3MHBA

Crystal structure of staphylococcal nuclease variant delta+phs l38a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mhbA00
5CV5A 3C1EA 3C1FA 3TP6A 4TRDA 2F0FA 3T16A 3NQTA 4R8NA 1F2MA 1KABA 2OF1A 3MHBA 4KY6A 4QB4A 5CV8A 1SNPA 1EY9A 1STYA 3TP8A 3SK5A 3T13A 2NUCA 3MZ5A 5I6YA 2F0TA 3MVVA 2F0QA 2KQ3A 4LAAA 5DEHA 1STHA 2F0IA 5E3FA 3S9WA 2PW7A 1RKNA 4ODGA 4RKLA 4KY7A 2WACA 2F0EA 1II3A 4EQOA 1A2TA 3HZXA 4HTHA 5CV7A 2PW5A 3NP8A 3NK9A 5CGKA 1ENCA 1KDCA 5KGUA 2EXZA 1NUCA 4ZQ3A 4WORA 5NUCA 1KDAA 4KY5A 2SOBA 3VA5A 3BDLA 3OMGA 4NMZA 4KTAA 5J22A 1U9RA 1EY0A 2QDBA 3D4WA 1EYCA 2EY5A 2F0SA 2OXPA 4J6HA 5IGBA 1STNA 5I6WA 2F0NA 1SYFA 4G57A 1EYDA 3OMCA 3P1HA 5ISRA 1EYAA 1STBA 5CR3A 3SK6A 5IGCA 4EQPA 2F0HA 2EYJA 1EQVA 1SYDA 2F0DA 3EROA 3EVQA 4B9XA 2PYKA 1TT2A 3DMUA 4PMCA 4EQNA 5HGTA 4ME5A 5KIXA 1AEXA 2F0JA 4QMGA 2EYFA 4PNYA 5CV6A 2PZUA 4KV6A 1A3VA 1SNOA 2HQEA 3U9OA 1JORA 1SNDA 3QB3A 5IIFA 1JOKA 5IGGA 5IGEA 2SNSA 5CV9A 5EKKA 2EY6A 2EYOA 4NKLA 4K14A 5HURA 3D4DA 4IUNA 2O4XA 3PMFA 3HEJA 3H6MA 4YIJA 1KAAA 2F0WA 2F0UA 2F3WA 1EY5A 2F3VA 4WRDA 5C5MA 1KDBA 2M00A 2EYPA 4NP5A 3TMEA 3V2TA 1A3UA 2KHSA 4B9WA 3E5SA 5M9OA 4I65A 1EY7A 1STAA 2F0LA 3DHQA 4OL7A 4KJNA 4N9TA 2F0VA 2EYLA 4IALA 3LX0A 4HMIA 4K5XA 4K5VA 1STGA 4ZUJA 3TP7A 4PMBA 1SYEA 4K8JA 5C3XA 4ID6A 1A3TA 2F0KA 1SNCA 5JOBA 1TR5A 3NXWA 2LKVA 1ENAA 2EY1A 1NSNS 4QF4A 5JAVA 5F2DA 2EY2A 3SK4A 5KYIA 2EYHA 5KEEA 4EVOA 3RUZA 5C6AA 4DGZA 4NDXA 4F8MA 4K5WA 3BDCA 1F2ZA 3NUCA 1SNMA 1EZ8A 2EYMA 2F0PA 2SNMA 4KD4A 5IOCA 1SYGA 2F0MA 2RKSA 4K8IA 5C4ZA 5K5PA 3MEHA 5E1FA 4DFAA 3D8GA 5J39A 1JOQA 4DU9A 5I9PA 5KRUA 3MXPA 5C3WA 2F0GA 3TP5A 2PZWA 1SYCA 1A2UA 5I9OA 4MIUA 5J1ZA 4H7BA 5IODA 5C5LA 5DAUA 3SR1A 5KYLA 4N9PA 4HMJA 1EY4A 2OEOA 3SK8A 3OWFA 4F7XA 3SHLA 4J1MA 4K6DA 3P75A 4RKBA 1EZ6A 1EY6A 4ZUIA 4KD3A 3R3OA 4S3SA 1SNQA 2PZTA 3D6CA 4KHVA 5CC4A 1F2YA 4K2LA 2PQEA 1SYBA 5EGTA 4DF7A 3QOJA 4K2KA 2RBMA 1IHZA 3OSOA 5CV4A 3EJIA 4E6IA 3ITPA 2F0OA 5C4HA 3QOLA 1TQOA 5IGDA 5IGFA 2RDFA 2ENBA 3SXHA 3ERQA 3NHHA 4IZ8A 5EKLA 4KJOA 1JOOA 1EY8A
chains in the Genus database with same CATH superfamily
1DONA 3CHBD 3R2TA 1GUNA 1OXVA 1QOHA 4DR7L 4M1UB 2OF1A 3PO3B 2ALYB 2YU9H 1SE2A 3I2ZA 4B3TL 3S1QH 3M4OB 2R93H 3IFTA 1STYA 3SK5A 1OXUA 3I7FA 4C3IG 4M8AA 1HXYD 2WACA 3L9AX 4KHPL 2EXDA 3GTQB 3Q0AA 5CBAE 1EQRA 4A3KH 3S1MH 2Q8TA 1I4RA 1B3AA 1IYUA 2UUAL 1VQNA 5M5YB 4K0KL 3J81j 3HKSA 1K9MC 3BVMA 4JBKA 4RAUC 1PLFA 1LLRD 3DWAA 4LNQA 2F0HA 1EQVA 2F0DA 4AYBG 5C4XH 4POGA 2PYKA 1K0RA 1ML0D 3U9SA 4O1NA 3FEWX 1CA5A 1CZGA 4DV3Q 3NTIA 4HSPA 5CV9A 4HJAA 4IUNA 5EAYA 1YNJD 4X64L 3C3LA 1STEA 3ZJYC 3K0XA 1KDBA 3TMEA 3V2TA 4LF4L 1IKMA 3K5MA 4EQ5A 3STBC 2VNUD 3IKJA 1D1KA 2SDFA 4LF6L 3OOCA 3G7LA 3PIP3 2LSSA 3N6RA 4HCEA 4RWSC 2J0TD 5FOBB 2R7DA 3HOXG 1AE2A 1ENAA 1NSNS 1Y1VB 3T1YQ 4JOIC 5JJKA 2NVQH 4EX5A 5M3MB 4N8X1 3U50C 4TSSA 1ILPA 2UXCL 3K80C 1XXGA 1BBWA 1N32L 3K81C 2V4DA 2F0GA 3EFXD 2KEEA 4GN3B 1WTWA 3MFGA 1JWSD 3PIPA 1N33L 5C5LA 5DAUA 1VF5C 5E7NA 4DV2L 2R7FA 4X6AH 2R6GA 2K5QA 5EPKA 1I94Q 3OIQA 1RD9D 1XYIA 4R8IA 4GOPC 2B2TA 3KF8A 4LF9L 2E2JH 3W1BA 2HCIA 1EL0A 2ES2A 3CP0A 4IZ8A 1FNVA 5T1GA 4LUVA 3KDFA 1G6PA 1HR0W 1PA6A 5JJLA 1F2LA 4QB4A 3DEOA 2JA5B 2NVXH 4DA2A 4BA2I 3ICEA 1GHJA 2YU9B 2R93B 1G291 2Z6BA 1VDZA 2F0EA 1BBXC 1YHBA 1WOCA 3ND9A 3A5ZB 3MXNB 4CKCA 2IX3A 1EU3A 1CA6A 4FF2A 4QUCA 2A68C 4DNRB 2M2LA 3I70A 4FXKC 2O2LD 5EBCA 2LXJA 3DXJC 1R4PB 3E0JA 4DV2Q 3HOUB 3I3CA 1STBA 5LMUL 2ZM6Q 2EYJA 1KL9A 4JYAL 2CKZB 2AQ3B 3PCOB 2JE6I 1JCKB 1Q46A 1KQSA 4N8FA 2E2HB 2AQ2B 2HQEA 1JOKA 4O0AA 4A3EH 3NBHB 3D6WA 4DR3L 4A93B 2HUGA 1MIUA 2KEDA 2X6LA 1G51A 2R61A 1PMRA 1ESFA 1Q86C 2HIVA 2I07B 2L55A 4JI3Q 1NMGA 1ZXTA 3AFPA 3QR8A 4MTKA 2I5LX 3TEHB 1EOVA 3G71A 1MSGA 3M3YH 1O80A 4GNXB 1WTPA 1BCPC 2HIXA 4JI4L 5I2YA 3ONAB 3Q24A 4A93H 4XXEA 3TRZA 4EVOA 1MJCA 3RUZA 2KCNA 3W1GA 1SNMA 2PNHA 3TREA 1PRTC 3CF5A 1O7LA 4MIUA 4V190 5J1ZA 3PUYA 1LV9A 2CHBD 2Z6KA 3HFZB 1YHAA 2UU9Q 1Q8KA 1TWHH 4BA1I 2G5DA 2QDLA 3J81i 1H9SA 3A8JE 5BR8L 4DV6L 1B9MA 2Q2TA 2MPMA 3SVMA 5CMDA 5LMNL 3A8IE 5G3LD 4K2KA 2N78A 2F0OA 1RJTA 3S15B 3K8AA 3CQZH 4P72A 2JA7B 1NBWA 1V1QA 3GTKB 3HOZG 1GHKA 5JEAH 2Z8LA 1H95A 4A3FB 3EQLC 1VMCA 2N88A 3OTOQ 1EWCA 5ELCA 1SROA 4JV5L 1RKNA 4ODGA 3RD4A 4EQOA 3QO2A 4KKUA 4IPGA 3TQYA 5IYBG 2E5LL 2A73B 1I4PA 4WORA 4YWKA 3VA5A 3OMGA 3RNUA 1PFMA 1Q81C 1Y1WH 1HRJA 1G91A 1LTTD 1LTGD 4LF6Q 1I6VC 2JA8G 1EIFA 2B2YA 3HRZC 3GV6A 3OWEB 4JI6L 3M4PA 3N52A 2K14A 3H0GG 5LMNQ 3IFDA 3WWVA 4APVA 3F2CA 3G4SA 5IIFA 4Y52H 4DV0L 1DOMA 2RHQB 1YJNA 5GQOA 1Q8IA 5GADC 3PO2G 1KAAA 4DN4M 3VR3A 5DM63 3A54A 1D1IA 2VB2X 1H9MA 4NW2A 2D2CC 3FKIB 2E8GA 4HIDA 2VQEQ 1CK1A 4DR2Q 3H3VH 3OW7A 2XIWA 3HOWB 1E22A 3NXWA 1B8AA 4QF4A 4O2DA 2EY2A 5C3EB 2JYOA 4OIKA 3U58A 1HNWL 1PFBA 5KNCA 4NDXA 3BYTB 1GUWA 5IT9L 3KK7A 3RN5A 1IBKL 5JJIA 2CQAA 5EBDA 1X55A 2NZ1D 2CH4A 1A2UA 1QVFA 2DGYA 3FKIG 3I4NH 2K1BA 4A3LG 4L63B 1U5KA 4BY1G 4C3HB 4A76A 4B3MQ 5HY6A 3SK8A 5IYDG 4MTNA 2BDNA 1JB7A 4X3KA 4KK7A 1Z7TA 3STBD 1FYCA 4DR4Q 3GTLH 3GTLB 4DUZQ 4A3DH 3GTQH 4A3CH 1VMPA 5M5YH 1YJWA 1RODA 2UXBL 1J5EL 4DAPA 3ERSX 1JE4A 4C3HH 1EY8A 1EQTA 2QF7A 1PTOD 1K8GA 4R8NA 1F2MA 1H9KA 4KY6A 1HNZQ 3E0EA 4L5QA 1MI2A 1E1TA 2TSSA 1KC8C 4BBRH 4P74A 4HIKA 1XNRQ 1JJCB 1HUMA 1E2WA 1ENCA 1ILQA 1KDCA 2E76C 5JEAJ 1SFOH 2WINB 2C9OA 4KY5A 3IRBA 3GDEA 4DNIA 4B3SQ 1HNXL 1EYCA 1I50B 1LABA 3I4NG 1A6XA 4ZRZA 3PUWA 3NEMA 4DR5Q 1SYFA 3K6OA 4AYBE 3OMCA 2CW0C 2YTVA 4NXNL 3LGJA 2D0OA 2EYFA 3L0OA 1BCPB 2PZUA 4KV6A 4GKKL 1RHPA 3IAYA 2BA0A 1KRTA 2EY6A 1DZ1A 3NELA 1XWEA 3K5OA 5M3MG 3H6MA 5HGQA 2F0WA 1K8AC 1ET6A 4QL5A 4DV1Q 2PMZE 2E2IB 1VQKA 1Q90A 4OL7A 2F0VA 4JI8Q 1K3RA 2Z1CA 1CKNA 3JAML 5D14A 3D4RA 4PMBA 1SSOA 2RDGA 4J15A 3RZOB 4LK1C 3I90A 4HJ8A 3S1QB 1BQQT 5LMUQ 1DXMA 5C6AA 2MHVA 1I4QA 1A63A 1G8ZD 3OHXC 2BCOA 1EWIA 2RKSA 3J80L 3K5LA 1ZYRC 4DFAA 5I9PA 1FVIA 1AH9A 2V1CC 1I3QH 1QCBD 4L5RC 3T53B 4UP8A 2VB3X 1PYWD 1HJPA 1IZ6A 2A6HC 1IXRA 3L7ZC 1G2TA 4N9PA 2N3SA 2OQKA 1DOLA 4F7XA 1GJXA 5IWAL 4ZUIA 3R3OA 5IYBH 2PZTA 1Q1BA 1VQEA 3RLNA 2H4OA 1NE3A 3OSOA 4DR6L 1FD7D 2GN5A 3A0JA 4YCWA 4PZ6A 1QUQB 1D5XC 3C1EA 5AJ3Q 1PH9A 1L2FA 2IT1A 1GOZA 2UUBL 5DEHA 3KLSX 1ICFB 4QIWE 3VYUA 4JI1L 2B2YC 2CW0D 1ONLA 1HA5A 1ASZA 3MA2B 2F4VQ 2B63H 1I6HB 3OPOA 4NMZA 1CM9A 1U9RA 1FGUA 4G7HC 1I5FA 2IX1A 1EYGA 4GKJL 3ULPA 1U4MA 4BS9A 1P16A 3CC2A 2Q8IB 1I50H 4GNXA 4XQNA 4EQPA 5C4JH 3EVQA 5JVH3 1GD7A 3KF6A 1HCZA 5CV6A 4PNYA 3I73A 2NVYB 1SNDA 4JV5Q 2K4KA 3NWTA 2KCCA 1TWHB 4YIJA 3PV0A 1MBYA 5IP9G 1BUVT 1STAA 1EEID 2F3IA 2XNAC 4B3RQ 4IPHA 1SYEA 1WI5A 1PHJA 1A3TA 2AWNA 5BN4A 5JOBA 3R93A 5C44B 2WB1G 1TR5A 5M5XB 2K5VA 4YHHL 5JAVA 4FXGC 1ICWA 3T56B 4X62L 1VQDA 3WDNA 2Z6KC 1EZ8A 1I4GA 1F9SA 1O7IA 4PV1C 2QCPX 2JA7H 2GA4B 4BBSG 3HKZE 2PMZB 4JG2A 2QEXA 3MXPA 4KHZA 3ULJA 3GTJH 3S2DB 3S24A 5AFWA 4A3FG 2FMMA 1GUTA 3NWSA 3R2IA 2WAQB 4LFBQ 2EDGA 2K5WA 4RKBA 1WTRA 3KLWA 5A2QE 3KLSA 3HOUH 3W2DA 3S2HB 4JI2Q 4UY8C 1IYJB 4G7ZC 1NY4A 3PF4A 5CV4A 3BDOA 1IKLA 5I2XA 3ITPA 1LT3D 2O5IC 2RSOA 4LF8Q 3CD6A 4C3JH 1K83B 5EPLA 1F77A 3CW2C 4DAYB 1LT4D 3TP6A 1AFPA 1E2VA 1SJHD 2ZTCA 1R9TH 1PYSB 2NVQB 2VQFQ 1S5DD 1H9RA 2NUCA 3T1HL 5E3FA 1NTGA 5M3MH 2PW7A 4RKLA 1QVCA 4KKTA 1LTSD 2EXZA 2KHJA 5C44H 2EJGC 3GQBA 3PO3G 2SOBA 2FINB 3GTKH 2JA6G 1BDOA 4GOPA 2NTTA 3J7AF 1D5ZC 3D4WA 3S1NB 4A3FH 4GS3A 4X66Q 3CCEA 4OO1G 3M7NA 1CKNB 1EYDA 3GV3A 1BVSA 4LFBL 5ISRA 1PV4A 3KF6B 3S2DH 4YY3L 1V1PB 4C3IB 2L4NA 4EQNA 4ME3A 2HCCA 4OHJA 2KECA 1VQ7A 1KRSA 5L37A 2NBFA 3MEFA 4IN3A 2Q8RE 1XNRL 1EOTA 4BBRG 1WTHA 1B7YB 1Y14B 2EYOA 4IUTA 4IO9A 4R4CA 4X3UA 1E0BA 1GO3E 4DK0A 5C5MA 2Y0SG 2RCFA 1Y69U 2MQHA 2QILA 4KJNA 2K03A 1SEBD 3W5OA 1T5EA 1X3EA 3T1HQ 3RZOH 1SE4A 4K8JA 5C3XA 3FP9A 4A4IA 2AWOA 2RSNA 3S16H 3S16B 2A19A 4DV7L 4NXMQ 2XTIA 1YVCA 5GAGC 1X54A 5FLXc 1VQMA 3NUCA 3TSSA 4KD4A 1PFSA 5IOCA 2SNMA 3K59A 4K8IA 2L1BA 2E2DC 1W6JA 5IYDH 3MEHA 3CCRA 3M4OH 3CMEA 4BY1H 2PZWA 2KVMA 1X3QA 4MZ9A 1SN8A 1GKHA 2AUJD 2KJXA 1WD1A 4JI0Q 5KYLA 1FJGL 3DUZA 2ZM6L 1ASYA 2B2WA 2FFKB 5ELEA 4X3SA 1EY6A 3GTPH 1SNQA 1VQOA 4YCUA 2B8FA 1AE3A 2JQOA 2PQEA 1LTBD 1BCPD 4U68A 2GVAA 3NE5B 3GTMB 5EPJA 4DR3Q 4R4TA 1PXUA 2UUAQ 2OCEA 4TVAB 2FXQA 4GLVB 2N55A 1HH2P 4CGYB 4FP5D 2B2UA 3MZ5A 3MVVA 1EFID 2KQ3A 2X69A 2JA6H 2UXDQ 5C44G 1ESRA 2JA9A 3CPFA 4HIMA 2UUCL 2E2JB 1PTOH 2Y0SE 5IWAQ 3HOYG 1IBML 3BG3A 4FDBA 4ILWA 3F2UA 2I5MX 2K28A 4LF4Q 1QE6A 1WVLA 3ULLA 4QQBX 1VQ9A 3MFYA 4OX9L 4IFDG 4CKBA 3CMAA 4NB3A 