3MHBA

Crystal structure of staphylococcal nuclease variant delta+phs l38a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mhbA00
1SYGA 5IIFA 2F0SA 5KYLA 3V2TA 4QMGA 5IOCA 4ME5A 3SHLA 1NSNS 2EYFA 5I9OA 1EY0A 5KRUA 5C5LA 1EY7A 5C3XA 5CGKA 2QDBA 1STHA 4EVOA 2OXPA 4KY5A 5CV8A 4YIJA 5JAVA 4DU9A 1SNCA 3SR1A 4WRDA 3EROA 3NP8A 1SNOA 1ENCA 3C1FA 4K6DA 4KJNA 1SYCA 5C5MA 5EKLA 1SNMA 4IALA 4NDXA 1JOOA 2F0PA 5IGCA 2ENBA 2F0IA 2EY6A 1SYDA 3EVQA 3QOJA 1STAA 1SNPA 4K2KA 3BDLA 4N9TA 5JOBA 5I6YA 2KHSA 1RKNA 4DGZA 2M00A 3P1HA 3TP6A 3ERQA 1EQVA 4PMCA 5IGFA 4DFAA 5IODA 4HMJA 5C4ZA 2PZTA 2LKVA 1SYFA 1STBA 4K8IA 2EXZA 3MVVA 4LAAA 5CV4A 1AEXA 1NUCA 3TP8A 3BDCA 5KEEA 1JORA 4QB4A 4ODGA 4ZUJA 3NXWA 4NKLA 2RDFA 4KV6A 4F8MA 2F3VA 2SNSA 1A2UA 2F0HA 1ENAA 1U9RA 5KYIA 1II3A 1SYEA 2F0VA 3HEJA 2F0NA 4ID6A 4B9XA 5HURA 1SYBA 1SNDA 5M9OA 3R3OA 1EY5A 4RKLA 2F0FA 2EYLA 4EQNA 4KY7A 3D4WA 2OF1A 3DMUA 3SK4A 3SK5A 4EQPA 5C6AA 1JOKA 4NMZA 4NP5A 1EYDA 2PW5A 5IGBA 1EY4A 4H7BA 3TMEA 2EY5A 3NHHA 1EY8A 1STNA 2OEOA 4J6HA 4K5XA 1IHZA 4ZQ3A 5I9PA 5IGDA 2SOBA 2F0MA 4KD3A 4HTHA 4J1MA 1KAAA 1TT2A 2F0KA 2NUCA 2PZWA 4HMIA 3P75A 1F2ZA 5KGUA 5J39A 2F0DA 3D6CA 2EY2A 1A2TA 4OL7A 5C4HA 2RBMA 3QB3A 4S3SA 4IUNA 5CV6A 5E3FA 3HZXA 2EYMA 2F0WA 4EQOA 4RKBA 4KD4A 3VA5A 4WORA 1SNQA 1EYCA 3NK9A 3SXHA 1TQOA 5IGGA 5HGTA 3MHBA 3LX0A 4F7XA 3DHQA 2O4XA 4K8JA 4ZUIA 5EKKA 4R8NA 3MEHA 4MIUA 5CV5A 5CR3A 3TP5A 5ISRA 3NUCA 2EYJA 3SK6A 3OMCA 1KDAA 4KJOA 4KTAA 4PMBA 4QF4A 2WACA 2F0TA 2PYKA 5F2DA 4E6IA 1KDBA 3OSOA 3U9OA 3MXPA 4IZ8A 5KIXA 2F0JA 4I65A 4KY6A 1F2MA 1JOQA 3TP7A 3T16A 5DEHA 4DF7A 5I6WA 1EYAA 3E5SA 3D8GA 4K5VA 1A3TA 3D4DA 3PMFA 4B9WA 2SNMA 2F0QA 3MZ5A 2F0GA 2PZUA 5CC4A 2F0UA 2HQEA 5J22A 2EY1A 3OWFA 1TR5A 3SK8A 4K2LA 1EZ8A 1STGA 1A3UA 3T13A 3C1EA 2F0OA 3H6MA 2PW7A 4KHVA 2RKSA 2PQEA 4PNYA 3NQTA 5CV9A 1A3VA 5J1ZA 3RUZA 5CV7A 5K5PA 5C3WA 2EYPA 2KQ3A 4K14A 4K5WA 5E1FA 1EY9A 1EY6A 2EYHA 5NUCA 4TRDA 5IGEA 4N9PA 2EYOA 3QOLA 3S9WA 2F0LA 3OMGA 3EJIA 3ITPA 5EGTA 1KDCA 1EZ6A 1KABA 2F0EA 5DAUA 1STYA 2F3WA 4G57A 1F2YA
chains in the Genus database with same CATH superfamily
3MFYA 3HOXH 1PH9A 2B2VA 1J5EQ 1RDPD 4FO2A 5C5LA 3VR4A 1SXTA 3NBIA 2ZXPA 1PHJA 3K7AB 1ESRA 4ZK9B 1STEA 1EUJA 1P16A 4K6DA 1SNOA 1TU2B 3X3NA 2N3SA 4MTKA 5EKLA 1BO0A 1KXLA 1BR9A 1QUQA 4C1NK 1HZ9A 1YNNC 3HKZB 1PH1A 2UXCQ 3M9BA 4TQUS 3FPUB 2DNCA 3H0GH 5EKIA 5GAEC 1STBA 4WJ4A 1AEXA 2LS01 1XNQL 1EU3A 4QIWB 3PO3G 2MNAA 2L5TA 1DD2A 3T1HQ 1EFWA 4FXKC 1NMGA 3IFDA 2JA5B 2F0FA 1WJJA 1PV4A 2LFNA 4C3HB 3OHXC 2NVQB 1P8LA 4CJ1B 3VYTA 1B53A 3T56B 2B8FA 4LMQD 4RA8A 5C0XJ 1ASZA 2F0KA 4GS3A 2RF4A 5IP7G 2UUBQ 5E3FA 4HJ9A 4OO1I 3GTPB 3HOUH 4DR5L 5HGTA 5BR8L 4X6AH 3MXNB 5EBCA 4DV6Q 2E2DC 3HOWB 4PMWA 3PUVA 1FNWA 4JI7Q 1KDAA 2IY5B 4BA1I 2F0TA 2PYKA 5JVH3 4I65A 3FVQA 3JC66 2K33A 3HOXG 1JOQA 2D2CC 1K28A 3FKIB 2XWJB 2KA7A 4DAPA 1YITA 5C4XB 4RHRA 5BN5A 2NN6H 1TR5A 3H15A 1VQMA 3J7AF 5EJWA 3RN5A 4DUZQ 1MI2A 3JAMc 3ONAB 3RNUA 5KNDA 3GTQH 5FLMG 2J0TD 3GTOB 2B2VC 2IW3A 1PZJD 3D3RA 3FKIH 1KABA 4JI0Q 1F2YA 5KGUA 4L5SA 1OXUA 1FYCA 2XRSD 4DAYA 2LSSA 2NTTA 2A6ED 3D4RA 1CQVA 1MKHA 2E2HB 4B3SQ 1KC8C 1XPOA 2JN4A 1SSOA 1PLFA 4JI0L 1TWGH 5LL6S 1YJNA 2RHQB 2HDLA 2WB1E 5IT9L 3VR5A 1G91A 1PYWD 1RTNA 4OEMB 3TZDA 3CCLA 1X32A 3PIP3 5EPLA 4K8IA 2L4NA 2K05A 4DN4M 5FO8B 1HA6A 4QB4A 1MHWC 2RDFA 1GO3E 1A15A 1CHQD 2IX1A 3H0GG 1FGBD 2K6AA 1JWUD 4J15A 1SYEA 2I46A 5FLMH 2Z4IA 3DUZA 4EQNA 2VZAA 2R93G 3S14H 1HNXL 1NNXA 4BBRB 3GTMB 1HTPA 1VQLA 1E2VA 3R93A 4ZYSA 4H7BA 4XDXA 3NELA 4ZRZA 2ZTCA 1C7YA 2IHEA 2R93B 4WJWA 3FHWA 4UP9A 5AFWA 2YTXA 2CHBD 3F2DA 1F2ZA 1HCZA 1H9MA 3KF6A 4GKKQ 2UUCL 1IW7C 3I4MH 1Z6HA 4HEDA 1Y8PB 3TEHB 1Q82C 3VA5A 3K58A 3KYHC 5IGGA 1L1OA 1TWCH 4HAEA 1FNVA 1UAPA 1QUQB 4IUTA 1N9WA 5CV5A 5TSSA 3UDFA 1D6EC 2YYZA 1SDFA 4E6IA 1QB5D 2JYOA 3IRBA 4DPGA 1FVIA 4KY6A 3TDQA 1LTAD 3LWUA 4YY3Q 3HOZB 2XNAC 1R9TH 3W1GA 1JE5A 1QG7A 2ICEC 1VQOA 4DV7L 1V1PB 1A3VA 3K7AH 4RGOS 1X6OA 1BDOA 2R7ZH 1G2TA 4IURA 2WAQG 3MFGA 3X3MA 4LFCL 4HTHA 4ME5A 1ICFB 4DAMA 4C3IH 5KRUA 4DNRB 1IXRA 4P71A 3HKZG 3CCVA 3BVGA 4X65L 4GNXA 5I4DA 4C3IG 1JWSD 1EIHA 3NWTA 4HIMA 1BCPB 1Q12A 4A3BG 3MA2B 5BN4A 5L37A 3I56A 1IL8A 1KRTA 1QZHA 2E5LQ 2PZTA 3K8AA 1SYFA 1ET9A 4LAAA 3TP8A 2JA6B 1VQCA 1E2ZA 2B8GA 3CP0A 2K75A 5GQOA 5GAGC 1YJ9A 4LF4Q 2WB1B 1EEID 2NVYB 4JK1C 1ENAA 1E7ZA 1GVPA 2CVRA 4TVAB 4JI2Q 4DUZL 2A69C 3BYTB 5HURA 5D65A 5C44H 1QILA 2MUYA 3UE0A 4ZAIA 3DMUA 1WTRA 1HHVA 2XN9C 5ELEA 2K7VA 1DZ1A 4DV7Q 3VR6A 4C3HG 1PH4A 3M4YA 1EY8A 4K5XA 4KN7C 2VB2X 4YCVA 2LXJA 2KBNA 2F0MA 3A54A 4DR1L 2PNRC 3CMAA 1K3BC 3KLWA 4F88A 2KECA 3S16B 4TKOB 1IYVA 4V0BA 5CV6A 3B6YA 4H44C 4HIOA 1PH2A 5BN3A 1A63A 5IE8A 5KNBA 4KKUA 5BR8Q 4IO9A 4F87A 4DR5Q 1UE6A 4LFCQ 2EJGC 2XSCA 4K8JA 4AH6A 4JW0A 4Y7NB 1F77A 4KJOA 2Q2IA 5F2DA 1KDBA 3QJYA 5JEAH 3U9OA 1HUNA 1X3FA 2CQAA 2B39A 5LHY1 2IX3A 1X54A 5CC4A 2CH4A 1JICA 1ML0D 3SK8A 5CORA 2VL6A 1XMQQ 2RHSB 2YTYA 5FK9C 3H6MA 2NBFA 2LMCB 2K04A 2PQEA 3RUZA 4CKEA 4DNTB 2A8VA 3KF8B 5C3WA 3JAML 1CKNA 4IJLA 1XNQQ 3TZUA 1QZGA 2PMZB 1K9MC 1WTOA 4LUZA 3ZYYX 3J81c 4FYDA 1GHJA 2WAQB 2JA5G 2I07B 4GLXA 4DV0Q 2PPBC 2A68C 3T51B 1IBLQ 1JT8A 3NSWA 2VQEQ 1DYQA 1D5ZC 4DU9A 2BE5D 3I73A 1WCMB 5EPKA 5M3FG 4K6LA 1SNMA 2MPMA 3TQYA 5C4JB 2F0IA 2D5DA 1K83H 3QOJA 1STAA 4BXXH 2B2UA 1EWIA 2A69D 5I6YA 1RKNA 1AE3A 2PQAA 5IT9c 1MGSA 3M7NA 4PMCA 1G8ZD 4UAIA 2JE6I 3OTOQ 1LM0A 3K5LA 3ULJA 3I90A 4F8MA 1V1PA 4LWCA 5FKAC 1ESFA 4BY1B 4IPGA 3KLSX 3I4NB 3W3AA 1B3AA 1CZGA 3J80c 2KCCA 2NZHA 1PYBA 3SK4A 1HFGA 4FXDA 2L0CA 1GKHA 5ELBA 3H3VC 1CKNB 3PGZA 5IYDH 4YWMA 4B3SL 1OO9B 1WFQA 4MNOA 1SAPA 5JJKA 1JJ2A 2B2YC 3A74A 1KAAA 3A56A 1EQRA 4X62L 4L63B 4C3HH 4X66Q 1ZYRC 3Q23A 1PTOD 2VUMH 3STBD 4IJHA 4KD4A 4H02A 1U4RA 4DA2A 3DHQA 1TS4A 4PZ6A 3I70A 4FF3A 4KN4C 4KHZA 4MIUA 3VYRA 4HJ5A 4HSVA 3J7AV 2K5NA 3P7JA 5DLQE 3KJOA 1B9NA 4Y7NH 4AIMA 2F0JA 4A3JG 1GXDC 1A3TA 3D4DA 5ELDA 4B9WA 3J7ZC 3MZ5A 2VW9A 1X3PA 3PF4A 4IUVA 3AQQA 2F1MA 2YU9B 3OW2A 1KLUD 1SMYC 4DR2L 3G4SA 2F4VQ 5IYDG 1YHBA 1JJCB 4B08A 4O42A 2KJXA 1S40A 2ZJQA 1TS5A 4X3UA 3RLNA 1EWHA 1HTLD 4A3FH 4RCOA 3V2TA 2EXDA 1NSNS 3QG1A 2B2UC 1YIJA 1VDZA 3HOYH 3KF6B 3S17H 3AFPA 4FP5D 1WD0A 2MO1A 3NP8A 2R7FA 5C5MA 4CDCC 4IALA 1XYIA 4KK7A 2ENBA 5ELFA 3EVQA 3V96A 2KENA 4AYBG 4PZ8A 1QJOA 2Z4HA 1O7YA 5C0XI 1K8GA 1WTXA 1WI5A 1NUCA 3BDCA 1Q90A 1HPCA 4JI8L 1CKMA 1TWFB 2RA4A 4RGMA 3RZOH 1PTOC 2OF1A 5CMDA 2JSOA 2Z9HA 4ALPA 2K5HA 2ZTEA 2MQHA 4MHEA 1EIYB 4DXFA 3W5OA 5I9PA 1BNZA 2QKIC 1W2BA 5EBDA 1O7ZA 1CQFA 1H9SB 1TWHB 4DKAC 2NVXB 1SFOH 5M3FB 4P74A 3K6OA 2OT2A 1EYCA 1BCPC 1M4VA 3GQBA 1SRUA 4P72A 4JI3L 1N36Q 1S5BD 3DXJC 2WACA 1I6HB 4JI2L 4DK0A 2JA6H 1K8OA 1PZKD 3O13A 3K5MA 3KBGA 2H1EA 1YHQA 1C9OA 5CBEE 1J9OA 3RN2A 2ZTDA 1LTSD 2HQEA 1BBWA 3E0EA 4JV5Q 3CC4A 4A3DB 1RODA 1VQNA 5C0XG 1E2WA 3T4AC 4HIKA 2B29A 4UPAA 3CPWA 3HOVB 2KQ3A 5AJ3L 1EY9A 4A3MG 1Z47A 4TRDA 4N9PA 3U4VA 3S9WA 4L6TB 5DM63 5EKKA 4DK1A 5IIFA 2GN5A 2E2IH 2UXBQ 1NJIC 1EY0A 5KNCA 4KY5A 4BY7G 2FINB 1XWEA 3CD6A 1BBUA 2JA9A 1HRJA 2A6EC 1KRSA 2EY6A 1S72A 2L55A 3PO2G 3TP6A 2NWGA 5I2XA 4DV5Q 1Q81C 1Y14B 1EQVA 2JQOA 3GV6A 4LF6Q 3UI2A 2ZXRA 4P73A 5GROA 3NXWA 1MJEA 4RHSA 4A3BB 2O5IC 1CSPA 1K0SA 5M5YH 1NCVA 1PTOH 5E4WC 3CQZH 3GTLH 1SYBA 3R3OA 1DOKA 3NWSA 2Z6BA 4NXNL 3Q6SA 1EYDA 1HA5A 1BVSA 1SE8A 5D3DA 5DM73 3D0FA 3NHHA 3PV0A 3ERSX 1Y1WG 2WKDA 1I3QH 2YV5A 4CKCA 4JI4L 1DXMA 2ASBA 1FGUA 1U4LA 3QB3A 3S2HH 1N33Q 2EYMA 5LMUL 4CKBA 1Y1WH 5DNFA 3NK9A 4F7XA 2JA8H 1FD7D 1FJGQ 4ZKCB 3I4MG 4R8NA 1B3QA 1PDQA 3GTJB 3S2DB 4A3IB 3IKJA 4GLAC 3TS0A 3S1MH 2UUAQ 4H0LC 1SN8A 5GADC 2B3GA 3CCQA 5JPNC 2QILA 1IBMQ 2JA7H 4QJFA 2MGSA 2EZVA 4IPDA 3I4NH 1IBKQ 5A35A 3A5UA 1LTBD 2ES2A 1D8LA 3R2IA 2KCMA 1PRTC 5FO9B 4N8X1 4XTCS 3KJPA 2EQSA 2EJMA 2F03A 1KNAA 5C0XH 3H09A 2RSOA 3HS0C 3S1NH 2I5HA 3EJIA 3PIPA 1Q46A 2HCIA 2F52A 4LJZC 1R4PB 2A73B 3CC2A 1WOCA 4DR3Q 3ICEA 1OXVA 3SHLA 2R7DA 2ZJRA 1EY7A 4OWXB 1STHA 2BOSA 1EIFA 1PA6A 4P2CB 2R93H 3SR1A 4EGVA 2ZJPA 2WINB 2EVBA 2PNHA 4NPSA 1VCIA 3VR3A 4A3FB 1PH6A 1ENFA 3NE5B 2SEBD 1W6JA 1SNPA 4GOPB 2K1BA 4QGUA 5C44B 2ALYB 4CDDC 5IP9G 3RD4A 1EEFD 1I5FA 3H94A 1VQFA 4R8IA 3AYHB 3EBEA 4KV6A 2HHHQ 2VXWA 4XT1B 5IP9H 2I5LX 3UDIA 4KY7A 3QWNA 3CRLC 3SK5A 1JOKA 4NMZA 4Z9CB 4LUVA 1C48A 2BDOA 2NVTB 1PRTB 1VQ8A 2EJFC 1X55A 2LY7A 2HCCA 3MTSA 2DY7A 3MEFA 5E4XA 1FJGL 1I6HH 1W3SA 4DXGA 1VQIA 4ILWA 