 1NTGA 5CBAE 2AKWB 1QUQA 3NTKA 3EIVA 3C1EA 2PZTA 4HR7B 2MGSA 3A7AB 3RLNA 5E3FA 5M3FB 4G57A 5I6YA 3HP3A 1BF4A 2R6GA 3PO2G 2YYZA 1N36L 1E2ZA 1EFID 1Y1VH 1E1TA 4X65Q 1LTTD 5KNDA 3GTJH 1XPRA 3GTOH 3S24A 4EVOA 1RIPA 4X6AH 2Q8IB 3H0GH 4A4IA 2JJQA 5M5WB 2I46A 3UDFA 1QVFA 2VS1A 1HNZQ 1KLUD 1F2YA 2UUAQ 4XT1B 3GTMH 1BOSA 1W6KA 4H02A 5LMNL 4CGYB 1QE6A 1UE7A 2E76C 4RGTA 4JG2A 1LTBD 2E2HB 1BXTA 5TSSA 3K58A 3QWNA 2OTLA 5CC4A 4H7BA 2UXDL 1LTID 3HOXH 1QVGA 1JJGA 4LF7Q 5LL6S 4K0KL 1X3PA 3EN2A 2A69D 2L11A 1VF7A 1GKHA 3FMCA 2EY1A 4DR2Q 4HIOA 1GO3E 3U9OA 5C4JB 4BY1B 1XTCD 1X6OA 2GVAA 1VQAA 3A8KE 4HN7A 3H3VI 1HNWQ 2F4VQ 5GQOA 2B63B 1XTDA 1TT2A 4A93H 1RCVD 2XTIA 3BVGA 1JB7A 1S5DD 2F4VL 2SOBA 2OCEA 3I2ZA 1U4PA 3CPFA 2MUYA 1J5EL 1M4VA 3MC0B 4DUYL 5JJZA 4KY6A 4DR1Q 1EU3A 4BBRH 3X3NA 3EBEA 2D5DA 3DWPA 4K6DA 3U4VA 2K05A 1XMOL 2QILA 2FFKB 1Q3LA 1VQNA 1GUWA 1X65A 1SYCA 1EYGA 3JAMc 1LT3D 1STHA 3S16H 1JE4A 1N8RC 2TMPA 2ZT9C 3M3YH 1IYUA 2F0FA 4KD3A 5LMNQ 3QOLA 4ZKCB 3A55A 4JI3Q 1YHBA 2NN6H 2RCFA 4MNOA 1N33L 3OWFA 4NXNL 3ZYYX 2HCCA 4C56C 1F2MA 5A2QL 3MFGA 2PI2E 1U4LA 1NNXA 4DV7Q 2A5HA 3BYYB 3T1YQ 3DLLA 4KV6A 4K8JA 2B2TC 1UAPA 3PO3G 4RHSA 4M8AA 1GUOA 1F9PA 1T5EA 4DV1L 2A8VA 3CCMA 3HOXB 3J7A5 2F0UA 1TS2A 1I94L 1X3QA 1ILPA 3IL8A 3CF5A 3I4NG 2VB3X 5EAYA 2EYPA 2JXMB 1ET6A 2AUJD 5M5YH 3DM3A 2NVYB 3GTKB 3TP5A 4JBJA 1Y1VB 1PRTC 4LFCL 3CXCA 5DLQE 2JA6B 2WIIB 4A3EB 5DM63 2K01A 4N8FA 3ERSX 1UWVA 4DR1L 2OQKA 4A3DH 1B4OA 2Z4HA 1I6HH 5BR8L 3HOYB 2JA5G 4X66Q 3SDZA 3J81E 2MHVA 1HNXL 1SNCA 2R7DA 4JV5L 4IFDG 4HJ8A 4KY7A 1CKNA 2F0VA 1WCMH 2K1BA 3IKJA 3SR1A 1KAAA 5JAVA 3VYRA 3H6MA 2V4DA 1G8ZD 1PLFA 4Q5VA 1SYGA 1YJNA 4JYAQ 3PF4A 4GN4B 1UE6A 3MEFA 1NR2A 4JCVE 1XYIA 1K28A 3J7ZC 2KJXA 2BDOA 4KHPL 4DR7Q 4DR5L 2JA8G 2RDHA 4HJ7A 4K0KQ 2AMCB 3RMHA 4EGVA 2K5WA 3E6ZX 2EZVA 4OGQC 4B3SQ 3CKIB 2F3IA 1Y69U 2L0CA 1R4PB 1HTLD 3GP7A 1HR0Q 3VYSA 2UXBL 4FVMA 3VA5A 4KTAA 1SE4A 2NN6I 1WTOA 3OWEB 4YCVA 4K6LA 1GHKA 1K73C 1FNUA 3TEHB 4BXXH 5JEAG 1QZHA 5LMUL 2F0NA 3AB9A 1RL2A 2XN9C 4IFDH 2WB1E 5M5XB 3CCEA 4JI6L 3TDQA 1M8AA 2FMCA 3Q8DA 4DA2A 1BR9A 4AYBE 3RN2A 1FNVA 1WVLA 3UI2A 4L5QA 4EQNA 5M5WH 5J3BA 2WINB 3G6JB 1WYDA 3J80i 4NDXA 3WOEA 1XNRQ 3CRKC 2HDLA 3FP9A 2C35B 1SMYC 4JOIA 1YJ9A 2JA8H 4CKBA 1EEFD 3H91A 4AQYL 3C1FA 1U4RA 4DV0L 2VZAA 3K7AH 4DV0Q 4GOPA 4A3DB 1I3QH 1S5ED 4A3GB 1MBYA 3OSOA 1EU4A 1SR3A 2PQEA 1EWHA 4A3JG 2N49A 2VL6A 1STBA 1ZYRC 1E22A 2K5VA 1HUNA 2O4XA 5M5XH 3TRZA 1CZGA 2RQXA 2F0JA 3GV3A 3OOCA 4DXGA 2K7VA 5C3EG 4WFN3 1E3PA 4ZCKA 5KRUA 4DR4L 1P16A 4IUQA 3GTOB 1G6PA 2WV6D 1ONLA 3URYA 1MIUA 1HUMA 3N6RA 2CWPA 4RWSC 2HIXA 2FMMA 2ZTCA 1C8CA 3EROA 4PG3A 4CBVA 4FF1A 1JICA 2R7ZG 1B1ZA 2FHTA 1FGUA 4B08A 1PMRA 2KEEA 1AE3A 2K5NA 4LJZC 3V05A 4LNQA 3D4WA 2B2UA 4GN5A 3A0JA 1PRTB 1WTPA 2JEBI 1H95A 5CV5A 1LM0A 1BCPF 1BKBA 5CGKA 4HAEA 2K28A 2F1MA 3ULPA 4FP5D 4IN3A 4G7ZC 2R3ZA 2ENBA 3SK5A 3E0JA 1JB3A 4FXGC 4IZ8A 4C3HB 4ZKBB 5FJ8G 3TN2A 1N34Q 1HNXQ 2R93H 5M3MG 3K5NA 1QWYA 5GAEC 4OHJA 4HJ9A 2F0IA 3D0FA 4ILWA 1WTHA 4RMFA 3S1NB 3FKIH 1QNUA 2Z9HA 1X9NA 2A6HD 5KYIA 3PO2B 1Q8KA 2EOTA 1DCZA 1YI2A 3S1MB 1EIYB 5K36G 4C2MB 4POFA 4LUOA 2JSOA 3FVQA 3OIQA 1GM5A 1OXXK 2UUCQ 2K14A 1L1OC 3F2UA 1A3UA 4NB3A 1IBLQ 1AP0A 2C9OA 1KRTA 1JQYD 2IJ0A 2RBMA 1YIJA 1KNAA 3J81L 5KIXA 1TWCB 2DNCA 2N8NA 3TQYA 3T51B 4DR6Q 2HCIA 1TWAH 1B70B 1II3A 4DV1Q 1B9NA 1FR3A 2F0PA 1SBBB 2AQ1B 1RTNA 2PNHA 3P75A 3V96A 2BOSA 1H9SA 2IHFA 2B2TA 4JI0L 1BDOA 3DEPA 3CQZB 2O2LD 5KEEA 4GLXA 2VB2X 2JQOA 2PMZB 1DZ1A 4CHTB 4LF4Q 3DXJC 2I5HA 5IP7H 3EVQA 3NP8A 4TVAB 4MTNA 4A3IH 3UDXA 1RODA 2B2VA 4B3ML 4PMBA 2KHJA 2YV5A 1TIID 3ZJYC 3PGZA 2D0OA 3HOZB 4FNFA 5JVH3 1OXTA 1I4QA 1G2TA 1BCPD 4ZQ3A 1UE1A 2E2IH 3D6WA 3TREA 1SE8A 3QJYA 3H15A 1JR0D 3UE0A 2NZ1D 3I72A 1DJRD 3PUXA 1J5EQ 4C3HG 2M2LA 4UP7A 2R7ZH 1TY2A 2BDNA 4PZ8A 2LMCB 1V9PA 1TWGH 1E0BA 1CTMA 3SGIA 1HQRD 1HNWL 1KXLA 3CAMA 3S1MH 1X32A 4QCLA 5C0XI 4OX9L 1ET9A 2N88A 3MFYA 1STAA 1R9TH 3I4MH 3HKSA 3CPWA 4YWMA 4ME3A 1D7QA 4RAUC 1J8IA 2YTVA 4OIKA 4A3GG 5G3LD 5D3IB 4NMZA 3GDEA 3R3OA 4HMJA 1L0WA 5C44H 2H1EA 1V1OA 2K03A 5JEAJ 1Z6HA 2ZXRA 3NWSA 2UUAL 3S2DH 1U0LA 1CZWA 1V43A 1CK1A 5E7NA 1HNZL 1PYWD 1E2WA 3A8JE 1X54A 1IXRA 2EYOA 4KI0A 1LT4D 1JCKB 2QKIC 1STYA 1OXVA 4A93B 1HJPA 2XIWA 2E75C 1DOLA 1TU2B 2JA6H 4IALA 4DR3Q 3L7ZC 1STGA 4U68A 3D4RA 4J15A 5CV6A 4P73A 2A68D 3S2DB 2PPBC 1RJTA 1UNSA 1JOKA 2SDFA 3H3VH 5C6AA 2F0MA 4DUZL 1HR0W 3FKIB 2CQOA 1SMXA 1ENCA 2JA5H 1K83H 4OELB 4G7HC 4I65A 5ELOA 3H3VC 4FDBA 1ILQA 2FINB 3KLSX 1OO9B 2JE6I 4QF4A 1I3QB 3SXHA 4YWLA 1Q82C 1IYJB 1Q8IA 4YHHQ 4A3CH 1K8OA 4XQQA 1BCPB 3OMGA 4LF6L 3IAYA 2Q2IA 4NXML 2AWOA 5EPKA 2HIVA 2ZJPA 2D9UA 2YTYA 4JI5Q 3S14B 5IODA 4DK0A 1XWEA 1CSPA 1SNMA 4S3SA 4PV1C 4N8X1 5JPMC 2CHBD 4R4CA 2VUMB 4X62L 2B2UC 5IT9E 3EQLC 3GQBA 4U673 1CHQD 1EY9A 4QB4A 2EY2A 3HOVG 5F2DA 3U9SA 4IFDJ 1DYQA 4DNRB 3I3CA 5I6WA 1PHJA 2WP8J 4LF8L 4RA8A 2BA1A 3S2HB 1B44D 2EYJA 4CDFC 2B2WC 1ESFA 1MJEA 3ER0A 4DV7L 1JJ2A 2ZXOA 3A74A 1G6ZA 3TS0A 3A54A 1K3BC 3BZCA 4A3KB 4QQBX 4YY3L 2RA4A 2CQAA 2OT2A 1PYBA 2UXCL 5IYBG 3I55A 3GTQH 1QZGA 4V190 3LGJA 5FKAC 1JMCA 3TMEA 1I6HB 2VQEL 3S17B 5GAGC 1WTWA 3UE1A 4BBSG 2F0EA 4GNXA 3MWYW 4H0LC 2VY3A 4KMUC 4A3MB 2X69A 4WJWA 1VQ9A 2R92B 1IL8A 1EYCA 2DNEA 3CW2C 4EX5A 3BZDB 3GTPB 2MPMA 5D14A 5H1SE 1BBWA 4ZK9B 4KHVA 4DUYQ 3T13A 4FF4A 2V1CC 1PA6A 3C2PA 2CKZB 2OQ0A 4DU9A 2EQSA 2NTSA 4LW1A 5IYDH 1VQPA 1IKLA 2EYFA 1K0SA 4BY1G 3NTIA 1IBKL 3W2DA 5HGQA 3DWQA 3G71A 2F0KA 1EQTA 2LKVA 2RDGA 4RGOS 3VDYA 1FL0A 2WB1G 3STBC 4DAYA 1BUVT 2XWJB 2O5JC 2ZM6L 3V2TA 2YU9B 2LY7A 5CMDA 3BG3A 4AYBG 1PFNA 3PF5A 3DM1A 3U4ZA 3KLSA 2M9VA 4C3IG 3MZ5A 5ELFA 5IWAQ 4MIUA 2RKSA 2QA4A 1KIXA 2L55A 3J81c 1WTXA 4P72A 2VQEQ 2JA6G 5JJIA 1PH1A 2O5IC 3BJUA 2UU9L 2K75A 4A3IB 1KNEA 2ID0A 4DV4Q 1F2ZA 1PFMA 3PIP3 1PFSA 4K5XA 3O13A 5EKKA 1Q81C 1XMQQ 3K7UC 4WJ3M 5KGUA 4CDCC 4GKJL 1HQMC 1KDAA 1VQEA 5EPLA 1WOCA 1QCBD 2F0DA 4JI1L 3MXUA 3QG1A 4A76A 1PXUA 2KECA 4BY7B 2F03A 1LTGD 3DWAA 1K83B 4BS9A 2WAQE 3BDCA 2G9HD 4CJ0B 5IP9G 2BE5D 1HA6A 5C5MA 2Z6BA 3MAQA 3HEJA 4APVA 4A3MG 2UUCL 1V1PA 5KNBA 1EZ8A 1SMYD 2RSOA 3HS0C 4O0AA 4PZ7A 2JK8A 2A68C 1S4ZA 3J81i 4JOIC 2PCFB 1PYSB 1A2TA 4RH6A 4AIMA 3FPUB 1PTOH 2UUBL 1ENAA 4KY5A 4DPGA 2MP1A 3WDNA 1IW7D 1QOHA 3OIPA 1KAWA 4NXMQ 3L0OA 3J80L 2A6EC 5C3EB 5C0XH 1PTOC 2RSNA 4KD4A 1LT5D 3U58A 2F0GA 3S9WA 1ML0D 3K0XA 2K5HA 3CMEA 3CCLA 5I9PA 3M4PA 1TQOA 1CKNB 1I4PA 1L2FA 3S15B 1FJGL 1LTAD 1VF5C 4DV3Q 2K04A 1XPOA 4JW0A 2FJ2A 2WFWA 1CI3M 3LX0A 3HOWG 1EIHA 2LXKA 2KEDA 2P5ZX 2G9DA 5LHY1 4X3UA 3HOVB 1Y14B 5IGDA 1EQVA 4CJ1B 4BWGB 3QR8A 4DR3L 3CCSA 2QW7A 3G7LA 1TY0A 2BH2A 3T1HL 5C3XA 3S1RH 1FNWA 4RKLA 1YNNC 1JT8A 1B3AA 4EQPA 4GNXC 3WWVA 3EFXD 1JOOA 5IGGA 4C3IH 3VR5A 3A8IE 1N32Q 4A3DG 5IT9c 2DY8A 5IY0A 3FHWA 2Q8RE 1AE2A 5DEHA 4DK3C 2RVLA 1I4GA 4L5RC 1RHPA 3CHBD 4DKAC 1WCMG 1LT6D 3D3RA 4WORA 2NWGA 3AQQA 3CP0A 2VQFQ 3OW2A 4DAVA 3I4MG 1SFOB 4RHRA 3VR2A 4UHVA 1CHPD 2WKCA 1LYLA 2B2WA 2QF7A 1RF2D 2E5LQ 1CA5A 4XQNA 3S14H 4AQYQ 3HKZG 4LAAA 1MHWC 4LF5L 4OO1G 3W1BA 1RD9D 1QUQB 3RZOB 1TS3A 1IBML 1U5KA 1GUTA 1O7ZA 4YCWA 2EYLA 3GTLH 1UEAB 2EJFC 2I5MX 5A2QE 1PH2A 3OW7A 2F0OA 2GA4B 1E1OA 2AUKA 2L15A 2NYZD 4A3EG 4L5SA 4HSVA 1ICFB 4G7OC 4JC0A 5C4XH 2IPKD 2EIFA 3ULLA 3GTLB 5C4ZA 4EQ5A 2UXBQ 3I4NB 4UDUC 4OONA 2XVSA 1VMPA 2CCZA 1EY6A 1MJCA 2EPBA 1EQQA 3AMUA 4GKKL 3OHXC 1CSQA 1K9MC 4DR5Q 2ALYB 3VR4A 4KHPQ 1TWFB 3Q6SA 3TP6A 3PIO3 3PO3B 2AQ3B 2A69C 5M9OA 1UE5A 1A2UA 2H4OA 5HY6A 4C3JB 5L37A 1V1QA 4PMWA 2OEOA 1EOVA 2BCOA 2PQAA 2EDGA 4RCNA 3DHQA 1GJXA 3GTPH 1Y1WH 1Q1BA 4BBRG 4LFAQ 3SK4A 1R9TB 4ME5A 3I4MB 3C3LA 1DOMA 4V0BA 2A19A 1A6XA 4GS3A 1QILA 2B39A 2JP1A 3KDFA 4YWKA 4LF9L 1IBLL 1EOTA 4ALPA 2JA7H 3AFQA 1E7ZA 1R4QB 5DAUA 4HJ5A 3K5MA 2KHIA 4OXPA 4PMCA 2KCTA 3STBD 4C2MH 2CVRA 3HOUH 3ITPA 2IW3A 1HZ9A 1Z7TA 4A3BB 3M9BA 1S72A 4B9WA 2E2JB 1TWCH 3S1NH 1I94Q 1SEBD 3EA6A 3KK7A 1N34L 2ZJRA 5FO9B 2ZTDA 1I4XA 4LUVA 3GTQB 1Q12A 2IX3A 2QGQA 4R9WA 1UEBA 3HGBA 1A3TA 4DK1A 1Q7YC 3CC2A 1ZYRD 5AJ3L 2CWAA 2RCNA 1Y8NB 2OWOA 2F52A 3I4NH 5CORA 4JI3L 1AW7A 3QB3A 4GLAC 1JC7A 2KCMA 3K7AB 2R7FA 3GTJB 1SYDA 4BY7H 