1X3GA 1PZID 4OWTB 2XSCA 1Y1WG 4F88A 2D62A 2KENA 3CPWA 2LY7A 1SYDA 4MNOA 1S5FD 3DWQA 1TT2A 3LWUA 4C3JG 1WTQA 4ME5A 5C0XI 1AEXA 3MXGA 1YNJC 3I4OA 3JAME 5IGGA 1CHQD 5IT9c 3S2HH 3A8KE 4IUPA 2K05A 3VYRA 4RG1A 2R3ZA 1N34Q 3VR5A 2R92H 2TMPA 4H0LC 2F3VA 2EYPA 1PH7A 4HIOA 1Q3LA 2IW3A 4I65A 1X6OA 1VQ4A 3C46A 3HOZH 1Y1WB 4K5XA 1VCIA 2YV5A 3TP7A 5COYA 3L3OC 1IBLL 5M5XH 1HTPA 2EY1A 4HJ7A 1BNZA 1R9TB 5F2DA 3TZDA 5KYIA 1S5ED 4C1NK 1SJED 4F8MA 3KOJA 2E5LQ 3HOYH 1MD2D 2KUMA 3J7AV 2EYMA 2D5DA 4YWLA 3PUXA 3AQQA 1RTNA 4UAIA 5E1FA 5J39A 1UE6A 2L5TA 4POFA 2B8GA 1NCVA 3J81c 2EZVA 1TXYA 3NBHA 1VQFA 3M7GA 4OIJA 1SE3A 5IP9H 3CRKC 4F87A 2Z9HA 1T9HA 2NWGA 1F2YA 3W3AA 1SYBA 4LFAQ 3J80E 3GTPB 1VQHA 4LMQD 1NR2A 1IL2A 2RDFA 2RA4A 2HD3A 3MTSA 3GTGB 3GTOH 2Y0SB 1CSQA 1VQIA 4IUVA 4B08A 4BWGB 2PNRC 1Y1VG 3MC0B 1DGSA 2UXCQ 1KABA 2B2TC 3MHBA 1YNND 4YY3Q 1JT8A 1EIHA 2J7ZA 3RMHA 3A74A 2K52A 4JCVE 2HDMA 3DM1A 3E9HA 2NN6I 2HQLA 4BY7G 1SBBB 5E4XA 2B63G 3T51B 4A3CG 2SEBD 3HOZB 2L9HA 3BZKA 3NENA 1I94L 3NP8A 3H91A 4JBJA 5BN3A 5NUCA 1DOKA 3UE1A 4LF8L 3PF5A 5ELNA 5BN5A 1WD0A 4IPDA 1NNXA 5IGBA 4OEMB 1E24A 1TIID 3M4YA 1XPRA 1TWAB 4FNFA 2DNEA 3TDQA 4CKEA 2LXKA 2HDLA 5CR3A 1I4HA 1RTOA 4OWXB 4Y7NH 4Y7NB 3UE0A 4B9XA 2NN6H 3HOVG 2F0JA 4DPGA 1D5MC 4IJLA 2N8NA 1WCMB 1HUNA 1GM5A 4G4KA 4C1NI 3S1MB 4RMFA 5ELFA 4A3IH 2F0UA 2F3WA 3CAMA 1SFOB 3DHQA 4AIMA 2B2WC 2EIFA 1TS3A 1L0XB 2YTXA 1KAWA 1MGSA 1TY2A 4ZAIA 1X9NA 5A35A 1UUPA 3H0GH 1U4LA 2A69C 2KOLA 4FF1A 3OIPA 1SYCA 2X6GA 2H1EA 3RLFA 4AQYQ 1PH4A 2UXDL 1HZ9A 4K6DA 2VY3A 3I8ZA 4DKAC 2KHIA 4TKOB 4KHVA 1E3PA 4K2LA 4PZ7A 5EGTA 5H1SE 1HQRD 3KBGA 3L2PA 4DK3C 1LYLA 1VQ5A 1HZAA 2NN6G 1PZJD 2K01A 3CCUA 3SXHA 3EIVA 2EJFC 2JA6B 3HOVH 1J9OA 1F9QA 4KJOA 1JOOA 4CDFC 1YITA 2QGQA 1LTID 3T16A 5JEAG 1PH5A 1Y8OB 2R7ZB 5DM73 4XT3B 1UE7A 5I6YA 4BBSB 2P5ZX 4I7AA 2F0IA 2IX0A 1U0LA 3FPPA 1CQVA 3E3XA 3T1YL 1QZHA 2XRQD 2ICEC 1N34L 4QCLA 3NK9A 1NUCA 1UE5A 2NZHA 1OXXK 4WFN3 1C7YA 2RHSB 4QGUA 2IHFA 1BCPF 1N8RC 4GLAC 2NTSA 4R9WA 2D0PA 2WAQE 1SXTA 1TWCB 1EYAA 1EFWA 4KN7C 1KHIA 1U4RA 2B3GA 5ELBA 4YWMA 4A3KG 1HZBA 1HNWQ 5GROA 4JW0A 2MP1A 2WIIB 3FPUB 1YIJA 1S72A 4KN4C 1A3VA 3U9OA 1IBKQ 4DR6Q 1HTLD 5GAEC 4RHRA 3RZDH 1OO9B 4UP7A 1LTAD 1C0AA 5AJ3L 1H9JA 4H44C 5C3WA 4H02A 2YTYA 1B2TA 2KHSA 3E5SA 4JI5L 4DNTB 5M3FG 4RCOA 4ID6A 1LT5D 2C35B 3J7YW 3CCVA 3HOWH 3D0FA 1FNUA 1C4QA 1RF2D 3O13A 4MHEA 1AN8A 2UXBQ 3PQIA 4FVMA 1Z6HA 3B6YA 1HHVA 2ID0A 5C4ZA 1MJEA 5LL6S 2ATWA 4HJ5A 4J8QA 1EQQA 1E1OA 1Y8NB 2ZJQA 4HAEA 2G9DA 1QJOA 2E74C 4H7BA 2PPBC 3KUPA 1PH3A 2YYZA 4L5SA 1LTLA 2OEOA 1ZEQX 3OWFA 4J1MA 1MSHA 4KKSA 3ZYYX 4DR1L 4NPSA 1H9SB 1Z47A 3K57A 3AMUA 3CRLC 4CHTB 2MO0A 1L1OA 4B3SL 4DR5L 3A7AB 2PI2E 4QIWB 3CU7A 4TRDA 3BZCA 3AU7A 1A0IA 5M5WH 5M5WB 2MO1A 4P73A 2EQSA 4JI3L 1S3OA 1TS2A 1C8CA 1XX8A 3UI2A 2PQAA 2F0QA 3S9WA 4GKKQ 2R92B 5J3BA 3RR5A 3Q23A 3GP7A 3LNNA 2WV6D 3H3VI 1SDFA 4LF7Q 5CV7A 4PG3A 2PW5A 1UAPA 4A3BB 1NR4A 2GVBA 4A3JG 1AZPA 4DV1L 4QJFA 2XN9C 1BOSA 1EU4A 2QDBA 4ZKCB 5JPMC 1A62A 1TWAH 1N33Q 3U4ZA 3S1RH 2KA7A 2F4IA 3C2PA 3P1HA 4A3IG 3X3NA 4FO2A 3J81E 2PQAB 5FK9C 1EEFD 4Q0FA 1KD1C 2ZJPA 2KBNA 4P75A 4HN7A 1SNOA 1ENFA 5FLXL 5KNBA 1AZQA 1HQMC 3PMFA 1V8QA 2QEJC 4OWWB 4RGMA 3NTHA 3QG1A 2DY8A 1EY5A 5IE8A 2BH8A 2NVTH 1A3UA 1KNEA 5M9OA 1X65A 4V0BA 3D31A 1HNXQ 4N9TA 3GTJB 2VQFL 4K5VA 3J7ZC 3MXUA 2F0KA 1KXLA 2KCMA 3VYSA 2LKVA 3HP3A 1B44D 4JBWA 3WOFA 1CHPD 2B39A 1F2ZA 4XT1B 3NBIA 4LUOA 4A93G 1HPCA 1SYGA 1V9PA 2L11A 3D8GA 1KNAA 2BA1A 4C3JB 4B3TQ 1HR0Q 2ZXRA 5E4WC 3F2BA 2MFIA 2IHEA 4AYBB 5FJ8H 2QA4A 5FO7B 1VQLA 4ABNA 3V96A 2XGTA 4JI1Q 5CC4A 1SRUA 4ULLA 1XMQL 3JC66 1JICA 1Q7YC 5EQ0A 3BS1A 1JC7A 1IW7D 3RN2A 3EJIA 2G9HD 4C3IH 4R1JA 1RIPA 2CQOA 1EIGA 2A8VA 2XRSD 1W2BA 4R4IA 4A3LH 2R7ZH 1JJGA 1SMXA 4OO1H 2QW7A 4G7OC 2A1AA 1CI3M 1K3BC 1V43A 5M3FB 3HOVB 3QWNA 3UDXA 2MGSA 1FGBD 1JQYD 1TS5A 2JXMB 1PH8A 1D8LA 3VR2A 5C0XJ 5CGKA 3GTGH 1BKBA 3BDLA 3PO2B 2L12A 2FHTA 3K0YA 1DD2A 1EY0A 1S4ZA 1GXDC 2OQ0A 3I4MB 2IY5B 2H5XA 4A3DB 1L1OC 3EA6A 2K33A 2A68D 4QUFA 3PSIA 2BE5D 5IGCA 4DR7Q 4B3ML 5BR8Q 4X62Q 1D6EC 3K5NA 5HGTA 1B9NA 2JN4A 2JEAI 1VQBA 1JORA 3QB3A 1B50A 5JPNC 5EKKA 4A3GH 1LACA 2ZT9C 2DJGC 4FF3A 1BBUA 4WJWA 4ZKBB 5I9OA 5IY0A 3Q6SA 4DV5L 2JA5G 1TWFH 1I4XA 3PIO3 1HNZL 4KLKA 2L15A 3RZDB 1XPOA 1AW7A 3OW2A 3CCSA 1KLUD 4PMWA 3KDFB 2LMCB 3KYHC 4K5WA 1X3FA 1PZKD 2F0PA 5KRUA 4ZYSA 5DLQE 4LW1A 2QKIC 5GAHC 1DCZA 4A3JB 3CC4A 4WJ4A 1TWGH 2K5HA 1N9WA 4IOCA 1XJVA 1LUZA 1Q1EA 3P7JA 5FLMG 3HS0C 1D7QA 1EZ6A 2RQXA 3D6CA 1KIXA 3SDZA 3QOJA 4DV0Q 3JAMi 3JAMc 5CORA 5IGDA 1YNXA 1TQOA 3WOEA 1PTOC 5C4JB 3KFUA 1SAPA 3H15A 5C4XG 2B2VA 1CT1D 5EKLA 1B3QA 3VR4A 2DN8A 1TKWB 5C0XH 1N32Q 1JB3A 1YBYA 3BZDB 3NQTA 4IUUA 1NAPA 1IYVA 5FKAC 2WP8J 4Q5VA 4DK6C 2F0TA 4LAAA 3MAQA 1STHA 4DXGA 4DAYA 2D9UA 3S14H 1N36L 3CCQA 1II3A 2A5HA 4HTHA 5IP7G 2JK8A 3BYYB 3FHWA 1KDAA 2WAQG 4ZLTF 5FLMH 2VXWA 2E75C 2R93G 1BO0A 2CWAA 2F03A 3I72A 2K04A 4AQYL 1AP0A 2PI2A 2VUMB 4P2CB 2E2HH 3TS2A 4A3EG 2NYZD 5JVG3 2EOTA 1Q82C 4XDXA 1PH6A 2ZTEA 2CCZA 4UHVA 4OELB 3U4VA 1PYBA 2K32A 2RDHA 1X56A 2ZTDA 1V1PA 1TWFB 3PO3H 4A3BH 1UEAB 4U673 2OWOA 1UNSA 2A74C 1UE1A 4WJ3M 1PTOF 2ICIA 2K5NA 2NVTB 5FLXE 1FR3A 1CKMA 3K58A 3TBIB 2A6HD 1JOQA 3SE0A 2EVBA 3S15H 3HKZG 3P20A 1PFNA 3K7UC 2A69D 4IFDJ 4CBVA 3DLLA 5EKIA 4GKJQ 1CKOA 3CCMA 1EY4A 1RL2A 2AQ1B 2NB0A 1QNKA 4HJ9A 1QWYA 3BJUA 2J4XA 3PUZA 4S3SA 3I4MG 1TWCH 3G6EA 1UWVA 1SMYC 1CQFA 2JJQA 4XQJA 4OGQC 1OXSC 4UDUC 3H94A 2DUDA 2ZJRA 5JJZA 3E6ZX 5M3FH 3HOXB 4KI0A 2BOSA 2I0QA 2DJFC 3I55A 3PGZA 2F0FA 3E9IA 1IW7C 4JI5Q 1DJRD 1L1OB 2Z4IA 4XYOA 4A3IB 5C3EG 3KJOA 2JA7G 1F9RA 4BBSH 3J7A5 3VA7A 1PTOB 3R8BA 2AUKA 4A3MB 2CWPA 1MKHA 4DAVA 3NTKA 4K6LA 3EN2A 3M3YB 1K83H 5FJ8G 5J22A 1WCMH 4Z9CB 1KTKA 3G6JB 2OXPA 1IBLQ 2F0NA 4P71A 2HHHL 1OTCA 5EJWA 3I4LA 4RGTA 4LUZA 1D2BA 1J8IA 1CTMA 1BF4A 4LFCL 4C3HG 4BY1B 3J80c 1YEZA 1JMCA 1W3SA 3OTOL 1M8AA 4BY7B 3DMUA 5I4DA 5ELDA 2CH4W 1XNQL 4A3MG 4CJ2C 1L0WA 1B1ZA 1QNUA 4IUQA 4A3DG 1X3PA 5LL6X 5C3EH 4LF9Q 1VQAA 1O7ZA 1ZKOA 2IL8A 2M00A 1EY7A 2F0LA 3FKIH 2BE5C 1JWMD 4OX9Q 2EYLA 2AHOB 2B2UC 3X3MA 1NMFA 2K75A 3K7AB 2N49A 4JI6Q 3CXCA 3A55A 3T4AC 4UPAA 2F4VL 1VQGA 4H13C 2F0MA 1ZYRD 4IQZA 1XTCD 1EIYB 1TS4A 1QG7A 4X3TA 2PCFB 4I7ZC 1P8LA 1QZGA 3I4NB 3FVQA 1QILA 5FO9B 2XWJB 4HMJA 1PDQA 1CFMA 3SHLA 5KNDA 3PO2H 2M9VA 2BDOA 2Z4HA 1TWGB 2RBMA 4DXFA 4E6IA 4C56C 5IGFA 1TY0A 3TN2A 4A3KB 4XIGS 2DY7A 5G3LF 4TQUS 1U4PA 3D3RA 1PRTF 4B3RL 4PQXA 5CV8A 5T1IA 4NXNQ 2K7VA 2VL6A 1RCVD 4X65L 3S14B 2L0CA 2LFNA 1BR9A 1K8OA 2VW9A 4JI4Q 2RVLA 2JA8B 4NXML 4HSVA 2WFWA 4UP9A 4ZQ3A 1Z9FA 3A56A 1YJ9A 1JWUD 4KTAA 1CZWA 4O42A 1J5EQ 4ALPA 2EY5A 2ZXOA 3DEPA 3MXNA 1JJ2A 3DM3A 4JI0L 1FJGQ 2K6AA 3CQZB 1GUSA 3EROA 5KGUA 4DR1Q 2FJ2A 4HR7B 4PMCA 1LTRD 3NPPA 5IP7H 1FL0A 4DV6Q 2ZXPA 3Q22A 5IGEA 1DM0B 2RF4A 3S1NH 4BY7H 4BXXG 1J6QA 4K14A 3D4DA 4IURA 3HOWG 1VQ6A 3HEJA 4CDEC 4OXPA 4C2MB 3S17B 4NP5A 2VUMG 4DV4L 2DNCA 5C0XG 1M90C 4LF5L 4RCNA 4IALA 3G48A 2Q2HA 1EWHA 4HMIA 1R4QB 4ZUJA 3AEVA 5DNFA 1SNCA 2PO4A 3PIOA 2B63B 1LO5D 1K73C 3OYYA 4IJHA 1M4VA 2EYHA 5KEEA 4LJZC 5K36G 2WKCA 1DYQA 1PRTD 1VQPA 1IBMQ 3CKIB 4PZ8A 5C4XB 3DWPA 5ELOA 4DU9A 3GD7A 3GTMH 1HA6A 5A2QL 3ER0A 2IPKD 2JP1A 2HT1A 3Q8DA 3SR1A 1T5XD 2VUMH 1WCMG 2XVSA 4IOAA 1VF7A 4JI8L 1K0SA 3FMCA 4KD3A 3ND8A 2BH2A 2OTJA 4RGNA 1HZCA 3HOYB 1IHZA 4AH6A 5C4HA 3PUVA 2CFMA 3VR6A 3QOLA 5IYCG 3GO5A 2MNAA 2ENBA 4DUYL 1GVPA 5FO8B 4DV4Q 2MJ8A 5CV5A 3C1FA 2K50A 4IPCA 1XMOQ 4LF5Q 1O7YA 4JK1C 4LFCQ 1S5BD 3F2DA 1K8MA 3VDYA 1EY9A 4KMUC 2WB1B 3TP8A 4C2MH 4LWCA 4A3GG 2Q2UA 4ZK9B 1NJIC 3LWEA 4KY7A 1GUGA 4X64Q 1WFQA 1SR3A 4ZCKA 1RDPD 2F52A 1QB5D 3CC7A 1CUKA 1BXTA 1WTOA 2XWBB 2ASBA 3EBEA 1HR0L 3UDFA 2O5JC 4JI7Q 2F0SA 4J6HA 1JE5A 1STNA 1YZ6A 2RCNA 2UU9L 4G57A 3MWYW 1Q12A 1L0YB 1CSPA 3CCLA 1XMQQ 1PVOA 5KIXA 2UUBQ 1YI2A 4QMGA 1A15A 4RGOS 2IWHA 1LM0A 1VQ8A 4JBMA 5D3DA 4GZYC 4NKLA 4LFAL 5HURA 3VYTA 2O4XA 2JEBI 1B53A 1B4OA 1EUJA 3K7AH 4GLXA 4RFBA 4WRDA 1XMOL 2VZAA 1I6HH 4R4QA 4CJ0B 2R7ZG 2JA8H 1E7ZA 2F1MA 3FRPB 2EJMA 2EPBA 3KJPA 3LX0A 4JC0A 1STGA 1V1OA 1HFGA 1OXTA 4JI2L 3AYHB 4L8JA 2HHHQ 1IL8A 3M4QA 3HKZB 1SMYD 3H3VC 3SK4A 1N36Q 4CJ1B 5CYUA 1TVXA 2CVRA 1M1KC 3CCJA 2B29A 1G2SA 1QUQA 1XNQQ 1B70B 1YHQA 1KLGD 3KBXA 3HOXH 2IJ0A 4RHSA 4JI7L 4JOIA 3A7LA 2A6ED 4EGVA 4A3EB 3AB9A 3I56A 3IL8A 3GTOB 2WKDA 3FDTA 3UDGA 5IT9E 2OTLA 1O78A 1E2ZA 5IYCH 4OO1I 4XQQA 1UEBA 2AKWB 4DF7A 4YHHQ 4A3MH 1XPUA 1C9OA 3AFQA 1G6ZA 1VQJA 4L6TB 1I3QB 4XYQA 4QY7A 4X66L 4DV5Q 2JSOA 1W6KA 3I91A 2VQEL 1Y1VH 4DR2L 4HCSA 2WB1E 1SNPA 4JVZA 4JYAQ 1MHWC 3S17H 3T13A 3KLRA 1K28A 4FF4A 1A8VA 4GOPB 1A2TA 3HZXA 3A5UA 5K36H 3M9BA 4YCVA 2E2IH 2A6EC 3BVZA 3M85A 3UDIA 1QVGA 1WTVA 3TS0A 4A75A 3URYA 5I6WA 2K5DA 3F1ZA 1SE8A 4HEDA 2MUYA 4XTCS 3SK6A 4A3JH 1XTDA 4DR4L 4X65Q 4DUZL 3SGIA 4BXXH 3J81L 5D65A 2VS1A 4GN4B 3TZUA 3J80i 2SNSA 3KF8B 1HFNA 4LF7L 2FMCA 3I4MH 1YNNC 2OT2A 5LHY1 3NQIA 4JPBW 1JR0D 3BVGA 2B2VC 1PH2A 2Z0SA 4B9WA 1GUOA 2JA5H 3H0GB 3QJYA 1WTXA 1VS0A 1TU2B 1Y8PB 1C48A 4CDDC 1LT6D 4BBRB 3QIAA 2R92G 4DK1A 1ET9A 3H09A 2C5CA 2AMCB 4A3GB 4DGZA 3F8TA 4OONA 4MN3A 4GN5A 3BDCA 3SEBA 4DUYQ 4KHPQ 4RA8A 3HOUG 5K5PA 2KCTA 4A3BG 2NVXB 1F9PA 1VQCA 4RH6A 4L5TA 2I5HA 1X32A 3TP5A 5LMNW 1WJJA 3RLOA 4FXDA 4IFDH 5IODA 2NVYH 4CDCC 4K0KQ 4GNXC 3HG9A 1PH1A 2EE1A 2I46A 4R4OA 3P75A 2UUCQ 5TSSA 4IFDI 5CBEE 3HGBA 3S1RB 4FYDA 5D3IB 1S40A 4DAMA 1WYDA 4DV7Q 2Q2IA 3NSWA 4DV3L 1FNWA 2NZOA 1PRTB 2LS01 1S5CD 3BU2A 3ERQA 3NHHA 1SLJA 3V05A