3AEVA 4JOIC 1AP0A 3AMUA 5JPMC 4P75A 2XVSA 4R9WA 3HKSA 2A6HD 1I50H 1QVGA 1HR0Q 3HOYG 2HIXA 3Q8DA 2Z1CA 5CBAE 1UNSA 2UXBL 1VQGA 4GNXB 1VQHA 1SE3A 2K52A 4IPHA 2AUJD 4ME3A 2NN6G 3MEHA 4C56C 1N32L 4DV4L 2B2WA 5JJIA 2ID0A 3NBHA 1YVCA 1X9NA 1XJVA 5KIXA 1D7QA 3U9SA 2YU9H 1QE6A 1CHPD 2NTSA 4BBRH 4DUYL 1EYAA 3ULLA 3GTMH 3E5SA 3D8GA 2JK8A 2OCEA 3A8JE 3MAQA 4X3KA 1VQPA 3G48A 2K5VA 1STGA 2UU9L 3C1EA 1XXGA 2C5CA 1CZWA 1I94L 2EYPA 2XGTA 4K5WA 2CCZA 2WB1G 5FLXE 3HOWH 2Y0SG 5M3MG 1ET6A 1JWMD 4CBVA 4DR7Q 3M3YH 3HGBA 1FR3A 2IHFA 2JJQA 2RQXA 5IWAL 1V8QA 5JOBA 1SYGA 4G4KA 4HJ8A 3BZCA 4HCEA 1YJWA 2XTIA 2CH4W 2R61A 1B44D 1G291 1L1OB 3KBXA 4QCLA 5CV8A 1KL9A 1HNZL 3F2BA 5D3IB 3T53B 1VQ6A 2R92G 2Q8IB 4KJNA 1K73C 1PMRA 1T9HA 1TKWB 2SDFA 2BE5C 2VY3A 4OWWB 1VQBA 1CFMA 3DM3A 1EOTA 2XIWA 4HJAA 4GNXC 3ERQA 4JG2A 5IODA 4CGYB 2R7ZB 3BG3A 2JA6G 1HQRD 4AQYL 2RSNA 1O7IA 2F3VA 1NE3A 5IWAQ 4AQYQ 5K36G 1V1OA 2KHIA 3PIOA 1V9PA 3HEJA 2D0PA 1R9TB 1A8VA 2VQFL 1EY5A 3LGJA 4JBJA 4JPBW 2AQ3B 1RF2D 1VS0A 3TREA 3K59A 2WP8J 4ZCKA 2E2HH 1TWAH 1EWCA 4B3MQ 4UHVA 4QUCA 5JEAJ 4ZQ3A 3GTJH 2D62A 5IGDA 5C3EH 3Q0AA 1O80A 4L8JA 2SOBA 2HD3A 3J81E 1MD2D 1VQJA 1L2FA 3MC0B 1CUKA 3I3CA 4BA2I 4DUYQ 1A2TA 2DUDA 4OL7A 5T1IA 4PV1C 1Y69U 3HZXA 4DAYB 4QL5A 3PUXA 3M4PA 2DN8A 1S5DD 1ICWA 4DV4Q 1I4PA 4OO1H 2A1AA 2KVMA 1I3QB 2N49A 3CCJA 2GA4B 4B3TL 1FL0A 1J6QA 4XYOA 2K01A 2O5JC 3OSOA 2D9UA 1EOVA 2KCTA 2KOLA 3A7LA 4K5VA 4A3CG 2SNMA 2NYZD 4K2LA 3VA7A 3BZDB 3R8BA 3T13A 4IN3A 2Q8RE 3IL8A 4IUPA 4A3CH 1HXYD 2AMCB 1SMXA 3H0GB 5IGEA 5M5WH 3HOUB 3QOLA 5EGTA 3OYYA 1G6ZA 2PMZE 1LT4D 1GOZA 3A8KE 3VYSA 2KHJA 3RLOA 3CF5A 5C4JH 5T1GA 1X3QA 1SEBD 1SNCA 4AYBB 2HIVA 3GV3A 4A93B 1F9RA 4BS9A 5IGCA 2JA8G 4XYQA 4K2KA 4KHPL 1H95A 1U4MA 3J81j 4CDEC 1I4GA 1S5FD 3A55A 4YHHL 1MSHA 2VUMG 3FEWX 4UP7A 2MO0A 5KEEA 1PH7A 3GTOH 3EN2A 2HHHL 3HOVH 4NKLA 4LW1A 1NTGA 1O7LA 2QA4A 2JEBI 1DCZA 1U9RA 2K5WA 1II3A 3LNNA 3I4NG 1Q86C 4A76A 1JCKB 5M5XB 4DV1Q 5JJZA 1TWAB 3F2UA 4GN5A 4EQPA 3PUWA 1TIID 5M5YB 1B7YB 2K14A 2UXDL 4UDUC 5LMNQ 4U673 2B63B 3DLLA 1MJCA 2NUCA 3S1QB 4LF9L 3CPFA 3KK7A 5D14A 2LXKA 2K4KA 4R4QA 2DNEA 3A5ZB 2WIIB 4DV6L 3J80E 1F9PA 2ZM6L 4DR6L 2K03A 3SXHA 1LTLA 4BY7H 4XQQA 4BBSG 1EIGA 2VUMB 1MSGA 2UUBL 5ISRA 3G71A 1LO5D 1BCPD 4ZLTF 1G51A 4K0KQ 5LMUQ 2R92B 4LF5Q 4G7HC 3S14B 2HDMA 3CCSA 3G7LA 4X3SA 4POFA 3C2PA 4LFAQ 2F0QA 2E2JH 1I94Q 4KMUC 2JA5H 2G9DA 3S1NB 1EZ8A 3MXUA 4A3DG 4C1NI 4KHVA 4PNYA 1XPUA 4O2DA 4RFBA 5COYA 1WYDA 2IT1A 3VDYA 4L5TA 2EYOA 1N34L 3K0XA 4UP8A 4O0AA 2F0EA 3E6ZX 2XRQD 4JI7L 3HG9A 1SMYD 3GP7A 4QMGA 1N32Q 1VQDA 4FNFA 5CGKA 4EVOA 1ASYA 4B3TQ 1XNRQ 4RMFA 3V05A 2CQOA 4IFDG 3TRZA 1SYCA 2G5DA 1ZKOA 1WD1A 4DR4L 1TWCB 4QUFA 4IFDH 4LUOA 1G2SA 2KHSA 5JJLA 1NR4A 2ZT9C 4HIDA 1HH2P 1RD9D 1S5ED 1YHAA 5EPJA 2AQ2B 4IOCA 4GKJQ 1JORA 2HUGA 3GD7A 1OXXK 1AW7A 1WTVA 4KKSA 3WWVA 3BZKA 4JYAL 1HNWL 1A2UA 4IFDJ 5FJ8G 4BBSH 1TS3A 1BUVT 4RKLA 1LABA 4DV5L 3D4WA 3J7YW 4OX9Q 2CFMA 2A5HA 3Q22A 2TSSA 2IWHA 5FJ8H 2CKZB 1SE4A 3T1YQ 3S1QH 1LLRD 1UE1A 1B9MA 3TMEA 5HGQA 3OIQA 1L1OC 5A2QE 2UXCL 1A62A 3CMEA 2NVTH 3FDTA 1T5XD 2OQ0A 3HP3A 4IUNA 3R2TA 4RWSC 3JAME 3I8ZA 4A3LH 2M9VA 4RH6A 2BA1A 3NENA 4ZUIA 4GOPA 1J5EL 4BBSB 2EDGA 1UEAB 4PMBA 3K5OA 3QR8A 4JVZA 4FF4A 1M1KC 3TP7A 5DEHA 4DF7A 2JEAI 1V1QA 4PG3A 2H5XA 4OX9L 2WFWA 4A3MB 4A3EG 4A3KB 4LF4L 3BU2A 1VQAA 3URYA 5K36H 5J1ZA 4R1JA 1GUNA 3NQTA 5JEAG 2F4IA 2O2LD 4ZKBB 4A3BH 3QIAA 1TY0A 1N36L 2UU9Q 2EYHA 1PTOF 1IBML 4A3DH 2Y0SE 1D5MC 2KEEA 3CW2C 3AFQA 3EQLC 1U4PA 3L2PA 2VNUD 2F0SA 2PCFB 5GAHC 1HZBA 3K80C 1D1IA 3HOUG 5C3XA 1SBBB 2QDBA 4JI5Q 2OXPA 5JAVA 1CTMA 4DR7L 4WRDA 5M3MH 1N33L 3C1FA 3J80i 4A3JB 1O78A 2GVAA 4A3KH 1K8AC 2X6GA 2Z6KA 4NDXA 3GTKB 4A93G 3NBHB 1SYDA 4A3FG 2QEXA 1X3GA 4DGZA 1Q8KA 2H4OA 1JB3A 4HN7A 1Y1VB 3ULPA 4JI5L 4RCNA 2Z6KC 1QNKA 1NBWA 4A3IH 4ODGA 2B2TC 4ZUJA 4BBRG 4XQNA 4JI8Q 1WVLA 1D2BA 3RMHA 1SR3A 3N6RA 4ID6A 5M9OA 3H91A 2QDLA 1SROA 1BOSA 2B2TA 4IQZA 5C4XG 1DOMA 4LFAL 1HZAA 2PW5A 1HR0W 1EL0A 1JMCA 3F1ZA 5ELCA 3GTGB 4JI6Q 4PQXA 1JJGA 1PH8A 1RHPA 1STNA 4K0KL 3H3VI 1U0LA 4HMIA 2PZWA 1UE5A 4GOPC 2F0DA 3I4LA 1GUGA 1WCMG 4KI0A 3UE1A 1TS2A 4JBWA 1SNQA 3PF5A 1ILPA 4DR6Q 4WFN3 3M4QA 1B4OA 4HJ7A 3PO2B 4QQBX 4LF8Q 2EYJA 4DV2Q 1Z9FA 4A3LG 4KTAA 1YNJD 4X64Q 1C8CA 1QOHA 4NXMQ 3UDXA 2R7ZG 4LFBQ 5LMNL 4A3MH 3RZDH 2DGYA 1G6PA 3S15B 5E7NA 4HSPA 1L0YB 2PZUA 1UWVA 5J22A 5A2QL 1GUSA 4DV1L 1A3UA 1LUZA 1E24A 4NW2A 4XQJA 1RJTA 1YNXA 4MZ9A 2CWAA 3PUZA 4JC0A 1ONLA 2F0LA 3CRKC 1OXTA 3E9IA 3UDGA 3U4ZA 3C3LA 1EZ6A 2L1BA 4FF2A 5LL6X 2IPKD 1STYA 1V43A 2F3WA 4XT3B 4WJ3M 2FXQA 2PI2A 5I9OA 4DR3L 5M5WB 1YNND 2EYFA 4GKJL 2Y0SB 4IPCA 5M3MB 2RDGA 1VQ5A 1I4XA 4YIJA 1T5EA 3KDFB 1CT1D 1WTHA 3TN2A 3K7UC 2N8NA 1I4QA 3PIO3 1GUTA 2XWBB 2WV6D 3PQIA 2X69A 2JP1A 1PH5A 2JA8B 4N9TA 1GUOA 1X65A 4IUQA 2M00A 3RZDB 4A3EB 2DJGC 4MN3A 4A93H 5C4ZA 3I4MB 1WCMH 4FVMA 3HFZB 1S5CD 4L5QA 4B9XA 3A0JA 1CK1A 1SNDA 4N8FA 1PVOA 2EPBA 2Z0SA 1HUMA 3KF8A 4CHTB 1K3RA 4JBMA 3KOJA 1VQEA 2ATWA 4Q0FA 2HQLA 1YI2A 5J39A 3L7ZC 4OHJA 3VYUA 3P75A 1VQ9A 2VB3X 1Y8NB 2Z8LA 5C4HA 1PZID 3SVMA 3LWEA 4JBKA 5C3EG 1BQQT 3NTKA 2L15A 1EFID 4WORA 3CCMA 3DWQA 1TWGB 2QF7A 1IW7D 4V190 1H9JA 1NY4A 4BY1H 4NXNQ 1C0AA 3HOWG 4AYBE 4YCUA 1VQ7A 3OIPA 1QVCA 2N78A 3OOCA 3PO2H 4LF7Q 4HCSA 4C3IB 1XPRA 2E75C 2QW7A 3NTIA 5G3LD 3AB9A 3DWAA 1IKMA 2A6HC 4B3ML 1KTKA 3PMFA 3ND9A 2KEDA 1K83B 3I2ZA 4GN3B 2CW0D 1GD7A 3C46A 2BH2A 2VQFQ 1ZEQX 3S1RB 1JC7A 1KAWA 3Q24A 3CCUA 5CV7A 3HOZG 2OTLA 1VF5C 3I72A 2KUMA 2I0QA 1LTRD 1Y1VH 5NUCA 4JV5L 1I4HA 3VR2A 1LTTD 1L0WA 1PH3A 1KDCA 2B63G 4G57A 4O1NA 1AZQA 3HOVG 2ZM6Q 4RAUC 4LFBL 2Q2HA 2NVYH 4NXML 4RGNA 4M8AA 2AHOB 2PI2E 3CCRA 2C35B 3E9HA 3GO5A 4DV2L 1LYLA 2EOTA 3N52A 4ABNA 4FXGC 3CXCA 4C2MH 1EQTA 1JOOA 3SEBA 2BCOA 4X62Q 1DOLA 3BDLA 2A74C 4BWGB 1NMFA 3T1YL 5LMNW 2QCPX 5IYCH 1MIUA 2K5DA 4HMJA 1JB7A 2LKVA 1Z7TA 4U68A 2FFKB 4A4IA 3MVVA 2JXMB 3I4OA 1QNUA 4GLVB 3EA6A 3S1RH 5I2YA 3WDNA 1CKOA 1JE4A 4MTNA 1IBKL 4M1UB 2F0HA 3D31A 5KYIA 2HT1A 4X64L 2AWNA 4YHHQ 1PFMA 5FO7B 4LF8L 5FLXL 2AKWB 4JI1L 1X56A 4NP5A 4C2MB 2BH8A 2OTJA 1I6VC 2MFIA 1TWFH 2RVLA 1PXUA 4POGA 4DR4Q 4J1MA 1TT2A 1C4QA 2FHTA 4YY3L 3D6CA 3M4OH 1XX8A 4DAVA 2F0WA 3L3OC 4JI6L 2VS1A 1S3OA 4JI4Q 1D5XC 4GN4B 2EIFA 1E0BA 1D1KA 2RCFA 3HKZE 3S1MB 4JOIA 4R4TA 2PQAB 5CR3A 4DV3Q 4Y52H 3J81i 3MXPA 2WKCA 4IZ8A 2J4XA 3HOYB 3S17B 1ILQA 1PFBA 3I91A 4GKKL 1TXYA 1GUWA 2F3IA 1BCPF 1SJHD 1PRTF 1BF4A 1UEBA 4JI1Q 2V1CC 3OWFA 1CI3M 1TY2A 2GVBA 5HY6A 1PYSB 5IP7H 4B3RQ 1XMQL 2F4VL 1X3EA 1XMOL 1FNUA 4DR2Q 3FKIG 4OELB 4IOAA 2OWOA 4LF5L 3W1BA 4C3JH 3OMGA 4QY7A 5C4XH 2Q2UA 1J8IA 3IFTA 1VQ4A 2FMMA 1LT6D 2ZXOA 3EFXD 3RZOB 1WTQA 1PTOB 3SGIA 2B63H 3KFUA 4XIGS 3KUPA 4KKTA 3OWEB 3U58A 1Y8OB 3HOXB 4YWLA 2FJ2A 3FPPA 1HNXQ 4A3IG 4L5RC 1TWHH 3M4OB 5IGFA 4RGTA 1HQMC 3A7AB 3FP9A 1AN8A 1XTDA 2K50A 4R4CA 2F0VA 1B8AA 5FOBB 2F0NA 2K32A 4A3EH 1IYJB 2EYLA 1Y1WB 1Q7YC 5IGBA 1KHIA 2A19A 4KHPQ 1I4RA 1YZ6A 5EAYA 3K0YA 1OTCA 2UUAL 4X3TA 2K28A 2L9HA 2EY2A 1PFSA 4S3SA 4EQOA 4RKBA 1BXTA 1E22A 1H9RA 3ER0A 3CHBD 2IL8A 2Q8TA 1IZ6A 4C3JG 1LACA 3CKIB 2QGQA 3SK6A 4OIJA 1RCVD 5C3EB 1DJRD 1M90C 1PFNA 1AE2A 2VQEL 4JYAQ 1K0RA 1HNWQ 2MJ8A 2R3ZA 1IL2A 3CCEA 4DV0L 5FLXc 3PO3H 4CJ0B 2E76C 3J7A5 2B2WC 1AZPA 1N34Q 2F0UA 3TBIB 1VMPA 4CDFC 4DNIA 1AFPA 1GJXA 3M7GA 1SJED 5IYBH 4A3KG 4FF1A 2MP1A 3RR5A 2F0OA 2PW7A 5I6WA 5K5PA 1KQSA 3BDOA 3PUYA 1LTGD 3BVZA 5E1FA 1WTPA 1EY6A 1W6KA 4LK1C 2KCNA 2IX0A 2E2IB 1I50B 4TSSA 3OW7A 2NZOA 1XNRL 4YWKA 3SE0A 1Q8IA 1H9SA 1IBLL 3S2HB 5KYLA 1NAPA 3AU7A 5IOCA 1BBXC 1XTCD 1IKLA 1R4QB 3S24A 3K81C 1LV9A 3MXNA 4OXPA 4J8QA 3EROA 4OIKA 2UUCQ 1Q1EA 3U50C 2E8GA 4OO1G 2IJ0A 2YTVA 3KLSA 1L0XB 3P1HA 1EU4A 5M5XH 4LF9Q 2AQ1B 4DFAA 3T1HL 2EXZA 4R4OA 2BDNA 5CV4A 3WOEA 2R92H 3ND8A 5IYBG 3P20A 1KNEA 2NVQH 2EE1A 1F9SA 2RCNA 2RDHA 3FRPB 3NTHA 3DWPA 5J3BA 3DEOA 1ZYRD 4I7ZC 2NN6I 4RG1A 5M3FH 4IFDI 4A3GG 1E3PA 3HRZC 3TS2A 3W2DA 3F8TA 3PO3B 1EY4A 4NB3A 5ELOA 3J81L 2J7ZA 3GTQB 3I7FA 5CYUA 1LTID 2EY5A 3FMCA 4J6HA 4A3GH 1HZCA 2OEOA 1IHZA 2MHVA 4A75A 4JI3Q 4APVA 1CA6A 1DM0B 4DR1Q 1RL2A 2BA0A 2RBMA 1U5KA 2UXDQ 1VMCA 1TQOA 1Q3LA 3E3XA 3NEMA 3LX0A 4X66L 4PZ7A 3KLRA 4C3JB 1RTOA 1KLGD 3TP5A 3H3VH 3NUCA 3MWYW 1EYGA 2N55A 4R4IA 1F2LA 3G6EA 1HFNA 1F2MA 2I5MX 2L12A 3T16A 1JQYD 2X6LA 3DM1A 3GTPH 2M2LA 2R6GA 1XMOQ 1JR0D 3QO2A 2F0GA 1TVXA 2JA7B 5C44G 1Y1VG 4EQ5A 4XXEA 3GDEA 1YEZA 3K5NA 3RLFA 2RKSA 1KD1C 2PO4A 1KIXA 2QEJC 3IAYA 3CU7A 3L9AX 4K14A 5IT9E 2A68D 2V4DA 2NZ1D 4X65Q 1B2TA 3ZJYC 4CJ2C 4DV3L 1DONA 5H1SE 5JVG3 4KLKA 1WTWA 1SFOB 2DY8A 4A3JH 4GZYC 3CC7A 1HR0L 5EQ0A 3GTKH 1B1ZA 3BVMA 4YCWA 1Q1BA 4G7ZC 2AWOA 2DJFC 1M8AA 4JCVE 1ENCA 1K8MA 1ZXTA 1BKBA 1QVFA 4DK6C 2K5QA 1CSQA 2F0PA 1S4ZA 3NQIA 4QIWE 3NPPA 1F9QA 1H9KA 3PSIA 1B50A 2E74C 1HJPA 4Q5VA 3J80L 3OPOA 2ICIA 1N8RC 3EIVA 1NR2A 1E1TA 3BYYB 2CWPA 4B3RL 2Q2TA 1E1OA 2SNSA 2G9HD 4IUUA 4I7AA 4LF6L 4DK3C 4UY8C 1GM5A 3S15H 2D0OA 1QCBD 2WAQE 5C6AA 4ULLA 2E2JB 4HR7B 3M3YB 4LNQA 4OONA 2TMPA 4H13C 2N88A 1CM9A 4BXXG 1AH9A 3PCOB 3S2DH 1EQQA 1RIPA 4KD3A 3STBC 3BJUA 1OXSC 1CA5A 3GTGH 1LT3D 1B70B 3K57A 5ELNA 1VQKA 1YBYA 1SLJA 3BS1A 2B2YA 3MHBA 2AUKA 3D6WA 3KDFA 2O4XA 1GHKA 1DGSA 1LT5D 4OWTB 3OMCA 3A8IE 1UUPA 5AJ3Q 4QF4A 1SE2A 1VF7A 3DEPA 4BY1G 3M85A 3SDZA 1MBYA 3G6JB 3WOFA 3I55A 3F2CA 1UE7A 4EX5A 3CQZB 3GTLB 2OQKA 2EY1A 3L0OA 3TSSA 2P5ZX 1IYUA 2L11A 2FMCA 3MXGA 1YNJC 2C9OA 5CV9A 5G3LF 3S16H 1QWYA 4A3GB 3JAMi 3E0JA 3CAMA 2CW0C 2E5LL 2JA7G 4FDBA 3OTOL 1PRTD 4LF7L 5IYCG 4OGQC 1A6XA 3ITPA 4BY7B 2NB0A 2NVXH 1HNZQ 4G7OC 3HOZH 1A0IA 5DAUA 5IY0A