4A3JB 4DV4L 3U50C 3ND8A 1Y1WB 3S1QB 3N52A 3HOXG 3BVMA 4Z9CB 3K59A 4ULLA 4OEMB 1XX8A 4X3TA 1QG7A 4G4KA 1HXYD 3FDTA 1N9WA 4QGUA 1B3QA 5IWAL 3A5ZB 1BNZA 2JA7B 5C4XG 1X3EA 4DR4Q 1F9RA 4BY1H 1I5FA 2L9HA 4DV2L 1HTPA 4OO1I 1B53A 5CV8A 4JI7L 4A3FH 2Q2TA 1TR5A 4XTCS 3PMFA 1W3SA 4HMIA 3HOYG 1ASZA 2B63H 2F4IA 2PW7A 3M7NA 4P75A 3KUPA 4IUVA 2N3SA 5FOBB 1CT1D 4JI4Q 1D5XC 2KQ3A 2DUDA 2L12A 3TBIB 1ESRA 2Y0SB 4UY8C 1MKHA 4PNYA 3MXNB 1CQVA 4F87A 1VQ6A 3RD4A 4DV5L 2VQFL 1HFGA 2QCPX 3D6CA 2WACA 4R4IA 1EIFA 3W1GA 1SJED 2NVQB 3OPOA 2DJFC 2OF1A 2CFMA 1EQRA 4IUPA 1H9RA 1WTQA 2VNUD 1ZXTA 3HFZB 4LMQD 1MSHA 2KHSA 1PH6A 1ASYA 1VCIA 5IIFA 1Z47A 4B3TL 4DV6Q 2VW9A 3M85A 1VQJA 3HOYH 5E4XA 1EWCA 2J0TD 4IO9A 1L1OB 4NP5A 5JVG3 2MJ8A 5IP9H 1I6VC 1PTOD 2HUGA 4GOPC 4LF8Q 3KDFB 1PH7A 4K2KA 1LV9A 5G3LF 4GNXB 1YHAA 2Y0SE 2Z0SA 2ZXPA 1N36Q 3HOZH 4NKLA 1NBWA 1CQFA 1VQKA 1A0IA 1PZID 4X3SA 3OYYA 4LFBL 2KENA 2WKDA 2K50A 1EYAA 5CV4A 1DXMA 5IGEA 1Q46A 3BDLA 4HIMA 3I7FA 2N78A 3HOUG 4IJHA 2VUMG 2NZOA 5D65A 3FEWX 4IURA 4JI8Q 1IZ6A 3CRLC 4JV5Q 4H13C 4MN3A 3OTOL 3F2BA 1CM9A 3OTOQ 2KOLA 5BR8Q 2PO4A 1T9HA 2GVBA 3LNNA 2I5LX 2YTXA 1PVOA 4P2CB 1A8VA 5FK9C 3KJPA 2MO0A 2WAQG 2AWNA 4KN7C 2MNAA 1SE2A 2JYOA 4DUZQ 3P7JA 3PUWA 4FYDA 4JBMA 5DNFA 5C3EH 1PZKD 1DGSA 4QL5A 2B63G 4A3BG 3I4LA 3R2TA 1P8LA 4FF3A 1LO5D 2IX0A 2F0QA 2WAQB 3I56A 1PDQA 4XQJA 4TQUS 4JVZA 1M1KC 5D3DA 1A15A 1XNQL 1B9MA 3IFTA 5HURA 3DMUA 3PUYA 2F0HA 1LABA 2SNMA 5FJ8H 4H44C 2AHOB 1A62A 3E9HA 4NXNQ 5CR3A 1NE3A 2EXDA 3E0EA 3FKIG 1PZJD 4K5WA 4B3TQ 2X6GA 4L5TA 2NTTA 5C44B 2Z6KC 3J80E 5AFWA 4ZAIA 3DEOA 5K36H 3KF6B 1IKMA 5COYA 1MI2A 3CQZH 1D8LA 3TS2A 4FXDA 2NVTB 2FXQA 2XRSD 3NBHA 4DAYB 1XMOQ 2K32A 2L4NA 2CH4A 1W6JA 1HFNA 4A93G 1OTCA 3NSWA 1C4QA 3MEHA 1HH2P 2OXPA 1FVIA 5LL6X 4C1NK 3RZDH 2HT1A 4OL7A 1EWIA 1F77A 5ELEA 1IBKQ 1S40A 1YNXA 2J7ZA 3BVZA 3KBXA 5M3FG 1GUNA 1EZ6A 4K2LA 4ZUJA 5IP7G 1QJOA 4GLVB 5JOBA 2VXWA 4KHZA 1JWMD 5KYLA 4DV2Q 1K8AC 1S3OA 3BS1A 2D62A 4J6HA 4DR2L 2EYMA 1IL2A 5M3MB 1VQDA 4IOAA 1KDBA 1SNPA 1ZEQX 1EFWA 1PFBA 5GROA 2VUMH 4L6TB 3MVVA 1H9MA 2NVQH 3AYHB 4RGMA 2UXDQ 1HRJA 1SE3A 1BCPC 4BBSH 2NBFA 3IRBA 3HKZE 4JBKA 4DN4M 1CKMA 4DNTB 4KLKA 4C3HH 3HOZG 3UDGA 1O80A 2EYHA 1SNQA 2A73B 1S5BD 1Y1WG 1K8GA 2MFIA 1D5ZC 1DOKA 5JEAH 1WD0A 1O7IA 3K8AA 3KJOA 1BO0A 2E8GA 2R92H 1WI5A 1EUJA 3NBIA 2A74C 3CCVA 4ODGA 2JA7G 3JAMi 5M3MH 2NVTH 1K0RA 2B29A 4HIDA 2B2YC 1NMFA 2R61A 2A1AA 2M00A 4ID6A 4LF5Q 4N9PA 3PO3H 5IT9L 1SNDA 3M7GA 2K33A 4BBRB 3K80C 4FF2A 1PH4A 3NK9A 1KLGD 4NW2A 3T56B 1Y8PB 3S2HH 4TKOB 4AYBB 1KABA 3TZUA 3CCUA 1PH9A 1VQ8A 3RZOH 4OWXB 1NMGA 2CW0C 4IJLA 1EY5A 3B6YA 3ERQA 5ISRA 1TKWB 2XWBB 4LF6Q 1EIGA 3R93A 4YHHL 5J39A 3IFDA 3NPPA 3F8TA 1VQ4A 2PW5A 3KFUA 2YU9H 3NQIA 2EJMA 4KKTA 2PMZE 4L63B 3PQIA 4UPAA 1YHQA 3KF6A 2OTJA 4RKBA 1O7YA 3T1HQ 2NVXH 1YZ6A 2JA8B 1K8MA 1XJVA 3GTMB 4CKCA 4HCSA 1SSOA 4HSPA 3KBGA 4XXEA 3NBHB 3LWEA 3KOJA 3X3MA 2K6AA 3T16A 1TS5A 1SXTA 3TSSA 2BA0A 4O42A 3SEBA 4DAPA 2LFNA 1XXGA 1FJGQ 1SFOH 3CU7A 5EQ0A 3MHBA 4O1NA 4IPGA 2MQHA 5K5PA 3PIOA 1PV4A 2A6HC 3SK8A 2LSSA 4F7XA 4UP8A 5C0XG 1ZKOA 3NTHA 4F8MA 1AH9A 4FO2A 1EY8A 4CDDC 1NAPA 2NB0A 1IYVA 4JBWA 5M3FH 1SLJA 2R93G 4E6IA 3JAML 4HTHA 5I9OA 3M3YB 4I7AA 1Y8OB 3VR6A 4A3JH 5IE8A 2E5LL 1SN8A 4IOCA 4R8NA 1SDFA 2F0WA 4A3LH 1CUKA 1C0AA 2IWHA 1MD2D 4A3FB 3RLOA 3T53B 4GOPB 3P1HA 1VQBA 1MGSA 5I2YA 5IYCG 2MO1A 5EKIA 5BN4A 1JWUD 1Q1EA 3CCJA 3I70A 1LTLA 1TXYA 2F0LA 3UDIA 5IYBH 3A7LA 3ONAB 2A6ED 3SVMA 4HCEA 4GZYC 2PI2A 2IHEA 2KBNA 1A63A 1XMQL 4DV6L 1QB5D 2JN4A 5M5YB 1YNND 5FLMG 3M4QA 5JJLA 4LWCA 4MZ9A 1HCZA 4B3MQ 1G2SA 3NUCA 1B2TA 3ND9A 1K3RA 4DV5Q 2DN8A 1VQHA 5IGFA 5I4DA 1SYFA 4OIJA 3T4AC 1HZBA 3GTGB 1FYCA 2Z4IA 2F3WA 1HHVA 3CD6A 1KHIA 2ZM6Q 4R4OA 4N9TA 1WD1A 3H0GB 2PQAB 4A3KG 1EY0A 1I4HA 1NR4A 3GO5A 5CV9A 4KN4C 4DR6L 3VA7A 3Q22A 1H9KA 1NCVA 1NY4A 1QNKA 3I91A 4M1UB 2JA9A 5JPNC 1U4MA 4CKEA 2K5QA 4JI7Q 3S16B 5FLXc 4A3EH 4NPSA 1RKNA 4IUUA 5FLMH 2HHHL 2CW0D 2Y0SG 3J7AV 4A3BH 5C0XJ 4XYQA 5GADC 3D4DA 2B8GA 2QDBA 1KTKA 2Q2UA 4POGA 5CV7A 1KC8C 4MHEA 1KRSA 3W5OA 1D5MC 3J80c 3MTSA 2NUCA 1VQIA 5ELDA 1EYDA 2UXCQ 1AFPA 3H09A 4X64L 5LMNW 2EY5A 1B8AA 1WTVA 3F2DA 1PRTF 2XRQD 2DY7A 2KCCA 5AJ3Q 3C46A 3L9AX 3ULJA 4KKSA 4DGZA 5A35A 5C3WA 3AFPA 4ZRZA 5EPJA 2WB1B 4A3KH 4A3LG 1F2LA 2RF4A 4DK6C 1N33Q 4GKJQ 1XNQQ 4A3MH 2EXZA 2RHSB 1LLRD 1G291 4QIWB 4X64Q 5CBEE 3I73A 3K0YA 5J1ZA 3K81C 2RHQB 3F2CA 1Q86C 5FO7B 4I7ZC 1STEA 3BZKA 3FPPA 1AN8A 1GVPA 3SK6A 1S5FD 3K6OA 5FLXL 3RR5A 3RN5A 3D8GA 4L8JA 1X3GA 1GHJA 5BN3A 3VYUA 2RDFA 4CDEC 3OMCA 4HEDA 4K5VA 2C5CA 3L2PA 1OXUA 1V8QA 2PNRC 4BBSB 3S1QH 1E24A 1LUZA 2EVBA 4O2DA 4IPDA 1PRTD 4DNIA 4P71A 3CMAA 4LF9Q 3Q23A 1TWFH 5IYCH 1HPCA 1O78A 4IFDI 3M4OH 4A3CG 2K5DA 5ELBA 3RLFA 3JAME 2I07B 4R4TA 3HOWH 2PYKA 4QIWE 5JJKA 1FGBD 2F0SA 2E2DC 1VQ7A 2NZHA 1I50H 1G51A 4A3GH 2DJGC 2B3GA 4LFBQ 1SNOA 3I4OA 4X3KA 1SJHD 1GUGA 1RTOA 1WJJA 3MXGA 3NELA 5GAHC 3K57A 4LF7L 4C3IB 5EJWA 4C3JH 5C4JH 2IY5B 3HOWB 3TZDA 1SYEA 1VS0A 3G48A 1IW7C 2QEJC 2QDLA 3KF8A 3CCRA 1JJCB 5T1IA 1L0YB 5LMUQ 4BA2I 4ZLTF 5J22A 4YY3Q 1KQSA 1GD7A 3NQTA 2IX1A 4XT3B 1Q90A 4Y7NB 1ICWA 1SYBA 2TSSA 3NXWA 4R8IA 2KUMA 3PCOB 1TWHB 2K52A 2N55A 3S15H 3DUZA 1EY7A 4ZUIA 3NENA 4IUTA 1STNA 1F9QA 4DFAA 4DR7L 1VDZA 1QVCA 4Q0FA 3GTGH 1EY4A 3QO2A 4X62Q 3K5OA 4Y52H 1GXDC 3HKZB 3M4YA 4C1NI 4OX9Q 4EQOA 4JYAL 4Y7NH 4C3JG 2J4XA 2K4KA 4JI4L 1E2VA 2EE1A 2JEAI 3E3XA 1VQFA 1DONA 1RDPD 3A56A 1ENFA 1YBYA 3Q0AA 2BH8A 3W3AA 3GD7A 4IPCA 3MXPA 4IPHA 3LWUA 2PZWA 4X66L 4F88A 3RUZA 4DAMA 3RNUA 1D1IA 4A75A 3TP7A 1C7YA 4KKUA 2B2VC 4KJOA 1W2BA 3CCQA 3NEMA 3E5SA 1AEXA 1I50B 4ABNA 1NUCA 5E4WC 4LFCQ 5EGTA 2R7ZB 3S1RB 2IL8A 4FXKC 1TS4A 4QUFA 1CA6A 2X6LA 1YVCA 1CKOA 3Q24A 1KL9A 5EBDA 5IGCA 1YITA 5E1FA 2E2IB 3EJIA 1DD2A 1D2BA 2ZTEA 1J6QA 1DM0B 4XYOA 1UUPA 3SE0A 3PIPA 1I4RA 5BN5A 1X55A 2ICEC 1KD1C 3WOFA 3KLWA 4JI2L 1PTOF 5HGTA 1WFQA 1YEZA 3T1YL 3AU7A 3VYTA 4DV3L 4KJNA 3QOJA 3KYHC 3K5LA 3VR3A 3PV0A 4JI0Q 1SRUA 3A5UA 2NN6G 2F0TA 3NWTA 2SEBD 2D0PA 3MA2B 3HOUB 2KA7A 3J7AF 2Z8LA 2Q8TA 4PZ6A 4A3IG 5IGBA 1HZAA 1NSNS 1YNJC 2KVMA 2UUBQ 5IYDG 4YCUA 4LK1C 4HIKA 1C9OA 5IOCA 4TSSA 2XSCA 2HQEA 2EJGC 4JPBW 2HHHQ 5C5LA 1XPUA 4JK1C 3P20A 3E9IA 4RG1A 4XIGS 3RZDB 4RFBA 3BU2A 4OWWB 5NUCA 1BBXC 3M4OB 2XGTA 4KK7A 2NVXB 4XDXA 1O7LA 2IT1A 1PH5A 4LFAL 1TWAB 4R1JA 2H5XA 3R8BA 3HZXA 4BY7G 1LACA 1BBUA 2BE5C 1PH8A 2B8FA 1T5XD 1GUSA 1HA5A 4JI1Q 1LTSD 1J9OA 2KCNA 5KNCA 4GN3B 2HD3A 4DXFA 3PO2H 2CH4W 4QUCA 4IQZA 4GKKQ 4UAIA 4B3RL 1B50A 2UU9Q 3PUVA 2XNAC 2GN5A 4B3RQ 3H94A 4QMGA 4P74A 1X56A 3I90A 1VQOA 1BQQT 1MSGA 5C44G 4LF4L 3ICEA 5FLXE 3PSIA 1L1OA 1F9SA 2D2CC 2PZUA 3AEVA 4HJAA 1JE5A 2AQ2B 5EKLA 1NJIC 4BXXG 2Z6KA 1A3VA 4CJ2C 4X65L 2ASBA 2ZJQA 4TRDA 1Y1VG 4AH6A 1SAPA 2E2JH 1VMCA 1IBMQ 1YJWA 1VQGA 2I0QA 4WRDA 3F1ZA 1LTRD 1EL0A 3PUZA 4A3FG 4MTKA 2F3VA 3MXNA 1GOZA 2DGYA 1EEID 3HG9A 2LXJA 1XNRL 4RCOA 4OO1H 1KDCA 3S17H 1CFMA 2ICIA 1TVXA 1JOQA 4RGNA 4IUNA 3HRZC 3J7YW 1BVSA 1JWSD 3D31A 4LUZA 1L0XB 1M90C 2L1BA 4JI6Q 2QEXA 1N32L 1FD7D 2Z1CA 3TP8A 5I2XA 1Z9FA 3L3OC 3G6EA 4QJFA 2SNSA 3KF8B 2ATWA 3NHHA 2R93B 3CC4A 3BYTB 1H9SB 1HZCA 4QY7A 2R92G 5ELCA 1HR0L 2HQLA 4YIJA 3QIAA 4B9XA 1G91A 1H9JA 4JI2Q 1JORA
chains in the Genus database with same CATH topology