chains in the Genus database with same CATH topology
1DONA 3CHBD 3R2TA 1GUNA 1OXVA 1QOHA 4M1UB 2OF1A 3PO3B 1SE2A 3M4OB 3IFTA 1STYA 3SK5A 1OXUA 4C3IG 4M8AA 1HXYD 2WACA 3L9AX 3GTQB 3Q0AA 5CBAE 2Q8TA 1I4RA 1B3AA 1IYUA 5M5YB 3BVMA 4RAUC 1PLFA 1LLRD 3DWAA 2F0HA 1EQVA 2F0DA 2PYKA 1ML0D 3U9SA 4O1NA 3FEWX 1CA5A 1CZGA 3NTIA 4HSPA 5CV9A 4IUNA 1YNJD 3C3LA 1STEA 3TMEA 1KDBA 3V2TA 1IKMA 3K5MA 2VNUD 3IKJA 1D1KA 2SDFA 3OOCA 3G7LA 3PIP3 3N6RA 4HCEA 4RWSC 2J0TD 5FOBB 1ENAA 1NSNS 1Y1VB 5M3MB 4TSSA 1ILPA 1XXGA 2V4DA 2F0GA 3EFXD 2KEEA 1WTWA 3MFGA 1JWSD 5C5LA 5DAUA 1VF5C 2R6GA 2K5QA 5EPKA 3OIQA 1RD9D 1XYIA 4R8IA 2B2TA 3KF8A 2HCIA 1EL0A 4IZ8A 1FNVA 5T1GA 1F2LA 4QB4A 3DEOA 2JA5B 4DA2A 4BA2I 1GHJA 2YU9B 2R93B 1G291 1VDZA 2F0EA 1BBXC 3ND9A 4CKCA 2IX3A 1EU3A 1CA6A 4FF2A 4QUCA 2A68C 4DNRB 2M2LA 3I70A 4FXKC 2O2LD 5EBCA 3DXJC 1R4PB 3E0JA 3HOUB 3I3CA 1STBA 2EYJA 2AQ3B 2JE6I 1JCKB 2E2HB 2AQ2B 2HQEA 1JOKA 3D6WA 4A93B 2HUGA 2KEDA 2X6LA 2R61A 1PMRA 1ESFA 2I07B 2L55A 1ZXTA 1MSGA 1O80A 1WTPA 1BCPC 5I2YA 3ONAB 3Q24A 4XXEA 4EVOA 3RUZA 2KCNA 1SNMA 1PRTC 1O7LA 4MIUA 4V190 5J1ZA 1LV9A 2CHBD 3PUYA 4BA1I 1H9SA 3A8JE 1B9MA 3SVMA 2MPMA 5CMDA 3A8IE 5G3LD 4K2KA 2F0OA 1RJTA 3S15B 2JA7B 3GTKB 1GHKA 5JEAH 2Z8LA 4A3FB 3EQLC 1VMCA 2N88A 1EWCA 5ELCA 1RKNA 4ODGA 3RD4A 4EQOA 3QO2A 4KKUA 2A73B 1I4PA 4WORA 3VA5A 3OMGA 1PFMA 1HRJA 1G91A 1LTTD 1LTGD 1I6VC 2B2YA 3HRZC 3GV6A 3OWEB 3N52A 3IFDA 5IIFA 1DOMA 1Q8IA 1KAAA 4DN4M 3VR3A 5DM63 3A54A 1D1IA 2VB2X 1H9MA 4NW2A 2D2CC 3FKIB 1CK1A 3OW7A 2XIWA 3HOWB 3NXWA 4QF4A 2EY2A 5C3EB 2JYOA 4OIKA 1PFBA 5KNCA 4NDXA 3BYTB 1GUWA 5IT9L 3KK7A 2CQAA 5EBDA 2NZ1D 1A2UA 2K1BA 4L63B 4C3HB 3SK8A 2BDNA 4X3KA 4KK7A 1Z7TA 1FYCA 3GTLB 1VMPA 1RODA 4DAPA 1JE4A 1EY8A 1EQTA 2QF7A 1PTOD 4R8NA 1F2MA 1H9KA 4KY6A 1MI2A 2TSSA 1HUMA 1E2WA 1ENCA 1ILQA 1KDCA 2E76C 5JEAJ 2WINB 2C9OA 4KY5A 1EYCA 1I50B 1LABA 1A6XA 4ZRZA 3PUWA 1SYFA 3K6OA 3OMCA 2CW0C 2EYFA 1BCPB 2PZUA 4KV6A 1RHPA 3IAYA 2BA0A 2EY6A 1DZ1A 1XWEA 3K5OA 3H6MA 2F0WA 1ET6A 2E2IB 1Q90A 4OL7A 2F0VA 2Z1CA 3JAML 5D14A 3D4RA 4PMBA 1SSOA 2RDGA 3RZOB 4LK1C 3I90A 3S1QB 1BQQT 1DXMA 5C6AA 2MHVA 1I4QA 1G8ZD 3OHXC 2BCOA 2RKSA 3J80L 3K5LA 1ZYRC 4DFAA 5I9PA 1QCBD 3T53B 2VB3X 1PYWD 2A6HC 3L7ZC 1G2TA 4N9PA 1DOLA 4F7XA 1GJXA 4ZUIA 3R3OA 2PZTA 1Q1BA 2H4OA 3OSOA 1FD7D 1D5XC 3C1EA 2IT1A 1GOZA 5DEHA 3KLSX 3VYUA 2B2YC 2CW0D 1ONLA 1HA5A 3MA2B 1I6HB 3OPOA 4NMZA 1CM9A 1U9RA 4G7HC 2IX1A 1U4MA 4BS9A 2Q8IB 4XQNA 4EQPA 3EVQA 5JVH3 1HCZA 5CV6A 4PNYA 3I73A 2NVYB 1SNDA 3NWTA 2KCCA 1TWHB 4YIJA 3PV0A 1MBYA 1BUVT 1STAA 1EEID 2XNAC 1SYEA 1A3TA 2AWNA 5BN4A 5JOBA 3R93A 5C44B 1TR5A 5M5XB 5JAVA 4FXGC 1ICWA 3T56B 3WDNA 1EZ8A 1I4GA 1F9SA 4PV1C 2QCPX 2GA4B 2PMZB 3MXPA 4KHZA 3S2DB 5AFWA 2FMMA 1GUTA 3NWSA 3R2IA 2WAQB 2EDGA 2K5WA 4RKBA 1WTRA 5A2QE 3S2HB 3KLSA 3W2DA 4G7ZC 5CV4A 3BDOA 1IKLA 5I2XA 3ITPA 1LT3D 2O5IC 2RSOA 1K83B 5EPLA 1F77A 1LT4D 3TP6A 1AFPA 1E2VA 1SJHD 2NVQB 1S5DD 1H9RA 2NUCA 5E3FA 2PW7A 4RKLA 4KKTA 1LTSD 2EXZA 2EJGC 3GQBA 2SOBA 2FINB 1BDOA 2NTTA 3J7AF 1D5ZC 3D4WA 3S1NB 4OO1G 3M7NA 1EYDA 3GV3A 5ISRA 1V1PB 4C3IB 2L4NA 4EQNA 2HCCA 4OHJA 2KECA 2NBFA 4IN3A 2Q8RE 1EOTA 2EYOA 4IUTA 4X3UA 1E0BA 4DK0A 5C5MA 1Y69U 2QILA 4KJNA 2K03A 1SEBD 1T5EA 1SE4A 4K8JA 5C3XA 2AWOA 2RSNA 3S16B 3NUCA 3TSSA 4KD4A 5IOCA 2SNMA 3K59A 4K8IA 2L1BA 2E2DC 1W6JA 3MEHA 2PZWA 2KVMA 1X3QA 2AUJD 2KJXA 1WD1A 5KYLA 3DUZA 2B2WA 2FFKB 5ELEA 4X3SA 1EY6A 1SNQA 2B8FA 2PQEA 1LTBD 1BCPD 4U68A 3NE5B 3GTMB 5EPJA 1PXUA 2N55A 4CGYB 4FP5D 2B2UA 3MZ5A 3MVVA 1EFID 2KQ3A 2X69A 1ESRA 2E2JB 1PTOH 3BG3A 4ILWA 3F2UA 2K28A 1QE6A 1WVLA 3MFYA 4IFDG 4CKBA 1PZID 2XSCA 4F88A 2D62A 2LY7A 1SYDA 1S5FD 3DWQA 1TT2A 3LWUA 4C3JG 1WTQA 4ME5A 5C0XI 1AEXA 3MXGA 1YNJC 3JAME 5IGGA 1CHQD 3A8KE 4IUPA 2K05A 3VYRA 2R3ZA 3VR5A 2TMPA 4H0LC 2F3VA 2EYPA 1Q3LA 2IW3A 4I65A 3C46A 1Y1WB 4K5XA 1VCIA 3TP7A 5COYA 3L3OC 1HTPA 2EY1A 1BNZA 1R9TB 5F2DA 3TZDA 5KYIA 1S5ED 4C1NK 1SJED 4F8MA 1MD2D 3J7AV 2KUMA 2EYMA 2D5DA 3PUXA 4UAIA 1RTNA 5E1FA 5J39A 2L5TA 2B8GA 1NCVA 2EZVA 3NBHA 3M7GA 4OIJA 1SE3A 3CRKC 4F87A 2NWGA 1F2YA 3W3AA 1SYBA 3J80E 3GTPB 4LMQD 1NR2A 2RDFA 2RA4A 3MTSA 3GTGB 2Y0SB 4IUVA 4B08A 4BWGB 2PNRC 3MC0B 1KABA 2B2TC 3MHBA 1YNND 1EIHA 2J7ZA 3RMHA 2HDMA 3DM1A 2NN6I 1SBBB 5E4XA 3T51B 2SEBD 3HOZB 2L9HA 3H91A 3NP8A 5BN3A 5NUCA 1DOKA 5BN5A 1WD0A 5IGBA 1TIID 3M4YA 1TWAB 4FNFA 2DNEA 3TDQA 4CKEA 2HDLA 5CR3A 1I4HA 1RTOA 4Y7NB 4B9XA 2NN6H 2F0JA 1D5MC 1WCMB 1HUNA 4G4KA 4C1NI 3S1MB 5ELFA 2F0UA 2F3WA 1SFOB 3DHQA 2B2WC 1TS3A 1L0XB 1MGSA 1TY2A 4ZAIA 5A35A 1UUPA 1U4LA 2A69C 2KOLA 4FF1A 3OIPA 1SYCA 2X6GA 2H1EA 3RLFA 4K6DA 3I8ZA 4TKOB 4KHVA 4K2LA 5EGTA 1HQRD 3KBGA 2NN6G 1PZJD 2K01A 3SXHA 2EJFC 2JA6B 1J9OA 1F9QA 4KJOA 1JOOA 1LTID 3T16A 5JEAG 1Y8OB 2R7ZB 5DM73 4XT3B 5I6YA 4BBSB 2F0IA 2IX0A 3FPPA 1CQVA 2XRQD 2ICEC 4QCLA 3NK9A 1NUCA 1OXXK 4WFN3 1BCPF 2NTSA 4R9WA 1SXTA 1TWCB 1EYAA 4KN7C 1U4RA 5ELBA 2MP1A 2WIIB 3FPUB 4KN4C 1A3VA 3U9OA 1HTLD 4RHRA 1OO9B 1LTAD 1H9JA 4H44C 5C3WA 1B2TA 2KHSA 3E5SA 4DNTB 4RCOA 4ID6A 1LT5D 3J7YW 1FNUA 1C4QA 1RF2D 3O13A 4MHEA 1AN8A 4FVMA 1Z6HA 1HHVA 2ID0A 5C4ZA 5LL6S 4J8QA 1Y8NB 4HAEA 2G9DA 1QJOA 2E74C 4H7BA 2PPBC 3KUPA 2YYZA 2OEOA 1ZEQX 3OWFA 4J1MA 1MSHA 4KKSA 3ZYYX 1H9SB 1Z47A 3K57A 3AMUA 3CRLC 4CHTB 3A7AB 4QIWB 3CU7A 4TRDA 3AU7A 5M5WB 1TS2A 1C8CA 1XX8A 3UI2A 2F0QA 3S9WA 2R92B 3Q23A 3GP7A 3LNNA 2WV6D 1SDFA 5CV7A 2PW5A 1UAPA 4A3BB 1NR4A 1AZPA 2XN9C 1BOSA 1EU4A 2QDBA 4ZKCB 5JPMC 2KA7A 2F4IA 3C2PA 3P1HA 3X3NA 4FO2A 3J81E 5FK9C 1EEFD 4Q0FA 5FLXL 4HN7A 1SNOA 1ENFA 5KNBA 1AZQA 1HQMC 3PMFA 1V8QA 2QEJC 4RGMA 3NTHA 3QG1A 2DY8A 1EY5A 1A3UA 1KNEA 5M9OA 4V0BA 3D31A 4N9TA 3GTJB 4K5VA 3MXUA 2F0KA 3VYSA 2LKVA 3HP3A 1B44D 4JBWA 3WOFA 1CHPD 2B39A 1F2ZA 4XT1B 3NBIA 1HPCA 1SYGA 2L11A 3D8GA 1KNAA 2BA1A 4C3JB 2ZXRA 5E4WC 4AYBB 5FO7B 4ABNA 3V96A 5CC4A 4ULLA 1JICA 5EQ0A 3BS1A 1JC7A 1IW7D 3EJIA 2G9HD 1EIGA 2XRSD 4OO1H 4G7OC 1CI3M 1V43A 5M3FB 3HOVB 3QWNA 2MGSA 1FGBD 1JQYD 1TS5A 2JXMB 3VR2A 5C0XJ 5CGKA 3BDLA 3PO2B 2L12A 2FHTA 3K0YA 1DD2A 1EY0A 1S4ZA 1GXDC 3I4MB 4A3DB 3EA6A 2K33A 2A68D 4QUFA 2BE5D 5IGCA 1D6EC 3K5NA 5HGTA 1B9NA 2JEAI 1JORA 3QB3A 1B50A 5JPNC 5EKKA 1LACA 2ZT9C 4FF3A 4WJWA 4ZKBB 5I9OA 3Q6SA 1I4XA 3PIO3 3RZDB 1AW7A 1KLUD 4PMWA 2LMCB 4K5WA 1PZKD 2F0PA 5KRUA 4ZYSA 2QKIC 4A3JB 1DCZA 1Q1EA 3P7JA 3HS0C 1EZ6A 2RQXA 3D6CA 3SDZA 3QOJA 5CORA 5IGDA 1TQOA 3WOEA 1PTOC 5C4JB 1SAPA 2B2VA 1CT1D 5EKLA 3VR4A 2DN8A 1TKWB 5C0XH 1JB3A 3BZDB 3NQTA 4IUUA 1NAPA 1IYVA 5FKAC 2WP8J 4Q5VA 2F0TA 4LAAA 3MAQA 1STHA 4DXGA 4DAYA 2D9UA 1II3A 2A5HA 4HTHA 3BYYB 1KDAA 4ZLTF 2VXWA 2E75C 1BO0A 2F03A 3I72A 2K04A 1AP0A 2VUMB 4P2CB 2NYZD 5JVG3 2EOTA 4XDXA 2K32A 2RDHA 1V1PA 1TWFB 1UEAB 4U673 1UNSA 2A74C 1PTOF 2ICIA 2NVTB 5FLXE 1FR3A 3K58A 3TBIB 2A6HD 1JOQA 3SE0A 2EVBA 3P20A 1PFNA 2A69D 4IFDJ 4CBVA 5EKIA 1EY4A 2AQ1B 2NB0A 1QNKA 1QWYA 2J4XA 3PUZA 4S3SA 1SMYC 1CQFA 4XQJA 4OGQC 1OXSC 4UDUC 3H94A 5JJZA 3E6ZX 3HOXB 4KI0A 2BOSA 2F0FA 1IW7C 1DJRD 2Z4IA 4XYOA 4A3IB 1F9RA 3VA7A 1PTOB 3R8BA 2AUKA 4A3MB 4DAVA 3NTKA 4K6LA 3M3YB 5J22A 4Z9CB 1KTKA 3G6JB 2OXPA 2F0NA 5EJWA 3I4LA 4RGTA 1D2BA 1J8IA 1CTMA 1BF4A 4C3HG 4BY1B 1M8AA 4BY7B 3DMUA 5I4DA 5ELDA 4CJ2C 1B1ZA 1QNUA 4IUQA 1X3PA 5LL6X 1O7ZA 1ZKOA 2IL8A 2M00A 1EY7A 2F0LA 2BE5C 1JWMD 2EYLA 2B2UC 3X3MA 3K7AB 3A55A 3T4AC 4H13C 2F0MA 1ZYRD 4IQZA 1XTCD 1TS4A 1QG7A 4X3TA 2PCFB 4I7ZC 3I4NB 3FVQA 1QILA 5FO9B 2XWJB 4HMJA 1PDQA 1CFMA 3SHLA 5KNDA 2M9VA 2BDOA 2Z4HA 1TWGB 