chains in the Genus database with same CATH topology
3MFYA 2B2VA 1RDPD 4FO2A 5C5LA 3VR4A 1SXTA 3NBIA 2ZXPA 3K7AB 1ESRA 4ZK9B 1STEA 4K6DA 1SNOA 1TU2B 3X3NA 5EKLA 1BO0A 1BR9A 4C1NK 1YNNC 3HKZB 4TQUS 3FPUB 2DNCA 5EKIA 1STBA 1AEXA 2LS01 1EU3A 4QIWB 2L5TA 1DD2A 4FXKC 3IFDA 2JA5B 2F0FA 2LFNA 4C3HB 3OHXC 2NVQB 4CJ1B 3VYTA 1B53A 3T56B 2B8FA 4LMQD 4RA8A 5C0XJ 2F0KA 5E3FA 4OO1I 3GTPB 5HGTA 5EBCA 2E2DC 3HOWB 4PMWA 3PUVA 1FNWA 1KDAA 4BA1I 2F0TA 2PYKA 5JVH3 4I65A 3FVQA 2K33A 1JOQA 2D2CC 3FKIB 2XWJB 2KA7A 4DAPA 5C4XB 4RHRA 5BN5A 2NN6H 1TR5A 3J7AF 5EJWA 1MI2A 3ONAB 5KNDA 2J0TD 3GTOB 2B2VC 2IW3A 1PZJD 3D3RA 1KABA 1F2YA 5KGUA 1OXUA 1FYCA 2XRSD 4DAYA 2NTTA 2A6ED 3D4RA 1CQVA 2E2HB 1SSOA 1PLFA 5LL6S 2HDLA 3VR5A 5IT9L 1G91A 1PYWD 1RTNA 3TZDA 1X32A 3PIP3 5EPLA 4K8IA 2L4NA 2K05A 4DN4M 5FO8B 1HA6A 4QB4A 2RDFA 1A15A 1CHQD 2IX1A 1FGBD 2K6AA 1JWUD 1SYEA 2I46A 2Z4IA 3DUZA 4EQNA 4BBRB 3GTMB 1HTPA 1E2VA 3R93A 4ZYSA 4H7BA 4XDXA 4ZRZA 2R93B 4WJWA 5AFWA 2CHBD 1F2ZA 1HCZA 1H9MA 1IW7C 1Z6HA 4HEDA 1Y8PB 3VA5A 3K58A 5IGGA 4HAEA 1FNVA 1UAPA 4IUTA 5CV5A 5TSSA 1D6EC 2YYZA 1SDFA 4E6IA 1QB5D 2JYOA 4KY6A 3TDQA 1LTAD 3LWUA 3HOZB 2XNAC 1QG7A 2ICEC 1V1PB 1A3VA 4RGOS 1BDOA 1G2TA 4IURA 3MFGA 3X3MA 4HTHA 4ME5A 5KRUA 4DNRB 3BVGA 5I4DA 4C3IG 1JWSD 1EIHA 3NWTA 1BCPB 1Q12A 3MA2B 5BN4A 1IL8A 2PZTA 1SYFA 1ET9A 4LAAA 3TP8A 2JA6B 1E2ZA 2B8GA 2WB1B 1EEID 2NVYB 4JK1C 1ENAA 2CVRA 2A69C 3BYTB 5HURA 5D65A 1QILA 2MUYA 4ZAIA 3DMUA 1WTRA 1HHVA 2XN9C 5ELEA 2K7VA 1DZ1A 3VR6A 4C3HG 3M4YA 1EY8A 4K5XA 4KN7C 2VB2X 2F0MA 3A54A 2PNRC 3S16B 4F88A 2KECA 4TKOB 1IYVA 4V0BA 5CV6A 4H44C 5BN3A 5KNBA 4KKUA 4F87A 2EJGC 2XSCA 4K8JA 4Y7NB 1F77A 4KJOA 5F2DA 1KDBA 3QJYA 5JEAH 3U9OA 1HUNA 2CQAA 2B39A 5LHY1 2IX3A 5CC4A 1JICA 1ML0D 3SK8A 5CORA 5FK9C 3H6MA 4DNTB 2NBFA 4CKEA 2LMCB 2K04A 2PQEA 3RUZA 5C3WA 3JAML 3TZUA 2PMZB 1WTOA 3ZYYX 4FYDA 1GHJA 2WAQB 2I07B 2PPBC 2A68C 3T51B 3NSWA 1DYQA 1D5ZC 4DU9A 2BE5D 3I73A 1WCMB 5EPKA 4K6LA 1SNMA 2MPMA 5C4JB 2F0IA 2D5DA 3QOJA 1STAA 2B2UA 2A69D 5I6YA 1RKNA 1MGSA 3M7NA 4PMCA 1G8ZD 4UAIA 2JE6I 3K5LA 3I90A 4F8MA 1V1PA 5FKAC 1ESFA 4BY1B 3KLSX 3I4NB 3W3AA 1B3AA 1CZGA 2KCCA 3SK4A 1HFGA 4FXDA 2L0CA 5ELBA 3H3VC 1OO9B 1SAPA 2B2YC 1KAAA 3A56A 4L63B 3Q23A 1ZYRC 1PTOD 4KD4A 1U4RA 4DA2A 3DHQA 1TS4A 3I70A 4FF3A 4KN4C 4KHZA 4MIUA 3VYRA 4HSVA 3J7AV 3P7JA 1B9NA 2F0JA 1GXDC 1A3TA 3D4DA 5ELDA 4B9WA 3MZ5A 1X3PA 4IUVA 2F1MA 2YU9B 1KLUD 1SMYC 4B08A 4O42A 2KJXA 1TS5A 4X3UA 1EWHA 1HTLD 4RCOA 3V2TA 1NSNS 3QG1A 2B2UC 1VDZA 4FP5D 1WD0A 3NP8A 5C5MA 4IALA 1XYIA 4KK7A 2ENBA 5ELFA 3EVQA 3V96A 1QJOA 2Z4HA 1O7YA 5C0XI 1WTXA 1NUCA 3BDCA 1Q90A 1HPCA 1TWFB 2RA4A 4RGMA 1PTOC 2OF1A 5CMDA 2JSOA 4MHEA 4DXFA 5I9PA 1BNZA 2QKIC 5EBDA 1O7ZA 1CQFA 1H9SB 1TWHB 2NVXB 5M3FB 3K6OA 2OT2A 1EYCA 1BCPC 1M4VA 3GQBA 1S5BD 3DXJC 2WACA 1I6HB 4DK0A 1K8OA 1PZKD 3O13A 3K5MA 3KBGA 2H1EA 5CBEE 1J9OA 1LTSD 2HQEA 4A3DB 1RODA 5C0XG 1E2WA 3T4AC 3HOVB 2KQ3A 1EY9A 1Z47A 4TRDA 4N9PA 3S9WA 4L6TB 5DM63 5EKKA 4DK1A 5IIFA 1EY0A 5KNCA 4KY5A 2FINB 1XWEA 1HRJA 2A6EC 2EY6A 2L55A 3TP6A 2NWGA 5I2XA 1EQVA 3GV6A 3UI2A 2ZXRA 3NXWA 4RHSA 4A3BB 2O5IC 1NCVA 1PTOH 5E4WC 1SYBA 3R3OA 1DOKA 3NWSA 3Q6SA 1EYDA 1HA5A 5D3DA 5DM73 3NHHA 3PV0A 2WKDA 4CKCA 1DXMA 1U4LA 3QB3A 2EYMA 4CKBA 5DNFA 3NK9A 4F7XA 1FD7D 4ZKCB 4R8NA 1PDQA 3GTJB 3S2DB 4A3IB 3IKJA 4H0LC 5JPNC 2QILA 2MGSA 2EZVA 5A35A 1LTBD 3R2IA 1PRTC 5FO9B 4XTCS 2EJMA 2F03A 1KNAA 5C0XH 3H09A 2RSOA 3HS0C 3EJIA 2HCIA 4LJZC 1R4PB 2A73B 1OXVA 3SHLA 1EY7A 1STHA 2BOSA 4P2CB 3SR1A 4EGVA 2WINB 2EVBA 1VCIA 3VR3A 4A3FB 1ENFA 3NE5B 2SEBD 1W6JA 1SNPA 2K1BA 5C44B 3RD4A 1EEFD 3H94A 4R8IA 4KV6A 2VXWA 4XT1B 4KY7A 3QWNA 3CRLC 3SK5A 1JOKA 4NMZA 4Z9CB 1C48A 2BDOA 2NVTB 1PRTB 2EJFC 2LY7A 2HCCA 2DY7A 3MTSA 5E4XA 4DXGA 4ILWA 1AP0A 3AMUA 5JPMC 4R9WA 2XVSA 2A6HD 2Z1CA 5CBAE 1UNSA 1SE3A 2AUJD 2NN6G 3MEHA 4C56C 2B2WA 2ID0A 3NBHA 5KIXA 3U9SA 1QE6A 1CHPD 2NTSA 1EYAA 3E5SA 3D8GA 3A8JE 3MAQA 4X3KA 1STGA 3C1EA 1XXGA 2C5CA 1CZWA 2EYPA 4K5WA 5FLXE 1ET6A 1JWMD 4CBVA 3HGBA 1FR3A 2RQXA 1V8QA 5JOBA 1SYGA 4G4KA 4HCEA 2R61A 1B44D 1G291 3KBXA 4QCLA 5CV8A 5D3IB 3T53B 2Q8IB 4KJNA 1PMRA 1TKWB 2SDFA 2BE5C 1CFMA 1EOTA 2XIWA 3ERQA 5IODA 4CGYB 2R7ZB 3BG3A 1HQRD 2RSNA 2F3VA 5K36G 1V1OA 3HEJA 1R9TB 1EY5A 2AQ3B 1RF2D 3K59A 2WP8J 1EWCA 4QUCA 5JEAJ 4ZQ3A 3Q0AA 2D62A 5IGDA 1O80A 4L8JA 2SOBA 3J81E 1MD2D 3MC0B 3I3CA 4BA2I 1A2TA 4OL7A 5T1IA 4PV1C 1Y69U 3HZXA 3PUXA 2DN8A 1S5DD 1ICWA 4OO1H 1I4PA 2KVMA 1I3QB 2GA4B 4XYOA 2K01A 2O5JC 3OSOA 2D9UA 2KOLA 3A7LA 4K5VA 2SNMA 2NYZD 4K2LA 3VA7A 3BZDB 3R8BA 3T13A 4IN3A 2Q8RE 3IL8A 4IUPA 1HXYD 3H0GB 5IGEA 3HOUB 3QOLA 5EGTA 1G6ZA 1LT4D 1GOZA 3A8KE 3VYSA 5T1GA 1X3QA 1SEBD 1SNCA 4AYBB 3GV3A 4A93B 1F9RA 4BS9A 5IGCA 4XYQA 4K2KA 1U4MA 1I4GA 1S5FD 3A55A 1MSHA 3FEWX 5KEEA 4NKLA 1O7LA 2JEBI 1DCZA 1U9RA 2K5WA 1II3A 3LNNA 1JCKB 5M5XB 5JJZA 1TWAB 3F2UA 4EQPA 3PUWA 1TIID 5M5YB 4UDUC 4U673 2B63B 2NUCA 3S1QB 3KK7A 5D14A 2DNEA 2WIIB 3J80E 1F9PA 2K03A 3SXHA 4XQQA 1EIGA 2VUMB 1MSGA 5ISRA 1LO5D 1BCPD 4ZLTF 2R92B 4G7HC 3S14B 2HDMA 3G7LA 4X3SA 3C2PA 2F0QA 4KMUC 2G9DA 3S1NB 1EZ8A 3MXUA 4C1NI 4KHVA 4PNYA 4RFBA 5COYA 2IT1A 2EYOA 2F0EA 3E6ZX 2XRQD 3HG9A 1SMYD 3GP7A 4QMGA 4FNFA 5CGKA 4EVOA 3V05A 4IFDG 1SYCA 1ZKOA 1WD1A 1TWCB 4QUFA 4IFDH 1G2SA 2KHSA 1NR4A 2ZT9C 1RD9D 1S5ED 5EPJA 2AQ2B 1JORA 2HUGA 3GD7A 1OXXK 1AW7A 1WTVA 4KKSA 1A2UA 4IFDJ 1TS3A 1BUVT 4RKLA 1LABA 3D4WA 3J7YW 2A5HA 3Q22A 2TSSA 2IWHA 1SE4A 1LLRD 3TMEA 1B9MA 3OIQA 5A2QE 3FDTA 1T5XD 3HP3A 4IUNA 3R2TA 4RWSC 3JAME 3I8ZA 2M9VA 4RH6A 2BA1A 4ZUIA 4BBSB 2EDGA 1UEAB 4PMBA 3K5OA 4FF4A 3TP7A 5DEHA 4DF7A 2JEAI 4A3MB 4A3KB 3URYA 5K36H 5J1ZA 1GUNA 3NQTA 5JEAG 2F4IA 2O2LD 4ZKBB 3QIAA 1TY0A 2EYHA 1PTOF 1D5MC 2KEEA 3EQLC 2VNUD 1U4PA 2F0SA 2PCFB 1D1IA 5C3XA 1SBBB 2QDBA 2OXPA 5JAVA 1CTMA 4WRDA 3C1FA 4A3JB 1O78A 2X6GA 4NDXA 3GTKB 1SYDA 4DGZA 2H4OA 4HN7A 1JB3A 1Y1VB 4RCNA 1QNKA 4ODGA 2B2TC 4ZUJA 4XQNA 1WVLA 1D2BA 3RMHA 3N6RA 4ID6A 5M9OA 3H91A 1BOSA 2B2TA 4IQZA 1DOMA 2PW5A 1EL0A 5ELCA 3GTGB 4PQXA 1RHPA 1STNA 4HMIA 2PZWA 2F0DA 3I4LA 1GUGA 4KI0A 1TS2A 4JBWA 1SNQA 1ILPA 4WFN3 1B4OA 3PO2B 2EYJA 4KTAA 1YNJD 1C8CA 1QOHA 3S15B 4HSPA 1L0YB 2PZUA 5J22A 5A2QL 1GUSA 1A3UA 4NW2A 4XQJA 1RJTA 3PUZA 1ONLA 2F0LA 3CRKC 1OXTA 3C3LA 1EZ6A 4FF2A 2L1BA 5LL6X 2IPKD 1V43A 1STYA 2F3WA 4XT3B 5I9OA 5M5WB 1YNND 2EYFA 2Y0SB 5M3MB 2RDGA 1I4XA 4YIJA 1T5EA 1CT1D 3TN2A 1I4QA 3PIO3 1GUTA 2XWBB 2WV6D 2X69A 2JP1A 2JA8B 4N9TA 1GUOA 4IUQA 2M00A 3RZDB 4A3EB 4MN3A 5C4ZA 3I4MB 4FVMA 1S5CD 4B9XA 1CK1A 1SNDA 2EPBA 1HUMA 3KF8A 4CHTB 4Q0FA 5J39A 3L7ZC 4OHJA 3VYUA 3P75A 2VB3X 1Y8NB 2Z8LA 5C4HA 1PZID 3SVMA 3LWEA 1BQQT 3NTKA 1EFID 4WORA 3DWQA 1TWGB 2QF7A 1IW7D 4V190 1H9JA 3OIPA 3OOCA 4HCSA 4C3IB 2E75C 3NTIA 5G3LD 1IKMA 3AB9A 3DWAA 2A6HC 1KTKA 3PMFA 3ND9A 2KEDA 1K83B 2CW0D 3C46A 1ZEQX 3S1RB 1JC7A 3Q24A 5CV7A 1VF5C 3I72A 2KUMA 1LTRD 5NUCA 1I4HA 3VR2A 1LTTD 1KDCA 4G57A 4O1NA 1AZQA 4RAUC 4RGNA 4M8AA 3GO5A 2EOTA 3N52A 4ABNA 4FXGC 1EQTA 1JOOA 3SEBA 2BCOA 1DOLA 3BDLA 2A74C 4BWGB 2QCPX 2K5DA 4HMJA 2LKVA 1Z7TA 4U68A 2FFKB 3MVVA 2JXMB 1QNUA 3EA6A 5I2YA 3WDNA 1JE4A 4M1UB 2F0HA 3D31A 5KYIA 2AWNA 1PFMA 5FO7B 5FLXL 4NP5A 4C2MB 1I6VC 2RVLA 1PXUA 4J1MA 1TT2A 