2EY6A 1YNJD 4J1MA 3GV6A 1AZPA 2E74C 1U9RA 1AZQA 5T1GA 4DF7A 1IHZA 1D1KA 5FO8B 3KLRA 4K14A 3BDOA 1D6EC 4BA1I 4PQXA 2HDMA 3R2IA 4J8QA 3NE5B 2JA5B 1V1PB 4ZYSA 1OXSC 1PTOB 3FRPB 2LS01 5CYUA 1WTRA 5DM73 5C4XB 2B2YA 1C48A 2L5TA 3I8ZA 5C4HA 1S5CD 1TWGB 1WCMB 5EBCA 4K8IA 3SHLA 5CBAE 3NTKA 3C1EA 2PZTA 4HR7B 2MGSA 3A7AB 5E3FA 5M3FB 4G57A 5I6YA 3HP3A 1BF4A 2R6GA 2YYZA 1E2ZA 1EFID 1LTTD 5KNDA 4EVOA 2Q8IB 5M5WB 2I46A 1KLUD 1F2YA 4XT1B 1BOSA 1W6KA 4CGYB 1QE6A 4RGTA 2E76C 1LTBD 2E2HB 1BXTA 5TSSA 3K58A 3QWNA 5CC4A 4H7BA 1LTID 5LL6S 1X3PA 2A69D 2L11A 1VF7A 3FMCA 2EY1A 3U9OA 5C4JB 4BY1B 1XTCD 3A8KE 4HN7A 2B63B 1TT2A 1RCVD 3BVGA 1S5DD 2SOBA 1U4PA 2MUYA 1M4VA 3MC0B 5JJZA 4KY6A 1EU3A 3X3NA 2D5DA 3DWPA 4K6DA 2K05A 2QILA 2FFKB 1Q3LA 1GUWA 1SYCA 1LT3D 1STHA 1JE4A 2TMPA 2ZT9C 1IYUA 2F0FA 4KD3A 3QOLA 4ZKCB 3A55A 2NN6H 3OWFA 3ZYYX 2HCCA 4C56C 1F2MA 5A2QL 3MFGA 1U4LA 2A5HA 3BYYB 4KV6A 4K8JA 2B2TC 1UAPA 4RHSA 4M8AA 1GUOA 1F9PA 1T5EA 3HOXB 2F0UA 1TS2A 1X3QA 1ILPA 3IL8A 2VB3X 2EYPA 2JXMB 1ET6A 2AUJD 3GTKB 2NVYB 3TP5A 1Y1VB 1PRTC 2JA6B 2WIIB 4A3EB 5DM63 2K01A 1B4OA 2Z4HA 3HOYB 3J81E 3SDZA 2MHVA 1SNCA 4IFDG 4KY7A 2F0VA 2K1BA 3IKJA 3SR1A 1KAAA 5JAVA 3VYRA 3H6MA 2V4DA 1G8ZD 1PLFA 4Q5VA 1SYGA 1NR2A 1XYIA 2KJXA 2BDOA 2RDHA 3RMHA 4EGVA 2K5WA 3E6ZX 2EZVA 4OGQC 3CKIB 1Y69U 2L0CA 1R4PB 1HTLD 3GP7A 3VYSA 4FVMA 3VA5A 4KTAA 1SE4A 2NN6I 1WTOA 3OWEB 4K6LA 1GHKA 1FNUA 5JEAG 2F0NA 3AB9A 2XN9C 4IFDH 5M5XB 3TDQA 1M8AA 2FMCA 4DA2A 1BR9A 1FNVA 1WVLA 3UI2A 4EQNA 2WINB 3G6JB 3WOEA 4NDXA 3CRKC 2HDLA 1SMYC 4CKBA 1EEFD 3H91A 3C1FA 1U4RA 4A3DB 1S5ED 4A3GB 1MBYA 3OSOA 1EU4A 2PQEA 1EWHA 1STBA 1ZYRC 1HUNA 2O4XA 1CZGA 2RQXA 2F0JA 3GV3A 3OOCA 4DXGA 2K7VA 4WFN3 5KRUA 3GTOB 4IUQA 2WV6D 1ONLA 3URYA 1HUMA 3N6RA 4RWSC 2FMMA 1C8CA 3EROA 4CBVA 4FF1A 1JICA 1B1ZA 2FHTA 4B08A 1PMRA 2KEEA 4LJZC 3V05A 3D4WA 2B2UA 1PRTB 1WTPA 2JEBI 5CV5A 1BCPF 5CGKA 4HAEA 2K28A 2F1MA 4FP5D 4IN3A 4G7ZC 2R3ZA 2ENBA 3SK5A 3E0JA 1JB3A 4FXGC 4IZ8A 4C3HB 4ZKBB 3TN2A 3K5NA 1QWYA 4OHJA 2F0IA 4ILWA 3S1NB 1QNUA 2A6HD 5KYIA 3PO2B 2EOTA 1DCZA 3S1MB 5K36G 4C2MB 2JSOA 3FVQA 3OIQA 1OXXK 3F2UA 1A3UA 1AP0A 2C9OA 1JQYD 2IJ0A 2RBMA 1KNAA 3J81L 5KIXA 1TWCB 2DNCA 3T51B 2HCIA 1II3A 1B9NA 1FR3A 2F0PA 1SBBB 2AQ1B 1RTNA 3P75A 3V96A 2BOSA 1H9SA 2B2TA 1BDOA 3DEPA 3CQZB 2O2LD 5KEEA 2VB2X 2PMZB 1DZ1A 4CHTB 3DXJC 3EVQA 3NP8A 1RODA 2B2VA 4PMBA 1TIID 3HOZB 4FNFA 5JVH3 1OXTA 1I4QA 1G2TA 1BCPD 4ZQ3A 3D6WA 3QJYA 1JR0D 2NZ1D 3I72A 1DJRD 3PUXA 4C3HG 2M2LA 1TY2A 2BDNA 2LMCB 1E0BA 1CTMA 1HQRD 1X32A 4QCLA 5C0XI 1ET9A 2N88A 3MFYA 1STAA 4RAUC 1J8IA 4OIKA 5G3LD 5D3IB 4NMZA 3R3OA 4HMJA 2H1EA 1V1OA 2K03A 5JEAJ 1Z6HA 2ZXRA 3NWSA 1CZWA 1V43A 1CK1A 1PYWD 1E2WA 3A8JE 4KI0A 2EYOA 1LT4D 1JCKB 2QKIC 1STYA 1OXVA 4A93B 2XIWA 2E75C 1DOLA 1TU2B 4IALA 3L7ZC 1STGA 4U68A 3D4RA 5CV6A 2A68D 3S2DB 2PPBC 1RJTA 1UNSA 1JOKA 2SDFA 5C6AA 2F0MA 3FKIB 1ENCA 4G7HC 4I65A 3H3VC 1ILQA 2FINB 3KLSX 1OO9B 2JE6I 4QF4A 1I3QB 3SXHA 1Q8IA 1K8OA 4XQQA 1BCPB 3OMGA 3IAYA 2AWOA 5EPKA 2D9UA 3S14B 5IODA 4DK0A 1XWEA 1SNMA 4S3SA 4PV1C 5JPMC 2CHBD 2VUMB 2B2UC 5IT9E 3EQLC 3GQBA 4U673 1CHQD 1EY9A 4QB4A 2EY2A 5F2DA 3U9SA 4IFDJ 1DYQA 4DNRB 3I3CA 5I6WA 2WP8J 4RA8A 2BA1A 3S2HB 1B44D 2EYJA 2B2WC 1ESFA 2ZXOA 1G6ZA 3A54A 4A3KB 2RA4A 2CQAA 2OT2A 4V190 5FKAC 3TMEA 1I6HB 3S17B 1WTWA 2F0EA 3MWYW 4H0LC 4KMUC 4A3MB 2X69A 4WJWA 2R92B 1IL8A 1EYCA 2DNEA 3BZDB 3GTPB 2MPMA 5D14A 4ZK9B 4KHVA 3T13A 4FF4A 3C2PA 4DU9A 2NTSA 1IKLA 2EYFA 3NTIA 3W2DA 3DWQA 2F0KA 1EQTA 2LKVA 2RDGA 4RGOS 4DAYA 1BUVT 2XWJB 2O5JC 3V2TA 2YU9B 2LY7A 5CMDA 3BG3A 1PFNA 3DM1A 3KLSA 2M9VA 4C3IG 5ELFA 3MZ5A 4MIUA 2RKSA 2L55A 1WTXA 2O5IC 4A3IB 1KNEA 2ID0A 1F2ZA 1PFMA 3PIP3 4K5XA 3O13A 5EKKA 5KGUA 1HQMC 1KDAA 5EPLA 1QCBD 2F0DA 3MXUA 3QG1A 1PXUA 2KECA 4BY7B 2F03A 1LTGD 3DWAA 1K83B 4BS9A 3BDCA 2G9HD 4CJ0B 2BE5D 1HA6A 5C5MA 3MAQA 3HEJA 1V1PA 5KNBA 1EZ8A 1SMYD 2RSOA 3HS0C 2A68C 1S4ZA 2PCFB 1A2TA 4RH6A 3FPUB 1PTOH 1ENAA 4KY5A 2MP1A 3WDNA 1IW7D 1QOHA 3OIPA 3J80L 2A6EC 5C3EB 5C0XH 1PTOC 2RSNA 4KD4A 1LT5D 2F0GA 3S9WA 1ML0D 5I9PA 1TQOA 1I4PA 3S15B 1LTAD 1VF5C 2K04A 2FJ2A 1CI3M 3LX0A 1EIHA 2KEDA 2G9DA 5LHY1 4X3UA 3HOVB 5IGDA 1EQVA 4CJ1B 4BWGB 3G7LA 1TY0A 5C3XA 1FNWA 4RKLA 1YNNC 1B3AA 4EQPA 3EFXD 1JOOA 5IGGA 3VR5A 3A8IE 2DY8A 2Q8RE 5DEHA 2RVLA 1I4GA 1RHPA 3CHBD 1LT6D 3D3RA 4WORA 2NWGA 4DAVA 1SFOB 4RHRA 3VR2A 1CHPD 2WKCA 2B2WA 2QF7A 1RF2D 1CA5A 4XQNA 4LAAA 4OO1G 1RD9D 3RZOB 1TS3A 1GUTA 1O7ZA 2EYLA 1UEAB 2EJFC 5A2QE 3OW7A 2F0OA 2GA4B 2AUKA 2NYZD 4HSVA 4G7OC 2IPKD 3GTLB 5C4ZA 3I4NB 4UDUC 2XVSA 1VMPA 1EY6A 2EPBA 3AMUA 3OHXC 3VR4A 1TWFB 3Q6SA 3TP6A 3PIO3 3PO3B 2AQ3B 2A69C 5M9OA 1A2UA 2H4OA 4C3JB 4PMWA 2OEOA 2BCOA 2EDGA 4RCNA 3DHQA 1GJXA 1Q1BA 3SK4A 1R9TB 4ME5A 3I4MB 3C3LA 1DOMA 4V0BA 1A6XA 1QILA 2B39A 2JP1A 1EOTA 1R4QB 5DAUA 3K5MA 4PMCA 2CVRA 3ITPA 2IW3A 1Z7TA 4A3BB 4B9WA 2E2JB 1SEBD 3EA6A 3KK7A 5FO9B 1I4XA 3GTQB 1Q12A 2IX3A 4R9WA 3HGBA 1A3TA 4DK1A 1ZYRD 1Y8NB 5CORA 1AW7A 3QB3A 1JC7A 3K7AB 3GTJB 1SYDA 4A3JB 3ND8A 1Y1WB 3S1QB 3N52A 3BVMA 4Z9CB 3K59A 4ULLA 1XX8A 4X3TA 1QG7A 4G4KA 1HXYD 3FDTA 1BNZA 2JA7B 1F9RA 2L9HA 1HTPA 4OO1I 1B53A 5CV8A 1TR5A 4XTCS 3PMFA 4HMIA 2F4IA 2PW7A 3M7NA 3KUPA 4IUVA 5FOBB 1CT1D 1D5XC 2KQ3A 2L12A 3TBIB 1ESRA 2Y0SB 4PNYA 1CQVA 4F87A 3RD4A 1HFGA 2QCPX 3D6CA 2WACA 1SJED 2NVQB 3OPOA 2OF1A 4IUPA 1H9RA 1WTQA 2VNUD 1ZXTA 4LMQD 1MSHA 2KHSA 1VCIA 5IIFA 1Z47A 3M85A 5E4XA 1EWCA 2J0TD 5JVG3 4NP5A 2MJ8A 1I6VC 1PTOD 2HUGA 4K2KA 1LV9A 5G3LF 2ZXPA 4NKLA 1CQFA 1PZID 4X3SA 2WKDA 1EYAA 5CV4A 1DXMA 5IGEA 3BDLA 5D65A 3FEWX 4IURA 3CRLC 4H13C 4MN3A 1CM9A 2KOLA 2PO4A 3LNNA 4P2CB 5FK9C 2AWNA 4KN7C 1SE2A 2JYOA 4FYDA 3P7JA 3PUWA 5DNFA 1PZKD 4FF3A 3I4LA 3R2TA 1LO5D 2IX0A 2F0QA 2WAQB 1PDQA 4XQJA 4TQUS 5D3DA 1A15A 1B9MA 3IFTA 5HURA 3DMUA 3PUYA 2F0HA 1LABA 2SNMA 4H44C 5CR3A 1PZJD 4K5WA 2X6GA 2NTTA 5C44B 3J80E 5AFWA 4ZAIA 3DEOA 5K36H 1IKMA 5COYA 1MI2A 4FXDA 2NVTB 2XRSD 3NBHA 2K32A 2L4NA 1W6JA 1HFNA 3NSWA 1C4QA 3MEHA 2OXPA 5LL6X 4C1NK 4OL7A 1F77A 5ELEA 2J7ZA 3BVZA 3KBXA 1GUNA 1EZ6A 4K2LA 4ZUJA 1QJOA 5JOBA 2VXWA 4KHZA 1JWMD 5KYLA 3BS1A 2D62A 4J6HA 2EYMA 5M3MB 1KDBA 1SNPA 1ZEQX 1PFBA 4L6TB 3MVVA 1H9MA 4RGMA 1HRJA 1SE3A 1BCPC 2NBFA 4DN4M 4DNTB 1O80A 2EYHA 1SNQA 2A73B 1S5BD 1D5ZC 1DOKA 5JEAH 1WD0A 1BO0A 3NBIA 2A74C 4ODGA 2B2YC 2R61A 2M00A 4ID6A 4N9PA 5IT9L 1SNDA 3M7GA 2K33A 4BBRB 4FF2A 3NK9A 1KLGD 4NW2A 3T56B 1Y8PB 4TKOB 4AYBB 1KABA 3TZUA 2CW0C 1EY5A 3ERQA 5ISRA 1TKWB 2XWBB 1EIGA 3R93A 5J39A 3IFDA 3NPPA 2PW5A 3NQIA 2EJMA 4KKTA 4L63B 4RKBA 1O7YA 2JA8B 1K8MA 3GTMB 4CKCA 4HCSA 1SSOA 4HSPA 3KBGA 4XXEA 3LWEA 3X3MA 2K6AA 3T16A 1TS5A 1SXTA 3TSSA 2BA0A 4O42A 3SEBA 4DAPA 2LFNA 1XXGA 3CU7A 5EQ0A 3MHBA 4O1NA 5K5PA 2A6HC 3SK8A 4F7XA 5C0XG 1ZKOA 3NTHA 4F8MA 4FO2A 1EY8A 1NAPA 2NB0A 1IYVA 4JBWA 4E6IA 3JAML 4HTHA 5I9OA 3M3YB 1Y8OB 3VR6A 4R8NA 1SDFA 2F0WA 2IWHA 1MD2D 4A3FB 3T53B 3P1HA 5I2YA 1MGSA 5EKIA 5BN4A 1JWUD 1Q1EA 3I70A 2F0LA 3A7LA 3ONAB 2A6ED 3SVMA 4HCEA 4GZYC 1QB5D 5M5YB 1YNND 1HCZA 1G2SA 3NUCA 1B2TA 3ND9A 2DN8A 5IGFA 5I4DA 1SYFA 4OIJA 3T4AC 3GTGB 1FYCA 2Z4IA 2F3WA 1HHVA 4N9TA 1WD1A 3H0GB 1EY0A 1I4HA 1NR4A 3GO5A 5CV9A 4KN4C 3VA7A 3Q22A 1H9KA 1NCVA 1QNKA 3I91A 4M1UB 5JPNC 1U4MA 4CKEA 2K5QA 3S16B 1RKNA 4IUUA 2CW0D 3J7AV 5C0XJ 4XYQA 3D4DA 2B8GA 2QDBA 1KTKA 5CV7A 4MHEA 1D5MC 3MTSA 2NUCA 5ELDA 1EYDA 1AFPA 3H09A 2EY5A 1WTVA 1PRTF 2XRQD 2DY7A 2KCCA 3C46A 3L9AX 4KKSA 4DGZA 5A35A 5C3WA 4ZRZA 5EPJA 2WB1B 1F2LA 2EXZA 1LLRD 1G291 4QIWB 5CBEE 3I73A 3K0YA 5J1ZA 5FO7B 4I7ZC 1STEA 3FPPA 1AN8A 5FLXL 3SK6A 1S5FD 3K6OA 3D8GA 4L8JA 1GHJA 5BN3A 3VYUA 2RDFA 3OMCA 4HEDA 4K5VA 2C5CA 1OXUA 1V8QA 2PNRC 4BBSB 2EVBA 1PRTD 3Q23A 1HPCA 1O78A 4IFDI 2K5DA 5ELBA 3RLFA 3JAME 2I07B 2PYKA 1FGBD 2F0SA 2E2DC 1SNOA 4X3KA 1SJHD 1GUGA 1RTOA 3MXGA 3K57A 4C3IB 5EJWA 3HOWB 3TZDA 1SYEA 1IW7C 2QEJC 3KF8A 5T1IA 1L0YB 4BA2I 4ZLTF 5J22A 3NQTA 2IX1A 4Y7NB 1Q90A 4XT3B 1ICWA 1SYBA 2TSSA 4R8IA 3NXWA 2KUMA 1TWHB 2N55A 3DUZA 1EY7A 4ZUIA 4IUTA 1STNA 1F9QA 4DFAA 1VDZA 4Q0FA 1EY4A 3QO2A 3K5OA 1GXDC 3HKZB 3M4YA 4C1NI 4EQOA 4C3JG 2J4XA 1E2VA 2EE1A 2JEAI 1DONA 1RDPD 3A56A 1ENFA 3Q0AA 3W3AA 3GD7A 3MXPA 3LWUA 2PZWA 4F88A 3RUZA 1D1IA 3TP7A 4KKUA 2B2VC 4KJOA 3E5SA 1AEXA 1I50B 4ABNA 1NUCA 5E4WC 5EGTA 2R7ZB 3S1RB 2IL8A 4FXKC 1TS4A 4QUFA 1CA6A 2X6LA 3Q24A 5EBDA 5IGCA 2E2IB 5E1FA 1DD2A 3EJIA 1D2BA 1DM0B 4XYOA 1UUPA 3SE0A 1I4RA 5BN5A 2ICEC 3WOFA 1PTOF 5HGTA 3AU7A 3VYTA 4KJNA 3QOJA 3K5LA 3VR3A 3PV0A 2NN6G 2F0TA 3NWTA 2SEBD 3MA2B 3HOUB 2KA7A 3J7AF 2Z8LA 2Q8TA 5IGBA 1NSNS 1YNJC 2KVMA 4LK1C 5IOCA 4TSSA 2XSCA 2HQEA 2EJGC 5C5LA 4JK1C 3P20A 4XIGS 3RZDB 4RFBA 5NUCA 1BBXC 3M4OB 4KK7A 2NVXB 4XDXA 1O7LA 2IT1A 1TWAB 3R8BA 3HZXA 1LACA 2BE5C 2B8FA 1T5XD 1GUSA 1HA5A 1LTSD 1J9OA 2KCNA 5KNCA 4DXFA 4QUCA 4IQZA 4UAIA 1B50A 3PUVA 2XNAC 3H94A 4QMGA 3I90A 1BQQT 1MSGA 5FLXE 1F9SA 2D2CC 2PZUA 2AQ2B 5EKLA 1A3VA 4CJ2C 4TRDA 1SAPA 1VMCA 4WRDA 1LTRD 1EL0A 3PUZA 2F3VA 3MXNA 1GOZA 1EEID 3HG9A 4RCOA 4OO1H 1KDCA 1CFMA 2ICIA 1TVXA 1JOQA 4RGNA 4IUNA 3HRZC 