2RBMA 4E6IA 4DXFA 4C56C 5IGFA 1TY0A 3TN2A 4A3KB 4XIGS 2DY7A 5G3LF 4TQUS 1U4PA 3D3RA 1PRTF 4PQXA 5CV8A 5T1IA 2K7VA 1RCVD 3S14B 2L0CA 2LFNA 1BR9A 1K8OA 2RVLA 2JA8B 4HSVA 4ZQ3A 3A56A 1JWUD 4KTAA 1CZWA 4O42A 2EY5A 2ZXOA 3DEPA 3MXNA 2K6AA 3CQZB 1GUSA 3EROA 5KGUA 2FJ2A 4HR7B 4PMCA 1LTRD 3NPPA 2ZXPA 3Q22A 5IGEA 1DM0B 4K14A 3D4DA 4IURA 3HEJA 4C2MB 3S17B 4NP5A 2DNCA 5C0XG 4RCNA 4IALA 1EWHA 4HMIA 1R4QB 4ZUJA 5DNFA 1SNCA 2PO4A 2B63B 1LO5D 1M4VA 2EYHA 5KEEA 4LJZC 5K36G 2WKCA 1DYQA 1PRTD 3CKIB 5C4XB 3DWPA 4DU9A 3GD7A 1HA6A 5A2QL 2IPKD 2JP1A 3SR1A 1T5XD 2XVSA 1VF7A 3FMCA 4KD3A 3ND8A 4RGNA 3HOYB 1IHZA 5C4HA 3PUVA 3VR6A 3QOLA 3GO5A 2ENBA 5FO8B 2MJ8A 5CV5A 3C1FA 1O7YA 4JK1C 1S5BD 1K8MA 1EY9A 4KMUC 2WB1B 3TP8A 4ZK9B 3LWEA 4KY7A 1GUGA 1RDPD 1QB5D 1BXTA 1WTOA 2XWBB 2O5JC 2F0SA 4J6HA 1STNA 4G57A 3MWYW 1Q12A 1L0YB 5KIXA 4QMGA 1A15A 4RGOS 2IWHA 4GZYC 5D3DA 4NKLA 5HURA 3VYTA 2O4XA 2JEBI 1B53A 1B4OA 4RFBA 4WRDA 4CJ0B 2F1MA 3FRPB 2EJMA 2EPBA 3LX0A 1V1OA 1STGA 1HFGA 1OXTA 4L8JA 1IL8A 3HKZB 1SMYD 3H3VC 3SK4A 4CJ1B 5CYUA 1TVXA 2CVRA 1G2SA 1KLGD 3KBXA 2IJ0A 4RHSA 3A7LA 2A6ED 4EGVA 4A3EB 3AB9A 3IL8A 3GTOB 2WKDA 3FDTA 5IT9E 1O78A 1E2ZA 4OO1I 4XQQA 4DF7A 1G6ZA 4L6TB 1I3QB 4XYQA 2JSOA 1W6KA 3I91A 4HCSA 1SNPA 3T13A 3KLRA 4FF4A 1A2TA 3HZXA 5K36H 2A6EC 3BVZA 3M85A 1WTVA 3URYA 5I6WA 2K5DA 4HEDA 2MUYA 4XTCS 3SK6A 3J81L 5D65A 3TZUA 2SNSA 1HFNA 2FMCA 1YNNC 2OT2A 5LHY1 3NQIA 1JR0D 3BVGA 2B2VC 4B9WA 1GUOA 3H0GB 3QJYA 1WTXA 1TU2B 1Y8PB 1C48A 1LT6D 4BBRB 3QIAA 4DK1A 1ET9A 3H09A 2C5CA 4A3GB 4DGZA 4MN3A 3BDCA 3SEBA 4RA8A 5K5PA 2NVXB 1F9PA 4RH6A 1X32A 3TP5A 4FXDA 4IFDH 5IODA 3HG9A 2EE1A 2I46A 3P75A 5TSSA 4IFDI 5CBEE 3HGBA 3S1RB 4FYDA 5D3IB 3NSWA 1FNWA 1PRTB 2LS01 1S5CD 3ERQA 3NHHA 3V05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV5 A;  3C1E A;  3C1F A;  3TP6 A;  4TRD A;  2F0F A;  3T16 A;  3NQT A;  4R8N A;  1F2M A;  1KAB A;  2OF1 A;  3MHB A;  4KY6 A;  4QB4 A;  5CV8 A;  1SNP A;  1EY9 A;  1STY A;  3TP8 A;  3SK5 A;  3T13 A;  2NUC A;  3MZ5 A;  5I6Y A;  2F0T A;  3MVV A;  2F0Q A;  2KQ3 A;  4LAA A;  5DEH A;  1STH A;  2F0I A;  5E3F A;  3S9W A;  2PW7 A;  1RKN A;  4ODG A;  4RKL A;  4KY7 A;  2WAC A;  2F0E A;  1II3 A;  4EQO A;  1A2T A;  3HZX A;  4HTH A;  5CV7 A;  2PW5 A;  3NP8 A;  3NK9 A;  5CGK A;  1ENC A;  1KDC A;  5KGU A;  2EXZ A;  1NUC A;  4ZQ3 A;  4WOR A;  5NUC A;  1KDA A;  4KY5 A;  2SOB A;  3VA5 A;  3BDL A;  3OMG A;  4NMZ A;  4KTA A;  5J22 A;  1U9R A;  1EY0 A;  2QDB A;  3D4W A;  1EYC A;  2EY5 A;  2F0S A;  2OXP A;  4J6H A;  5IGB A;  1STN A;  5I6W A;  2F0N A;  1SYF A;  4G57 A;  1EYD A;  3OMC A;  3P1H A;  5ISR A;  1EYA A;  1STB A;  5CR3 A;  3SK6 A;  5IGC A;  4EQP A;  2F0H A;  2EYJ A;  1EQV A;  1SYD A;  2F0D A;  3ERO A;  3EVQ A;  4B9X A;  2PYK A;  1TT2 A;  3DMU A;  4PMC A;  4EQN A;  5HGT A;  4ME5 A;  5KIX A;  1AEX A;  2F0J A;  4QMG A;  2EYF A;  4PNY A;  5CV6 A;  2PZU A;  4KV6 A;  1A3V A;  1SNO A;  2HQE A;  3U9O A;  1JOR A;  1SND A;  3QB3 A;  5IIF A;  1JOK A;  5IGG A;  5IGE A;  2SNS A;  5CV9 A;  5EKK A;  2EY6 A;  2EYO A;  4NKL A;  4K14 A;  5HUR A;  3D4D A;  4IUN A;  2O4X A;  3PMF A;  3HEJ A;  3H6M A;  4YIJ A;  1KAA A;  2F0W A;  2F0U A;  2F3W A;  1EY5 A;  2F3V A;  4WRD A;  5C5M A;  1KDB A;  2M00 A;  2EYP A;  4NP5 A;  3TME A;  3V2T A;  1A3U A;  2KHS A;  4B9W A;  3E5S A;  5M9O A;  4I65 A;  1EY7 A;  1STA A;  2F0L A;  3DHQ A;  4OL7 A;  4KJN A;  4N9T A;  2F0V A;  2EYL A;  4IAL A;  3LX0 A;  4HMI A;  4K5X A;  4K5V A;  1STG A;  4ZUJ A;  3TP7 A;  4PMB A;  1SYE A;  4K8J A;  5C3X A;  4ID6 A;  1A3T A;  2F0K A;  1SNC A;  5JOB A;  1TR5 A;  3NXW A;  2LKV A;  1ENA A;  2EY1 A;  1NSN S;  4QF4 A;  5JAV A;  5F2D A;  2EY2 A;  3SK4 A;  5KYI A;  2EYH A;  5KEE A;  4EVO A;  3RUZ A;  5C6A A;  4DGZ A;  4NDX A;  4F8M A;  4K5W A;  3BDC A;  1F2Z A;  3NUC A;  1SNM A;  1EZ8 A;  2EYM A;  2F0P A;  2SNM A;  4KD4 A;  5IOC A;  1SYG A;  2F0M A;  2RKS A;  4K8I A;  5C4Z A;  5K5P A;  3MEH A;  5E1F A;  4DFA A;  3D8G A;  5J39 A;  1JOQ A;  4DU9 A;  5I9P A;  5KRU A;  3MXP A;  5C3W A;  2F0G A;  3TP5 A;  2PZW A;  1SYC A;  1A2U A;  5I9O A;  4MIU A;  5J1Z A;  4H7B A;  5IOD A;  5C5L A;  5DAU A;  3SR1 A;  5KYL A;  4N9P A;  4HMJ A;  1EY4 A;  2OEO A;  3SK8 A;  3OWF A;  4F7X A;  3SHL A;  4J1M A;  4K6D A;  3P75 A;  4RKB A;  1EZ6 A;  1EY6 A;  4ZUI A;  4KD3 A;  3R3O A;  4S3S A;  1SNQ A;  2PZT A;  3D6C A;  4KHV A;  5CC4 A;  1F2Y A;  4K2L A;  2PQE A;  1SYB A;  5EGT A;  4DF7 A;  3QOJ A;  4K2K A;  2RBM A;  1IHZ A;  3OSO A;  5CV4 A;  3EJI A;  4E6I A;  3ITP A;  2F0O A;  5C4H A;  3QOL A;  1TQO A;  5IGD A;  5IGF A;  2RDF A;  2ENB A;  3SXH A;  3ERQ A;  3NHH A;  4IZ8 A;  5EKL A;  4KJO A;  1JOO A;  1EY8 A; 
#chains in the Genus database with same CATH topology
 1DON A;  3CHB D;  3R2T A;  1GUN A;  1OXV A;  1QOH A;  4DR7 L;  4M1U B;  2OF1 A;  3PO3 B;  2ALY B;  2YU9 H;  1SE2 A;  3I2Z A;  4B3T L;  3S1Q H;  3M4O B;  2R93 H;  3IFT A;  1STY A;  3SK5 A;  1OXU A;  3I7F A;  4C3I G;  4M8A A;  1HXY D;  2WAC A;  3L9A X;  4KHP L;  2EXD A;  3GTQ B;  3Q0A A;  5CBA E;  1EQR A;  4A3K H;  3S1M H;  2Q8T A;  1I4R A;  1B3A A;  1IYU A;  2UUA L;  1VQN A;  5M5Y B;  4K0K L;  3J81 j;  3HKS A;  1K9M C;  3BVM A;  4JBK A;  4RAU C;  1PLF A;  1LLR D;  3DWA A;  4LNQ A;  2F0H A;  1EQV A;  2F0D A;  4AYB G;  5C4X H;  4POG A;  2PYK A;  1K0R A;  1ML0 D;  3U9S A;  4O1N A;  3FEW X;  1CA5 A;  1CZG A;  4DV3 Q;  3NTI A;  4HSP A;  5CV9 A;  4HJA A;  4IUN A;  5EAY A;  1YNJ D;  4X64 L;  3C3L A;  1STE A;  3ZJY C;  3K0X A;  1KDB A;  3TME A;  3V2T A;  4LF4 L;  1IKM A;  3K5M A;  4EQ5 A;  3STB C;  2VNU D;  3IKJ A;  1D1K A;  2SDF A;  4LF6 L;  3OOC A;  3G7L A;  3PIP 3;  2LSS A;  3N6R A;  4HCE A;  4RWS C;  2J0T D;  5FOB B;  2R7D A;  3HOX G;  1AE2 A;  1ENA A;  1NSN S;  1Y1V B;  3T1Y Q;  4JOI C;  5JJK A;  2NVQ H;  4EX5 A;  5M3M B;  4N8X 1;  3U50 C;  4TSS A;  1ILP A;  2UXC L;  3K80 C;  1XXG A;  1BBW A;  1N32 L;  3K81 C;  2V4D A;  2F0G A;  3EFX D;  2KEE A;  4GN3 B;  1WTW A;  3MFG A;  1JWS D;  3PIP A;  1N33 L;  5C5L A;  5DAU A;  1VF5 C;  5E7N A;  4DV2 L;  2R7F A;  4X6A H;  2R6G A;  2K5Q A;  5EPK A;  1I94 Q;  3OIQ A;  1RD9 D;  1XYI A;  4R8I A;  4GOP C;  2B2T A;  3KF8 A;  4LF9 L;  2E2J H;  3W1B A;  2HCI A;  1EL0 A;  2ES2 A;  3CP0 A;  4IZ8 A;  1FNV A;  5T1G A;  4LUV A;  3KDF A;  1G6P A;  1HR0 W;  1PA6 A;  5JJL A;  1F2L A;  4QB4 A;  3DEO A;  2JA5 B;  2NVX H;  4DA2 A;  4BA2 I;  3ICE A;  1GHJ A;  2YU9 B;  2R93 B;  1G29 1;  2Z6B A;  1VDZ A;  2F0E A;  1BBX C;  1YHB A;  1WOC A;  3ND9 A;  3A5Z B;  3MXN B;  4CKC A;  2IX3 A;  1EU3 A;  1CA6 A;  4FF2 A;  4QUC A;  2A68 C;  4DNR B;  2M2L A;  3I70 A;  4FXK C;  2O2L D;  5EBC A;  2LXJ A;  3DXJ C;  1R4P B;  3E0J A;  4DV2 Q;  3HOU B;  3I3C A;  1STB A;  5LMU L;  2ZM6 Q;  2EYJ A;  1KL9 A;  4JYA L;  2CKZ B;  2AQ3 B;  3PCO B;  2JE6 I;  1JCK B;  1Q46 A;  1KQS A;  4N8F A;  2E2H B;  2AQ2 B;  2HQE A;  1JOK A;  4O0A A;  4A3E H;  3NBH B;  3D6W A;  4DR3 L;  4A93 B;  2HUG A;  1MIU A;  2KED A;  2X6L A;  1G51 A;  2R61 A;  1PMR A;  1ESF A;  1Q86 C;  2HIV A;  2I07 B;  2L55 A;  4JI3 Q;  1NMG A;  1ZXT A;  3AFP A;  3QR8 A;  4MTK A;  2I5L X;  3TEH B;  1EOV A;  3G71 A;  1MSG A;  3M3Y H;  1O80 A;  4GNX B;  1WTP A;  1BCP C;  2HIX A;  4JI4 L;  5I2Y A;  3ONA B;  3Q24 A;  4A93 H;  4XXE A;  3TRZ A;  4EVO A;  1MJC A;  3RUZ A;  2KCN A;  3W1G A;  1SNM A;  2PNH A;  3TRE A;  1PRT C;  3CF5 A;  1O7L A;  4MIU A;  4V19 0;  5J1Z A;  3PUY A;  1LV9 A;  2CHB D;  2Z6K A;  3HFZ B;  1YHA A;  2UU9 Q;  1Q8K A;  1TWH H;  4BA1 I;  2G5D A;  2QDL A;  3J81 i;  1H9S A;  3A8J E;  5BR8 L;  4DV6 L;  1B9M A;  2Q2T A;  2MPM A;  3SVM A;  5CMD A;  5LMN L;  3A8I E;  5G3L D;  4K2K A;  2N78 A;  2F0O A;  1RJT A;  3S15 B;  3K8A A;  3CQZ H;  4P72 A;  2JA7 B;  1NBW A;  1V1Q A;  3GTK B;  3HOZ G;  1GHK A;  5JEA H;  2Z8L A;  1H95 A;  4A3F B;  3EQL C;  1VMC A;  2N88 A;  3OTO Q;  1EWC A;  5ELC A;  1SRO A;  4JV5 L;  1RKN A;  4ODG A;  3RD4 A;  4EQO A;  3QO2 A;  4KKU A;  4IPG A;  3TQY A;  5IYB G;  2E5L L;  2A73 B;  1I4P A;  4WOR A;  4YWK A;  3VA5 A;  3OMG A;  3RNU A;  1PFM A;  1Q81 C;  1Y1W H;  1HRJ A;  1G91 A;  1LTT D;  1LTG D;  4LF6 Q;  1I6V C;  2JA8 G;  1EIF A;  2B2Y A;  3HRZ C;  3GV6 A;  3OWE B;  4JI6 L;  3M4P A;  3N52 A;  2K14 A;  3H0G G;  5LMN Q;  3IFD A;  3WWV A;  4APV A;  3F2C A;  3G4S A;  5IIF A;  4Y52 H;  4DV0 L;  1DOM A;  2RHQ B;  1YJN A;  5GQO A;  1Q8I A;  5GAD C;  3PO2 G;  1KAA A;  4DN4 