1C4QA 2FHTA 3D6CA 1XX8A 4DAVA 2F0WA 3L3OC 1D5XC 1E0BA 1D1KA 3S1MB 5CR3A 3MXPA 2WKCA 4IZ8A 2J4XA 3HOYB 3S17B 1ILQA 1PFBA 3I91A 1GUWA 1BCPF 1SJHD 1PRTF 1BF4A 3OWFA 1CI3M 1TY2A 1FNUA 3OMGA 1J8IA 3IFTA 2FMMA 1LT6D 2ZXOA 3EFXD 3RZOB 1WTQA 1PTOB 4XIGS 3KUPA 4KKTA 3OWEB 1Y8OB 3HOXB 2FJ2A 3FPPA 3M4OB 5IGFA 4RGTA 1HQMC 3A7AB 1AN8A 2F0VA 5FOBB 2F0NA 2K32A 2EYLA 1Y1WB 5IGBA 1I4RA 3K0YA 4X3TA 2K28A 2L9HA 2EY2A 4S3SA 4EQOA 4RKBA 1BXTA 1H9RA 3CHBD 2IL8A 2Q8TA 4C3JG 1LACA 3CKIB 3SK6A 4OIJA 1RCVD 5C3EB 1DJRD 1PFNA 2MJ8A 2R3ZA 4CJ0B 2E76C 2B2WC 1AZPA 2F0UA 3TBIB 1VMPA 1AFPA 1GJXA 3M7GA 1SJED 4FF1A 2MP1A 2F0OA 2PW7A 5I6WA 5K5PA 3BDOA 3PUYA 1LTGD 3BVZA 5E1FA 1WTPA 1EY6A 1W6KA 4LK1C 2KCNA 2IX0A 2E2IB 1I50B 4TSSA 3OW7A 3SE0A 1Q8IA 1H9SA 3S2HB 5KYLA 1NAPA 3AU7A 5IOCA 1BBXC 1XTCD 1IKLA 1R4QB 1LV9A 3MXNA 4J8QA 3EROA 4OIKA 1Q1EA 4OO1G 2IJ0A 3KLSA 1L0XB 3P1HA 1EU4A 2AQ1B 4DFAA 2EXZA 2BDNA 5CV4A 3WOEA 3ND8A 3P20A 1KNEA 2EE1A 1F9SA 2RDHA 3FRPB 3NTHA 3DWPA 3DEOA 1ZYRD 4I7ZC 2NN6I 4IFDI 3HRZC 3W2DA 3PO3B 1EY4A 3J81L 2J7ZA 3GTQB 5CYUA 1LTID 2EY5A 3FMCA 4J6HA 2OEOA 1IHZA 2MHVA 1CA6A 1DM0B 2BA0A 2RBMA 1VMCA 1TQOA 1Q3LA 3LX0A 3KLRA 4C3JB 1RTOA 1KLGD 3TP5A 3NUCA 3MWYW 2N55A 1F2LA 1HFNA 1F2MA 2L12A 3T16A 1JQYD 2X6LA 3DM1A 2M2LA 2R6GA 1JR0D 3QO2A 2F0GA 1TVXA 2JA7B 3K5NA 4XXEA 3RLFA 2RKSA 2PO4A 2QEJC 3IAYA 3CU7A 3L9AX 4K14A 5IT9E 2A68D 2V4DA 2NZ1D 1B2TA 4CJ2C 1DONA 5JVG3 1WTWA 1SFOB 4GZYC 2DY8A 5EQ0A 1B1ZA 3BVMA 1Q1BA 4G7ZC 2AWOA 1M8AA 1ENCA 1K8MA 1ZXTA 2K5QA 2F0PA 1S4ZA 3NQIA 3NPPA 1F9QA 1H9KA 1B50A 2E74C 4Q5VA 3J80L 3OPOA 2ICIA 1NR2A 3BYYB 2SNSA 2G9HD 4IUUA 1QCBD 5C6AA 2E2JB 4ULLA 4HR7B 3M3YB 2TMPA 4H13C 2N88A 1CM9A 4KD3A 1OXSC 1CA5A 1LT3D 3K57A 3BS1A 2B2YA 3MHBA 2AUKA 3D6WA 2O4XA 1GHKA 1LT5D 3OMCA 3A8IE 1UUPA 4QF4A 1SE2A 1VF7A 3DEPA 3M85A 3SDZA 1MBYA 3G6JB 3WOFA 3CQZB 3GTLB 2EY1A 3TSSA 1IYUA 2L11A 2FMCA 3MXGA 1YNJC 2C9OA 5CV9A 5G3LF 1QWYA 4A3GB 3E0JA 2CW0C 1PRTD 4OGQC 1A6XA 3ITPA 4BY7B 2NB0A 4G7OC 5DAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYG A;  5IIF A;  2F0S A;  5KYL A;  3V2T A;  4QMG A;  5IOC A;  4ME5 A;  3SHL A;  1NSN S;  2EYF A;  5I9O A;  1EY0 A;  5KRU A;  5C5L A;  1EY7 A;  5C3X A;  5CGK A;  2QDB A;  1STH A;  4EVO A;  2OXP A;  4KY5 A;  5CV8 A;  4YIJ A;  5JAV A;  4DU9 A;  1SNC A;  3SR1 A;  4WRD A;  3ERO A;  3NP8 A;  1SNO A;  1ENC A;  3C1F A;  4K6D A;  4KJN A;  1SYC A;  5C5M A;  5EKL A;  1SNM A;  4IAL A;  4NDX A;  1JOO A;  2F0P A;  5IGC A;  2ENB A;  2F0I A;  2EY6 A;  1SYD A;  3EVQ A;  3QOJ A;  1STA A;  1SNP A;  4K2K A;  3BDL A;  4N9T A;  5JOB A;  5I6Y A;  2KHS A;  1RKN A;  4DGZ A;  2M00 A;  3P1H A;  3TP6 A;  3ERQ A;  1EQV A;  4PMC A;  5IGF A;  4DFA A;  5IOD A;  4HMJ A;  5C4Z A;  2PZT A;  2LKV A;  1SYF A;  1STB A;  4K8I A;  2EXZ A;  3MVV A;  4LAA A;  5CV4 A;  1AEX A;  1NUC A;  3TP8 A;  3BDC A;  5KEE A;  1JOR A;  4QB4 A;  4ODG A;  4ZUJ A;  3NXW A;  4NKL A;  2RDF A;  4KV6 A;  4F8M A;  2F3V A;  2SNS A;  1A2U A;  2F0H A;  1ENA A;  1U9R A;  5KYI A;  1II3 A;  1SYE A;  2F0V A;  3HEJ A;  2F0N A;  4ID6 A;  4B9X A;  5HUR A;  1SYB A;  1SND A;  5M9O A;  3R3O A;  1EY5 A;  4RKL A;  2F0F A;  2EYL A;  4EQN A;  4KY7 A;  3D4W A;  2OF1 A;  3DMU A;  3SK4 A;  3SK5 A;  4EQP A;  5C6A A;  1JOK A;  4NMZ A;  4NP5 A;  1EYD A;  2PW5 A;  5IGB A;  1EY4 A;  4H7B A;  3TME A;  2EY5 A;  3NHH A;  1EY8 A;  1STN A;  2OEO A;  4J6H A;  4K5X A;  1IHZ A;  4ZQ3 A;  5I9P A;  5IGD A;  2SOB A;  2F0M A;  4KD3 A;  4HTH A;  4J1M A;  1KAA A;  1TT2 A;  2F0K A;  2NUC A;  2PZW A;  4HMI A;  3P75 A;  1F2Z A;  5KGU A;  5J39 A;  2F0D A;  3D6C A;  2EY2 A;  1A2T A;  4OL7 A;  5C4H A;  2RBM A;  3QB3 A;  4S3S A;  4IUN A;  5CV6 A;  5E3F A;  3HZX A;  2EYM A;  2F0W A;  4EQO A;  4RKB A;  4KD4 A;  3VA5 A;  4WOR A;  1SNQ A;  1EYC A;  3NK9 A;  3SXH A;  1TQO A;  5IGG A;  5HGT A;  3MHB A;  3LX0 A;  4F7X A;  3DHQ A;  2O4X A;  4K8J A;  4ZUI A;  5EKK A;  4R8N A;  3MEH A;  4MIU A;  5CV5 A;  5CR3 A;  3TP5 A;  5ISR A;  3NUC A;  2EYJ A;  3SK6 A;  3OMC A;  1KDA A;  4KJO A;  4KTA A;  4PMB A;  4QF4 A;  2WAC A;  2F0T A;  2PYK A;  5F2D A;  4E6I A;  1KDB A;  3OSO A;  3U9O A;  3MXP A;  4IZ8 A;  5KIX A;  2F0J A;  4I65 A;  4KY6 A;  1F2M A;  1JOQ A;  3TP7 A;  3T16 A;  5DEH A;  4DF7 A;  5I6W A;  1EYA A;  3E5S A;  3D8G A;  4K5V A;  1A3T A;  3D4D A;  3PMF A;  4B9W A;  2SNM A;  2F0Q A;  3MZ5 A;  2F0G A;  2PZU A;  5CC4 A;  2F0U A;  2HQE A;  5J22 A;  2EY1 A;  3OWF A;  1TR5 A;  3SK8 A;  4K2L A;  1EZ8 A;  1STG A;  1A3U A;  3T13 A;  3C1E A;  2F0O A;  3H6M A;  2PW7 A;  4KHV A;  2RKS A;  2PQE A;  4PNY A;  3NQT A;  5CV9 A;  1A3V A;  5J1Z A;  3RUZ A;  5CV7 A;  5K5P A;  5C3W A;  2EYP A;  2KQ3 A;  4K14 A;  4K5W A;  5E1F A;  1EY9 A;  1EY6 A;  2EYH A;  5NUC A;  4TRD A;  5IGE A;  4N9P A;  2EYO A;  3QOL A;  3S9W A;  2F0L A;  3OMG A;  3EJI A;  3ITP A;  5EGT A;  1KDC A;  1EZ6 A;  1KAB A;  2F0E A;  5DAU A;  1STY A;  2F3W A;  4G57 A;  1F2Y A; 
#chains in the Genus database with same CATH topology
 3MFY A;  3HOX H;  1PH9 A;  2B2V A;  1J5E Q;  1RDP D;  4FO2 A;  5C5L A;  3VR4 A;  1SXT A;  3NBI A;  2ZXP A;  1PHJ A;  3K7A B;  1ESR A;  4ZK9 B;  1STE A;  1EUJ A;  1P16 A;  4K6D A;  1SNO A;  1TU2 B;  3X3N A;  2N3S A;  4MTK A;  5EKL A;  1BO0 A;  1KXL A;  1BR9 A;  1QUQ A;  4C1N K;  1HZ9 A;  1YNN C;  3HKZ B;  1PH1 A;  2UXC Q;  3M9B A;  4TQU S;  3FPU B;  2DNC A;  3H0G H;  5EKI A;  5GAE C;  1STB A;  4WJ4 A;  1AEX A;  2LS0 1;  1XNQ L;  1EU3 A;  4QIW B;  3PO3 G;  2MNA A;  2L5T A;  1DD2 A;  3T1H Q;  1EFW A;  4FXK C;  1NMG A;  3IFD A;  2JA5 B;  2F0F A;  1WJJ A;  1PV4 A;  2LFN A;  4C3H B;  3OHX C;  2NVQ B;  1P8L A;  4CJ1 B;  3VYT A;  1B53 A;  3T56 B;  2B8F A;  4LMQ D;  4RA8 A;  5C0X J;  1ASZ A;  2F0K A;  4GS3 A;  2RF4 A;  5IP7 G;  2UUB Q;  5E3F A;  4HJ9 A;  4OO1 I;  3GTP B;  3HOU H;  4DR5 L;  5HGT A;  5BR8 L;  4X6A H;  3MXN B;  5EBC A;  4DV6 Q;  2E2D C;  3HOW B;  4PMW A;  3PUV A;  1FNW A;  4JI7 Q;  1KDA A;  2IY5 B;  4BA1 I;  2F0T A;  2PYK A;  5JVH 3;  4I65 A;  3FVQ A;  3JC6 6;  2K33 A;  3HOX G;  1JOQ A;  2D2C C;  1K28 A;  3FKI B;  2XWJ B;  2KA7 A;  4DAP A;  1YIT A;  5C4X B;  4RHR A;  5BN5 A;  2NN6 H;  1TR5 A;  3H15 A;  1VQM A;  3J7A F;  5EJW A;  3RN5 A;  4DUZ Q;  1MI2 A;  3JAM c;  3ONA B;  3RNU A;  5KND A;  3GTQ H;  5FLM G;  2J0T D;  3GTO B;  2B2V C;  2IW3 A;  1PZJ D;  3D3R A;  3FKI H;  1KAB A;  4JI0 Q;  1F2Y A;  5KGU A;  4L5S A;  1OXU A;  1FYC A;  2XRS D;  4DAY A;  2LSS A;  2NTT A;  2A6E D;  3D4R A;  1CQV A;  1MKH A;  2E2H B;  4B3S Q;  1KC8 C;  1XPO A;  2JN4 A;  1SSO A;  1PLF A;  4JI0 L;  1TWG H;  5LL6 S;  1YJN A;  2RHQ B;  2HDL A;  2WB1 E;  5IT9 L;  3VR5 A;  1G91 A;  1PYW D;  1RTN A;  4OEM B;  3TZD A;  3CCL A;  1X32 A;  3PIP 3;  5EPL A;  4K8I A;  2L4N A;  2K05 A;  4DN4 M;  5FO8 B;  1HA6 A;  4QB4 A;  1MHW C;  2RDF A;  1GO3 E;  1A15 A;  1CHQ D;  2IX1 A;  3H0G G;  1FGB D;  2K6A A;  1JWU D;  4J15 A;  1SYE A;  2I46 A;  5FLM H;  2Z4I A;  3DUZ A;  4EQN A;  2VZA A;  2R93 G;  3S14 H;  1HNX L;  1NNX A;  4BBR B;  3GTM B;  1HTP A;  1VQL A;  1E2V A;  3R93 A;  4ZYS A;  4H7B A;  4XDX A;  3NEL A;  4ZRZ A;  2ZTC A;  1C7Y A;  2IHE A;  2R93 B;  4WJW A;  3FHW A;  4UP9 A;  5AFW A;  2YTX A;  2CHB D;  3F2D A;  1F2Z A;  1HCZ A;  1H9M A;  3KF6 A;  4GKK Q;  2UUC L;  1IW7 C;  3I4M H;  1Z6H A;  4HED A;  1Y8P B;  3TEH B;  1Q82 C;  3VA5 A;  3K58 A;  3KYH C;  5IGG A;  1L1O A;  1TWC H;  4HAE A;  1FNV A;  1UAP A;  1QUQ B;  4IUT A;  1N9W A;  5CV5 A;  5TSS A;  3UDF A;  1D6E C;  2YYZ A;  1SDF A;  4E6I A;  1QB5 D;  2JYO A;  3IRB A;  4DPG A;  1FVI A;  4KY6 A;  3TDQ A;  1LTA D;  3LWU A;  4YY3 Q;  3HOZ B;  2XNA C;  1R9T H;  3W1G A;  1JE5 A;  1QG7 A;  2ICE C;  1VQO A;  4DV7 L;  1V1P B;  1A3V A;  3K7A H;  4RGO S;  1X6O A;  1BDO A;  2R7Z H;  1G2T A;  4IUR A;  2WAQ G;  3MFG A;  3X3M A;  4LFC L;  4HTH A;  4ME5 A;  1ICF B;  4DAM A;  4C3I H;  5KRU A;  4DNR B;  1IXR A;  4P71 A;  3HKZ G;  3CCV A;  3BVG A;  4X65 L;  4GNX A;  5I4D A;  4C3I G;  1JWS D;  1EIH A;  3NWT A;  4HIM A;  1BCP B;  1Q12 A;  4A3B G;  3MA2 B;  5BN4 A;  5L37 A;  3I56 A;  1IL8 A;  1KRT A;  1QZH A;  2E5L Q;  2PZT A;  3K8A A;  1SYF A;  1ET9 A;  4LAA A;  3TP8 A;  2JA6 B;  1VQC A;  1E2Z A;  2B8G A;  3CP0 A;  2K75 A;  5GQO A;  5GAG C;  1YJ9 A;  4LF4 Q;  2WB1 B;  1EEI D;  2NVY B;  4JK1 C;  1ENA A;  1E7Z A;  1GVP A;  2CVR A;  4TVA