3J7YW 1JWSD 3D31A 1L0XB 2L1BA 1FD7D 2Z1CA 3TP8A 5I2XA 3L3OC 2SNSA 3NHHA 2R93B 3BYTB 1H9SB 5ELCA 4B9XA 4YIJA 3QIAA 1G91A 1H9JA 1JORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  1SND A;  2EY1 A;  3SR1 A;  4J1M A;  4EQO A;  1KAA A;  5DAU A;  1U9R A;  3U9O A;  5JAV A;  3H6M A;  5J1Z A;  5DEH A;  2F0L A;  3HZX A;  3NK9 A;  4PMC A;  2KHS A;  5KYI A;  1F2Z A;  4DF7 A;  5IOD A;  1IHZ A;  3ITP A;  1KAB A;  5IIF A;  1SYG A;  1SNM A;  4S3S A;  4K5X A;  5EKK A;  3SK6 A;  3D4W A;  4K14 A;  1EY5 A;  4B9W A;  3ERQ A;  5KGU A;  5ISR A;  1KDA A;  1TT2 A;  3D8G A;  3MXP A;  4WOR A;  2PZW A;  5CV5 A;  2F0D A;  2SOB A;  1EY9 A;  3RUZ A;  4QB4 A;  2EY2 A;  2RDF A;  5J39 A;  4NP5 A;  5F2D A;  3TP7 A;  3OMC A;  4K5V A;  4KJO A;  5CGK A;  2PW5 A;  4KY6 A;  3E5S A;  1AEX A;  3MEH A;  4K2K A;  5I6W A;  1NUC A;  2OXP A;  2ENB A;  3SK5 A;  3NUC A;  4QMG A;  1STA A;  2EYJ A;  3BDC A;  4IZ8 A;  4LAA A;  5EGT A;  4K6D A;  4OL7 A;  3VA5 A;  4KTA A;  4K5W A;  4NKL A;  1A3T A;  5IGF A;  4RKB A;  2EYL A;  1SYC A;  2F0I A;  1SYF A;  5C5M A;  3HEJ A;  5C4H A;  1STH A;  2PZU A;  2F0N A;  5IGC A;  2F3W A;  1EYA A;  1EZ6 A;  3QB3 A;  4K2L A;  5CV4 A;  4ZUJ A;  5E1F A;  5IGE A;  1EZ8 A;  3BDL A;  3EJI A;  4NMZ A;  2PYK A;  3R3O A;  4HMJ A;  1SYD A;  2F0F A;  2F0O A;  5JOB A;  2F0S A;  5KYL A;  4KD3 A;  4N9T A;  4K8I A;  3SHL A;  5EKL A;  1A2T A;  3QOL A;  3T16 A;  1ENA A;  4J6H A;  4KY5 A;  3TME A;  1JOR A;  2EYM A;  1A3V A;  1A3U A;  1SNO A;  2PZT A;  3C1E A;  5HGT A;  1KDB A;  2EYO A;  4TRD A;  1EY0 A;  3OWF A;  1SNP A;  5CV9 A;  1STY A;  5E3F A;  2F0E A;  4EQN A;  2RBM A;  1F2M A;  3MVV A;  4KJN A;  4G57 A;  5I6Y A;  3QOJ A;  5KIX A;  4NDX A;  4WRD A;  4KD4 A;  5C4Z A;  4KV6 A;  2F0G A;  4K8J A;  3S9W A;  3MHB A;  1II3 A;  2F0P A;  4IAL A;  1EYC A;  2F0T A;  2F3V A;  1RKN A;  3C1F A;  5I9P A;  1EY6 A;  3P75 A;  5K5P A;  1TQO A;  1SYE A;  3SK8 A;  1STG A;  4KHV A;  5CV8 A;  3T13 A;  4F7X A;  5CV6 A;  1TR5 A;  4EVO A;  2F0U A;  3OSO A;  3PMF A;  4HMI A;  4DU9 A;  5KEE A;  3D4D A;  2EYH A;  4F8M A;  1SNQ A;  1KDC A;  5IGB A;  2PQE A;  2QDB A;  1EY8 A;  1NSN S;  1JOK A;  2EYF A;  5J22 A;  5CV7 A;  3TP6 A;  2EYP A;  2PW7 A;  2F0K A;  4E6I A;  5C6A A;  2F0M A;  2LKV A;  1JOQ A;  1F2Y A;  1STB A;  3LX0 A;  4IUN A;  5M9O A;  3NQT A;  4HTH A;  3EVQ A;  1ENC A;  1A2U A;  2NUC A;  3NP8 A;  3TP5 A;  5I9O A;  2O4X A;  1SYB A;  3NXW A;  5IOC A;  1EYD A;  2F0Q A;  2F0J A;  2OEO A;  4I65 A;  3V2T A;  3DHQ A;  5IGD A;  2EY5 A;  1EQV A;  2HQE A;  2KQ3 A;  4PMB A;  5C5L A;  4R8N A;  5KRU A;  3TP8 A;  5CC4 A;  2F0W A;  4H7B A;  3SK4 A;  4ME5 A;  4ODG A;  4QF4 A;  4PNY A;  2SNS A;  1EY7 A;  3SXH A;  5C3X A;  4ZUI A;  3DMU A;  5HUR A;  3MZ5 A;  3NHH A;  2F0H A;  1STN A;  2SNM A;  3P1H A;  4MIU A;  5NUC A;  4RKL A;  4DFA A;  4DGZ A;  5C3W A;  2RKS A;  4EQP A;  3D6C A;  3OMG A;  1SNC A;  2WAC A;  1EY4 A;  2M00 A;  4ID6 A;  1JOO A;  4KY7 A;  4ZQ3 A;  5CR3 A;  4YIJ A;  4B9X A;  5IGG A;  4N9P A;  3ERO A;  2F0V A;  2OF1 A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 2EY6 A;  1YNJ D;  4WJ4 A;  4J1M A;  3GV6 A;  1AZP A;  2E74 C;  1U9R A;  2NVY H;  3GTK H;  2G5D A;  2ES2 A;  1AZQ A;  5T1G A;  4B3S L;  3CC7 A;  4DF7 A;  3HOV H;  3G4S A;  1IHZ A;  1D1K A;  5FO8 B;  1TWH H;  2Q2H A;  3KLR A;  4K14 A;  3BDO A;  1D6E C;  4BA1 I;  1SRO A;  4PQX A;  4UP9 A;  2HDM A;  3JC6 6;  5ELN A;  3R2I A;  4J8Q A;  3NE5 B;  1X3F A;  4R4Q A;  2JA5 B;  1V1P B;  4JI5 L;  4ZYS A;  1OXS C;  2E2H H;  4OWT B;  1PTO B;  3FRP B;  2LS0 1;  5CYU A;  3H0G G;  1WTR A;  1PH3 A;  3J81 j;  1VQ5 A;  5DM7 3;  5C4X B;  1VQM A;  2B2Y A;  1B7Y B;  1C48 A;  1VQL A;  2L5T A;  1VQC A;  3I8Z A;  4JI8 L;  5C4H A;  1S5C D;  1TWG B;  1WCM B;  5EBC A;  4K8I A;  3SHL A;  1NTG A;  5CBA E;  2AKW B;  1QUQ A;  3NTK A;  3EIV A;  3C1E A;  2PZT A;  4HR7 B;  2MGS A;  3A7A B;  3RLN A;  5E3F A;  5M3F B;  4G57 A;  5I6Y A;  3HP3 A;  1BF4 A;  2R6G A;  3PO2 G;  2YYZ A;  1N36 L;  1E2Z A;  1EFI D;  1Y1V H;  1E1T A;  4X65 Q;  1LTT D;  5KND A;  3GTJ H;  1XPR A;  3GTO H;  3S24 A;  4EVO A;  1RIP A;  4X6A H;  2Q8I B;  3H0G H;  4A4I A;  2JJQ A;  5M5W B;  2I46 A;  3UDF A;  1QVF A;  2VS1 A;  1HNZ Q;  1KLU D;  1F2Y A;  2UUA Q;  4XT1 B;  3GTM H;  1BOS A;  1W6K A;  4H02 A;  5LMN L;  4CGY B;  1QE6 A;  1UE7 A;  2E76 C;  4RGT A;  4JG2 A;  1LTB D;  2E2H B;  1BXT A;  5TSS A;  3K58 A;  3QWN A;  2OTL A;  5CC4 A;  4H7B A;  2UXD L;  1LTI D;  3HOX H;  1QVG A;  1JJG A;  4LF7 Q;  5LL6 S;  4K0K L;  1X3P A;  3EN2 A;  2A69 D;  2L11 A;  1VF7 A;  1GKH A;  3FMC A;  2EY1 A;  4DR2 Q;  4HIO A;  1GO3 E;  3U9O A;  5C4J B;  4BY1 B;  1XTC D;  1X6O A;  2GVA A;  1VQA A;  3A8K E;  4HN7 A;  3H3V I;  1HNW Q;  2F4V Q;  5GQO A;  2B63 B;  1XTD A;  1TT2 A;  4A93 H;  1RCV D;  2XTI A;  3BVG A;  1JB7 A;  1S5D D;  2F4V L;  2SOB A;  2OCE A;  3I2Z A;  1U4P A;  3CPF A;  2MUY A;  1J5E L;  1M4V A;  3MC0 B;  4DUY L;  5JJZ A;  4KY6 A;  4DR1 Q;  1EU3 A;  4BBR H;  3X3N A;  3EBE A;  2D5D A;  3DWP A;  4K6D A;  3U4V A;  2K05 A;  1XMO L;  2QIL A;  2FFK B;  1Q3L A;  1VQN A;  1GUW A;  1X65 A;  1SYC A;  1EYG A;  3JAM c;  1LT3 D;  1STH A;  3S16 H;  1JE4 A;  1N8R C;  2TMP A;  2ZT9 C;  3M3Y H;  1IYU A;  2F0F A;  4KD3 A;  5LMN Q;  3QOL A;  4ZKC B;  3A55 A;  4JI3 Q;  1YHB A;  2NN6 H;  2RCF A;  4MNO A;  1N33 L;  3OWF A;  4NXN L;  3ZYY X;  2HCC A;  4C56 C;  1F2M A;  5A2Q L;  3MFG A;  2PI2 E;  1U4L A;  1NNX A;  4DV7 Q;  2A5H A;  3BYY B;  3T1Y Q;  3DLL A;  4KV6 A;  4K8J A;  2B2T C;  1UAP A;  3PO3 G;  4RHS A;  4M8A A;  1GUO A;  1F9P A;  1T5E A;  4DV1 L;  2A8V A;  3CCM A;  3HOX B;  3J7A 5;  2F0U A;  1TS2 A;  1I94 L;  1X3Q A;  1ILP A;  3IL8 A;  3CF5 A;  3I4N G;  2VB3 X;  5EAY A;  2EYP A;  2JXM B;  1ET6 A;  2AUJ D;  5M5Y H;  3DM3 A;  2NVY B;  3GTK B;  3TP5 A;  4JBJ A;  1Y1V B;  1PRT C;  4LFC L;  3CXC A;  5DLQ E;  2JA6 B;  2WII B;  4A3E B;  5DM6 3;  2K01 A;  4N8F A;  3ERS X;  1UWV A;  4DR1 L;  2OQK A;  4A3D H;  1B4O A;  2Z4H A;  1I6H H;  5BR8 L;  3HOY B;  2JA5 G;  4X66 Q;  3SDZ A;  3J81 E;  2MHV A;  1HNX L;  1SNC A;  2R7D A;  4JV5 L;  4IFD G;  4HJ8 A;  4KY7 A;  1CKN A;  2F0V A;  1WCM H;  2K1B A;  3IKJ A;  3SR1 A;  1KAA A;  5JAV A;  3VYR A;  3H6M A;  2V4D A;  1G8Z D;  1PLF A;  4Q5V A;  1SYG A;  1YJN A;  4JYA Q;  3PF4 A;  4GN4 B;  1UE6 A;  3MEF A;  1NR2 A;  4JCV E;  1XYI A;  1K28 A;  3J7Z C;  2KJX A;  2BDO A;  4KHP L;  4DR7 Q;  4DR5 L;  2JA8 G;  2RDH A;  4HJ7 A;  4K0K Q;  2AMC B;  3RMH A;  4EGV A;  2K5W A;  3E6Z X;  2EZV A;  4OGQ C;  4B3S Q;  3CKI B;  2F3I A;  1Y69 U;  2L0C A;  1R4P B;  1HTL D;  3GP7 A;  1HR0 Q;  3VYS A;  2UXB L;  4FVM A;  3VA5 A;  4KTA A;  1SE4 A;  2NN6 I;  1WTO A;  3OWE B;  4YCV A;  4K6L A;  1GHK A;  1K73 C;  1FNU A;  3TEH B;  4BXX H;  5JEA G;  1QZH A;  5LMU L;  2F0N A;  3AB9 A;  1RL2 A;  2XN9 C;  4IFD H;  2WB1 E;  5M5X B;  3CCE A;  4JI6 L;  3TDQ A;  1M8A A;  2FMC A;  3Q8D A;  4DA2 A;  1BR9 A;  4AYB E;  3RN2 A;  1FNV A;  1WVL A;  3UI2 A;  4L5Q A;  4EQN A;  5M5W H;  5J3B A;  2WIN B;  3G6J B;  1WYD A;  3J80 i;  4NDX A;  3WOE A;  1XNR Q;  3CRK C;  2HDL A;  3FP9 A;  2C35 B;  1SMY C;  4JOI A;  1YJ9 A;  2JA8 H;  4CKB A;  1EEF D;  3H91 A;  4AQY L;  3C1F A;  1U4R A;  4DV0 L;  2VZA A;  3K7A H;  4DV0 Q;  4GOP A;  4A3D B;  1I3Q H;  1S5E D;  4A3G B;  1MBY A;  3OSO A;  1EU4 A;  1SR3 A;  2PQE A;  1EWH A;  4A3J G;  2N49 A;  2VL6 A;  1STB A;  1ZYR C;  1E22 A;  2K5V A;  1HUN A;  2O4X A;  5M5X H;  3TRZ A;  1CZG A;  2RQX A;  2F0J A;  3GV3 A;  3OOC A;  4DXG A;  2K7V A;  5C3E G;  4WFN 3;  1E3P A;  4ZCK A;  5KRU A;  4DR4 L;  1P16 A;  4IUQ A;  3GTO B;  1G6P A;  2WV6 D;  1ONL A;  3URY A;  1MIU A;  1HUM A;  3N6R A;  2CWP A;  4RWS C;  2HIX A;  2FMM A;  2ZTC A;  1C8C A;  3ERO A;  4PG3 A;  4CBV A;  4FF1 A;  1JIC A;  2R7Z G;  1B1Z A;  2FHT A;  1FGU A;  4B08 A;  1PMR A;  2KEE A;  1AE3 A;  2K5N A;  4LJZ C;  3V05 A;  4LNQ A;  3D4W A;  2B2U A;  4GN5 A;  3A0J A;  1PRT B;  1WTP A;  2JEB I;  1H95 A;  5CV5 A;  1LM0 A;  1BCP F;  1BKB A;  5CGK A;  4HAE A;  2K28 A;  2F1M A;  3ULP A;  4FP5 