M;  3VR3 A;  5DM6 3;  3A54 A;  1D1I A;  2VB2 X;  1H9M A;  4NW2 A;  2D2C C;  3FKI B;  2E8G A;  4HID A;  2VQE Q;  1CK1 A;  4DR2 Q;  3H3V H;  3OW7 A;  2XIW A;  3HOW B;  1E22 A;  3NXW A;  1B8A A;  4QF4 A;  4O2D A;  2EY2 A;  5C3E B;  2JYO A;  4OIK A;  3U58 A;  1HNW L;  1PFB A;  5KNC A;  4NDX A;  3BYT B;  1GUW A;  5IT9 L;  3KK7 A;  3RN5 A;  1IBK L;  5JJI A;  2CQA A;  5EBD A;  1X55 A;  2NZ1 D;  2CH4 A;  1A2U A;  1QVF A;  2DGY A;  3FKI G;  3I4N H;  2K1B A;  4A3L G;  4L63 B;  1U5K A;  4BY1 G;  4C3H B;  4A76 A;  4B3M Q;  5HY6 A;  3SK8 A;  5IYD G;  4MTN A;  2BDN A;  1JB7 A;  4X3K A;  4KK7 A;  1Z7T A;  3STB D;  1FYC A;  4DR4 Q;  3GTL H;  3GTL B;  4DUZ Q;  4A3D H;  3GTQ H;  4A3C H;  1VMP A;  5M5Y H;  1YJW A;  1ROD A;  2UXB L;  1J5E L;  4DAP A;  3ERS X;  1JE4 A;  4C3H H;  1EY8 A;  1EQT A;  2QF7 A;  1PTO D;  1K8G A;  4R8N A;  1F2M A;  1H9K A;  4KY6 A;  1HNZ Q;  3E0E A;  4L5Q A;  1MI2 A;  1E1T A;  2TSS A;  1KC8 C;  4BBR H;  4P74 A;  4HIK A;  1XNR Q;  1JJC B;  1HUM A;  1E2W A;  1ENC A;  1ILQ A;  1KDC A;  2E76 C;  5JEA J;  1SFO H;  2WIN B;  2C9O A;  4KY5 A;  3IRB A;  3GDE A;  4DNI A;  4B3S Q;  1HNX L;  1EYC A;  1I50 B;  1LAB A;  3I4N G;  1A6X A;  4ZRZ A;  3PUW A;  3NEM A;  4DR5 Q;  1SYF A;  3K6O A;  4AYB E;  3OMC A;  2CW0 C;  2YTV A;  4NXN L;  3LGJ A;  2D0O A;  2EYF A;  3L0O A;  1BCP B;  2PZU A;  4KV6 A;  4GKK L;  1RHP A;  3IAY A;  2BA0 A;  1KRT A;  2EY6 A;  1DZ1 A;  3NEL A;  1XWE A;  3K5O A;  5M3M G;  3H6M A;  5HGQ A;  2F0W A;  1K8A C;  1ET6 A;  4QL5 A;  4DV1 Q;  2PMZ E;  2E2I B;  1VQK A;  1Q90 A;  4OL7 A;  2F0V A;  4JI8 Q;  1K3R A;  2Z1C A;  1CKN A;  3JAM L;  5D14 A;  3D4R A;  4PMB A;  1SSO A;  2RDG A;  4J15 A;  3RZO B;  4LK1 C;  3I90 A;  4HJ8 A;  3S1Q B;  1BQQ T;  5LMU Q;  1DXM A;  5C6A A;  2MHV A;  1I4Q A;  1A63 A;  1G8Z D;  3OHX C;  2BCO A;  1EWI A;  2RKS A;  3J80 L;  3K5L A;  1ZYR C;  4DFA A;  5I9P A;  1FVI A;  1AH9 A;  2V1C C;  1I3Q H;  1QCB D;  4L5R C;  3T53 B;  4UP8 A;  2VB3 X;  1PYW D;  1HJP A;  1IZ6 A;  2A6H C;  1IXR A;  3L7Z C;  1G2T A;  4N9P A;  2N3S A;  2OQK A;  1DOL A;  4F7X A;  1GJX A;  5IWA L;  4ZUI A;  3R3O A;  5IYB H;  2PZT A;  1Q1B A;  1VQE A;  3RLN A;  2H4O A;  1NE3 A;  3OSO A;  4DR6 L;  1FD7 D;  2GN5 A;  3A0J A;  4YCW A;  4PZ6 A;  1QUQ B;  1D5X C;  3C1E A;  5AJ3 Q;  1PH9 A;  1L2F A;  2IT1 A;  1GOZ A;  2UUB L;  5DEH A;  3KLS X;  1ICF B;  4QIW E;  3VYU A;  4JI1 L;  2B2Y C;  2CW0 D;  1ONL A;  1HA5 A;  1ASZ A;  3MA2 B;  2F4V Q;  2B63 H;  1I6H B;  3OPO A;  4NMZ A;  1CM9 A;  1U9R A;  1FGU A;  4G7H C;  1I5F A;  2IX1 A;  1EYG A;  4GKJ L;  3ULP A;  1U4M A;  4BS9 A;  1P16 A;  3CC2 A;  2Q8I B;  1I50 H;  4GNX A;  4XQN A;  4EQP A;  5C4J H;  3EVQ A;  5JVH 3;  1GD7 A;  3KF6 A;  1HCZ A;  5CV6 A;  4PNY A;  3I73 A;  2NVY B;  1SND A;  4JV5 Q;  2K4K A;  3NWT A;  2KCC A;  1TWH B;  4YIJ A;  3PV0 A;  1MBY A;  5IP9 G;  1BUV T;  1STA A;  1EEI D;  2F3I A;  2XNA C;  4B3R Q;  4IPH A;  1SYE A;  1WI5 A;  1PHJ A;  1A3T A;  2AWN A;  5BN4 A;  5JOB A;  3R93 A;  5C44 B;  2WB1 G;  1TR5 A;  5M5X B;  2K5V A;  4YHH L;  5JAV A;  4FXG C;  1ICW A;  3T56 B;  4X62 L;  1VQD A;  3WDN A;  2Z6K C;  1EZ8 A;  1I4G A;  1F9S A;  1O7I A;  4PV1 C;  2QCP X;  2JA7 H;  2GA4 B;  4BBS G;  3HKZ E;  2PMZ B;  4JG2 A;  2QEX A;  3MXP A;  4KHZ A;  3ULJ A;  3GTJ H;  3S2D B;  3S24 A;  5AFW A;  4A3F G;  2FMM A;  1GUT A;  3NWS A;  3R2I A;  2WAQ B;  4LFB Q;  2EDG A;  2K5W A;  4RKB A;  1WTR A;  3KLW A;  5A2Q E;  3KLS A;  3HOU H;  3W2D A;  3S2H B;  4JI2 Q;  4UY8 C;  1IYJ B;  4G7Z C;  1NY4 A;  3PF4 A;  5CV4 A;  3BDO A;  1IKL A;  5I2X A;  3ITP A;  1LT3 D;  2O5I C;  2RSO A;  4LF8 Q;  3CD6 A;  4C3J H;  1K83 B;  5EPL A;  1F77 A;  3CW2 C;  4DAY B;  1LT4 D;  3TP6 A;  1AFP A;  1E2V A;  1SJH D;  2ZTC A;  1R9T H;  1PYS B;  2NVQ B;  2VQF Q;  1S5D D;  1H9R A;  2NUC A;  3T1H L;  5E3F A;  1NTG A;  5M3M H;  2PW7 A;  4RKL A;  1QVC A;  4KKT A;  1LTS D;  2EXZ A;  2KHJ A;  5C44 H;  2EJG C;  3GQB A;  3PO3 G;  2SOB A;  2FIN B;  3GTK H;  2JA6 G;  1BDO A;  4GOP A;  2NTT A;  3J7A F;  1D5Z C;  3D4W A;  3S1N B;  4A3F H;  4GS3 A;  4X66 Q;  3CCE A;  4OO1 G;  3M7N A;  1CKN B;  1EYD A;  3GV3 A;  1BVS A;  4LFB L;  5ISR A;  1PV4 A;  3KF6 B;  3S2D H;  4YY3 L;  1V1P B;  4C3I B;  2L4N A;  4EQN A;  4ME3 A;  2HCC A;  4OHJ A;  2KEC A;  1VQ7 A;  1KRS A;  5L37 A;  2NBF A;  3MEF A;  4IN3 A;  2Q8R E;  1XNR L;  1EOT A;  4BBR G;  1WTH A;  1B7Y B;  1Y14 B;  2EYO A;  4IUT A;  4IO9 A;  4R4C A;  4X3U A;  1E0B A;  1GO3 E;  4DK0 A;  5C5M A;  2Y0S G;  2RCF A;  1Y69 U;  2MQH A;  2QIL A;  4KJN A;  2K03 A;  1SEB D;  3W5O A;  1T5E A;  1X3E A;  3T1H Q;  3RZO H;  1SE4 A;  4K8J A;  5C3X A;  3FP9 A;  4A4I A;  2AWO A;  2RSN A;  3S16 H;  3S16 B;  2A19 A;  4DV7 L;  4NXM Q;  2XTI A;  1YVC A;  5GAG C;  1X54 A;  5FLX c;  1VQM A;  3NUC A;  3TSS A;  4KD4 A;  1PFS A;  5IOC A;  2SNM A;  3K59 A;  4K8I A;  2L1B A;  2E2D C;  1W6J A;  5IYD H;  3MEH A;  3CCR A;  3M4O H;  3CME A;  4BY1 H;  2PZW A;  2KVM A;  1X3Q A;  4MZ9 A;  1SN8 A;  1GKH A;  2AUJ D;  2KJX A;  1WD1 A;  4JI0 Q;  5KYL A;  1FJG L;  3DUZ A;  2ZM6 L;  1ASY A;  2B2W A;  2FFK B;  5ELE A;  4X3S A;  1EY6 A;  3GTP H;  1SNQ A;  1VQO A;  4YCU A;  2B8F A;  1AE3 A;  2JQO A;  2PQE A;  1LTB D;  1BCP D;  4U68 A;  2GVA A;  3NE5 B;  3GTM B;  5EPJ A;  4DR3 Q;  4R4T A;  1PXU A;  2UUA Q;  2OCE A;  4TVA B;  2FXQ A;  4GLV B;  2N55 A;  1HH2 P;  4CGY B;  4FP5 D;  2B2U A;  3MZ5 A;  3MVV A;  1EFI D;  2KQ3 A;  2X69 A;  2JA6 H;  2UXD Q;  5C44 G;  1ESR A;  2JA9 A;  3CPF A;  4HIM A;  2UUC L;  2E2J B;  1PTO H;  2Y0S E;  5IWA Q;  3HOY G;  1IBM L;  3BG3 A;  4FDB A;  4ILW A;  3F2U A;  2I5M X;  2K28 A;  4LF4 Q;  1QE6 A;  1WVL A;  3ULL A;  4QQB X;  1VQ9 A;  3MFY A;  4OX9 L;  4IFD G;  4CKB A;  3CMA A;  4NB3 A;  1X3G A;  1PZI D;  4OWT B;  2XSC A;  1Y1W G;  4F88 A;  2D62 A;  2KEN A;  3CPW A;  2LY7 A;  1SYD A;  4MNO A;  1S5F D;  3DWQ A;  1TT2 A;  3LWU A;  4C3J G;  1WTQ A;  4ME5 A;  5C0X I;  1AEX A;  3MXG A;  1YNJ C;  3I4O A;  3JAM E;  5IGG A;  1CHQ D;  5IT9 c;  3S2H H;  3A8K E;  4IUP A;  2K05 A;  3VYR A;  4RG1 A;  2R3Z A;  1N34 Q;  3VR5 A;  2R92 H;  2TMP A;  4H0L C;  2F3V A;  2EYP A;  1PH7 A;  4HIO A;  1Q3L A;  2IW3 A;  4I65 A;  1X6O A;  1VQ4 A;  3C46 A;  3HOZ H;  1Y1W B;  4K5X A;  1VCI A;  2YV5 A;  3TP7 A;  5COY A;  3L3O C;  1IBL L;  5M5X H;  1HTP A;  2EY1 A;  4HJ7 A;  1BNZ A;  1R9T B;  5F2D A;  3TZD A;  5KYI A;  1S5E D;  4C1N K;  1SJE D;  4F8M A;  3KOJ A;  2E5L Q;  3HOY H;  1MD2 D;  2KUM A;  3J7A V;  2EYM A;  2D5D A;  4YWL A;  3PUX A;  3AQQ A;  1RTN A;  4UAI A;  5E1F A;  5J39 A;  1UE6 A;  2L5T A;  4POF A;  2B8G A;  1NCV A;  3J81 c;  2EZV A;  1TXY A;  3NBH A;  1VQF A;  3M7G A;  4OIJ A;  1SE3 A;  5IP9 H;  3CRK C;  4F87 A;  2Z9H A;  1T9H A;  2NWG A;  1F2Y A;  3W3A A;  1SYB A;  4LFA Q;  3J80 E;  3GTP B;  1VQH A;  4LMQ D;  1NR2 A;  1IL2 A;  2RDF A;  2RA4 A;  2HD3 A;  3MTS A;  3GTG B;  3GTO H;  2Y0S B;  1CSQ A;  1VQI A;  4IUV A;  4B08 A;  4BWG B;  2PNR C;  1Y1V G;  3MC0 B;  1DGS A;  2UXC Q;  1KAB A;  2B2T C;  3MHB A;  1YNN D;  4YY3 Q;  1JT8 A;  1EIH A;  2J7Z A;  3RMH A;  3A74 A;  2K52 A;  4JCV E;  2HDM A;  3DM1 A;  3E9H A;  2NN6 I;  2HQL A;  4BY7 G;  1SBB B;  5E4X A;  2B63 G;  3T51 B;  4A3C G;  2SEB D;  3HOZ B;  2L9H A;  3BZK A;  3NEN A;  1I94 L;  3NP8 A;  3H91 A;  4JBJ A;  5BN3 A;  5NUC A;  1DOK A;  3UE1 A;  4LF8 L;  3PF5 A;  5ELN A;  5BN5 A;  1WD0 A;  4IPD A;  1NNX A;  5IGB A;  4OEM B;  1E24 A;  1TII D;  3M4Y A;  1XPR A;  1TWA B;  4FNF A;  2DNE A;  3TDQ A;  4CKE A;  2LXK A;  2HDL A;  5CR3 A;  1I4H A;  1RTO A;  4OWX B;  4Y7N H;  4Y7N B;  3UE0 A;  4B9X A;  2NN6 H;  3HOV G;  2F0J A;  4DPG A;  1D5M C;  4IJL A;  2N8N A;  1WCM B;  1HUN A;  1GM5 A;  4G4K A;  4C1N I;  3S1M B;  4RMF A;  5ELF A;  4A3I H;  2F0U A;  2F3W A;  3CAM A;  1SFO B;  3DHQ A;  4AIM A;  2B2W C;  2EIF A;  1TS3 A;  1L0X B;  2YTX A;  1KAW A;  1MGS A;  1TY2 A;  4ZAI A;  1X9N A;  5A35 A;  1UUP A;  3H0G H;  1U4L A;  2A69 C;  2KOL A;  4FF1 A;  3OIP A;  1SYC A;  2X6G A;  2H1E A;  3RLF A;  4AQY Q;  1PH4 A;  2UXD L;  1HZ9 A;  4K6D A;  2VY3 A;  3I8Z A;  4DKA C;  2KHI A;  4TKO B;  4KHV A;  1E3P A;  4K2L A;  4PZ7 A;  5EGT A;  5H1S E;  1HQR D;  3KBG A;  3L2P A;  4DK3 C;  1LYL A;  1VQ5 A;  1HZA A;  2NN6 G;  1PZJ D;  2K01 A;  3CCU A;  3SXH A;  3EIV A;  2EJF C;  2JA6 B;  3HOV H;  1J9O A;  1F9Q A;  4KJO A;  1JOO A;  4CDF C;  1YIT A;  2QGQ A;  1LTI