B;  4JI2 Q;  4DUZ L;  2A69 C;  3BYT B;  5HUR A;  5D65 A;  5C44 H;  1QIL A;  2MUY A;  3UE0 A;  4ZAI A;  3DMU A;  1WTR A;  1HHV A;  2XN9 C;  5ELE A;  2K7V A;  1DZ1 A;  4DV7 Q;  3VR6 A;  4C3H G;  1PH4 A;  3M4Y A;  1EY8 A;  4K5X A;  4KN7 C;  2VB2 X;  4YCV A;  2LXJ A;  2KBN A;  2F0M A;  3A54 A;  4DR1 L;  2PNR C;  3CMA A;  1K3B C;  3KLW A;  4F88 A;  2KEC A;  3S16 B;  4TKO B;  1IYV A;  4V0B A;  5CV6 A;  3B6Y A;  4H44 C;  4HIO A;  1PH2 A;  5BN3 A;  1A63 A;  5IE8 A;  5KNB A;  4KKU A;  5BR8 Q;  4IO9 A;  4F87 A;  4DR5 Q;  1UE6 A;  4LFC Q;  2EJG C;  2XSC A;  4K8J A;  4AH6 A;  4JW0 A;  4Y7N B;  1F77 A;  4KJO A;  2Q2I A;  5F2D A;  1KDB A;  3QJY A;  5JEA H;  3U9O A;  1HUN A;  1X3F A;  2CQA A;  2B39 A;  5LHY 1;  2IX3 A;  1X54 A;  5CC4 A;  2CH4 A;  1JIC A;  1ML0 D;  3SK8 A;  5COR A;  2VL6 A;  1XMQ Q;  2RHS B;  2YTY A;  5FK9 C;  3H6M A;  2NBF A;  2LMC B;  2K04 A;  2PQE A;  3RUZ A;  4CKE A;  4DNT B;  2A8V A;  3KF8 B;  5C3W A;  3JAM L;  1CKN A;  4IJL A;  1XNQ Q;  3TZU A;  1QZG A;  2PMZ B;  1K9M C;  1WTO A;  4LUZ A;  3ZYY X;  3J81 c;  4FYD A;  1GHJ A;  2WAQ B;  2JA5 G;  2I07 B;  4GLX A;  4DV0 Q;  2PPB C;  2A68 C;  3T51 B;  1IBL Q;  1JT8 A;  3NSW A;  2VQE Q;  1DYQ A;  1D5Z C;  4DU9 A;  2BE5 D;  3I73 A;  1WCM B;  5EPK A;  5M3F G;  4K6L A;  1SNM A;  2MPM A;  3TQY A;  5C4J B;  2F0I A;  2D5D A;  1K83 H;  3QOJ A;  1STA A;  4BXX H;  2B2U A;  1EWI A;  2A69 D;  5I6Y A;  1RKN A;  1AE3 A;  2PQA A;  5IT9 c;  1MGS A;  3M7N A;  4PMC A;  1G8Z D;  4UAI A;  2JE6 I;  3OTO Q;  1LM0 A;  3K5L A;  3ULJ A;  3I90 A;  4F8M A;  1V1P A;  4LWC A;  5FKA C;  1ESF A;  4BY1 B;  4IPG A;  3KLS X;  3I4N B;  3W3A A;  1B3A A;  1CZG A;  3J80 c;  2KCC A;  2NZH A;  1PYB A;  3SK4 A;  1HFG A;  4FXD A;  2L0C A;  1GKH A;  5ELB A;  3H3V C;  1CKN B;  3PGZ A;  5IYD H;  4YWM A;  4B3S L;  1OO9 B;  1WFQ A;  4MNO A;  1SAP A;  5JJK A;  1JJ2 A;  2B2Y C;  3A74 A;  1KAA A;  3A56 A;  1EQR A;  4X62 L;  4L63 B;  4C3H H;  4X66 Q;  1ZYR C;  3Q23 A;  1PTO D;  2VUM H;  3STB D;  4IJH A;  4KD4 A;  4H02 A;  1U4R A;  4DA2 A;  3DHQ A;  1TS4 A;  4PZ6 A;  3I70 A;  4FF3 A;  4KN4 C;  4KHZ A;  4MIU A;  3VYR A;  4HJ5 A;  4HSV A;  3J7A V;  2K5N A;  3P7J A;  5DLQ E;  3KJO A;  1B9N A;  4Y7N H;  4AIM A;  2F0J A;  4A3J G;  1GXD C;  1A3T A;  3D4D A;  5ELD A;  4B9W A;  3J7Z C;  3MZ5 A;  2VW9 A;  1X3P A;  3PF4 A;  4IUV A;  3AQQ A;  2F1M A;  2YU9 B;  3OW2 A;  1KLU D;  1SMY C;  4DR2 L;  3G4S A;  2F4V Q;  5IYD G;  1YHB A;  1JJC B;  4B08 A;  4O42 A;  2KJX A;  1S40 A;  2ZJQ A;  1TS5 A;  4X3U A;  3RLN A;  1EWH A;  1HTL D;  4A3F H;  4RCO A;  3V2T A;  2EXD A;  1NSN S;  3QG1 A;  2B2U C;  1YIJ A;  1VDZ A;  3HOY H;  3KF6 B;  3S17 H;  3AFP A;  4FP5 D;  1WD0 A;  2MO1 A;  3NP8 A;  2R7F A;  5C5M A;  4CDC C;  4IAL A;  1XYI A;  4KK7 A;  2ENB A;  5ELF A;  3EVQ A;  3V96 A;  2KEN A;  4AYB G;  4PZ8 A;  1QJO A;  2Z4H A;  1O7Y A;  5C0X I;  1K8G A;  1WTX A;  1WI5 A;  1NUC A;  3BDC A;  1Q90 A;  1HPC A;  4JI8 L;  1CKM A;  1TWF B;  2RA4 A;  4RGM A;  3RZO H;  1PTO C;  2OF1 A;  5CMD A;  2JSO A;  2Z9H A;  4ALP A;  2K5H A;  2ZTE A;  2MQH A;  4MHE A;  1EIY B;  4DXF A;  3W5O A;  5I9P A;  1BNZ A;  2QKI C;  1W2B A;  5EBD A;  1O7Z A;  1CQF A;  1H9S B;  1TWH B;  4DKA C;  2NVX B;  1SFO H;  5M3F B;  4P74 A;  3K6O A;  2OT2 A;  1EYC A;  1BCP C;  1M4V A;  3GQB A;  1SRU A;  4P72 A;  4JI3 L;  1N36 Q;  1S5B D;  3DXJ C;  2WAC A;  1I6H B;  4JI2 L;  4DK0 A;  2JA6 H;  1K8O A;  1PZK D;  3O13 A;  3K5M A;  3KBG A;  2H1E A;  1YHQ A;  1C9O A;  5CBE E;  1J9O A;  3RN2 A;  2ZTD A;  1LTS D;  2HQE A;  1BBW A;  3E0E A;  4JV5 Q;  3CC4 A;  4A3D B;  1ROD A;  1VQN A;  5C0X G;  1E2W A;  3T4A C;  4HIK A;  2B29 A;  4UPA A;  3CPW A;  3HOV B;  2KQ3 A;  5AJ3 L;  1EY9 A;  4A3M G;  1Z47 A;  4TRD A;  4N9P A;  3U4V A;  3S9W A;  4L6T B;  5DM6 3;  5EKK A;  4DK1 A;  5IIF A;  2GN5 A;  2E2I H;  2UXB Q;  1NJI C;  1EY0 A;  5KNC A;  4KY5 A;  4BY7 G;  2FIN B;  1XWE A;  3CD6 A;  1BBU A;  2JA9 A;  1HRJ A;  2A6E C;  1KRS A;  2EY6 A;  1S72 A;  2L55 A;  3PO2 G;  3TP6 A;  2NWG A;  5I2X A;  4DV5 Q;  1Q81 C;  1Y14 B;  1EQV A;  2JQO A;  3GV6 A;  4LF6 Q;  3UI2 A;  2ZXR A;  4P73 A;  5GRO A;  3NXW A;  1MJE A;  4RHS A;  4A3B B;  2O5I C;  1CSP A;  1K0S A;  5M5Y H;  1NCV A;  1PTO H;  5E4W C;  3CQZ H;  3GTL H;  1SYB A;  3R3O A;  1DOK A;  3NWS A;  2Z6B A;  4NXN L;  3Q6S A;  1EYD A;  1HA5 A;  1BVS A;  1SE8 A;  5D3D A;  5DM7 3;  3D0F A;  3NHH A;  3PV0 A;  3ERS X;  1Y1W G;  2WKD A;  1I3Q H;  2YV5 A;  4CKC A;  4JI4 L;  1DXM A;  2ASB A;  1FGU A;  1U4L A;  3QB3 A;  3S2H H;  1N33 Q;  2EYM A;  5LMU L;  4CKB A;  1Y1W H;  5DNF A;  3NK9 A;  4F7X A;  2JA8 H;  1FD7 D;  1FJG Q;  4ZKC B;  3I4M G;  4R8N A;  1B3Q A;  1PDQ A;  3GTJ B;  3S2D B;  4A3I B;  3IKJ A;  4GLA C;  3TS0 A;  3S1M H;  2UUA Q;  4H0L C;  1SN8 A;  5GAD C;  2B3G A;  3CCQ A;  5JPN C;  2QIL A;  1IBM Q;  2JA7 H;  4QJF A;  2MGS A;  2EZV A;  4IPD A;  3I4N H;  1IBK Q;  5A35 A;  3A5U A;  1LTB D;  2ES2 A;  1D8L A;  3R2I A;  2KCM A;  1PRT C;  5FO9 B;  4N8X 1;  4XTC S;  3KJP A;  2EQS A;  2EJM A;  2F03 A;  1KNA A;  5C0X H;  3H09 A;  2RSO A;  3HS0 C;  3S1N H;  2I5H A;  3EJI A;  3PIP A;  1Q46 A;  2HCI A;  2F52 A;  4LJZ C;  1R4P B;  2A73 B;  3CC2 A;  1WOC A;  4DR3 Q;  3ICE A;  1OXV A;  3SHL A;  2R7D A;  2ZJR A;  1EY7 A;  4OWX B;  1STH A;  2BOS A;  1EIF A;  1PA6 A;  4P2C B;  2R93 H;  3SR1 A;  4EGV A;  2ZJP A;  2WIN B;  2EVB A;  2PNH A;  4NPS A;  1VCI A;  3VR3 A;  4A3F B;  1PH6 A;  1ENF A;  3NE5 B;  2SEB D;  1W6J A;  1SNP A;  4GOP B;  2K1B A;  4QGU A;  5C44 B;  2ALY B;  4CDD C;  5IP9 G;  3RD4 A;  1EEF D;  1I5F A;  3H94 A;  1VQF A;  4R8I A;  3AYH B;  3EBE A;  4KV6 A;  2HHH Q;  2VXW A;  4XT1 B;  5IP9 H;  2I5L X;  3UDI A;  4KY7 A;  3QWN A;  3CRL C;  3SK5 A;  1JOK A;  4NMZ A;  4Z9C B;  4LUV A;  1C48 A;  2BDO A;  2NVT B;  1PRT B;  1VQ8 A;  2EJF C;  1X55 A;  2LY7 A;  2HCC A;  3MTS A;  2DY7 A;  3MEF A;  5E4X A;  1FJG L;  1I6H H;  1W3S A;  4DXG A;  1VQI A;  4ILW A;  3AEV A;  4JOI C;  1AP0 A;  3AMU A;  5JPM C;  4P75 A;  2XVS A;  4R9W A;  3HKS A;  2A6H D;  1I50 H;  1QVG A;  1HR0 Q;  3HOY G;  2HIX A;  3Q8D A;  2Z1C A;  5CBA E;  1UNS A;  2UXB L;  1VQG A;  4GNX B;  1VQH A;  1SE3 A;  2K52 A;  4IPH A;  2AUJ D;  4ME3 A;  2NN6 G;  3MEH A;  4C56 C;  1N32 L;  4DV4 L;  2B2W A;  5JJI A;  2ID0 A;  3NBH A;  1YVC A;  1X9N A;  1XJV A;  5KIX A;  1D7Q A;  3U9S A;  2YU9 H;  1QE6 A;  1CHP D;  2NTS A;  4BBR H;  4DUY L;  1EYA A;  3ULL A;  3GTM H;  3E5S A;  3D8G A;  2JK8 A;  2OCE A;  3A8J E;  3MAQ A;  4X3K A;  1VQP A;  3G48 A;  2K5V A;  1STG A;  2UU9 L;  3C1E A;  1XXG A;  2C5C A;  1CZW A;  1I94 L;  2EYP A;  2XGT A;  4K5W A;  2CCZ A;  2WB1 G;  5FLX E;  3HOW H;  2Y0S G;  5M3M G;  1ET6 A;  1JWM D;  4CBV A;  4DR7 Q;  3M3Y H;  3HGB A;  1FR3 A;  2IHF A;  2JJQ A;  2RQX A;  5IWA L;  1V8Q A;  5JOB A;  1SYG A;  4G4K A;  4HJ8 A;  3BZC A;  4HCE A;  1YJW A;  2XTI A;  2CH4 W;  2R61 A;  1B44 D;  1G29 1;  1L1O B;  3KBX A;  4QCL A;  5CV8 A;  1KL9 A;  1HNZ L;  3F2B A;  5D3I B;  3T53 B;  1VQ6 A;  2R92 G;  2Q8I B;  4KJN A;  1K73 C;  1PMR A;  1T9H A;  1TKW B;  2SDF A;  2BE5 C;  2VY3 A;  4OWW B;  1VQB A;  1CFM A;  3DM3 A;  1EOT A;  2XIW A;  4HJA A;  4GNX C;  3ERQ A;  4JG2 A;  5IOD A;  4CGY B;  2R7Z B;  3BG3 A;  2JA6 G;  1HQR D;  4AQY L;  2RSN A;  1O7I A;  2F3V A;  1NE3 A;  5IWA Q;  4AQY Q;  5K36 G;  1V1O A;  2KHI A;  3PIO A;  1V9P A;  3HEJ A;  2D0P A;  1R9T B;  1A8V A;  2VQF L;  1EY5 A;  3LGJ A;  4JBJ A;  4JPB W;  2AQ3 B;  1RF2 D;  1VS0 A;  3TRE A;  3K59 A;  2WP8 J;  4ZCK A;  2E2H H;  1TWA H;  1EWC A;  4B3M Q;  4UHV A;  4QUC A;  5JEA J;  4ZQ3 A;  3GTJ H;  2D62 A;  5IGD A;  5C3E H;  3Q0A A;  1O80 A;  4L8J A;  2SOB A;  2HD3 A;  3J81 E;  1MD2 D;  1VQJ A;  1L2F A;  3MC0 B;  1CUK A;  3I3C A;  4BA2 I;  4DUY Q;  1A2T A;  2DUD A;  4OL7 A;  5T1I A;  4PV1 C;  1Y69 U;  3HZX A;  4DAY B;  4QL5 A;  3PUX A;  3M4P A;  2DN8 A;  1S5D D;  1ICW A;  4DV4 Q;  1I4P A;  4OO1 H;  2A1A A;  2KVM A;  1I3Q B;  2N49 A;  3CCJ A;  2GA4 B;  4B3T L;  1FL0 A;  1J6Q A;  4XYO A;  2K01 A;  2O5J C;  3OSO A;  2D9U A;  1EOV A;  2KCT A;  2KOL A;  3A7L A;  4K5V A;  4A3C G;  2SNM A;  2NYZ D;  4K2L A;  3VA7 A;  3BZD B;  3R8B A;  3T13 A;  4IN3 A;  2Q8R E;  3IL8 A;  4IUP A;  4A3C H;  1HXY D;  2AMC B;  1SMX A;  3H0G B;  5IGE A;  5M5W H;  3HOU B;  3QOL A;  5EGT A;  3OYY