D;  4IN3 A;  4G7Z C;  2R3Z A;  2ENB A;  3SK5 A;  3E0J A;  1JB3 A;  4FXG C;  4IZ8 A;  4C3H B;  4ZKB B;  5FJ8 G;  3TN2 A;  1N34 Q;  1HNX Q;  2R93 H;  5M3M G;  3K5N A;  1QWY A;  5GAE C;  4OHJ A;  4HJ9 A;  2F0I A;  3D0F A;  4ILW A;  1WTH A;  4RMF A;  3S1N B;  3FKI H;  1QNU A;  2Z9H A;  1X9N A;  2A6H D;  5KYI A;  3PO2 B;  1Q8K A;  2EOT A;  1DCZ A;  1YI2 A;  3S1M B;  1EIY B;  5K36 G;  4C2M B;  4POF A;  4LUO A;  2JSO A;  3FVQ A;  3OIQ A;  1GM5 A;  1OXX K;  2UUC Q;  2K14 A;  1L1O C;  3F2U A;  1A3U A;  4NB3 A;  1IBL Q;  1AP0 A;  2C9O A;  1KRT A;  1JQY D;  2IJ0 A;  2RBM A;  1YIJ A;  1KNA A;  3J81 L;  5KIX A;  1TWC B;  2DNC A;  2N8N A;  3TQY A;  3T51 B;  4DR6 Q;  2HCI A;  1TWA H;  1B70 B;  1II3 A;  4DV1 Q;  1B9N A;  1FR3 A;  2F0P A;  1SBB B;  2AQ1 B;  1RTN A;  2PNH A;  3P75 A;  3V96 A;  2BOS A;  1H9S A;  2IHF A;  2B2T A;  4JI0 L;  1BDO A;  3DEP A;  3CQZ B;  2O2L D;  5KEE A;  4GLX A;  2VB2 X;  2JQO A;  2PMZ B;  1DZ1 A;  4CHT B;  4LF4 Q;  3DXJ C;  2I5H A;  5IP7 H;  3EVQ A;  3NP8 A;  4TVA B;  4MTN A;  4A3I H;  3UDX A;  1ROD A;  2B2V A;  4B3M L;  4PMB A;  2KHJ A;  2YV5 A;  1TII D;  3ZJY C;  3PGZ A;  2D0O A;  3HOZ B;  4FNF A;  5JVH 3;  1OXT A;  1I4Q A;  1G2T A;  1BCP D;  4ZQ3 A;  1UE1 A;  2E2I H;  3D6W A;  3TRE A;  1SE8 A;  3QJY A;  3H15 A;  1JR0 D;  3UE0 A;  2NZ1 D;  3I72 A;  1DJR D;  3PUX A;  1J5E Q;  4C3H G;  2M2L A;  4UP7 A;  2R7Z H;  1TY2 A;  2BDN A;  4PZ8 A;  2LMC B;  1V9P A;  1TWG H;  1E0B A;  1CTM A;  3SGI A;  1HQR D;  1HNW L;  1KXL A;  3CAM A;  3S1M H;  1X32 A;  4QCL A;  5C0X I;  4OX9 L;  1ET9 A;  2N88 A;  3MFY A;  1STA A;  1R9T H;  3I4M H;  3HKS A;  3CPW A;  4YWM A;  4ME3 A;  1D7Q A;  4RAU C;  1J8I A;  2YTV A;  4OIK A;  4A3G G;  5G3L D;  5D3I B;  4NMZ A;  3GDE A;  3R3O A;  4HMJ A;  1L0W A;  5C44 H;  2H1E A;  1V1O A;  2K03 A;  5JEA J;  1Z6H A;  2ZXR A;  3NWS A;  2UUA L;  3S2D H;  1U0L A;  1CZW A;  1V43 A;  1CK1 A;  5E7N A;  1HNZ L;  1PYW D;  1E2W A;  3A8J E;  1X54 A;  1IXR A;  2EYO A;  4KI0 A;  1LT4 D;  1JCK B;  2QKI C;  1STY A;  1OXV A;  4A93 B;  1HJP A;  2XIW A;  2E75 C;  1DOL A;  1TU2 B;  2JA6 H;  4IAL A;  4DR3 Q;  3L7Z C;  1STG A;  4U68 A;  3D4R A;  4J15 A;  5CV6 A;  4P73 A;  2A68 D;  3S2D B;  2PPB C;  1RJT A;  1UNS A;  1JOK A;  2SDF A;  3H3V H;  5C6A A;  2F0M A;  4DUZ L;  1HR0 W;  3FKI B;  2CQO A;  1SMX A;  1ENC A;  2JA5 H;  1K83 H;  4OEL B;  4G7H C;  4I65 A;  5ELO A;  3H3V C;  4FDB A;  1ILQ A;  2FIN B;  3KLS X;  1OO9 B;  2JE6 I;  4QF4 A;  1I3Q B;  3SXH A;  4YWL A;  1Q82 C;  1IYJ B;  1Q8I A;  4YHH Q;  4A3C H;  1K8O A;  4XQQ A;  1BCP B;  3OMG A;  4LF6 L;  3IAY A;  2Q2I A;  4NXM L;  2AWO A;  5EPK A;  2HIV A;  2ZJP A;  2D9U A;  2YTY A;  4JI5 Q;  3S14 B;  5IOD A;  4DK0 A;  1XWE A;  1CSP A;  1SNM A;  4S3S A;  4PV1 C;  4N8X 1;  5JPM C;  2CHB D;  4R4C A;  2VUM B;  4X62 L;  2B2U C;  5IT9 E;  3EQL C;  3GQB A;  4U67 3;  1CHQ D;  1EY9 A;  4QB4 A;  2EY2 A;  3HOV G;  5F2D A;  3U9S A;  4IFD J;  1DYQ A;  4DNR B;  3I3C A;  5I6W A;  1PHJ A;  2WP8 J;  4LF8 L;  4RA8 A;  2BA1 A;  3S2H B;  1B44 D;  2EYJ A;  4CDF C;  2B2W C;  1ESF A;  1MJE A;  3ER0 A;  4DV7 L;  1JJ2 A;  2ZXO A;  3A74 A;  1G6Z A;  3TS0 A;  3A54 A;  1K3B C;  3BZC A;  4A3K B;  4QQB X;  4YY3 L;  2RA4 A;  2CQA A;  2OT2 A;  1PYB A;  2UXC L;  5IYB G;  3I55 A;  3GTQ H;  1QZG A;  4V19 0;  3LGJ A;  5FKA C;  1JMC A;  3TME A;  1I6H B;  2VQE L;  3S17 B;  5GAG C;  1WTW A;  3UE1 A;  4BBS G;  2F0E A;  4GNX A;  3MWY W;  4H0L C;  2VY3 A;  4KMU C;  4A3M B;  2X69 A;  4WJW A;  1VQ9 A;  2R92 B;  1IL8 A;  1EYC A;  2DNE A;  3CW2 C;  4EX5 A;  3BZD B;  3GTP B;  2MPM A;  5D14 A;  5H1S E;  1BBW A;  4ZK9 B;  4KHV A;  4DUY Q;  3T13 A;  4FF4 A;  2V1C C;  1PA6 A;  3C2P A;  2CKZ B;  2OQ0 A;  4DU9 A;  2EQS A;  2NTS A;  4LW1 A;  5IYD H;  1VQP A;  1IKL A;  2EYF A;  1K0S A;  4BY1 G;  3NTI A;  1IBK L;  3W2D A;  5HGQ A;  3DWQ A;  3G71 A;  2F0K A;  1EQT A;  2LKV A;  2RDG A;  4RGO S;  3VDY A;  1FL0 A;  2WB1 G;  3STB C;  4DAY A;  1BUV T;  2XWJ B;  2O5J C;  2ZM6 L;  3V2T A;  2YU9 B;  2LY7 A;  5CMD A;  3BG3 A;  4AYB G;  1PFN A;  3PF5 A;  3DM1 A;  3U4Z A;  3KLS A;  2M9V A;  4C3I G;  3MZ5 A;  5ELF A;  5IWA Q;  4MIU A;  2RKS A;  2QA4 A;  1KIX A;  2L55 A;  3J81 c;  1WTX A;  4P72 A;  2VQE Q;  2JA6 G;  5JJI A;  1PH1 A;  2O5I C;  3BJU A;  2UU9 L;  2K75 A;  4A3I B;  1KNE A;  2ID0 A;  4DV4 Q;  1F2Z A;  1PFM A;  3PIP 3;  1PFS A;  4K5X A;  3O13 A;  5EKK A;  1Q81 C;  1XMQ Q;  3K7U C;  4WJ3 M;  5KGU A;  4CDC C;  4GKJ L;  1HQM C;  1KDA A;  1VQE A;  5EPL A;  1WOC A;  1QCB D;  2F0D A;  4JI1 L;  3MXU A;  3QG1 A;  4A76 A;  1PXU A;  2KEC A;  4BY7 B;  2F03 A;  1LTG D;  3DWA A;  1K83 B;  4BS9 A;  2WAQ E;  3BDC A;  2G9H D;  4CJ0 B;  5IP9 G;  2BE5 D;  1HA6 A;  5C5M A;  2Z6B A;  3MAQ A;  3HEJ A;  4APV A;  4A3M G;  2UUC L;  1V1P A;  5KNB A;  1EZ8 A;  1SMY D;  2RSO A;  3HS0 C;  4O0A A;  4PZ7 A;  2JK8 A;  2A68 C;  1S4Z A;  3J81 i;  4JOI C;  2PCF B;  1PYS B;  1A2T A;  4RH6 A;  4AIM A;  3FPU B;  1PTO H;  2UUB L;  1ENA A;  4KY5 A;  4DPG A;  2MP1 A;  3WDN A;  1IW7 D;  1QOH A;  3OIP A;  1KAW A;  4NXM Q;  3L0O A;  3J80 L;  2A6E C;  5C3E B;  5C0X H;  1PTO C;  2RSN A;  4KD4 A;  1LT5 D;  3U58 A;  2F0G A;  3S9W A;  1ML0 D;  3K0X A;  2K5H A;  3CME A;  3CCL A;  5I9P A;  3M4P A;  1TQO A;  1CKN B;  1I4P A;  1L2F A;  3S15 B;  1FJG L;  1LTA D;  1VF5 C;  4DV3 Q;  2K04 A;  1XPO A;  4JW0 A;  2FJ2 A;  2WFW A;  1CI3 M;  3LX0 A;  3HOW G;  1EIH A;  2LXK A;  2KED A;  2P5Z X;  2G9D A;  5LHY 1;  4X3U A;  3HOV B;  1Y14 B;  5IGD A;  1EQV A;  4CJ1 B;  4BWG B;  3QR8 A;  4DR3 L;  3CCS A;  2QW7 A;  3G7L A;  1TY0 A;  2BH2 A;  3T1H L;  5C3X A;  3S1R H;  1FNW A;  4RKL A;  1YNN C;  1JT8 A;  1B3A A;  4EQP A;  4GNX C;  3WWV A;  3EFX D;  1JOO A;  5IGG A;  4C3I H;  3VR5 A;  3A8I E;  1N32 Q;  4A3D G;  5IT9 c;  2DY8 A;  5IY0 A;  3FHW A;  2Q8R E;  1AE2 A;  5DEH A;  4DK3 C;  2RVL A;  1I4G A;  4L5R C;  1RHP A;  3CHB D;  4DKA C;  1WCM G;  1LT6 D;  3D3R A;  4WOR A;  2NWG A;  3AQQ A;  3CP0 A;  2VQF Q;  3OW2 A;  4DAV A;  3I4M G;  1SFO B;  4RHR A;  3VR2 A;  4UHV A;  1CHP D;  2WKC A;  1LYL A;  2B2W A;  2QF7 A;  1RF2 D;  2E5L Q;  1CA5 A;  4XQN A;  3S14 H;  4AQY Q;  3HKZ G;  4LAA A;  1MHW C;  4LF5 L;  4OO1 G;  3W1B A;  1RD9 D;  1QUQ B;  3RZO B;  1TS3 A;  1IBM L;  1U5K A;  1GUT A;  1O7Z A;  4YCW A;  2EYL A;  3GTL H;  1UEA B;  2EJF C;  2I5M X;  5A2Q E;  1PH2 A;  3OW7 A;  2F0O A;  2GA4 B;  1E1O A;  2AUK A;  2L15 A;  2NYZ D;  4A3E G;  4L5S A;  4HSV A;  1ICF B;  4G7O C;  4JC0 A;  5C4X H;  2IPK D;  2EIF A;  3ULL A;  3GTL B;  5C4Z A;  4EQ5 A;  2UXB Q;  3I4N B;  4UDU C;  4OON A;  2XVS A;  1VMP A;  2CCZ A;  1EY6 A;  1MJC A;  2EPB A;  1EQQ A;  3AMU A;  4GKK L;  3OHX C;  1CSQ A;  1K9M C;  4DR5 Q;  2ALY B;  3VR4 A;  4KHP Q;  1TWF B;  3Q6S A;  3TP6 A;  3PIO 3;  3PO3 B;  2AQ3 B;  2A69 C;  5M9O A;  1UE5 A;  1A2U A;  2H4O A;  5HY6 A;  4C3J B;  5L37 A;  1V1Q A;  4PMW A;  2OEO A;  1EOV A;  2BCO A;  2PQA A;  2EDG A;  4RCN A;  3DHQ A;  1GJX A;  3GTP H;  1Y1W H;  1Q1B A;  4BBR G;  4LFA Q;  3SK4 A;  1R9T B;  4ME5 A;  3I4M B;  3C3L A;  1DOM A;  4V0B A;  2A19 A;  1A6X A;  4GS3 A;  1QIL A;  2B39 A;  2JP1 A;  3KDF A;  4YWK A;  4LF9 L;  1IBL L;  1EOT A;  4ALP A;  2JA7 H;  3AFQ A;  1E7Z A;  1R4Q B;  5DAU A;  4HJ5 A;  3K5M A;  2KHI A;  4OXP A;  4PMC A;  2KCT A;  3STB D;  4C2M H;  2CVR A;  3HOU H;  3ITP A;  2IW3 A;  1HZ9 A;  1Z7T A;  4A3B B;  3M9B A;  1S72 A;  4B9W A;  2E2J B;  1TWC H;  3S1N H;  1I94 Q;  1SEB D;  3EA6 A;  3KK7 A;  1N34 L;  2ZJR A;  5FO9 B;  2ZTD A;  1I4X A;  4LUV A;  3GTQ B;  1Q12 A;  2IX3 A;  2QGQ A;  4R9W A;  1UEB A;  3HGB A;  1A3T A;  4DK1 A;  1Q7Y C;  3CC2 A;  1ZYR D;  5AJ3 L;  2CWA A;  2RCN A;  1Y8N B;  2OWO A;  2F52 A;  3I4N H;  5COR A;  4JI3 L;  1AW7 A;  3QB3 A;  4GLA C;  1JC7 A;  2KCM A;  3K7A B;  2R7F A;  3GTJ B;  1SYD A;  4BY7 H;  4A3J B;  4DV4 L;  3U50 C;  3ND8 A;  1Y1W B;  3S1Q B;  3N52 A;  3HOX G;  3BVM A;  4Z9C B;  3K59 A;  4ULL A;  4OEM B;  1XX8 A;  4X3T A;  1QG7 A;  4G4K A;  1HXY D;  3FDT A;  1N9W A;  4QGU A;  1B3Q A;  5IWA L;  3A5Z B;  1BNZ A;  2JA7 