D;  3T16 A;  5JEA G;  1PH5 A;  1Y8O B;  2R7Z B;  5DM7 3;  4XT3 B;  1UE7 A;  5I6Y A;  4BBS B;  2P5Z X;  4I7A A;  2F0I A;  2IX0 A;  1U0L A;  3FPP A;  1CQV A;  3E3X A;  3T1Y L;  1QZH A;  2XRQ D;  2ICE C;  1N34 L;  4QCL A;  3NK9 A;  1NUC A;  1UE5 A;  2NZH A;  1OXX K;  4WFN 3;  1C7Y A;  2RHS B;  4QGU A;  2IHF A;  1BCP F;  1N8R C;  4GLA C;  2NTS A;  4R9W A;  2D0P A;  2WAQ E;  1SXT A;  1TWC B;  1EYA A;  1EFW A;  4KN7 C;  1KHI A;  1U4R A;  2B3G A;  5ELB A;  4YWM A;  4A3K G;  1HZB A;  1HNW Q;  5GRO A;  4JW0 A;  2MP1 A;  2WII B;  3FPU B;  1YIJ A;  1S72 A;  4KN4 C;  1A3V A;  3U9O A;  1IBK Q;  4DR6 Q;  1HTL D;  5GAE C;  4RHR A;  3RZD H;  1OO9 B;  4UP7 A;  1LTA D;  1C0A A;  5AJ3 L;  1H9J A;  4H44 C;  5C3W A;  4H02 A;  2YTY A;  1B2T A;  2KHS A;  3E5S A;  4JI5 L;  4DNT B;  5M3F G;  4RCO A;  4ID6 A;  1LT5 D;  2C35 B;  3J7Y W;  3CCV A;  3HOW H;  3D0F A;  1FNU A;  1C4Q A;  1RF2 D;  3O13 A;  4MHE A;  1AN8 A;  2UXB Q;  3PQI A;  4FVM A;  1Z6H A;  3B6Y A;  1HHV A;  2ID0 A;  5C4Z A;  1MJE A;  5LL6 S;  2ATW A;  4HJ5 A;  4J8Q A;  1EQQ A;  1E1O A;  1Y8N B;  2ZJQ A;  4HAE A;  2G9D A;  1QJO A;  2E74 C;  4H7B A;  2PPB C;  3KUP A;  1PH3 A;  2YYZ A;  4L5S A;  1LTL A;  2OEO A;  1ZEQ X;  3OWF A;  4J1M A;  1MSH A;  4KKS A;  3ZYY X;  4DR1 L;  4NPS A;  1H9S B;  1Z47 A;  3K57 A;  3AMU A;  3CRL C;  4CHT B;  2MO0 A;  1L1O A;  4B3S L;  4DR5 L;  3A7A B;  2PI2 E;  4QIW B;  3CU7 A;  4TRD A;  3BZC A;  3AU7 A;  1A0I A;  5M5W H;  5M5W B;  2MO1 A;  4P73 A;  2EQS A;  4JI3 L;  1S3O A;  1TS2 A;  1C8C A;  1XX8 A;  3UI2 A;  2PQA A;  2F0Q A;  3S9W A;  4GKK Q;  2R92 B;  5J3B A;  3RR5 A;  3Q23 A;  3GP7 A;  3LNN A;  2WV6 D;  3H3V I;  1SDF A;  4LF7 Q;  5CV7 A;  4PG3 A;  2PW5 A;  1UAP A;  4A3B B;  1NR4 A;  2GVB A;  4A3J G;  1AZP A;  4DV1 L;  4QJF A;  2XN9 C;  1BOS A;  1EU4 A;  2QDB A;  4ZKC B;  5JPM C;  1A62 A;  1TWA H;  1N33 Q;  3U4Z A;  3S1R H;  2KA7 A;  2F4I A;  3C2P A;  3P1H A;  4A3I G;  3X3N A;  4FO2 A;  3J81 E;  2PQA B;  5FK9 C;  1EEF D;  4Q0F A;  1KD1 C;  2ZJP A;  2KBN A;  4P75 A;  4HN7 A;  1SNO A;  1ENF A;  5FLX L;  5KNB A;  1AZQ A;  1HQM C;  3PMF A;  1V8Q A;  2QEJ C;  4OWW B;  4RGM A;  3NTH A;  3QG1 A;  2DY8 A;  1EY5 A;  5IE8 A;  2BH8 A;  2NVT H;  1A3U A;  1KNE A;  5M9O A;  1X65 A;  4V0B A;  3D31 A;  1HNX Q;  4N9T A;  3GTJ B;  2VQF L;  4K5V A;  3J7Z C;  3MXU A;  2F0K A;  1KXL A;  2KCM A;  3VYS A;  2LKV A;  3HP3 A;  1B44 D;  4JBW A;  3WOF A;  1CHP D;  2B39 A;  1F2Z A;  4XT1 B;  3NBI A;  4LUO A;  4A93 G;  1HPC A;  1SYG A;  1V9P A;  2L11 A;  3D8G A;  1KNA A;  2BA1 A;  4C3J B;  4B3T Q;  1HR0 Q;  2ZXR A;  5E4W C;  3F2B A;  2MFI A;  2IHE A;  4AYB B;  5FJ8 H;  2QA4 A;  5FO7 B;  1VQL A;  4ABN A;  3V96 A;  2XGT A;  4JI1 Q;  5CC4 A;  1SRU A;  4ULL A;  1XMQ L;  3JC6 6;  1JIC A;  1Q7Y C;  5EQ0 A;  3BS1 A;  1JC7 A;  1IW7 D;  3RN2 A;  3EJI A;  2G9H D;  4C3I H;  4R1J A;  1RIP A;  2CQO A;  1EIG A;  2A8V A;  2XRS D;  1W2B A;  4R4I A;  4A3L H;  2R7Z H;  1JJG A;  1SMX A;  4OO1 H;  2QW7 A;  4G7O C;  2A1A A;  1CI3 M;  1K3B C;  1V43 A;  5M3F B;  3HOV B;  3QWN A;  3UDX A;  2MGS A;  1FGB D;  1JQY D;  1TS5 A;  2JXM B;  1PH8 A;  1D8L A;  3VR2 A;  5C0X J;  5CGK A;  3GTG H;  1BKB A;  3BDL A;  3PO2 B;  2L12 A;  2FHT A;  3K0Y A;  1DD2 A;  1EY0 A;  1S4Z A;  1GXD C;  2OQ0 A;  3I4M B;  2IY5 B;  2H5X A;  4A3D B;  1L1O C;  3EA6 A;  2K33 A;  2A68 D;  4QUF A;  3PSI A;  2BE5 D;  5IGC A;  4DR7 Q;  4B3M L;  5BR8 Q;  4X62 Q;  1D6E C;  3K5N A;  5HGT A;  1B9N A;  2JN4 A;  2JEA I;  1VQB A;  1JOR A;  3QB3 A;  1B50 A;  5JPN C;  5EKK A;  4A3G H;  1LAC A;  2ZT9 C;  2DJG C;  4FF3 A;  1BBU A;  4WJW A;  4ZKB B;  5I9O A;  5IY0 A;  3Q6S A;  4DV5 L;  2JA5 G;  1TWF H;  1I4X A;  3PIO 3;  1HNZ L;  4KLK A;  2L15 A;  3RZD B;  1XPO A;  1AW7 A;  3OW2 A;  3CCS A;  1KLU D;  4PMW A;  3KDF B;  2LMC B;  3KYH C;  4K5W A;  1X3F A;  1PZK D;  2F0P A;  5KRU A;  4ZYS A;  5DLQ E;  4LW1 A;  2QKI C;  5GAH C;  1DCZ A;  4A3J B;  3CC4 A;  4WJ4 A;  1TWG H;  2K5H A;  1N9W A;  4IOC A;  1XJV A;  1LUZ A;  1Q1E A;  3P7J A;  5FLM G;  3HS0 C;  1D7Q A;  1EZ6 A;  2RQX A;  3D6C A;  1KIX A;  3SDZ A;  3QOJ A;  4DV0 Q;  3JAM i;  3JAM c;  5COR A;  5IGD A;  1YNX A;  1TQO A;  3WOE A;  1PTO C;  5C4J B;  3KFU A;  1SAP A;  3H15 A;  5C4X G;  2B2V A;  1CT1 D;  5EKL A;  1B3Q A;  3VR4 A;  2DN8 A;  1TKW B;  5C0X H;  1N32 Q;  1JB3 A;  1YBY A;  3BZD B;  3NQT A;  4IUU A;  1NAP A;  1IYV A;  5FKA C;  2WP8 J;  4Q5V A;  4DK6 C;  2F0T A;  4LAA A;  3MAQ A;  1STH A;  4DXG A;  4DAY A;  2D9U A;  3S14 H;  1N36 L;  3CCQ A;  1II3 A;  2A5H A;  4HTH A;  5IP7 G;  2JK8 A;  3BYY B;  3FHW A;  1KDA A;  2WAQ G;  4ZLT F;  5FLM H;  2VXW A;  2E75 C;  2R93 G;  1BO0 A;  2CWA A;  2F03 A;  3I72 A;  2K04 A;  4AQY L;  1AP0 A;  2PI2 A;  2VUM B;  4P2C B;  2E2H H;  3TS2 A;  4A3E G;  2NYZ D;  5JVG 3;  2EOT A;  1Q82 C;  4XDX A;  1PH6 A;  2ZTE A;  2CCZ A;  4UHV A;  4OEL B;  3U4V A;  1PYB A;  2K32 A;  2RDH A;  1X56 A;  2ZTD A;  1V1P A;  1TWF B;  3PO3 H;  4A3B H;  1UEA B;  4U67 3;  2OWO A;  1UNS A;  2A74 C;  1UE1 A;  4WJ3 M;  1PTO F;  2ICI A;  2K5N A;  2NVT B;  5FLX E;  1FR3 A;  1CKM A;  3K58 A;  3TBI B;  2A6H D;  1JOQ A;  3SE0 A;  2EVB A;  3S15 H;  3HKZ G;  3P20 A;  1PFN A;  3K7U C;  2A69 D;  4IFD J;  4CBV A;  3DLL A;  5EKI A;  4GKJ Q;  1CKO A;  3CCM A;  1EY4 A;  1RL2 A;  2AQ1 B;  2NB0 A;  1QNK A;  4HJ9 A;  1QWY A;  3BJU A;  2J4X A;  3PUZ A;  4S3S A;  3I4M G;  1TWC H;  3G6E A;  1UWV A;  1SMY C;  1CQF A;  2JJQ A;  4XQJ A;  4OGQ C;  1OXS C;  4UDU C;  3H94 A;  2DUD A;  2ZJR A;  5JJZ A;  3E6Z X;  5M3F H;  3HOX B;  4KI0 A;  2BOS A;  2I0Q A;  2DJF C;  3I55 A;  3PGZ A;  2F0F A;  3E9I A;  1IW7 C;  4JI5 Q;  1DJR D;  1L1O B;  2Z4I A;  4XYO A;  4A3I B;  5C3E G;  3KJO A;  2JA7 G;  1F9R A;  4BBS H;  3J7A 5;  3VA7 A;  1PTO B;  3R8B A;  2AUK A;  4A3M B;  2CWP A;  1MKH A;  4DAV A;  3NTK A;  4K6L A;  3EN2 A;  3M3Y B;  1K83 H;  5FJ8 G;  5J22 A;  1WCM H;  4Z9C B;  1KTK A;  3G6J B;  2OXP A;  1IBL Q;  2F0N A;  4P71 A;  2HHH L;  1OTC A;  5EJW A;  3I4L A;  4RGT A;  4LUZ A;  1D2B A;  1J8I A;  1CTM A;  1BF4 A;  4LFC L;  4C3H G;  4BY1 B;  3J80 c;  1YEZ A;  1JMC A;  1W3S A;  3OTO L;  1M8A A;  4BY7 B;  3DMU A;  5I4D A;  5ELD A;  2CH4 W;  1XNQ L;  4A3M G;  4CJ2 C;  1L0W A;  1B1Z A;  1QNU A;  4IUQ A;  4A3D G;  1X3P A;  5LL6 X;  5C3E H;  4LF9 Q;  1VQA A;  1O7Z A;  1ZKO A;  2IL8 A;  2M00 A;  1EY7 A;  2F0L A;  3FKI H;  2BE5 C;  1JWM D;  4OX9 Q;  2EYL A;  2AHO B;  2B2U C;  3X3M A;  1NMF A;  2K75 A;  3K7A B;  2N49 A;  4JI6 Q;  3CXC A;  3A55 A;  3T4A C;  4UPA A;  2F4V L;  1VQG A;  4H13 C;  2F0M A;  1ZYR D;  4IQZ A;  1XTC D;  1EIY B;  1TS4 A;  1QG7 A;  4X3T A;  2PCF B;  4I7Z C;  1P8L A;  1QZG A;  3I4N B;  3FVQ A;  1QIL A;  5FO9 B;  2XWJ B;  4HMJ A;  1PDQ A;  1CFM A;  3SHL A;  5KND A;  3PO2 H;  2M9V A;  2BDO A;  2Z4H A;  1TWG B;  2RBM A;  4DXF A;  4E6I A;  4C56 C;  5IGF A;  1TY0 A;  3TN2 A;  4A3K B;  4XIG S;  2DY7 A;  5G3L F;  4TQU S;  1U4P A;  3D3R A;  1PRT F;  4B3R L;  4PQX A;  5CV8 A;  5T1I A;  4NXN Q;  2K7V A;  2VL6 A;  1RCV D;  4X65 L;  3S14 B;  2L0C A;  2LFN A;  1BR9 A;  1K8O A;  2VW9 A;  4JI4 Q;  2RVL A;  2JA8 B;  4NXM L;  4HSV A;  2WFW A;  4UP9 A;  4ZQ3 A;  1Z9F A;  3A56 A;  1YJ9 A;  1JWU D;  4KTA A;  1CZW A;  4O42 A;  1J5E Q;  4ALP A;  2EY5 A;  2ZXO A;  3DEP A;  3MXN A;  1JJ2 A;  3DM3 A;  4JI0 L;  1FJG Q;  2K6A A;  3CQZ B;  1GUS A;  3ERO A;  5KGU A;  4DR1 Q;  2FJ2 A;  4HR7 B;  4PMC A;  1LTR D;  3NPP A;  5IP7 H;  1FL0 A;  4DV6 Q;  2ZXP A;  3Q22 A;  5IGE A;  1DM0 B;  2RF4 A;  3S1N H;  4BY7 H;  4BXX G;  1J6Q A;  4K14 A;  3D4D A;  4IUR A;  3HOW G;  1VQ6 A;  3HEJ A;  4CDE C;  4OXP A;  4C2M B;  3S17 B;  4NP5 A;  2VUM G;  4DV4 L;  2DNC A;  5C0X G;  1M90 C;  4LF5 L;  4RCN A;  4IAL A;  3G48 A;  2Q2H A;  1EWH A;  4HMI A;  1R4Q B;  4ZUJ A;  3AEV A;  5DNF A;  1SNC A;  2PO4 A;  3PIO A;  2B63 B;  1LO5 D;  1K73 C;  3OYY A;  4IJH A;  1M4V A;  2EYH A;  5KEE A;  4LJZ C;  5K36 G;  2WKC A;  1DYQ A;  1PRT D;  1VQP A;  1IBM Q;  3CKI B;  4PZ8 A;  5C4X B;  3DWP A;  5ELO A;  4DU9 A;  3GD7 A;  3GTM H;  1HA6 A;  5A2Q L;  3ER0 A;  2IPK D;  2JP1 A;  2HT1 A;  3Q8D A;  3SR1 A;  1T5X D;  2VUM H;  1WCM G;  2XVS A;  4IOA A;  1VF7 A;  4JI8 L;  1K0S A;  3FMC A;  4KD3 A;  3ND8 A;  2BH2 A;  2OTJ A;  4RGN A;  1HZC A;  3HOY B;  1IHZ A;  4AH6 A;  5C4H A;  3PUV A;  2CFM A;  3VR6 A;  3QOL A;  5IYC G;  3GO5 A;  2MNA A;  2ENB A;  4DUY L;  