A;  1G6Z A;  2PMZ E;  1LT4 D;  1GOZ A;  3A8K E;  3VYS A;  2KHJ A;  3RLO A;  3CF5 A;  5C4J H;  5T1G A;  1X3Q A;  1SEB D;  1SNC A;  4AYB B;  2HIV A;  3GV3 A;  4A93 B;  1F9R A;  4BS9 A;  5IGC A;  2JA8 G;  4XYQ A;  4K2K A;  4KHP L;  1H95 A;  1U4M A;  3J81 j;  4CDE C;  1I4G A;  1S5F D;  3A55 A;  4YHH L;  1MSH A;  2VUM G;  3FEW X;  4UP7 A;  2MO0 A;  5KEE A;  1PH7 A;  3GTO H;  3EN2 A;  2HHH L;  3HOV H;  4NKL A;  4LW1 A;  1NTG A;  1O7L A;  2QA4 A;  2JEB I;  1DCZ A;  1U9R A;  2K5W A;  1II3 A;  3LNN A;  3I4N G;  1Q86 C;  4A76 A;  1JCK B;  5M5X B;  4DV1 Q;  5JJZ A;  1TWA B;  3F2U A;  4GN5 A;  4EQP A;  3PUW A;  1TII D;  5M5Y B;  1B7Y B;  2K14 A;  2UXD L;  4UDU C;  5LMN Q;  4U67 3;  2B63 B;  3DLL A;  1MJC A;  2NUC A;  3S1Q B;  4LF9 L;  3CPF A;  3KK7 A;  5D14 A;  2LXK A;  2K4K A;  4R4Q A;  2DNE A;  3A5Z B;  2WII B;  4DV6 L;  3J80 E;  1F9P A;  2ZM6 L;  4DR6 L;  2K03 A;  3SXH A;  1LTL A;  4BY7 H;  4XQQ A;  4BBS G;  1EIG A;  2VUM B;  1MSG A;  2UUB L;  5ISR A;  3G71 A;  1LO5 D;  1BCP D;  4ZLT F;  1G51 A;  4K0K Q;  5LMU Q;  2R92 B;  4LF5 Q;  4G7H C;  3S14 B;  2HDM A;  3CCS A;  3G7L A;  4X3S A;  4POF A;  3C2P A;  4LFA Q;  2F0Q A;  2E2J H;  1I94 Q;  4KMU C;  2JA5 H;  2G9D A;  3S1N B;  1EZ8 A;  3MXU A;  4A3D G;  4C1N I;  4KHV A;  4PNY A;  1XPU A;  4O2D A;  4RFB A;  5COY A;  1WYD A;  2IT1 A;  3VDY A;  4L5T A;  2EYO A;  1N34 L;  3K0X A;  4UP8 A;  4O0A A;  2F0E A;  3E6Z X;  2XRQ D;  4JI7 L;  3HG9 A;  1SMY D;  3GP7 A;  4QMG A;  1N32 Q;  1VQD A;  4FNF A;  5CGK A;  4EVO A;  1ASY A;  4B3T Q;  1XNR Q;  4RMF A;  3V05 A;  2CQO A;  4IFD G;  3TRZ A;  1SYC A;  2G5D A;  1ZKO A;  1WD1 A;  4DR4 L;  1TWC B;  4QUF A;  4IFD H;  4LUO A;  1G2S A;  2KHS A;  5JJL A;  1NR4 A;  2ZT9 C;  4HID A;  1HH2 P;  1RD9 D;  1S5E D;  1YHA A;  5EPJ A;  2AQ2 B;  4IOC A;  4GKJ Q;  1JOR A;  2HUG A;  3GD7 A;  1OXX K;  1AW7 A;  1WTV A;  4KKS A;  3WWV A;  3BZK A;  4JYA L;  1HNW L;  1A2U A;  4IFD J;  5FJ8 G;  4BBS H;  1TS3 A;  1BUV T;  4RKL A;  1LAB A;  4DV5 L;  3D4W A;  3J7Y W;  4OX9 Q;  2CFM A;  2A5H A;  3Q22 A;  2TSS A;  2IWH A;  5FJ8 H;  2CKZ B;  1SE4 A;  3T1Y Q;  3S1Q H;  1LLR D;  1UE1 A;  1B9M A;  3TME A;  5HGQ A;  3OIQ A;  1L1O C;  5A2Q E;  2UXC L;  1A62 A;  3CME A;  2NVT H;  3FDT A;  1T5X D;  2OQ0 A;  3HP3 A;  4IUN A;  3R2T A;  4RWS C;  3JAM E;  3I8Z A;  4A3L H;  2M9V A;  4RH6 A;  2BA1 A;  3NEN A;  4ZUI A;  4GOP A;  1J5E L;  4BBS B;  2EDG A;  1UEA B;  4PMB A;  3K5O A;  3QR8 A;  4JVZ A;  4FF4 A;  1M1K C;  3TP7 A;  5DEH A;  4DF7 A;  2JEA I;  1V1Q A;  4PG3 A;  2H5X A;  4OX9 L;  2WFW A;  4A3M B;  4A3E G;  4A3K B;  4LF4 L;  3BU2 A;  1VQA A;  3URY A;  5K36 H;  5J1Z A;  4R1J A;  1GUN A;  3NQT A;  5JEA G;  2F4I A;  2O2L D;  4ZKB B;  4A3B H;  3QIA A;  1TY0 A;  1N36 L;  2UU9 Q;  2EYH A;  1PTO F;  1IBM L;  4A3D H;  2Y0S E;  1D5M C;  2KEE A;  3CW2 C;  3AFQ A;  3EQL C;  1U4P A;  3L2P A;  2VNU D;  2F0S A;  2PCF B;  5GAH C;  1HZB A;  3K80 C;  1D1I A;  3HOU G;  5C3X A;  1SBB B;  2QDB A;  4JI5 Q;  2OXP A;  5JAV A;  1CTM A;  4DR7 L;  4WRD A;  5M3M H;  1N33 L;  3C1F A;  3J80 i;  4A3J B;  1O78 A;  2GVA A;  4A3K H;  1K8A C;  2X6G A;  2Z6K A;  4NDX A;  3GTK B;  4A93 G;  3NBH B;  1SYD A;  4A3F G;  2QEX A;  1X3G A;  4DGZ A;  1Q8K A;  2H4O A;  1JB3 A;  4HN7 A;  1Y1V B;  3ULP A;  4JI5 L;  4RCN A;  2Z6K C;  1QNK A;  1NBW A;  4A3I H;  4ODG A;  2B2T C;  4ZUJ A;  4BBR G;  4XQN A;  4JI8 Q;  1WVL A;  1D2B A;  3RMH A;  1SR3 A;  3N6R A;  4ID6 A;  5M9O A;  3H91 A;  2QDL A;  1SRO A;  1BOS A;  2B2T A;  4IQZ A;  5C4X G;  1DOM A;  4LFA L;  1HZA A;  2PW5 A;  1HR0 W;  1EL0 A;  1JMC A;  3F1Z A;  5ELC A;  3GTG B;  4JI6 Q;  4PQX A;  1JJG A;  1PH8 A;  1RHP A;  1STN A;  4K0K L;  3H3V I;  1U0L A;  4HMI A;  2PZW A;  1UE5 A;  4GOP C;  2F0D A;  3I4L A;  1GUG A;  1WCM G;  4KI0 A;  3UE1 A;  1TS2 A;  4JBW A;  1SNQ A;  3PF5 A;  1ILP A;  4DR6 Q;  4WFN 3;  3M4Q A;  1B4O A;  4HJ7 A;  3PO2 B;  4QQB X;  4LF8 Q;  2EYJ A;  4DV2 Q;  1Z9F A;  4A3L G;  4KTA A;  1YNJ D;  4X64 Q;  1C8C A;  1QOH A;  4NXM Q;  3UDX A;  2R7Z G;  4LFB Q;  5LMN L;  4A3M H;  3RZD H;  2DGY A;  1G6P A;  3S15 B;  5E7N A;  4HSP A;  1L0Y B;  2PZU A;  1UWV A;  5J22 A;  5A2Q L;  1GUS A;  4DV1 L;  1A3U A;  1LUZ A;  1E24 A;  4NW2 A;  4XQJ A;  1RJT A;  1YNX A;  4MZ9 A;  2CWA A;  3PUZ A;  4JC0 A;  1ONL A;  2F0L A;  3CRK C;  1OXT A;  3E9I A;  3UDG A;  3U4Z A;  3C3L A;  1EZ6 A;  2L1B A;  4FF2 A;  5LL6 X;  2IPK D;  1STY A;  1V43 A;  2F3W A;  4XT3 B;  4WJ3 M;  2FXQ A;  2PI2 A;  5I9O A;  4DR3 L;  5M5W B;  1YNN D;  2EYF A;  4GKJ L;  2Y0S B;  4IPC A;  5M3M B;  2RDG A;  1VQ5 A;  1I4X A;  4YIJ A;  1T5E A;  3KDF B;  1CT1 D;  1WTH A;  3TN2 A;  3K7U C;  2N8N A;  1I4Q A;  3PIO 3;  1GUT A;  2XWB B;  2WV6 D;  3PQI A;  2X69 A;  2JP1 A;  1PH5 A;  2JA8 B;  4N9T A;  1GUO A;  1X65 A;  4IUQ A;  2M00 A;  3RZD B;  4A3E B;  2DJG C;  4MN3 A;  4A93 H;  5C4Z A;  3I4M B;  1WCM H;  4FVM A;  3HFZ B;  1S5C D;  4L5Q A;  4B9X A;  3A0J A;  1CK1 A;  1SND A;  4N8F A;  1PVO A;  2EPB A;  2Z0S A;  1HUM A;  3KF8 A;  4CHT B;  1K3R A;  4JBM A;  3KOJ A;  1VQE A;  2ATW A;  4Q0F A;  2HQL A;  1YI2 A;  5J39 A;  3L7Z C;  4OHJ A;  3VYU A;  3P75 A;  1VQ9 A;  2VB3 X;  1Y8N B;  2Z8L A;  5C4H A;  1PZI D;  3SVM A;  3LWE A;  4JBK A;  5C3E G;  1BQQ T;  3NTK A;  2L15 A;  1EFI D;  4WOR A;  3CCM A;  3DWQ A;  1TWG B;  2QF7 A;  1IW7 D;  4V19 0;  1H9J A;  1NY4 A;  4BY1 H;  4NXN Q;  1C0A A;  3HOW G;  4AYB E;  4YCU A;  1VQ7 A;  3OIP A;  1QVC A;  2N78 A;  3OOC A;  3PO2 H;  4LF7 Q;  4HCS A;  4C3I B;  1XPR A;  2E75 C;  2QW7 A;  3NTI A;  5G3L D;  3AB9 A;  3DWA A;  1IKM A;  2A6H C;  4B3M L;  1KTK A;  3PMF A;  3ND9 A;  2KED A;  1K83 B;  3I2Z A;  4GN3 B;  2CW0 D;  1GD7 A;  3C46 A;  2BH2 A;  2VQF Q;  1ZEQ X;  3S1R B;  1JC7 A;  1KAW A;  3Q24 A;  3CCU A;  5CV7 A;  3HOZ G;  2OTL A;  1VF5 C;  3I72 A;  2KUM A;  2I0Q A;  1LTR D;  1Y1V H;  5NUC A;  4JV5 L;  1I4H A;  3VR2 A;  1LTT D;  1L0W A;  1PH3 A;  1KDC A;  2B63 G;  4G57 A;  4O1N A;  1AZQ A;  3HOV G;  2ZM6 Q;  4RAU C;  4LFB L;  2Q2H A;  2NVY H;  4NXM L;  4RGN A;  4M8A A;  2AHO B;  2PI2 E;  3CCR A;  2C35 B;  3E9H A;  3GO5 A;  4DV2 L;  1LYL A;  2EOT A;  3N52 A;  4ABN A;  4FXG C;  3CXC A;  4C2M H;  1EQT A;  1JOO A;  3SEB A;  2BCO A;  4X62 Q;  1DOL A;  3BDL A;  2A74 C;  4BWG B;  1NMF A;  3T1Y L;  5LMN W;  2QCP X;  5IYC H;  1MIU A;  2K5D A;  4HMJ A;  1JB7 A;  2LKV A;  1Z7T A;  4U68 A;  2FFK B;  4A4I A;  3MVV A;  2JXM B;  3I4O A;  1QNU A;  4GLV B;  3EA6 A;  3S1R H;  5I2Y A;  3WDN A;  1CKO A;  1JE4 A;  4MTN A;  1IBK L;  4M1U B;  2F0H A;  3D31 A;  5KYI A;  2HT1 A;  4X64 L;  2AWN A;  4YHH Q;  1PFM A;  5FO7 B;  4LF8 L;  5FLX L;  2AKW B;  4JI1 L;  1X56 A;  4NP5 A;  4C2M B;  2BH8 A;  2OTJ A;  1I6V C;  2MFI A;  1TWF H;  2RVL A;  1PXU A;  4POG A;  4DR4 Q;  4J1M A;  1TT2 A;  1C4Q A;  2FHT A;  4YY3 L;  3D6C A;  3M4O H;  1XX8 A;  4DAV A;  2F0W A;  3L3O C;  4JI6 L;  2VS1 A;  1S3O A;  4JI4 Q;  1D5X C;  4GN4 B;  2EIF A;  1E0B A;  1D1K A;  2RCF A;  3HKZ E;  3S1M B;  4JOI A;  4R4T A;  2PQA B;  5CR3 A;  4DV3 Q;  4Y52 H;  3J81 i;  3MXP A;  2WKC A;  4IZ8 A;  2J4X A;  3HOY B;  3S17 B;  1ILQ A;  1PFB A;  3I91 A;  4GKK L;  1TXY A;  1GUW A;  2F3I A;  1BCP F;  1SJH D;  1PRT F;  1BF4 A;  1UEB A;  4JI1 Q;  2V1C C;  3OWF A;  1CI3 M;  1TY2 A;  2GVB A;  5HY6 A;  1PYS B;  5IP7 H;  4B3R Q;  1XMQ L;  2F4V L;  1X3E A;  1XMO L;  1FNU A;  4DR2 Q;  3FKI G;  4OEL B;  4IOA A;  2OWO A;  4LF5 L;  3W1B A;  4C3J H;  3OMG A;  4QY7 A;  5C4X H;  2Q2U A;  1J8I A;  3IFT A;  1VQ4 A;  2FMM A;  1LT6 D;  2ZXO A;  3EFX D;  3RZO B;  1WTQ A;  1PTO B;  3SGI A;  2B63 H;  3KFU A;  4XIG S;  3KUP A;  4KKT A;  3OWE B;  3U58 A;  1Y8O B;  3HOX B;  4YWL A;  2FJ2 A;  3FPP A;  1HNX Q;  4A3I G;  4L5R C;  1TWH H;  3M4O B;  5IGF A;  4RGT A;  1HQM C;  3A7A B;  3FP9 A;  1AN8 A;  1XTD A;  2K50 A;  4R4C A;  2F0V A;  1B8A A;  5FOB B;  2F0N A;  2K32 A;  4A3E H;  1IYJ B;  2EYL A;  1Y1W B;  1Q7Y C;  5IGB A;  1KHI A;  2A19 A;  4KHP Q;  1I4R A;  1YZ6 A;  5EAY A;  3K0Y A;  1OTC A;  2UUA L;  4X3T A;  2K28 A;  2L9H A;  2EY2 A;  1PFS A;  4S3S A;  4EQO A;  4RKB A;  1BXT A;  1E22 A;  1H9R A;  3ER0 A;  3CHB D;  2IL8 A;  2Q8T A;  1IZ6 A;  4C3J G;  1LAC A;  3CKI B;  2QGQ A;  3SK6 A;  4OIJ A;  1RCV D;  5C3E B;  1DJR D;  1M90 C;  1PFN A;  1AE2 A;  2VQE L;  4JYA Q;  1K0R A;  