B;  5C4X G;  1X3E A;  4DR4 Q;  1F9R A;  4BY1 H;  1I5F A;  2L9H A;  4DV2 L;  1HTP A;  4OO1 I;  1B53 A;  5CV8 A;  4JI7 L;  4A3F H;  2Q2T A;  1TR5 A;  4XTC S;  3PMF A;  1W3S A;  4HMI A;  3HOY G;  1ASZ A;  2B63 H;  2F4I A;  2PW7 A;  3M7N A;  4P75 A;  3KUP A;  4IUV A;  2N3S A;  5FOB B;  1CT1 D;  4JI4 Q;  1D5X C;  2KQ3 A;  2DUD A;  2L12 A;  3TBI B;  1ESR A;  2Y0S B;  4UY8 C;  1MKH A;  4PNY A;  3MXN B;  1CQV A;  4F87 A;  1VQ6 A;  3RD4 A;  4DV5 L;  2VQF L;  1HFG A;  2QCP X;  3D6C A;  2WAC A;  4R4I A;  1EIF A;  3W1G A;  1SJE D;  2NVQ B;  3OPO A;  2DJF C;  2OF1 A;  2CFM A;  1EQR A;  4IUP A;  1H9R A;  1WTQ A;  2VNU D;  1ZXT A;  3HFZ B;  4LMQ D;  1MSH A;  2KHS A;  1PH6 A;  1ASY A;  1VCI A;  5IIF A;  1Z47 A;  4B3T L;  4DV6 Q;  2VW9 A;  3M85 A;  1VQJ A;  3HOY H;  5E4X A;  1EWC A;  2J0T D;  4IO9 A;  1L1O B;  4NP5 A;  5JVG 3;  2MJ8 A;  5IP9 H;  1I6V C;  1PTO D;  2HUG A;  4GOP C;  4LF8 Q;  3KDF B;  1PH7 A;  4K2K A;  1LV9 A;  5G3L F;  4GNX B;  1YHA A;  2Y0S E;  2Z0S A;  2ZXP A;  1N36 Q;  3HOZ H;  4NKL A;  1NBW A;  1CQF A;  1VQK A;  1A0I A;  1PZI D;  4X3S A;  3OYY A;  4LFB L;  2KEN A;  2WKD A;  2K50 A;  1EYA A;  5CV4 A;  1DXM A;  5IGE A;  1Q46 A;  3BDL A;  4HIM A;  3I7F A;  2N78 A;  3HOU G;  4IJH A;  2VUM G;  2NZO A;  5D65 A;  3FEW X;  4IUR A;  4JI8 Q;  1IZ6 A;  3CRL C;  4JV5 Q;  4H13 C;  4MN3 A;  3OTO L;  3F2B A;  1CM9 A;  3OTO Q;  2KOL A;  5BR8 Q;  2PO4 A;  1T9H A;  2GVB A;  3LNN A;  2I5L X;  2YTX A;  1PVO A;  4P2C B;  1A8V A;  5FK9 C;  3KJP A;  2MO0 A;  2WAQ G;  2AWN A;  4KN7 C;  2MNA A;  1SE2 A;  2JYO A;  4DUZ Q;  3P7J A;  3PUW A;  4FYD A;  4JBM A;  5DNF A;  5C3E H;  1PZK D;  1DGS A;  4QL5 A;  2B63 G;  4A3B G;  3I4L A;  3R2T A;  1P8L A;  4FF3 A;  1LO5 D;  2IX0 A;  2F0Q A;  2WAQ B;  3I56 A;  1PDQ A;  4XQJ A;  4TQU S;  4JVZ A;  1M1K C;  5D3D A;  1A15 A;  1XNQ L;  1B9M A;  3IFT A;  5HUR A;  3DMU A;  3PUY A;  2F0H A;  1LAB A;  2SNM A;  5FJ8 H;  4H44 C;  2AHO B;  1A62 A;  3E9H A;  4NXN Q;  5CR3 A;  1NE3 A;  2EXD A;  3E0E A;  3FKI G;  1PZJ D;  4K5W A;  4B3T Q;  2X6G A;  4L5T A;  2NTT A;  5C44 B;  2Z6K C;  3J80 E;  5AFW A;  4ZAI A;  3DEO A;  5K36 H;  3KF6 B;  1IKM A;  5COY A;  1MI2 A;  3CQZ H;  1D8L A;  3TS2 A;  4FXD A;  2NVT B;  2FXQ A;  2XRS D;  3NBH A;  4DAY B;  1XMO Q;  2K32 A;  2L4N A;  2CH4 A;  1W6J A;  1HFN A;  4A93 G;  1OTC A;  3NSW A;  1C4Q A;  3MEH A;  1HH2 P;  2OXP A;  1FVI A;  5LL6 X;  4C1N K;  3RZD H;  2HT1 A;  4OL7 A;  1EWI A;  1F77 A;  5ELE A;  1IBK Q;  1S40 A;  1YNX A;  2J7Z A;  3BVZ A;  3KBX A;  5M3F G;  1GUN A;  1EZ6 A;  4K2L A;  4ZUJ A;  5IP7 G;  1QJO A;  4GLV B;  5JOB A;  2VXW A;  4KHZ A;  1JWM D;  5KYL A;  4DV2 Q;  1K8A C;  1S3O A;  3BS1 A;  2D62 A;  4J6H A;  4DR2 L;  2EYM A;  1IL2 A;  5M3M B;  1VQD A;  4IOA A;  1KDB A;  1SNP A;  1ZEQ X;  1EFW A;  1PFB A;  5GRO A;  2VUM H;  4L6T B;  3MVV A;  1H9M A;  2NVQ H;  3AYH B;  4RGM A;  2UXD Q;  1HRJ A;  1SE3 A;  1BCP C;  4BBS H;  2NBF A;  3IRB A;  3HKZ E;  4JBK A;  4DN4 M;  1CKM A;  4DNT B;  4KLK A;  4C3H H;  3HOZ G;  3UDG A;  1O80 A;  2EYH A;  1SNQ A;  2A73 B;  1S5B D;  1Y1W G;  1K8G A;  2MFI A;  1D5Z C;  1DOK A;  5JEA H;  1WD0 A;  1O7I A;  3K8A A;  3KJO A;  1BO0 A;  2E8G A;  2R92 H;  1WI5 A;  1EUJ A;  3NBI A;  2A74 C;  3CCV A;  4ODG A;  2JA7 G;  3JAM i;  5M3M H;  2NVT H;  1K0R A;  2B29 A;  4HID A;  2B2Y C;  1NMF A;  2R61 A;  2A1A A;  2M00 A;  4ID6 A;  4LF5 Q;  4N9P A;  3PO3 H;  5IT9 L;  1SND A;  3M7G A;  2K33 A;  4BBR B;  3K80 C;  4FF2 A;  1PH4 A;  3NK9 A;  1KLG D;  4NW2 A;  3T56 B;  1Y8P B;  3S2H H;  4TKO B;  4AYB B;  1KAB A;  3TZU A;  3CCU A;  1PH9 A;  1VQ8 A;  3RZO H;  4OWX B;  1NMG A;  2CW0 C;  4IJL A;  1EY5 A;  3B6Y A;  3ERQ A;  5ISR A;  1TKW B;  2XWB B;  4LF6 Q;  1EIG A;  3R93 A;  4YHH L;  5J39 A;  3IFD A;  3NPP A;  3F8T A;  1VQ4 A;  2PW5 A;  3KFU A;  2YU9 H;  3NQI A;  2EJM A;  4KKT A;  2PMZ E;  4L63 B;  3PQI A;  4UPA A;  1YHQ A;  3KF6 A;  2OTJ A;  4RKB A;  1O7Y A;  3T1H Q;  2NVX H;  1YZ6 A;  2JA8 B;  1K8M A;  1XJV A;  3GTM B;  4CKC A;  4HCS A;  1SSO A;  4HSP A;  3KBG A;  4XXE A;  3NBH B;  3LWE A;  3KOJ A;  3X3M A;  2K6A A;  3T16 A;  1TS5 A;  1SXT A;  3TSS A;  2BA0 A;  4O42 A;  3SEB A;  4DAP A;  2LFN A;  1XXG A;  1FJG Q;  1SFO H;  3CU7 A;  5EQ0 A;  3MHB A;  4O1N A;  4IPG A;  2MQH A;  5K5P A;  3PIO A;  1PV4 A;  2A6H C;  3SK8 A;  2LSS A;  4F7X A;  4UP8 A;  5C0X G;  1ZKO A;  3NTH A;  4F8M A;  1AH9 A;  4FO2 A;  1EY8 A;  4CDD C;  1NAP A;  2NB0 A;  1IYV A;  4JBW A;  5M3F H;  1SLJ A;  2R93 G;  4E6I A;  3JAM L;  4HTH A;  5I9O A;  3M3Y B;  4I7A A;  1Y8O B;  3VR6 A;  4A3J H;  5IE8 A;  2E5L L;  1SN8 A;  4IOC A;  4R8N A;  1SDF A;  2F0W A;  4A3L H;  1CUK A;  1C0A A;  2IWH A;  1MD2 D;  4A3F B;  3RLO A;  3T53 B;  4GOP B;  3P1H A;  1VQB A;  1MGS A;  5I2Y A;  5IYC G;  2MO1 A;  5EKI A;  5BN4 A;  1JWU D;  1Q1E A;  3CCJ A;  3I70 A;  1LTL A;  1TXY A;  2F0L A;  3UDI A;  5IYB H;  3A7L A;  3ONA B;  2A6E D;  3SVM A;  4HCE A;  4GZY C;  2PI2 A;  2IHE A;  2KBN A;  1A63 A;  1XMQ L;  4DV6 L;  1QB5 D;  2JN4 A;  5M5Y B;  1YNN D;  5FLM G;  3M4Q A;  5JJL A;  4LWC A;  4MZ9 A;  1HCZ A;  4B3M Q;  1G2S A;  3NUC A;  1B2T A;  3ND9 A;  1K3R A;  4DV5 Q;  2DN8 A;  1VQH A;  5IGF A;  5I4D A;  1SYF A;  4OIJ A;  3T4A C;  1HZB A;  3GTG B;  1FYC A;  2Z4I A;  2F3W A;  1HHV A;  3CD6 A;  1KHI A;  2ZM6 Q;  4R4O A;  4N9T A;  1WD1 A;  3H0G B;  2PQA B;  4A3K G;  1EY0 A;  1I4H A;  1NR4 A;  3GO5 A;  5CV9 A;  4KN4 C;  4DR6 L;  3VA7 A;  3Q22 A;  1H9K A;  1NCV A;  1NY4 A;  1QNK A;  3I91 A;  4M1U B;  2JA9 A;  5JPN C;  1U4M A;  4CKE A;  2K5Q A;  4JI7 Q;  3S16 B;  5FLX c;  4A3E H;  4NPS A;  1RKN A;  4IUU A;  5FLM H;  2HHH L;  2CW0 D;  2Y0S G;  3J7A V;  4A3B H;  5C0X J;  4XYQ A;  5GAD C;  3D4D A;  2B8G A;  2QDB A;  1KTK A;  2Q2U A;  4POG A;  5CV7 A;  1KC8 C;  4MHE A;  1KRS A;  3W5O A;  1D5M C;  3J80 c;  3MTS A;  2NUC A;  1VQI A;  5ELD A;  1EYD A;  2UXC Q;  1AFP A;  3H09 A;  4X64 L;  5LMN W;  2EY5 A;  1B8A A;  1WTV A;  3F2D A;  1PRT F;  2XRQ D;  2DY7 A;  2KCC A;  5AJ3 Q;  3C46 A;  3L9A X;  3ULJ A;  4KKS A;  4DGZ A;  5A35 A;  5C3W A;  3AFP A;  4ZRZ A;  5EPJ A;  2WB1 B;  4A3K H;  4A3L G;  1F2L A;  2RF4 A;  4DK6 C;  1N33 Q;  4GKJ Q;  1XNQ Q;  4A3M H;  2EXZ A;  2RHS B;  1LLR D;  1G29 1;  4QIW B;  4X64 Q;  5CBE E;  3I73 A;  3K0Y A;  5J1Z A;  3K81 C;  2RHQ B;  3F2C A;  1Q86 C;  5FO7 B;  4I7Z C;  1STE A;  3BZK A;  3FPP A;  1AN8 A;  1GVP A;  3SK6 A;  1S5F D;  3K6O A;  5FLX L;  3RR5 A;  3RN5 A;  3D8G A;  4L8J A;  1X3G A;  1GHJ A;  5BN3 A;  3VYU A;  2RDF A;  4CDE C;  3OMC A;  4HED A;  4K5V A;  2C5C A;  3L2P A;  1OXU A;  1V8Q A;  2PNR C;  4BBS B;  3S1Q H;  1E24 A;  1LUZ A;  2EVB A;  4O2D A;  4IPD A;  1PRT D;  4DNI A;  4P71 A;  3CMA A;  4LF9 Q;  3Q23 A;  1TWF H;  5IYC H;  1HPC A;  1O78 A;  4IFD I;  3M4O H;  4A3C G;  2K5D A;  5ELB A;  3RLF A;  3JAM E;  2I07 B;  4R4T A;  3HOW H;  2PYK A;  4QIW E;  5JJK A;  1FGB D;  2F0S A;  2E2D C;  1VQ7 A;  2NZH A;  1I50 H;  1G51 A;  4A3G H;  2DJG C;  2B3G A;  4LFB Q;  1SNO A;  3I4O A;  4X3K A;  1SJH D;  1GUG A;  1RTO A;  1WJJ A;  3MXG A;  3NEL A;  5GAH C;  3K57 A;  4LF7 L;  4C3I B;  5EJW A;  4C3J H;  5C4J H;  2IY5 B;  3HOW B;  3TZD A;  1SYE A;  1VS0 A;  3G48 A;  1IW7 C;  2QEJ C;  2QDL A;  3KF8 A;  3CCR A;  1JJC B;  5T1I A;  1L0Y B;  5LMU Q;  4BA2 I;  4ZLT F;  5J22 A;  4YY3 Q;  1KQS A;  1GD7 A;  3NQT A;  2IX1 A;  4XT3 B;  1Q90 A;  4Y7N B;  1ICW A;  1SYB A;  2TSS A;  3NXW A;  4R8I A;  2KUM A;  3PCO B;  1TWH B;  2K52 A;  2N55 A;  3S15 H;  3DUZ A;  1EY7 A;  4ZUI A;  3NEN A;  4IUT A;  1STN A;  1F9Q A;  4DFA A;  4DR7 L;  1VDZ A;  1QVC A;  4Q0F A;  3GTG H;  1EY4 A;  3QO2 A;  4X62 Q;  3K5O A;  4Y52 H;  1GXD C;  3HKZ B;  3M4Y A;  4C1N I;  4OX9 Q;  4EQO A;  4JYA L;  4Y7N H;  4C3J G;  2J4X A;  2K4K A;  4JI4 L;  1E2V A;  2EE1 A;  2JEA I;  3E3X A;  1VQF A;  1DON A;  1RDP D;  3A56 A;  1ENF A;  1YBY A;  3Q0A A;  2BH8 A;  3W3A A;  3GD7 A;  4IPC A;  3MXP A;  4IPH A;  3LWU A;  2PZW A;  4X66 L;  4F88 A;  3RUZ A;  4DAM A;  3RNU A;  1D1I A;  4A75 A;  3TP7 A;  1C7Y A;  4KKU A;  2B2V C;  