1GVP A;  5FO8 B;  4DV4 Q;  2MJ8 A;  5CV5 A;  3C1F A;  2K50 A;  4IPC A;  1XMO Q;  4LF5 Q;  1O7Y A;  4JK1 C;  4LFC Q;  1S5B D;  3F2D A;  1K8M A;  3VDY A;  1EY9 A;  4KMU C;  2WB1 B;  3TP8 A;  4C2M H;  4LWC A;  4A3G G;  2Q2U A;  4ZK9 B;  1NJI C;  3LWE A;  4KY7 A;  1GUG A;  4X64 Q;  1WFQ A;  1SR3 A;  4ZCK A;  1RDP D;  2F52 A;  1QB5 D;  3CC7 A;  1CUK A;  1BXT A;  1WTO A;  2XWB B;  2ASB A;  3EBE A;  1HR0 L;  3UDF A;  2O5J C;  4JI7 Q;  2F0S A;  4J6H A;  1JE5 A;  1STN A;  1YZ6 A;  2RCN A;  2UU9 L;  4G57 A;  3MWY W;  1Q12 A;  1L0Y B;  1CSP A;  3CCL A;  1XMQ Q;  1PVO A;  5KIX A;  2UUB Q;  1YI2 A;  4QMG A;  1A15 A;  4RGO S;  2IWH A;  1LM0 A;  1VQ8 A;  4JBM A;  5D3D A;  4GZY C;  4NKL A;  4LFA L;  5HUR A;  3VYT A;  2O4X A;  2JEB I;  1B53 A;  1B4O A;  1EUJ A;  3K7A H;  4GLX A;  4RFB A;  4WRD A;  1XMO L;  2VZA A;  1I6H H;  4R4Q A;  4CJ0 B;  2R7Z G;  2JA8 H;  1E7Z A;  2F1M A;  3FRP B;  2EJM A;  2EPB A;  3KJP A;  3LX0 A;  4JC0 A;  1STG A;  1V1O A;  1HFG A;  1OXT A;  4JI2 L;  3AYH B;  4L8J A;  2HHH Q;  1IL8 A;  3M4Q A;  3HKZ B;  1SMY D;  3H3V C;  3SK4 A;  1N36 Q;  4CJ1 B;  5CYU A;  1TVX A;  2CVR A;  1M1K C;  3CCJ A;  2B29 A;  1G2S A;  1QUQ A;  1XNQ Q;  1B70 B;  1YHQ A;  1KLG D;  3KBX A;  3HOX H;  2IJ0 A;  4RHS A;  4JI7 L;  4JOI A;  3A7L A;  2A6E D;  4EGV A;  4A3E B;  3AB9 A;  3I56 A;  3IL8 A;  3GTO B;  2WKD A;  3FDT A;  3UDG A;  5IT9 E;  2OTL A;  1O78 A;  1E2Z A;  5IYC H;  4OO1 I;  4XQQ A;  1UEB A;  2AKW B;  4DF7 A;  4YHH Q;  4A3M H;  1XPU A;  1C9O A;  3AFQ A;  1G6Z A;  1VQJ A;  4L6T B;  1I3Q B;  4XYQ A;  4QY7 A;  4X66 L;  4DV5 Q;  2JSO A;  1W6K A;  3I91 A;  2VQE L;  1Y1V H;  4DR2 L;  4HCS A;  2WB1 E;  1SNP A;  4JVZ A;  4JYA Q;  1MHW C;  3S17 H;  3T13 A;  3KLR A;  1K28 A;  4FF4 A;  1A8V A;  4GOP B;  1A2T A;  3HZX A;  3A5U A;  5K36 H;  3M9B A;  4YCV A;  2E2I H;  2A6E C;  3BVZ A;  3M85 A;  3UDI A;  1QVG A;  1WTV A;  3TS0 A;  4A75 A;  3URY A;  5I6W A;  2K5D A;  3F1Z A;  1SE8 A;  4HED A;  2MUY A;  4XTC S;  3SK6 A;  4A3J H;  1XTD A;  4DR4 L;  4X65 Q;  4DUZ L;  3SGI A;  4BXX H;  3J81 L;  5D65 A;  2VS1 A;  4GN4 B;  3TZU A;  3J80 i;  2SNS A;  3KF8 B;  1HFN A;  4LF7 L;  2FMC A;  3I4M H;  1YNN C;  2OT2 A;  5LHY 1;  3NQI A;  4JPB W;  1JR0 D;  3BVG A;  2B2V C;  1PH2 A;  2Z0S A;  4B9W A;  1GUO A;  2JA5 H;  3H0G B;  3QJY A;  1WTX A;  1VS0 A;  1TU2 B;  1Y8P B;  1C48 A;  4CDD C;  1LT6 D;  4BBR B;  3QIA A;  2R92 G;  4DK1 A;  1ET9 A;  3H09 A;  2C5C A;  2AMC B;  4A3G B;  4DGZ A;  3F8T A;  4OON A;  4MN3 A;  4GN5 A;  3BDC A;  3SEB A;  4DUY Q;  4KHP Q;  4RA8 A;  3HOU G;  5K5P A;  2KCT A;  4A3B G;  2NVX B;  1F9P A;  1VQC A;  4RH6 A;  4L5T A;  2I5H A;  1X32 A;  3TP5 A;  5LMN W;  1WJJ A;  3RLO A;  4FXD A;  4IFD H;  5IOD A;  2NVY H;  4CDC C;  4K0K Q;  4GNX C;  3HG9 A;  1PH1 A;  2EE1 A;  2I46 A;  4R4O A;  3P75 A;  2UUC Q;  5TSS A;  4IFD I;  5CBE E;  3HGB A;  3S1R B;  4FYD A;  5D3I B;  1S40 A;  4DAM A;  1WYD A;  4DV7 Q;  2Q2I A;  3NSW A;  4DV3 L;  1FNW A;  2NZO A;  1PRT B;  2LS0 1;  1S5C D;  3BU2 A;  3ERQ A;  3NHH A;  1SLJ A;  3V05 A; 
#chains in the Genus database with same CATH homology
 1DON A;  3CHB D;  3R2T A;  1GUN A;  1OXV A;  1QOH A;  4M1U B;  2OF1 A;  3PO3 B;  1SE2 A;  3M4O B;  3IFT A;  1STY A;  3SK5 A;  1OXU A;  4C3I G;  4M8A A;  1HXY D;  2WAC A;  3L9A X;  3GTQ B;  3Q0A A;  5CBA E;  2Q8T A;  1I4R A;  1B3A A;  1IYU A;  5M5Y B;  3BVM A;  4RAU C;  1PLF A;  1LLR D;  3DWA A;  2F0H A;  1EQV A;  2F0D A;  2PYK A;  1ML0 D;  3U9S A;  4O1N A;  3FEW X;  1CA5 A;  1CZG A;  3NTI A;  4HSP A;  5CV9 A;  4IUN A;  1YNJ D;  3C3L A;  1STE A;  3TME A;  1KDB A;  3V2T A;  1IKM A;  3K5M A;  2VNU D;  3IKJ A;  1D1K A;  2SDF A;  3OOC A;  3G7L A;  3PIP 3;  3N6R A;  4HCE A;  4RWS C;  2J0T D;  5FOB B;  1ENA A;  1NSN S;  1Y1V B;  5M3M B;  4TSS A;  1ILP A;  1XXG A;  2V4D A;  2F0G A;  3EFX D;  2KEE A;  1WTW A;  3MFG A;  1JWS D;  5C5L A;  5DAU A;  1VF5 C;  2R6G A;  2K5Q A;  5EPK A;  3OIQ A;  1RD9 D;  1XYI A;  4R8I A;  2B2T A;  3KF8 A;  2HCI A;  1EL0 A;  4IZ8 A;  1FNV A;  5T1G A;  1F2L A;  4QB4 A;  3DEO A;  2JA5 B;  4DA2 A;  4BA2 I;  1GHJ A;  2YU9 B;  2R93 B;  1G29 1;  1VDZ A;  2F0E A;  1BBX C;  3ND9 A;  4CKC A;  2IX3 A;  1EU3 A;  1CA6 A;  4FF2 A;  4QUC A;  2A68 C;  4DNR B;  2M2L A;  3I70 A;  4FXK C;  2O2L D;  5EBC A;  3DXJ C;  1R4P B;  3E0J A;  3HOU B;  3I3C A;  1STB A;  2EYJ A;  2AQ3 B;  2JE6 I;  1JCK B;  2E2H B;  2AQ2 B;  2HQE A;  1JOK A;  3D6W A;  4A93 B;  2HUG A;  2KED A;  2X6L A;  2R61 A;  1PMR A;  1ESF A;  2I07 B;  2L55 A;  1ZXT A;  1MSG A;  1O80 A;  1WTP A;  1BCP C;  5I2Y A;  3ONA B;  3Q24 A;  4XXE A;  4EVO A;  3RUZ A;  2KCN A;  1SNM A;  1PRT C;  1O7L A;  4MIU A;  4V19 0;  5J1Z A;  1LV9 A;  2CHB D;  3PUY A;  4BA1 I;  1H9S A;  3A8J E;  1B9M A;  3SVM A;  2MPM A;  5CMD A;  3A8I E;  5G3L D;  4K2K A;  2F0O A;  1RJT A;  3S15 B;  2JA7 B;  3GTK B;  1GHK A;  5JEA H;  2Z8L A;  4A3F B;  3EQL C;  1VMC A;  2N88 A;  1EWC A;  5ELC A;  1RKN A;  4ODG A;  3RD4 A;  4EQO A;  3QO2 A;  4KKU A;  2A73 B;  1I4P A;  4WOR A;  3VA5 A;  3OMG A;  1PFM A;  1HRJ A;  1G91 A;  1LTT D;  1LTG D;  1I6V C;  2B2Y A;  3HRZ C;  3GV6 A;  3OWE B;  3N52 A;  3IFD A;  5IIF A;  1DOM A;  1Q8I A;  1KAA A;  4DN4 M;  3VR3 A;  5DM6 3;  3A54 A;  1D1I A;  2VB2 X;  1H9M A;  4NW2 A;  2D2C C;  3FKI B;  1CK1 A;  3OW7 A;  2XIW A;  3HOW B;  3NXW A;  4QF4 A;  2EY2 A;  5C3E B;  2JYO A;  4OIK A;  1PFB A;  5KNC A;  4NDX A;  3BYT B;  1GUW A;  5IT9 L;  3KK7 A;  2CQA A;  5EBD A;  2NZ1 D;  1A2U A;  2K1B A;  4L63 B;  4C3H B;  3SK8 A;  2BDN A;  4X3K A;  4KK7 A;  1Z7T A;  1FYC A;  3GTL B;  1VMP A;  1ROD A;  4DAP A;  1JE4 A;  1EY8 A;  1EQT A;  2QF7 A;  1PTO D;  4R8N A;  1F2M A;  1H9K A;  4KY6 A;  1MI2 A;  2TSS A;  1HUM A;  1E2W A;  1ENC A;  1ILQ A;  1KDC A;  2E76 C;  5JEA J;  2WIN B;  2C9O A;  4KY5 A;  1EYC A;  1I50 B;  1LAB A;  1A6X A;  4ZRZ A;  3PUW A;  1SYF A;  3K6O A;  3OMC A;  2CW0 C;  2EYF A;  1BCP B;  2PZU A;  4KV6 A;  1RHP A;  3IAY A;  2BA0 A;  2EY6 A;  1DZ1 A;  1XWE A;  3K5O A;  3H6M A;  2F0W A;  1ET6 A;  2E2I B;  1Q90 A;  4OL7 A;  2F0V A;  2Z1C A;  3JAM L;  5D14 A;  3D4R A;  4PMB A;  1SSO A;  2RDG A;  3RZO B;  4LK1 C;  3I90 A;  3S1Q B;  1BQQ T;  1DXM A;  5C6A A;  2MHV A;  1I4Q A;  1G8Z D;  3OHX C;  2BCO A;  2RKS A;  3J80 L;  3K5L A;  1ZYR C;  4DFA A;  5I9P A;  1QCB D;  3T53 B;  2VB3 X;  1PYW D;  2A6H C;  3L7Z C;  1G2T A;  4N9P A;  1DOL A;  4F7X A;  1GJX A;  4ZUI A;  3R3O A;  2PZT A;  1Q1B A;  2H4O A;  3OSO A;  1FD7 D;  1D5X C;  3C1E A;  2IT1 A;  1GOZ A;  5DEH A;  3KLS X;  3VYU A;  2B2Y C;  2CW0 D;  1ONL A;  1HA5 A;  3MA2 B;  1I6H B;  3OPO A;  4NMZ A;  1CM9 A;  1U9R A;  4G7H C;  2IX1 A;  1U4M A;  4BS9 A;  2Q8I B;  4XQN A;  4EQP A;  3EVQ A;  5JVH 3;  1HCZ A;  5CV6 A;  4PNY A;  3I73 A;  2NVY B;  1SND A;  3NWT A;  2KCC A;  1TWH B;  4YIJ A;  3PV0 A;  1MBY A;  1BUV T;  1STA A;  1EEI D;  2XNA C;  1SYE A;  1A3T A;  2AWN A;  5BN4 A;  5JOB A;  3R93 A;  5C44 B;  1TR5 A;  5M5X B;  5JAV A;  4FXG C;  1ICW A;  3T56 B;  3WDN A;  1EZ8 A;  1I4G A;  1F9S A;  4PV1 C;  2QCP X;  2GA4 B;  2PMZ B;  3MXP A;  4KHZ A;  3S2D B;  5AFW A;  2FMM A;  1GUT A;  3NWS A;  3R2I A;  2WAQ B;  2EDG A;  2K5W A;  4RKB A;  1WTR A;  5A2Q E;  3S2H B;  3KLS A;  3W2D A;  4G7Z C;  5CV4 A;  3BDO A;  1IKL A;  5I2X A;  3ITP A;  1LT3 D;  2O5I C;  2RSO A;  1K83 B;  5EPL A;  1F77 A;  1LT4 D;  3TP6 A;  1AFP A;  1E2V A;  1SJH D;  2NVQ B;  1S5D D;  1H9R A;  2NUC A;  5E3F A;  2PW7 A;  4RKL A;  4KKT A;  1LTS D;  2EXZ A;  2EJG C;  3GQB A;  2SOB A;  2FIN B;  1BDO A;  2NTT A;  3J7A F;  1D5Z C;  3D4W A;  3S1N B;  4OO1 G;  3M7N A;  1EYD A;  3GV3 A;  5ISR A;  1V1P B;  4C3I B;  2L4N A;  4EQN A;  2HCC A;  4OHJ A;  2KEC A;  2NBF A;  4IN3 A;  2Q8R E;  1EOT A;  2EYO A;  4IUT A;  4X3U A;  1E0B A;  4DK0 A;  5C5M A;  1Y69 U;  2QIL A;  4KJN A;  2K03 A;  1SEB D;  1T5E A;  1SE4 A;  4K8J A;  5C3X A;  2AWO A;  2RSN A;  3S16 B;  3NUC A;  3TSS A;  4KD4 A;  5IOC A;  2SNM A;  3K59 A;  4K8I A;  2L1B A;  2E2D C;  1W6J A;  3MEH A;  2PZW A;  2KVM A;  1X3Q A;  2AUJ D;  2KJX A;  1WD1 A;  5KYL A;  3DUZ A;  2B2W A;  2FFK B;  5ELE A;  4X3S A;  1EY6 A;  1SNQ A;  2B8F A;  2PQE A;  1LTB D;  1BCP D;  4U68 A;  3NE5 B;  3GTM B;  5EPJ A;  1PXU A;  2N55 A;  4CGY B;  4FP5 D;  2B2U A;  3MZ5 A;  3MVV A;  1EFI D;  2KQ3 A;  2X69 A;  1ESR A;  2E2J B;  1PTO H;  3BG3 A;  4ILW A;  3F2U A;  2K28 A;  1QE6 A;  1WVL