1HNW Q;  2MJ8 A;  2R3Z A;  1IL2 A;  3CCE A;  4DV0 L;  5FLX c;  3PO3 H;  4CJ0 B;  2E76 C;  3J7A 5;  2B2W C;  1AZP A;  1N34 Q;  2F0U A;  3TBI B;  1VMP A;  4CDF C;  4DNI A;  1AFP A;  1GJX A;  3M7G A;  1SJE D;  5IYB H;  4A3K G;  4FF1 A;  2MP1 A;  3RR5 A;  2F0O A;  2PW7 A;  5I6W A;  5K5P A;  1KQS A;  3BDO A;  3PUY A;  1LTG D;  3BVZ A;  5E1F A;  1WTP A;  1EY6 A;  1W6K A;  4LK1 C;  2KCN A;  2IX0 A;  2E2I B;  1I50 B;  4TSS A;  3OW7 A;  2NZO A;  1XNR L;  4YWK A;  3SE0 A;  1Q8I A;  1H9S A;  1IBL L;  3S2H B;  5KYL A;  1NAP A;  3AU7 A;  5IOC A;  1BBX C;  1XTC D;  1IKL A;  1R4Q B;  3S24 A;  3K81 C;  1LV9 A;  3MXN A;  4OXP A;  4J8Q A;  3ERO A;  4OIK A;  2UUC Q;  1Q1E A;  3U50 C;  2E8G A;  4OO1 G;  2IJ0 A;  2YTV A;  3KLS A;  1L0X B;  3P1H A;  1EU4 A;  5M5X H;  4LF9 Q;  2AQ1 B;  4DFA A;  3T1H L;  2EXZ A;  4R4O A;  2BDN A;  5CV4 A;  3WOE A;  2R92 H;  3ND8 A;  5IYB G;  3P20 A;  1KNE A;  2NVQ H;  2EE1 A;  1F9S A;  2RCN A;  2RDH A;  3FRP B;  3NTH A;  3DWP A;  5J3B A;  3DEO A;  1ZYR D;  4I7Z C;  2NN6 I;  4RG1 A;  5M3F H;  4IFD I;  4A3G G;  1E3P A;  3HRZ C;  3TS2 A;  3W2D A;  3F8T A;  3PO3 B;  1EY4 A;  4NB3 A;  5ELO A;  3J81 L;  2J7Z A;  3GTQ B;  3I7F A;  5CYU A;  1LTI D;  2EY5 A;  3FMC A;  4J6H A;  4A3G H;  1HZC A;  2OEO A;  1IHZ A;  2MHV A;  4A75 A;  4JI3 Q;  4APV A;  1CA6 A;  1DM0 B;  4DR1 Q;  1RL2 A;  2BA0 A;  2RBM A;  1U5K A;  2UXD Q;  1VMC A;  1TQO A;  1Q3L A;  3E3X A;  3NEM A;  3LX0 A;  4X66 L;  4PZ7 A;  3KLR A;  4C3J B;  1RTO A;  1KLG D;  3TP5 A;  3H3V H;  3NUC A;  3MWY W;  1EYG A;  2N55 A;  4R4I A;  1F2L A;  3G6E A;  1HFN A;  1F2M A;  2I5M X;  2L12 A;  3T16 A;  1JQY D;  2X6L A;  3DM1 A;  3GTP H;  2M2L A;  2R6G A;  1XMO Q;  1JR0 D;  3QO2 A;  2F0G A;  1TVX A;  2JA7 B;  5C44 G;  1Y1V G;  4EQ5 A;  4XXE A;  3GDE A;  1YEZ A;  3K5N A;  3RLF A;  2RKS A;  1KD1 C;  2PO4 A;  1KIX A;  2QEJ C;  3IAY A;  3CU7 A;  3L9A X;  4K14 A;  5IT9 E;  2A68 D;  2V4D A;  2NZ1 D;  4X65 Q;  1B2T A;  3ZJY C;  4CJ2 C;  4DV3 L;  1DON A;  5H1S E;  5JVG 3;  4KLK A;  1WTW A;  1SFO B;  2DY8 A;  4A3J H;  4GZY C;  3CC7 A;  1HR0 L;  5EQ0 A;  3GTK H;  1B1Z A;  3BVM A;  4YCW A;  1Q1B A;  4G7Z C;  2AWO A;  2DJF C;  1M8A A;  4JCV E;  1ENC A;  1K8M A;  1ZXT A;  1BKB A;  1QVF A;  4DK6 C;  2K5Q A;  1CSQ A;  2F0P A;  1S4Z A;  3NQI A;  4QIW E;  3NPP A;  1F9Q A;  1H9K A;  3PSI A;  1B50 A;  2E74 C;  1HJP A;  4Q5V A;  3J80 L;  3OPO A;  2ICI A;  1N8R C;  3EIV A;  1NR2 A;  1E1T A;  3BYY B;  2CWP A;  4B3R L;  2Q2T A;  1E1O A;  2SNS A;  2G9H D;  4IUU A;  4I7A A;  4LF6 L;  4DK3 C;  4UY8 C;  1GM5 A;  3S15 H;  2D0O A;  1QCB D;  2WAQ E;  5C6A A;  4ULL A;  2E2J B;  4HR7 B;  3M3Y B;  4LNQ A;  4OON A;  2TMP A;  4H13 C;  2N88 A;  1CM9 A;  4BXX G;  1AH9 A;  3PCO B;  3S2D H;  1EQQ A;  1RIP A;  4KD3 A;  3STB C;  3BJU A;  1OXS C;  1CA5 A;  3GTG H;  1LT3 D;  1B70 B;  3K57 A;  5ELN A;  1VQK A;  1YBY A;  1SLJ A;  3BS1 A;  2B2Y A;  3MHB A;  2AUK A;  3D6W A;  3KDF A;  2O4X A;  1GHK A;  1DGS A;  1LT5 D;  4OWT B;  3OMC A;  3A8I E;  1UUP A;  5AJ3 Q;  4QF4 A;  1SE2 A;  1VF7 A;  3DEP A;  4BY1 G;  3M85 A;  3SDZ A;  1MBY A;  3G6J B;  3WOF A;  3I55 A;  3F2C A;  1UE7 A;  4EX5 A;  3CQZ B;  3GTL B;  2OQK A;  2EY1 A;  3L0O A;  3TSS A;  2P5Z X;  1IYU A;  2L11 A;  2FMC A;  3MXG A;  1YNJ C;  2C9O A;  5CV9 A;  5G3L F;  3S16 H;  1QWY A;  4A3G B;  3JAM i;  3E0J A;  3CAM A;  2CW0 C;  2E5L L;  2JA7 G;  4FDB A;  3OTO L;  1PRT D;  4LF7 L;  5IYC G;  4OGQ C;  1A6X A;  3ITP A;  4BY7 B;  2NB0 A;  2NVX H;  1HNZ Q;  4G7O C;  3HOZ H;  1A0I A;  5DAU A;  5IY0 A; 
#chains in the Genus database with same CATH homology
 3MFY A;  2B2V A;  1RDP D;  4FO2 A;  5C5L A;  3VR4 A;  1SXT A;  3NBI A;  2ZXP A;  3K7A B;  1ESR A;  4ZK9 B;  1STE A;  4K6D A;  1SNO A;  1TU2 B;  3X3N A;  5EKL A;  1BO0 A;  1BR9 A;  4C1N K;  1YNN C;  3HKZ B;  4TQU S;  3FPU B;  2DNC A;  5EKI A;  1STB A;  1AEX A;  2LS0 1;  1EU3 A;  4QIW B;  2L5T A;  1DD2 A;  4FXK C;  3IFD A;  2JA5 B;  2F0F A;  2LFN A;  4C3H B;  3OHX C;  2NVQ B;  4CJ1 B;  3VYT A;  1B53 A;  3T56 B;  2B8F A;  4LMQ D;  4RA8 A;  5C0X J;  2F0K A;  5E3F A;  4OO1 I;  3GTP B;  5HGT A;  5EBC A;  2E2D C;  3HOW B;  4PMW A;  3PUV A;  1FNW A;  1KDA A;  4BA1 I;  2F0T A;  2PYK A;  5JVH 3;  4I65 A;  3FVQ A;  2K33 A;  1JOQ A;  2D2C C;  3FKI B;  2XWJ B;  2KA7 A;  4DAP A;  5C4X B;  4RHR A;  5BN5 A;  2NN6 H;  1TR5 A;  3J7A F;  5EJW A;  1MI2 A;  3ONA B;  5KND A;  2J0T D;  3GTO B;  2B2V C;  2IW3 A;  1PZJ D;  3D3R A;  1KAB A;  1F2Y A;  5KGU A;  1OXU A;  1FYC A;  2XRS D;  4DAY A;  2NTT A;  2A6E D;  3D4R A;  1CQV A;  2E2H B;  1SSO A;  1PLF A;  5LL6 S;  2HDL A;  3VR5 A;  5IT9 L;  1G91 A;  1PYW D;  1RTN A;  3TZD A;  1X32 A;  3PIP 3;  5EPL A;  4K8I A;  2L4N A;  2K05 A;  4DN4 M;  5FO8 B;  1HA6 A;  4QB4 A;  2RDF A;  1A15 A;  1CHQ D;  2IX1 A;  1FGB D;  2K6A A;  1JWU D;  1SYE A;  2I46 A;  2Z4I A;  3DUZ A;  4EQN A;  4BBR B;  3GTM B;  1HTP A;  1E2V A;  3R93 A;  4ZYS A;  4H7B A;  4XDX A;  4ZRZ A;  2R93 B;  4WJW A;  5AFW A;  2CHB D;  1F2Z A;  1HCZ A;  1H9M A;  1IW7 C;  1Z6H A;  4HED A;  1Y8P B;  3VA5 A;  3K58 A;  5IGG A;  4HAE A;  1FNV A;  1UAP A;  4IUT A;  5CV5 A;  5TSS A;  1D6E C;  2YYZ A;  1SDF A;  4E6I A;  1QB5 D;  2JYO A;  4KY6 A;  3TDQ A;  1LTA D;  3LWU A;  3HOZ B;  2XNA C;  1QG7 A;  2ICE C;  1V1P B;  1A3V A;  4RGO S;  1BDO A;  1G2T A;  4IUR A;  3MFG A;  3X3M A;  4HTH A;  4ME5 A;  5KRU A;  4DNR B;  3BVG A;  5I4D A;  4C3I G;  1JWS D;  1EIH A;  3NWT A;  1BCP B;  1Q12 A;  3MA2 B;  5BN4 A;  1IL8 A;  2PZT A;  1SYF A;  1ET9 A;  4LAA A;  3TP8 A;  2JA6 B;  1E2Z A;  2B8G A;  2WB1 B;  1EEI D;  2NVY B;  4JK1 C;  1ENA A;  2CVR A;  2A69 C;  3BYT B;  5HUR A;  5D65 A;  1QIL A;  2MUY A;  4ZAI A;  3DMU A;  1WTR A;  1HHV A;  2XN9 C;  5ELE A;  2K7V A;  1DZ1 A;  3VR6 A;  4C3H G;  3M4Y A;  1EY8 A;  4K5X A;  4KN7 C;  2VB2 X;  2F0M A;  3A54 A;  2PNR C;  3S16 B;  4F88 A;  2KEC A;  4TKO B;  1IYV A;  4V0B A;  5CV6 A;  4H44 C;  5BN3 A;  5KNB A;  4KKU A;  4F87 A;  2EJG C;  2XSC A;  4K8J A;  4Y7N B;  1F77 A;  4KJO A;  5F2D A;  1KDB A;  3QJY A;  5JEA H;  3U9O A;  1HUN A;  2CQA A;  2B39 A;  5LHY 1;  2IX3 A;  5CC4 A;  1JIC A;  1ML0 D;  3SK8 A;  5COR A;  5FK9 C;  3H6M A;  4DNT B;  2NBF A;  4CKE A;  2LMC B;  2K04 A;  2PQE A;  3RUZ A;  5C3W A;  3JAM L;  3TZU A;  2PMZ B;  1WTO A;  3ZYY X;  4FYD A;  1GHJ A;  2WAQ B;  2I07 B;  2PPB C;  2A68 C;  3T51 B;  3NSW A;  1DYQ A;  1D5Z C;  4DU9 A;  2BE5 D;  3I73 A;  1WCM B;  5EPK A;  4K6L A;  1SNM A;  2MPM A;  5C4J B;  2F0I A;  2D5D A;  3QOJ A;  1STA A;  2B2U A;  2A69 D;  5I6Y A;  1RKN A;  1MGS A;  3M7N A;  4PMC A;  1G8Z D;  4UAI A;  2JE6 I;  3K5L A;  3I90 A;  4F8M A;  1V1P A;  5FKA C;  1ESF A;  4BY1 B;  3KLS X;  3I4N B;  3W3A A;  1B3A A;  1CZG A;  2KCC A;  3SK4 A;  1HFG A;  4FXD A;  2L0C A;  5ELB A;  3H3V C;  1OO9 B;  1SAP A;  2B2Y C;  1KAA A;  3A56 A;  4L63 B;  3Q23 A;  1ZYR C;  1PTO D;  4KD4 A;  1U4R A;  4DA2 A;  3DHQ A;  1TS4 A;  3I70 A;  4FF3 A;  4KN4 C;  4KHZ A;  4MIU A;  3VYR A;  4HSV A;  3J7A V;  3P7J A;  1B9N A;  2F0J A;  1GXD C;  1A3T A;  3D4D A;  5ELD A;  4B9W A;  3MZ5 A;  1X3P A;  4IUV A;  2F1M A;  2YU9 B;  1KLU D;  1SMY C;  4B08 A;  4O42 A;  2KJX A;  1TS5 A;  4X3U A;  1EWH A;  1HTL D;  4RCO A;  3V2T A;  1NSN S;  3QG1 A;  2B2U C;  1VDZ A;  4FP5 D;  1WD0 A;  3NP8 A;  5C5M A;  4IAL A;  1XYI A;  4KK7 A;  2ENB A;  5ELF A;  3EVQ A;  3V96 A;  1QJO A;  2Z4H A;  1O7Y A;  5C0X I;  1WTX A;  1NUC A;  3BDC A;  1Q90 A;  1HPC A;  1TWF B;  2RA4 A;  4RGM A;  1PTO C;  2OF1 A;  5CMD A;  2JSO A;  4MHE A;  4DXF A;  5I9P A;  1BNZ A;  2QKI C;  5EBD A;  1O7Z A;  1CQF A;  1H9S B;  1TWH B;  2NVX B;  5M3F B;  3K6O A;  2OT2 A;  1EYC A;  1BCP C;  1M4V A;  3GQB A;  1S5B D;  3DXJ C;  2WAC A;  1I6H B;  4DK0 A;  1K8O A;  1PZK D;  3O13 A;  3K5M A;  3KBG A;  2H1E A;  5CBE E;  1J9O A;  1LTS D;  2HQE A;  4A3D B;  1ROD A;  5C0X G;  1E2W A;  3T4A C;  3HOV B;  2KQ3 A;  1EY9 A;  1Z47 A;  4TRD A;  4N9P A;  3S9W A;  4L6T B;  5DM6 3;  5EKK A;  4DK1 A;  5IIF A;  1EY0 A;  5KNC A;  4KY5 A;  2FIN B;  1XWE A;  1HRJ A;  2A6E C;  2EY6 A;  2L55 A;  3TP6 A;  2NWG A;  5I2X A;  1EQV A;  3GV6 A;  3UI2 A;  2ZXR A;  3NXW A;  4RHS A;  4A3B B;  2O5I C;  1NCV A;  1PTO H;  5E4W C;  1SYB A;  3R3O A;  1DOK A;  3NWS A;  3Q6S A;  1EYD A;  1HA5 A;  5D3D A;  5DM7 3;  3NHH