4KJO A;  1W2B A;  3CCQ A;  3NEM A;  3E5S A;  1AEX A;  1I50 B;  4ABN A;  1NUC A;  5E4W C;  4LFC Q;  5EGT A;  2R7Z B;  3S1R B;  2IL8 A;  4FXK C;  1TS4 A;  4QUF A;  1CA6 A;  2X6L A;  1YVC A;  1CKO A;  3Q24 A;  1KL9 A;  5EBD A;  5IGC A;  1YIT A;  5E1F A;  2E2I B;  3EJI A;  1DD2 A;  1D2B A;  2ZTE A;  1J6Q A;  1DM0 B;  4XYO A;  1UUP A;  3SE0 A;  3PIP A;  1I4R A;  5BN5 A;  1X55 A;  2ICE C;  1KD1 C;  3WOF A;  3KLW A;  4JI2 L;  1PTO F;  5HGT A;  1WFQ A;  1YEZ A;  3T1Y L;  3AU7 A;  3VYT A;  4DV3 L;  4KJN A;  3QOJ A;  3KYH C;  3K5L A;  3VR3 A;  3PV0 A;  4JI0 Q;  1SRU A;  3A5U A;  2NN6 G;  2F0T A;  3NWT A;  2SEB D;  2D0P A;  3MA2 B;  3HOU B;  2KA7 A;  3J7A F;  2Z8L A;  2Q8T A;  4PZ6 A;  4A3I G;  5IGB A;  1HZA A;  1NSN S;  1YNJ C;  2KVM A;  2UUB Q;  5IYD G;  4YCU A;  4LK1 C;  4HIK A;  1C9O A;  5IOC A;  4TSS A;  2XSC A;  2HQE A;  2EJG C;  4JPB W;  2HHH Q;  5C5L A;  1XPU A;  4JK1 C;  3P20 A;  3E9I A;  4RG1 A;  4XIG S;  3RZD B;  4RFB A;  3BU2 A;  4OWW B;  5NUC A;  1BBX C;  3M4O B;  2XGT A;  4KK7 A;  2NVX B;  4XDX A;  1O7L A;  2IT1 A;  1PH5 A;  4LFA L;  1TWA B;  4R1J A;  2H5X A;  3R8B A;  3HZX A;  4BY7 G;  1LAC A;  1BBU A;  2BE5 C;  1PH8 A;  2B8F A;  1T5X D;  1GUS A;  1HA5 A;  4JI1 Q;  1LTS D;  1J9O A;  2KCN A;  5KNC A;  4GN3 B;  2HD3 A;  4DXF A;  3PO2 H;  2CH4 W;  4QUC A;  4IQZ A;  4GKK Q;  4UAI A;  4B3R L;  1B50 A;  2UU9 Q;  3PUV A;  2XNA C;  2GN5 A;  4B3R Q;  3H94 A;  4QMG A;  4P74 A;  1X56 A;  3I90 A;  1VQO A;  1BQQ T;  1MSG A;  5C44 G;  4LF4 L;  3ICE A;  5FLX E;  3PSI A;  1L1O A;  1F9S A;  2D2C C;  2PZU A;  3AEV A;  4HJA A;  1JE5 A;  2AQ2 B;  5EKL A;  1NJI C;  4BXX G;  2Z6K A;  1A3V A;  4CJ2 C;  4X65 L;  2ASB A;  2ZJQ A;  4TRD A;  1Y1V G;  4AH6 A;  1SAP A;  2E2J H;  1VMC A;  1IBM Q;  1YJW A;  1VQG A;  2I0Q A;  4WRD A;  3F1Z A;  1LTR D;  1EL0 A;  3PUZ A;  4A3F G;  4MTK A;  2F3V A;  3MXN A;  1GOZ A;  2DGY A;  1EEI D;  3HG9 A;  2LXJ A;  1XNR L;  4RCO A;  4OO1 H;  1KDC A;  3S17 H;  1CFM A;  2ICI A;  1TVX A;  1JOQ A;  4RGN A;  4IUN A;  3HRZ C;  3J7Y W;  1BVS A;  1JWS D;  3D31 A;  4LUZ A;  1L0X B;  1M90 C;  2L1B A;  4JI6 Q;  2QEX A;  1N32 L;  1FD7 D;  2Z1C A;  3TP8 A;  5I2X A;  1Z9F A;  3L3O C;  3G6E A;  4QJF A;  2SNS A;  3KF8 B;  2ATW A;  3NHH A;  2R93 B;  3CC4 A;  3BYT B;  1H9S B;  1HZC A;  4QY7 A;  2R92 G;  5ELC A;  1HR0 L;  2HQL A;  4YIJ A;  3QIA A;  4B9X A;  1G91 A;  1H9J A;  4JI2 Q;  1JOR A; 
#chains in the Genus database with same CATH homology
 2EY6 A;  1YNJ D;  4J1M A;  3GV6 A;  1AZP A;  2E74 C;  1U9R A;  1AZQ A;  5T1G A;  4DF7 A;  1IHZ A;  1D1K A;  5FO8 B;  3KLR A;  4K14 A;  3BDO A;  1D6E C;  4BA1 I;  4PQX A;  2HDM A;  3R2I A;  4J8Q A;  3NE5 B;  2JA5 B;  1V1P B;  4ZYS A;  1OXS C;  1PTO B;  3FRP B;  2LS0 1;  5CYU A;  1WTR A;  5DM7 3;  5C4X B;  2B2Y A;  1C48 A;  2L5T A;  3I8Z A;  5C4H A;  1S5C D;  1TWG B;  1WCM B;  5EBC A;  4K8I A;  3SHL A;  5CBA E;  3NTK A;  3C1E A;  2PZT A;  4HR7 B;  2MGS A;  3A7A B;  5E3F A;  5M3F B;  4G57 A;  5I6Y A;  3HP3 A;  1BF4 A;  2R6G A;  2YYZ A;  1E2Z A;  1EFI D;  1LTT D;  5KND A;  4EVO A;  2Q8I B;  5M5W B;  2I46 A;  1KLU D;  1F2Y A;  4XT1 B;  1BOS A;  1W6K A;  4CGY B;  1QE6 A;  4RGT A;  2E76 C;  1LTB D;  2E2H B;  1BXT A;  5TSS A;  3K58 A;  3QWN A;  5CC4 A;  4H7B A;  1LTI D;  5LL6 S;  1X3P A;  2A69 D;  2L11 A;  1VF7 A;  3FMC A;  2EY1 A;  3U9O A;  5C4J B;  4BY1 B;  1XTC D;  3A8K E;  4HN7 A;  2B63 B;  1TT2 A;  1RCV D;  3BVG A;  1S5D D;  2SOB A;  1U4P A;  2MUY A;  1M4V A;  3MC0 B;  5JJZ A;  4KY6 A;  1EU3 A;  3X3N A;  2D5D A;  3DWP A;  4K6D A;  2K05 A;  2QIL A;  2FFK B;  1Q3L A;  1GUW A;  1SYC A;  1LT3 D;  1STH A;  1JE4 A;  2TMP A;  2ZT9 C;  1IYU A;  2F0F A;  4KD3 A;  3QOL A;  4ZKC B;  3A55 A;  2NN6 H;  3OWF A;  3ZYY X;  2HCC A;  4C56 C;  1F2M A;  5A2Q L;  3MFG A;  1U4L A;  2A5H A;  3BYY B;  4KV6 A;  4K8J A;  2B2T C;  1UAP A;  4RHS A;  4M8A A;  1GUO A;  1F9P A;  1T5E A;  3HOX B;  2F0U A;  1TS2 A;  1X3Q A;  1ILP A;  3IL8 A;  2VB3 X;  2EYP A;  2JXM B;  1ET6 A;  2AUJ D;  3GTK B;  2NVY B;  3TP5 A;  1Y1V B;  1PRT C;  2JA6 B;  2WII B;  4A3E B;  5DM6 3;  2K01 A;  1B4O A;  2Z4H A;  3HOY B;  3J81 E;  3SDZ A;  2MHV A;  1SNC A;  4IFD G;  4KY7 A;  2F0V A;  2K1B A;  3IKJ A;  3SR1 A;  1KAA A;  5JAV A;  3VYR A;  3H6M A;  2V4D A;  1G8Z D;  1PLF A;  4Q5V A;  1SYG A;  1NR2 A;  1XYI A;  2KJX A;  2BDO A;  2RDH A;  3RMH A;  4EGV A;  2K5W A;  3E6Z X;  2EZV A;  4OGQ C;  3CKI B;  1Y69 U;  2L0C A;  1R4P B;  1HTL D;  3GP7 A;  3VYS A;  4FVM A;  3VA5 A;  4KTA A;  1SE4 A;  2NN6 I;  1WTO A;  3OWE B;  4K6L A;  1GHK A;  1FNU A;  5JEA G;  2F0N A;  3AB9 A;  2XN9 C;  4IFD H;  5M5X B;  3TDQ A;  1M8A A;  2FMC A;  4DA2 A;  1BR9 A;  1FNV A;  1WVL A;  3UI2 A;  4EQN A;  2WIN B;  3G6J B;  3WOE A;  4NDX A;  3CRK C;  2HDL A;  1SMY C;  4CKB A;  1EEF D;  3H91 A;  3C1F A;  1U4R A;  4A3D B;  1S5E D;  4A3G B;  1MBY A;  3OSO A;  1EU4 A;  2PQE A;  1EWH A;  1STB A;  1ZYR C;  1HUN A;  2O4X A;  1CZG A;  2RQX A;  2F0J A;  3GV3 A;  3OOC A;  4DXG A;  2K7V A;  4WFN 3;  5KRU A;  3GTO B;  4IUQ A;  2WV6 D;  1ONL A;  3URY A;  1HUM A;  3N6R A;  4RWS C;  2FMM A;  1C8C A;  3ERO A;  4CBV A;  4FF1 A;  1JIC A;  1B1Z A;  2FHT A;  4B08 A;  1PMR A;  2KEE A;  4LJZ C;  3V05 A;  3D4W A;  2B2U A;  1PRT B;  1WTP A;  2JEB I;  5CV5 A;  1BCP F;  5CGK A;  4HAE A;  2K28 A;  2F1M A;  4FP5 D;  4IN3 A;  4G7Z C;  2R3Z A;  2ENB A;  3SK5 A;  3E0J A;  1JB3 A;  4FXG C;  4IZ8 A;  4C3H B;  4ZKB B;  3TN2 A;  3K5N A;  1QWY A;  4OHJ A;  2F0I A;  4ILW A;  3S1N B;  1QNU A;  2A6H D;  5KYI A;  3PO2 B;  2EOT A;  1DCZ A;  3S1M B;  5K36 G;  4C2M B;  2JSO A;  3FVQ A;  3OIQ A;  1OXX K;  3F2U A;  1A3U A;  1AP0 A;  2C9O A;  1JQY D;  2IJ0 A;  2RBM A;  1KNA A;  3J81 L;  5KIX A;  1TWC B;  2DNC A;  3T51 B;  2HCI A;  1II3 A;  1B9N A;  1FR3 A;  2F0P A;  1SBB B;  2AQ1 B;  1RTN A;  3P75 A;  3V96 A;  2BOS A;  1H9S A;  2B2T A;  1BDO A;  3DEP A;  3CQZ B;  2O2L D;  5KEE A;  2VB2 X;  2PMZ B;  1DZ1 A;  4CHT B;  3DXJ C;  3EVQ A;  3NP8 A;  1ROD A;  2B2V A;  4PMB A;  1TII D;  3HOZ B;  4FNF A;  5JVH 3;  1OXT A;  1I4Q A;  1G2T A;  1BCP D;  4ZQ3 A;  3D6W A;  3QJY A;  1JR0 D;  2NZ1 D;  3I72 A;  1DJR D;  3PUX A;  4C3H G;  2M2L A;  1TY2 A;  2BDN A;  2LMC B;  1E0B A;  1CTM A;  1HQR D;  1X32 A;  4QCL A;  5C0X I;  1ET9 A;  2N88 A;  3MFY A;  1STA A;  4RAU C;  1J8I A;  4OIK A;  5G3L D;  5D3I B;  4NMZ A;  3R3O A;  4HMJ A;  2H1E A;  1V1O A;  2K03 A;  5JEA J;  1Z6H A;  2ZXR A;  3NWS A;  1CZW A;  1V43 A;  1CK1 A;  1PYW D;  1E2W A;  3A8J E;  4KI0 A;  2EYO A;  1LT4 D;  1JCK B;  2QKI C;  1STY A;  1OXV A;  4A93 B;  2XIW A;  2E75 C;  1DOL A;  1TU2 B;  4IAL A;  3L7Z C;  1STG A;  4U68 A;  3D4R A;  5CV6 A;  2A68 D;  3S2D B;  2PPB C;  1RJT A;  1UNS A;  1JOK A;  2SDF A;  5C6A A;  2F0M A;  3FKI B;  1ENC A;  4G7H C;  4I65 A;  3H3V C;  1ILQ A;  2FIN B;  3KLS X;  1OO9 B;  2JE6 I;  4QF4 A;  1I3Q B;  3SXH A;  1Q8I A;  1K8O A;  4XQQ A;  1BCP B;  3OMG A;  3IAY A;  2AWO A;  5EPK A;  2D9U A;  3S14 B;  5IOD A;  4DK0 A;  1XWE A;  1SNM A;  4S3S A;  4PV1 C;  5JPM C;  2CHB D;  2VUM B;  2B2U C;  5IT9 E;  3EQL C;  3GQB A;  4U67 3;  1CHQ D;  1EY9 A;  4QB4 A;  2EY2 A;  5F2D A;  3U9S A;  4IFD J;  1DYQ A;  4DNR B;  3I3C A;  5I6W A;  2WP8 J;  4RA8 A;  2BA1 A;  3S2H B;  1B44 D;  2EYJ A;  2B2W C;  1ESF A;  2ZXO A;  1G6Z A;  3A54 A;  4A3K B;  2RA4 A;  2CQA A;  2OT2 A;  4V19 0;  5FKA C;  3TME A;  1I6H B;  3S17 B;  1WTW A;  2F0E A;  3MWY W;  4H0L C;  4KMU C;  4A3M B;  2X69 A;  4WJW A;  2R92 B;  1IL8 A;  1EYC A;  2DNE A;  3BZD B;  3GTP B;  2MPM A;  5D14 A;  4ZK9 B;  4KHV A;  3T13 A;  4FF4 A;  3C2P A;  4DU9 A;  2NTS A;  1IKL A;  2EYF A;  3NTI A;  3W2D A;  3DWQ A;  2F0K A;  1EQT A;  2LKV A;  2RDG A;  4RGO S;  4DAY A;  1BUV T;  2XWJ B;  2O5J C;  3V2T A;  2YU9 B;  2LY7 A;  5CMD A;  3BG3 A;  1PFN A;  3DM1 A;  3KLS A;  2M9V A;  4C3I G;  5ELF A;  3MZ5 A;  4MIU A;  2RKS A;  2L55 A;  1WTX A;  2O5I C;  4A3I B;  1KNE A;  2ID0 A;  1F2Z A;  1PFM A;  3PIP 3;  4K5X A;  3O13 A;  5EKK A;  5KGU A;  1HQM C;  1KDA A;  5EPL A;  1QCB D;  2F0D A;  3MXU