A;  3MFY A;  4IFD G;  4CKB A;  1PZI D;  2XSC A;  4F88 A;  2D62 A;  2LY7 A;  1SYD A;  1S5F D;  3DWQ A;  1TT2 A;  3LWU A;  4C3J G;  1WTQ A;  4ME5 A;  5C0X I;  1AEX A;  3MXG A;  1YNJ C;  3JAM E;  5IGG A;  1CHQ D;  3A8K E;  4IUP A;  2K05 A;  3VYR A;  2R3Z A;  3VR5 A;  2TMP A;  4H0L C;  2F3V A;  2EYP A;  1Q3L A;  2IW3 A;  4I65 A;  3C46 A;  1Y1W B;  4K5X A;  1VCI A;  3TP7 A;  5COY A;  3L3O C;  1HTP A;  2EY1 A;  1BNZ A;  1R9T B;  5F2D A;  3TZD A;  5KYI A;  1S5E D;  4C1N K;  1SJE D;  4F8M A;  1MD2 D;  3J7A V;  2KUM A;  2EYM A;  2D5D A;  3PUX A;  4UAI A;  1RTN A;  5E1F A;  5J39 A;  2L5T A;  2B8G A;  1NCV A;  2EZV A;  3NBH A;  3M7G A;  4OIJ A;  1SE3 A;  3CRK C;  4F87 A;  2NWG A;  1F2Y A;  3W3A A;  1SYB A;  3J80 E;  3GTP B;  4LMQ D;  1NR2 A;  2RDF A;  2RA4 A;  3MTS A;  3GTG B;  2Y0S B;  4IUV A;  4B08 A;  4BWG B;  2PNR C;  3MC0 B;  1KAB A;  2B2T C;  3MHB A;  1YNN D;  1EIH A;  2J7Z A;  3RMH A;  2HDM A;  3DM1 A;  2NN6 I;  1SBB B;  5E4X A;  3T51 B;  2SEB D;  3HOZ B;  2L9H A;  3H91 A;  3NP8 A;  5BN3 A;  5NUC A;  1DOK A;  5BN5 A;  1WD0 A;  5IGB A;  1TII D;  3M4Y A;  1TWA B;  4FNF A;  2DNE A;  3TDQ A;  4CKE A;  2HDL A;  5CR3 A;  1I4H A;  1RTO A;  4Y7N B;  4B9X A;  2NN6 H;  2F0J A;  1D5M C;  1WCM B;  1HUN A;  4G4K A;  4C1N I;  3S1M B;  5ELF A;  2F0U A;  2F3W A;  1SFO B;  3DHQ A;  2B2W C;  1TS3 A;  1L0X B;  1MGS A;  1TY2 A;  4ZAI A;  5A35 A;  1UUP A;  1U4L A;  2A69 C;  2KOL A;  4FF1 A;  3OIP A;  1SYC A;  2X6G A;  2H1E A;  3RLF A;  4K6D A;  3I8Z A;  4TKO B;  4KHV A;  4K2L A;  5EGT A;  1HQR D;  3KBG A;  2NN6 G;  1PZJ D;  2K01 A;  3SXH A;  2EJF C;  2JA6 B;  1J9O A;  1F9Q A;  4KJO A;  1JOO A;  1LTI D;  3T16 A;  5JEA G;  1Y8O B;  2R7Z B;  5DM7 3;  4XT3 B;  5I6Y A;  4BBS B;  2F0I A;  2IX0 A;  3FPP A;  1CQV A;  2XRQ D;  2ICE C;  4QCL A;  3NK9 A;  1NUC A;  1OXX K;  4WFN 3;  1BCP F;  2NTS A;  4R9W A;  1SXT A;  1TWC B;  1EYA A;  4KN7 C;  1U4R A;  5ELB A;  2MP1 A;  2WII B;  3FPU B;  4KN4 C;  1A3V A;  3U9O A;  1HTL D;  4RHR A;  1OO9 B;  1LTA D;  1H9J A;  4H44 C;  5C3W A;  1B2T A;  2KHS A;  3E5S A;  4DNT B;  4RCO A;  4ID6 A;  1LT5 D;  3J7Y W;  1FNU A;  1C4Q A;  1RF2 D;  3O13 A;  4MHE A;  1AN8 A;  4FVM A;  1Z6H A;  1HHV A;  2ID0 A;  5C4Z A;  5LL6 S;  4J8Q A;  1Y8N B;  4HAE A;  2G9D A;  1QJO A;  2E74 C;  4H7B A;  2PPB C;  3KUP A;  2YYZ A;  2OEO A;  1ZEQ X;  3OWF A;  4J1M A;  1MSH A;  4KKS A;  3ZYY X;  1H9S B;  1Z47 A;  3K57 A;  3AMU A;  3CRL C;  4CHT B;  3A7A B;  4QIW B;  3CU7 A;  4TRD A;  3AU7 A;  5M5W B;  1TS2 A;  1C8C A;  1XX8 A;  3UI2 A;  2F0Q A;  3S9W A;  2R92 B;  3Q23 A;  3GP7 A;  3LNN A;  2WV6 D;  1SDF A;  5CV7 A;  2PW5 A;  1UAP A;  4A3B B;  1NR4 A;  1AZP A;  2XN9 C;  1BOS A;  1EU4 A;  2QDB A;  4ZKC B;  5JPM C;  2KA7 A;  2F4I A;  3C2P A;  3P1H A;  3X3N A;  4FO2 A;  3J81 E;  5FK9 C;  1EEF D;  4Q0F A;  5FLX L;  4HN7 A;  1SNO A;  1ENF A;  5KNB A;  1AZQ A;  1HQM C;  3PMF A;  1V8Q A;  2QEJ C;  4RGM A;  3NTH A;  3QG1 A;  2DY8 A;  1EY5 A;  1A3U A;  1KNE A;  5M9O A;  4V0B A;  3D31 A;  4N9T A;  3GTJ B;  4K5V A;  3MXU A;  2F0K A;  3VYS A;  2LKV A;  3HP3 A;  1B44 D;  4JBW A;  3WOF A;  1CHP D;  2B39 A;  1F2Z A;  4XT1 B;  3NBI A;  1HPC A;  1SYG A;  2L11 A;  3D8G A;  1KNA A;  2BA1 A;  4C3J B;  2ZXR A;  5E4W C;  4AYB B;  5FO7 B;  4ABN A;  3V96 A;  5CC4 A;  4ULL A;  1JIC A;  5EQ0 A;  3BS1 A;  1JC7 A;  1IW7 D;  3EJI A;  2G9H D;  1EIG A;  2XRS D;  4OO1 H;  4G7O C;  1CI3 M;  1V43 A;  5M3F B;  3HOV B;  3QWN A;  2MGS A;  1FGB D;  1JQY D;  1TS5 A;  2JXM B;  3VR2 A;  5C0X J;  5CGK A;  3BDL A;  3PO2 B;  2L12 A;  2FHT A;  3K0Y A;  1DD2 A;  1EY0 A;  1S4Z A;  1GXD C;  3I4M B;  4A3D B;  3EA6 A;  2K33 A;  2A68 D;  4QUF A;  2BE5 D;  5IGC A;  1D6E C;  3K5N A;  5HGT A;  1B9N A;  2JEA I;  1JOR A;  3QB3 A;  1B50 A;  5JPN C;  5EKK A;  1LAC A;  2ZT9 C;  4FF3 A;  4WJW A;  4ZKB B;  5I9O A;  3Q6S A;  1I4X A;  3PIO 3;  3RZD B;  1AW7 A;  1KLU D;  4PMW A;  2LMC B;  4K5W A;  1PZK D;  2F0P A;  5KRU A;  4ZYS A;  2QKI C;  4A3J B;  1DCZ A;  1Q1E A;  3P7J A;  3HS0 C;  1EZ6 A;  2RQX A;  3D6C A;  3SDZ A;  3QOJ A;  5COR A;  5IGD A;  1TQO A;  3WOE A;  1PTO C;  5C4J B;  1SAP A;  2B2V A;  1CT1 D;  5EKL A;  3VR4 A;  2DN8 A;  1TKW B;  5C0X H;  1JB3 A;  3BZD B;  3NQT A;  4IUU A;  1NAP A;  1IYV A;  5FKA C;  2WP8 J;  4Q5V A;  2F0T A;  4LAA A;  3MAQ A;  1STH A;  4DXG A;  4DAY A;  2D9U A;  1II3 A;  2A5H A;  4HTH A;  3BYY B;  1KDA A;  4ZLT F;  2VXW A;  2E75 C;  1BO0 A;  2F03 A;  3I72 A;  2K04 A;  1AP0 A;  2VUM B;  4P2C B;  2NYZ D;  5JVG 3;  2EOT A;  4XDX A;  2K32 A;  2RDH A;  1V1P A;  1TWF B;  1UEA B;  4U67 3;  1UNS A;  2A74 C;  1PTO F;  2ICI A;  2NVT B;  5FLX E;  1FR3 A;  3K58 A;  3TBI B;  2A6H D;  1JOQ A;  3SE0 A;  2EVB A;  3P20 A;  1PFN A;  2A69 D;  4IFD J;  4CBV A;  5EKI A;  1EY4 A;  2AQ1 B;  2NB0 A;  1QNK A;  1QWY A;  2J4X A;  3PUZ A;  4S3S A;  1SMY C;  1CQF A;  4XQJ A;  4OGQ C;  1OXS C;  4UDU C;  3H94 A;  5JJZ A;  3E6Z X;  3HOX B;  4KI0 A;  2BOS A;  2F0F A;  1IW7 C;  1DJR D;  2Z4I A;  4XYO A;  4A3I B;  1F9R A;  3VA7 A;  1PTO B;  3R8B A;  2AUK A;  4A3M B;  4DAV A;  3NTK A;  4K6L A;  3M3Y B;  5J22 A;  4Z9C B;  1KTK A;  3G6J B;  2OXP A;  2F0N A;  5EJW A;  3I4L A;  4RGT A;  1D2B A;  1J8I A;  1CTM A;  1BF4 A;  4C3H G;  4BY1 B;  1M8A A;  4BY7 B;  3DMU A;  5I4D A;  5ELD A;  4CJ2 C;  1B1Z A;  1QNU A;  4IUQ A;  1X3P A;  5LL6 X;  1O7Z A;  1ZKO A;  2IL8 A;  2M00 A;  1EY7 A;  2F0L A;  2BE5 C;  1JWM D;  2EYL A;  2B2U C;  3X3M A;  3K7A B;  3A55 A;  3T4A C;  4H13 C;  2F0M A;  1ZYR D;  4IQZ A;  1XTC D;  1TS4 A;  1QG7 A;  4X3T A;  2PCF B;  4I7Z C;  3I4N B;  3FVQ A;  1QIL A;  5FO9 B;  2XWJ B;  4HMJ A;  1PDQ A;  1CFM A;  3SHL A;  5KND A;  2M9V A;  2BDO A;  2Z4H A;  1TWG B;  2RBM A;  4E6I A;  4DXF A;  4C56 C;  5IGF A;  1TY0 A;  3TN2 A;  4A3K B;  4XIG S;  2DY7 A;  5G3L F;  4TQU S;  1U4P A;  3D3R A;  1PRT F;  4PQX A;  5CV8 A;  5T1I A;  2K7V A;  1RCV D;  3S14 B;  2L0C A;  2LFN A;  1BR9 A;  1K8O A;  2RVL A;  2JA8 B;  4HSV A;  4ZQ3 A;  3A56 A;  1JWU D;  4KTA A;  1CZW A;  4O42 A;  2EY5 A;  2ZXO A;  3DEP A;  3MXN A;  2K6A A;  3CQZ B;  1GUS A;  3ERO A;  5KGU A;  2FJ2 A;  4HR7 B;  4PMC A;  1LTR D;  3NPP A;  2ZXP A;  3Q22 A;  5IGE A;  1DM0 B;  4K14 A;  3D4D A;  4IUR A;  3HEJ A;  4C2M B;  3S17 B;  4NP5 A;  2DNC A;  5C0X G;  4RCN A;  4IAL A;  1EWH A;  4HMI A;  1R4Q B;  4ZUJ A;  5DNF A;  1SNC A;  2PO4 A;  2B63 B;  1LO5 D;  1M4V A;  2EYH A;  5KEE A;  4LJZ C;  5K36 G;  2WKC A;  1DYQ A;  1PRT D;  3CKI B;  5C4X B;  3DWP A;  4DU9 A;  3GD7 A;  1HA6 A;  5A2Q L;  2IPK D;  2JP1 A;  3SR1 A;  1T5X D;  2XVS A;  1VF7 A;  3FMC A;  4KD3 A;  3ND8 A;  4RGN A;  3HOY B;  1IHZ A;  5C4H A;  3PUV A;  3VR6 A;  3QOL A;  3GO5 A;  2ENB A;  5FO8 B;  2MJ8 A;  5CV5 A;  3C1F A;  1O7Y A;  4JK1 C;  1S5B D;  1K8M A;  1EY9 A;  4KMU C;  2WB1 B;  3TP8 A;  4ZK9 B;  3LWE A;  4KY7 A;  1GUG A;  1RDP D;  1QB5 D;  1BXT A;  1WTO A;  2XWB B;  2O5J C;  2F0S A;  4J6H A;  1STN A;  4G57 A;  3MWY W;  1Q12 A;  1L0Y B;  5KIX A;  4QMG A;  1A15 A;  4RGO S;  2IWH A;  4GZY C;  5D3D A;  4NKL A;  5HUR A;  3VYT A;  2O4X A;  2JEB I;  1B53 A;  1B4O A;  4RFB A;  4WRD A;  4CJ0 B;  2F1M A;  3FRP B;  2EJM A;  2EPB A;  3LX0 A;  1V1O A;  1STG A;  1HFG A;  1OXT A;  4L8J A;  1IL8 A;  3HKZ B;  1SMY D;  3H3V C;  3SK4 A;  4CJ1 B;  5CYU A;  1TVX A;  2CVR A;  1G2S A;  1KLG D;  3KBX A;  2IJ0 A;  4RHS A;  3A7L A;  2A6E D;  4EGV A;  4A3E B;  3AB9 A;  3IL8 A;  3GTO B;  2WKD A;  3FDT A;  5IT9 E;  1O78 A;  1E2Z A;  4OO1 I;  4XQQ A;  4DF7 A;  1G6Z A;  4L6T B;  1I3Q B;  4XYQ A;  2JSO A;  1W6K A;  3I91 A;  4HCS A;  1SNP A;  3T13 A;  3KLR A;  4FF4 A;  1A2T A;  3HZX A;  5K36 H;  2A6E C;  3BVZ A;  3M85 A;  1WTV A;  3URY A;  5I6W A;  2K5D A;  4HED A;  2MUY A;  4XTC S;  3SK6 A;  3J81 L;  5D65 A;  3TZU A;  2SNS A;  1HFN A;  2FMC A;  1YNN C;  2OT2 A;  5LHY 1;  3NQI A;  1JR0 D;  3BVG A;  2B2V C;  4B9W A;  1GUO A;  3H0G B;  3QJY A;  1WTX A;  1TU2 B;  1Y8P B;  1C48 A;  1LT6 D;  4BBR B;  3QIA A;  4DK1 A;  1ET9 A;  3H09 A;  2C5C A;  4A3G B;  4DGZ A;  4MN3 A;  3BDC A;  3SEB A;  4RA8 A;  5K5P A;  2NVX B;  1F9P A;  4RH6 A;  1X32 A;  3TP5 A;  4FXD A;  4IFD H;  5IOD A;  3HG9 A;  2EE1 A;  2I46 A;  3P75 A;  5TSS A;  4IFD I;  5CBE E;  3HGB A;  3S1R B;  4FYD A;  5D3I B;  3NSW A;  1FNW A;  1PRT B;  2LS0 1;  1S5C D;  3ERQ A;  3NHH A;  3V05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...