A;  3QG1 A;  1PXU A;  2KEC A;  4BY7 B;  2F03 A;  1LTG D;  3DWA A;  1K83 B;  4BS9 A;  3BDC A;  2G9H D;  4CJ0 B;  2BE5 D;  1HA6 A;  5C5M A;  3MAQ A;  3HEJ A;  1V1P A;  5KNB A;  1EZ8 A;  1SMY D;  2RSO A;  3HS0 C;  2A68 C;  1S4Z A;  2PCF B;  1A2T A;  4RH6 A;  3FPU B;  1PTO H;  1ENA A;  4KY5 A;  2MP1 A;  3WDN A;  1IW7 D;  1QOH A;  3OIP A;  3J80 L;  2A6E C;  5C3E B;  5C0X H;  1PTO C;  2RSN A;  4KD4 A;  1LT5 D;  2F0G A;  3S9W A;  1ML0 D;  5I9P A;  1TQO A;  1I4P A;  3S15 B;  1LTA D;  1VF5 C;  2K04 A;  2FJ2 A;  1CI3 M;  3LX0 A;  1EIH A;  2KED A;  2G9D A;  5LHY 1;  4X3U A;  3HOV B;  5IGD A;  1EQV A;  4CJ1 B;  4BWG B;  3G7L A;  1TY0 A;  5C3X A;  1FNW A;  4RKL A;  1YNN C;  1B3A A;  4EQP A;  3EFX D;  1JOO A;  5IGG A;  3VR5 A;  3A8I E;  2DY8 A;  2Q8R E;  5DEH A;  2RVL A;  1I4G A;  1RHP A;  3CHB D;  1LT6 D;  3D3R A;  4WOR A;  2NWG A;  4DAV A;  1SFO B;  4RHR A;  3VR2 A;  1CHP D;  2WKC A;  2B2W A;  2QF7 A;  1RF2 D;  1CA5 A;  4XQN A;  4LAA A;  4OO1 G;  1RD9 D;  3RZO B;  1TS3 A;  1GUT A;  1O7Z A;  2EYL A;  1UEA B;  2EJF C;  5A2Q E;  3OW7 A;  2F0O A;  2GA4 B;  2AUK A;  2NYZ D;  4HSV A;  4G7O C;  2IPK D;  3GTL B;  5C4Z A;  3I4N B;  4UDU C;  2XVS A;  1VMP A;  1EY6 A;  2EPB A;  3AMU A;  3OHX C;  3VR4 A;  1TWF B;  3Q6S A;  3TP6 A;  3PIO 3;  3PO3 B;  2AQ3 B;  2A69 C;  5M9O A;  1A2U A;  2H4O A;  4C3J B;  4PMW A;  2OEO A;  2BCO A;  2EDG A;  4RCN A;  3DHQ A;  1GJX A;  1Q1B A;  3SK4 A;  1R9T B;  4ME5 A;  3I4M B;  3C3L A;  1DOM A;  4V0B A;  1A6X A;  1QIL A;  2B39 A;  2JP1 A;  1EOT A;  1R4Q B;  5DAU A;  3K5M A;  4PMC A;  2CVR A;  3ITP A;  2IW3 A;  1Z7T A;  4A3B B;  4B9W A;  2E2J B;  1SEB D;  3EA6 A;  3KK7 A;  5FO9 B;  1I4X A;  3GTQ B;  1Q12 A;  2IX3 A;  4R9W A;  3HGB A;  1A3T A;  4DK1 A;  1ZYR D;  1Y8N B;  5COR A;  1AW7 A;  3QB3 A;  1JC7 A;  3K7A B;  3GTJ B;  1SYD A;  4A3J B;  3ND8 A;  1Y1W B;  3S1Q B;  3N52 A;  3BVM A;  4Z9C B;  3K59 A;  4ULL A;  1XX8 A;  4X3T A;  1QG7 A;  4G4K A;  1HXY D;  3FDT A;  1BNZ A;  2JA7 B;  1F9R A;  2L9H A;  1HTP A;  4OO1 I;  1B53 A;  5CV8 A;  1TR5 A;  4XTC S;  3PMF A;  4HMI A;  2F4I A;  2PW7 A;  3M7N A;  3KUP A;  4IUV A;  5FOB B;  1CT1 D;  1D5X C;  2KQ3 A;  2L12 A;  3TBI B;  1ESR A;  2Y0S B;  4PNY A;  1CQV A;  4F87 A;  3RD4 A;  1HFG A;  2QCP X;  3D6C A;  2WAC A;  1SJE D;  2NVQ B;  3OPO A;  2OF1 A;  4IUP A;  1H9R A;  1WTQ A;  2VNU D;  1ZXT A;  4LMQ D;  1MSH A;  2KHS A;  1VCI A;  5IIF A;  1Z47 A;  3M85 A;  5E4X A;  1EWC A;  2J0T D;  5JVG 3;  4NP5 A;  2MJ8 A;  1I6V C;  1PTO D;  2HUG A;  4K2K A;  1LV9 A;  5G3L F;  2ZXP A;  4NKL A;  1CQF A;  1PZI D;  4X3S A;  2WKD A;  1EYA A;  5CV4 A;  1DXM A;  5IGE A;  3BDL A;  5D65 A;  3FEW X;  4IUR A;  3CRL C;  4H13 C;  4MN3 A;  1CM9 A;  2KOL A;  2PO4 A;  3LNN A;  4P2C B;  5FK9 C;  2AWN A;  4KN7 C;  1SE2 A;  2JYO A;  4FYD A;  3P7J A;  3PUW A;  5DNF A;  1PZK D;  4FF3 A;  3I4L A;  3R2T A;  1LO5 D;  2IX0 A;  2F0Q A;  2WAQ B;  1PDQ A;  4XQJ A;  4TQU S;  5D3D A;  1A15 A;  1B9M A;  3IFT A;  5HUR A;  3DMU A;  3PUY A;  2F0H A;  1LAB A;  2SNM A;  4H44 C;  5CR3 A;  1PZJ D;  4K5W A;  2X6G A;  2NTT A;  5C44 B;  3J80 E;  5AFW A;  4ZAI A;  3DEO A;  5K36 H;  1IKM A;  5COY A;  1MI2 A;  4FXD A;  2NVT B;  2XRS D;  3NBH A;  2K32 A;  2L4N A;  1W6J A;  1HFN A;  3NSW A;  1C4Q A;  3MEH A;  2OXP A;  5LL6 X;  4C1N K;  4OL7 A;  1F77 A;  5ELE A;  2J7Z A;  3BVZ A;  3KBX A;  1GUN A;  1EZ6 A;  4K2L A;  4ZUJ A;  1QJO A;  5JOB A;  2VXW A;  4KHZ A;  1JWM D;  5KYL A;  3BS1 A;  2D62 A;  4J6H A;  2EYM A;  5M3M B;  1KDB A;  1SNP A;  1ZEQ X;  1PFB A;  4L6T B;  3MVV A;  1H9M A;  4RGM A;  1HRJ A;  1SE3 A;  1BCP C;  2NBF A;  4DN4 M;  4DNT B;  1O80 A;  2EYH A;  1SNQ A;  2A73 B;  1S5B D;  1D5Z C;  1DOK A;  5JEA H;  1WD0 A;  1BO0 A;  3NBI A;  2A74 C;  4ODG A;  2B2Y C;  2R61 A;  2M00 A;  4ID6 A;  4N9P A;  5IT9 L;  1SND A;  3M7G A;  2K33 A;  4BBR B;  4FF2 A;  3NK9 A;  1KLG D;  4NW2 A;  3T56 B;  1Y8P B;  4TKO B;  4AYB B;  1KAB A;  3TZU A;  2CW0 C;  1EY5 A;  3ERQ A;  5ISR A;  1TKW B;  2XWB B;  1EIG A;  3R93 A;  5J39 A;  3IFD A;  3NPP A;  2PW5 A;  3NQI A;  2EJM A;  4KKT A;  4L63 B;  4RKB A;  1O7Y A;  2JA8 B;  1K8M A;  3GTM B;  4CKC A;  4HCS A;  1SSO A;  4HSP A;  3KBG A;  4XXE A;  3LWE A;  3X3M A;  2K6A A;  3T16 A;  1TS5 A;  1SXT A;  3TSS A;  2BA0 A;  4O42 A;  3SEB A;  4DAP A;  2LFN A;  1XXG A;  3CU7 A;  5EQ0 A;  3MHB A;  4O1N A;  5K5P A;  2A6H C;  3SK8 A;  4F7X A;  5C0X G;  1ZKO A;  3NTH A;  4F8M A;  4FO2 A;  1EY8 A;  1NAP A;  2NB0 A;  1IYV A;  4JBW A;  4E6I A;  3JAM L;  4HTH A;  5I9O A;  3M3Y B;  1Y8O B;  3VR6 A;  4R8N A;  1SDF A;  2F0W A;  2IWH A;  1MD2 D;  4A3F B;  3T53 B;  3P1H A;  5I2Y A;  1MGS A;  5EKI A;  5BN4 A;  1JWU D;  1Q1E A;  3I70 A;  2F0L A;  3A7L A;  3ONA B;  2A6E D;  3SVM A;  4HCE A;  4GZY C;  1QB5 D;  5M5Y B;  1YNN D;  1HCZ A;  1G2S A;  3NUC A;  1B2T A;  3ND9 A;  2DN8 A;  5IGF A;  5I4D A;  1SYF A;  4OIJ A;  3T4A C;  3GTG B;  1FYC A;  2Z4I A;  2F3W A;  1HHV A;  4N9T A;  1WD1 A;  3H0G B;  1EY0 A;  1I4H A;  1NR4 A;  3GO5 A;  5CV9 A;  4KN4 C;  3VA7 A;  3Q22 A;  1H9K A;  1NCV A;  1QNK A;  3I91 A;  4M1U B;  5JPN C;  1U4M A;  4CKE A;  2K5Q A;  3S16 B;  1RKN A;  4IUU A;  2CW0 D;  3J7A V;  5C0X J;  4XYQ A;  3D4D A;  2B8G A;  2QDB A;  1KTK A;  5CV7 A;  4MHE A;  1D5M C;  3MTS A;  2NUC A;  5ELD A;  1EYD A;  1AFP A;  3H09 A;  2EY5 A;  1WTV A;  1PRT F;  2XRQ D;  2DY7 A;  2KCC A;  3C46 A;  3L9A X;  4KKS A;  4DGZ A;  5A35 A;  5C3W A;  4ZRZ A;  5EPJ A;  2WB1 B;  1F2L A;  2EXZ A;  1LLR D;  1G29 1;  4QIW B;  5CBE E;  3I73 A;  3K0Y A;  5J1Z A;  5FO7 B;  4I7Z C;  1STE A;  3FPP A;  1AN8 A;  5FLX L;  3SK6 A;  1S5F D;  3K6O A;  3D8G A;  4L8J A;  1GHJ A;  5BN3 A;  3VYU A;  2RDF A;  3OMC A;  4HED A;  4K5V A;  2C5C A;  1OXU A;  1V8Q A;  2PNR C;  4BBS B;  2EVB A;  1PRT D;  3Q23 A;  1HPC A;  1O78 A;  4IFD I;  2K5D A;  5ELB A;  3RLF A;  3JAM E;  2I07 B;  2PYK A;  1FGB D;  2F0S A;  2E2D C;  1SNO A;  4X3K A;  1SJH D;  1GUG A;  1RTO A;  3MXG A;  3K57 A;  4C3I B;  5EJW A;  3HOW B;  3TZD A;  1SYE A;  1IW7 C;  2QEJ C;  3KF8 A;  5T1I A;  1L0Y B;  4BA2 I;  4ZLT F;  5J22 A;  3NQT A;  2IX1 A;  4Y7N B;  1Q90 A;  4XT3 B;  1ICW A;  1SYB A;  2TSS A;  4R8I A;  3NXW A;  2KUM A;  1TWH B;  2N55 A;  3DUZ A;  1EY7 A;  4ZUI A;  4IUT A;  1STN A;  1F9Q A;  4DFA A;  1VDZ A;  4Q0F A;  1EY4 A;  3QO2 A;  3K5O A;  1GXD C;  3HKZ B;  3M4Y A;  4C1N I;  4EQO A;  4C3J G;  2J4X A;  1E2V A;  2EE1 A;  2JEA I;  1DON A;  1RDP D;  3A56 A;  1ENF A;  3Q0A A;  3W3A A;  3GD7 A;  3MXP A;  3LWU A;  2PZW A;  4F88 A;  3RUZ A;  1D1I A;  3TP7 A;  4KKU A;  2B2V C;  4KJO A;  3E5S A;  1AEX A;  1I50 B;  4ABN A;  1NUC A;  5E4W C;  5EGT A;  2R7Z B;  3S1R B;  2IL8 A;  4FXK C;  1TS4 A;  4QUF A;  1CA6 A;  2X6L A;  3Q24 A;  5EBD A;  5IGC A;  2E2I B;  5E1F A;  1DD2 A;  3EJI A;  1D2B A;  1DM0 B;  4XYO A;  1UUP A;  3SE0 A;  1I4R A;  5BN5 A;  2ICE C;  3WOF A;  1PTO F;  5HGT A;  3AU7 A;  3VYT A;  4KJN A;  3QOJ A;  3K5L A;  3VR3 A;  3PV0 A;  2NN6 G;  2F0T A;  3NWT A;  2SEB D;  3MA2 B;  3HOU B;  2KA7 A;  3J7A F;  2Z8L A;  2Q8T A;  5IGB A;  1NSN S;  1YNJ C;  2KVM A;  4LK1 C;  5IOC A;  4TSS A;  2XSC A;  2HQE A;  2EJG C;  5C5L A;  4JK1 C;  3P20 A;  4XIG S;  3RZD B;  4RFB A;  5NUC A;  1BBX C;  3M4O B;  4KK7 A;  2NVX B;  4XDX A;  1O7L A;  2IT1 A;  1TWA B;  3R8B A;  3HZX A;  1LAC A;  2BE5 C;  2B8F A;  1T5X D;  1GUS A;  1HA5 A;  1LTS D;  1J9O A;  2KCN A;  5KNC A;  4DXF A;  4QUC A;  4IQZ A;  4UAI A;  1B50 A;  3PUV A;  2XNA C;  3H94 A;  4QMG A;  3I90 A;  1BQQ T;  1MSG A;  5FLX E;  1F9S A;  2D2C C;  2PZU A;  2AQ2 B;  5EKL A;  1A3V A;  4CJ2 C;  4TRD A;  1SAP A;  1VMC A;  4WRD A;  1LTR D;  1EL0 A;  3PUZ A;  2F3V A;  3MXN A;  1GOZ A;  1EEI D;  3HG9 A;  4RCO A;  4OO1 H;  1KDC A;  1CFM A;  2ICI A;  1TVX A;  1JOQ A;  4RGN A;  4IUN A;  3HRZ C;  3J7Y W;  1JWS D;  3D31 A;  1L0X B;  2L1B A;  1FD7 D;  2Z1C A;  3TP8 A;  5I2X A;  3L3O C;  2SNS A;  3NHH A;  2R93 B;  3BYT B;  1H9S B;  5ELC A;  4B9X A;  4YIJ A;  3QIA A;  1G91 A;  1H9J A;  1JOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...