A;  3PV0 A;  2WKD A;  4CKC A;  1DXM A;  1U4L A;  3QB3 A;  2EYM A;  4CKB A;  5DNF A;  3NK9 A;  4F7X A;  1FD7 D;  4ZKC B;  4R8N A;  1PDQ A;  3GTJ B;  3S2D B;  4A3I B;  3IKJ A;  4H0L C;  5JPN C;  2QIL A;  2MGS A;  2EZV A;  5A35 A;  1LTB D;  3R2I A;  1PRT C;  5FO9 B;  4XTC S;  2EJM A;  2F03 A;  1KNA A;  5C0X H;  3H09 A;  2RSO A;  3HS0 C;  3EJI A;  2HCI A;  4LJZ C;  1R4P B;  2A73 B;  1OXV A;  3SHL A;  1EY7 A;  1STH A;  2BOS A;  4P2C B;  3SR1 A;  4EGV A;  2WIN B;  2EVB A;  1VCI A;  3VR3 A;  4A3F B;  1ENF A;  3NE5 B;  2SEB D;  1W6J A;  1SNP A;  2K1B A;  5C44 B;  3RD4 A;  1EEF D;  3H94 A;  4R8I A;  4KV6 A;  2VXW A;  4XT1 B;  4KY7 A;  3QWN A;  3CRL C;  3SK5 A;  1JOK A;  4NMZ A;  4Z9C B;  1C48 A;  2BDO A;  2NVT B;  1PRT B;  2EJF C;  2LY7 A;  2HCC A;  2DY7 A;  3MTS A;  5E4X A;  4DXG A;  4ILW A;  1AP0 A;  3AMU A;  5JPM C;  4R9W A;  2XVS A;  2A6H D;  2Z1C A;  5CBA E;  1UNS A;  1SE3 A;  2AUJ D;  2NN6 G;  3MEH A;  4C56 C;  2B2W A;  2ID0 A;  3NBH A;  5KIX A;  3U9S A;  1QE6 A;  1CHP D;  2NTS A;  1EYA A;  3E5S A;  3D8G A;  3A8J E;  3MAQ A;  4X3K A;  1STG A;  3C1E A;  1XXG A;  2C5C A;  1CZW A;  2EYP A;  4K5W A;  5FLX E;  1ET6 A;  1JWM D;  4CBV A;  3HGB A;  1FR3 A;  2RQX A;  1V8Q A;  5JOB A;  1SYG A;  4G4K A;  4HCE A;  2R61 A;  1B44 D;  1G29 1;  3KBX A;  4QCL A;  5CV8 A;  5D3I B;  3T53 B;  2Q8I B;  4KJN A;  1PMR A;  1TKW B;  2SDF A;  2BE5 C;  1CFM A;  1EOT A;  2XIW A;  3ERQ A;  5IOD A;  4CGY B;  2R7Z B;  3BG3 A;  1HQR D;  2RSN A;  2F3V A;  5K36 G;  1V1O A;  3HEJ A;  1R9T B;  1EY5 A;  2AQ3 B;  1RF2 D;  3K59 A;  2WP8 J;  1EWC A;  4QUC A;  5JEA J;  4ZQ3 A;  3Q0A A;  2D62 A;  5IGD A;  1O80 A;  4L8J A;  2SOB A;  3J81 E;  1MD2 D;  3MC0 B;  3I3C A;  4BA2 I;  1A2T A;  4OL7 A;  5T1I A;  4PV1 C;  1Y69 U;  3HZX A;  3PUX A;  2DN8 A;  1S5D D;  1ICW A;  4OO1 H;  1I4P A;  2KVM A;  1I3Q B;  2GA4 B;  4XYO A;  2K01 A;  2O5J C;  3OSO A;  2D9U A;  2KOL A;  3A7L A;  4K5V A;  2SNM A;  2NYZ D;  4K2L A;  3VA7 A;  3BZD B;  3R8B A;  3T13 A;  4IN3 A;  2Q8R E;  3IL8 A;  4IUP A;  1HXY D;  3H0G B;  5IGE A;  3HOU B;  3QOL A;  5EGT A;  1G6Z A;  1LT4 D;  1GOZ A;  3A8K E;  3VYS A;  5T1G A;  1X3Q A;  1SEB D;  1SNC A;  4AYB B;  3GV3 A;  4A93 B;  1F9R A;  4BS9 A;  5IGC A;  4XYQ A;  4K2K A;  1U4M A;  1I4G A;  1S5F D;  3A55 A;  1MSH A;  3FEW X;  5KEE A;  4NKL A;  1O7L A;  2JEB I;  1DCZ A;  1U9R A;  2K5W A;  1II3 A;  3LNN A;  1JCK B;  5M5X B;  5JJZ A;  1TWA B;  3F2U A;  4EQP A;  3PUW A;  1TII D;  5M5Y B;  4UDU C;  4U67 3;  2B63 B;  2NUC A;  3S1Q B;  3KK7 A;  5D14 A;  2DNE A;  2WII B;  3J80 E;  1F9P A;  2K03 A;  3SXH A;  4XQQ A;  1EIG A;  2VUM B;  1MSG A;  5ISR A;  1LO5 D;  1BCP D;  4ZLT F;  2R92 B;  4G7H C;  3S14 B;  2HDM A;  3G7L A;  4X3S A;  3C2P A;  2F0Q A;  4KMU C;  2G9D A;  3S1N B;  1EZ8 A;  3MXU A;  4C1N I;  4KHV A;  4PNY A;  4RFB A;  5COY A;  2IT1 A;  2EYO A;  2F0E A;  3E6Z X;  2XRQ D;  3HG9 A;  1SMY D;  3GP7 A;  4QMG A;  4FNF A;  5CGK A;  4EVO A;  3V05 A;  4IFD G;  1SYC A;  1ZKO A;  1WD1 A;  1TWC B;  4QUF A;  4IFD H;  1G2S A;  2KHS A;  1NR4 A;  2ZT9 C;  1RD9 D;  1S5E D;  5EPJ A;  2AQ2 B;  1JOR A;  2HUG A;  3GD7 A;  1OXX K;  1AW7 A;  1WTV A;  4KKS A;  1A2U A;  4IFD J;  1TS3 A;  1BUV T;  4RKL A;  1LAB A;  3D4W A;  3J7Y W;  2A5H A;  3Q22 A;  2TSS A;  2IWH A;  1SE4 A;  1LLR D;  3TME A;  1B9M A;  3OIQ A;  5A2Q E;  3FDT A;  1T5X D;  3HP3 A;  4IUN A;  3R2T A;  4RWS C;  3JAM E;  3I8Z A;  2M9V A;  4RH6 A;  2BA1 A;  4ZUI A;  4BBS B;  2EDG A;  1UEA B;  4PMB A;  3K5O A;  4FF4 A;  3TP7 A;  5DEH A;  4DF7 A;  2JEA I;  4A3M B;  4A3K B;  3URY A;  5K36 H;  5J1Z A;  1GUN A;  3NQT A;  5JEA G;  2F4I A;  2O2L D;  4ZKB B;  3QIA A;  1TY0 A;  2EYH A;  1PTO F;  1D5M C;  2KEE A;  3EQL C;  2VNU D;  1U4P A;  2F0S A;  2PCF B;  1D1I A;  5C3X A;  1SBB B;  2QDB A;  2OXP A;  5JAV A;  1CTM A;  4WRD A;  3C1F A;  4A3J B;  1O78 A;  2X6G A;  4NDX A;  3GTK B;  1SYD A;  4DGZ A;  2H4O A;  4HN7 A;  1JB3 A;  1Y1V B;  4RCN A;  1QNK A;  4ODG A;  2B2T C;  4ZUJ A;  4XQN A;  1WVL A;  1D2B A;  3RMH A;  3N6R A;  4ID6 A;  5M9O A;  3H91 A;  1BOS A;  2B2T A;  4IQZ A;  1DOM A;  2PW5 A;  1EL0 A;  5ELC A;  3GTG B;  4PQX A;  1RHP A;  1STN A;  4HMI A;  2PZW A;  2F0D A;  3I4L A;  1GUG A;  4KI0 A;  1TS2 A;  4JBW A;  1SNQ A;  1ILP A;  4WFN 3;  1B4O A;  3PO2 B;  2EYJ A;  4KTA A;  1YNJ D;  1C8C A;  1QOH A;  3S15 B;  4HSP A;  1L0Y B;  2PZU A;  5J22 A;  5A2Q L;  1GUS A;  1A3U A;  4NW2 A;  4XQJ A;  1RJT A;  3PUZ A;  1ONL A;  2F0L A;  3CRK C;  1OXT A;  3C3L A;  1EZ6 A;  4FF2 A;  2L1B A;  5LL6 X;  2IPK D;  1V43 A;  1STY A;  2F3W A;  4XT3 B;  5I9O A;  5M5W B;  1YNN D;  2EYF A;  2Y0S B;  5M3M B;  2RDG A;  1I4X A;  4YIJ A;  1T5E A;  1CT1 D;  3TN2 A;  1I4Q A;  3PIO 3;  1GUT A;  2XWB B;  2WV6 D;  2X69 A;  2JP1 A;  2JA8 B;  4N9T A;  1GUO A;  4IUQ A;  2M00 A;  3RZD B;  4A3E B;  4MN3 A;  5C4Z A;  3I4M B;  4FVM A;  1S5C D;  4B9X A;  1CK1 A;  1SND A;  2EPB A;  1HUM A;  3KF8 A;  4CHT B;  4Q0F A;  5J39 A;  3L7Z C;  4OHJ A;  3VYU A;  3P75 A;  2VB3 X;  1Y8N B;  2Z8L A;  5C4H A;  1PZI D;  3SVM A;  3LWE A;  1BQQ T;  3NTK A;  1EFI D;  4WOR A;  3DWQ A;  1TWG B;  2QF7 A;  1IW7 D;  4V19 0;  1H9J A;  3OIP A;  3OOC A;  4HCS A;  4C3I B;  2E75 C;  3NTI A;  5G3L D;  1IKM A;  3AB9 A;  3DWA A;  2A6H C;  1KTK A;  3PMF A;  3ND9 A;  2KED A;  1K83 B;  2CW0 D;  3C46 A;  1ZEQ X;  3S1R B;  1JC7 A;  3Q24 A;  5CV7 A;  1VF5 C;  3I72 A;  2KUM A;  1LTR D;  5NUC A;  1I4H A;  3VR2 A;  1LTT D;  1KDC A;  4G57 A;  4O1N A;  1AZQ A;  4RAU C;  4RGN A;  4M8A A;  3GO5 A;  2EOT A;  3N52 A;  4ABN A;  4FXG C;  1EQT A;  1JOO A;  3SEB A;  2BCO A;  1DOL A;  3BDL A;  2A74 C;  4BWG B;  2QCP X;  2K5D A;  4HMJ A;  2LKV A;  1Z7T A;  4U68 A;  2FFK B;  3MVV A;  2JXM B;  1QNU A;  3EA6 A;  5I2Y A;  3WDN A;  1JE4 A;  4M1U B;  2F0H A;  3D31 A;  5KYI A;  2AWN A;  1PFM A;  5FO7 B;  5FLX L;  4NP5 A;  4C2M B;  1I6V C;  2RVL A;  1PXU A;  4J1M A;  1TT2 A;  1C4Q A;  2FHT A;  3D6C A;  1XX8 A;  4DAV A;  2F0W A;  3L3O C;  1D5X C;  1E0B A;  1D1K A;  3S1M B;  5CR3 A;  3MXP A;  2WKC A;  4IZ8 A;  2J4X A;  3HOY B;  3S17 B;  1ILQ A;  1PFB A;  3I91 A;  1GUW A;  1BCP F;  1SJH D;  1PRT F;  1BF4 A;  3OWF A;  1CI3 M;  1TY2 A;  1FNU A;  3OMG A;  1J8I A;  3IFT A;  2FMM A;  1LT6 D;  2ZXO A;  3EFX D;  3RZO B;  1WTQ A;  1PTO B;  4XIG S;  3KUP A;  4KKT A;  3OWE B;  1Y8O B;  3HOX B;  2FJ2 A;  3FPP A;  3M4O B;  5IGF A;  4RGT A;  1HQM C;  3A7A B;  1AN8 A;  2F0V A;  5FOB B;  2F0N A;  2K32 A;  2EYL A;  1Y1W B;  5IGB A;  1I4R A;  3K0Y A;  4X3T A;  2K28 A;  2L9H A;  2EY2 A;  4S3S A;  4EQO A;  4RKB A;  1BXT A;  1H9R A;  3CHB D;  2IL8 A;  2Q8T A;  4C3J G;  1LAC A;  3CKI B;  3SK6 A;  4OIJ A;  1RCV D;  5C3E B;  1DJR D;  1PFN A;  2MJ8 A;  2R3Z A;  4CJ0 B;  2E76 C;  2B2W C;  1AZP A;  2F0U A;  3TBI B;  1VMP A;  1AFP A;  1GJX A;  3M7G A;  1SJE D;  4FF1 A;  2MP1 A;  2F0O A;  2PW7 A;  5I6W A;  5K5P A;  3BDO A;  3PUY A;  1LTG D;  3BVZ A;  5E1F A;  1WTP A;  1EY6 A;  1W6K A;  4LK1 C;  2KCN A;  2IX0 A;  2E2I B;  1I50 B;  4TSS A;  3OW7 A;  3SE0 A;  1Q8I A;  1H9S A;  3S2H B;  5KYL A;  1NAP A;  3AU7 A;  5IOC A;  1BBX C;  1XTC D;  1IKL A;  1R4Q B;  1LV9 A;  3MXN A;  4J8Q A;  3ERO A;  4OIK A;  1Q1E A;  4OO1 G;  2IJ0 A;  3KLS A;  1L0X B;  3P1H A;  1EU4 A;  2AQ1 B;  4DFA A;  2EXZ A;  2BDN A;  5CV4 A;  3WOE A;  3ND8 A;  3P20 A;  1KNE A;  2EE1 A;  1F9S A;  2RDH A;  3FRP B;  3NTH A;  3DWP A;  3DEO A;  1ZYR D;  4I7Z C;  2NN6 I;  4IFD I;  3HRZ C;  3W2D A;  3PO3 B;  1EY4 A;  3J81 L;  2J7Z A;  3GTQ B;  5CYU A;  1LTI D;  2EY5 A;  3FMC A;  4J6H A;  2OEO A;  1IHZ A;  2MHV A;  1CA6 A;  1DM0 B;  2BA0 A;  2RBM A;  1VMC A;  1TQO A;  1Q3L A;  3LX0 A;  3KLR A;  4C3J B;  1RTO A;  1KLG D;  3TP5 A;  3NUC A;  3MWY W;  2N55 A;  1F2L A;  1HFN A;  1F2M A;  2L12 A;  3T16 A;  1JQY D;  2X6L A;  3DM1 A;  2M2L A;  2R6G A;  1JR0 D;  3QO2 A;  2F0G A;  1TVX A;  2JA7 B;  3K5N A;  4XXE A;  3RLF A;  2RKS A;  2PO4 A;  2QEJ C;  3IAY A;  3CU7 A;  3L9A X;  4K14 A;  5IT9 E;  2A68 D;  2V4D A;  2NZ1 D;  1B2T A;  4CJ2 C;  1DON A;  5JVG 3;  1WTW A;  1SFO B;  4GZY C;  2DY8 A;  5EQ0 A;  1B1Z A;  3BVM A;  1Q1B A;  4G7Z C;  2AWO A;  1M8A A;  1ENC A;  1K8M A;  1ZXT A;  2K5Q A;  2F0P A;  1S4Z A;  3NQI A;  3NPP A;  1F9Q A;  1H9K A;  1B50 A;  2E74 C;  4Q5V A;  3J80 L;  3OPO A;  2ICI A;  1NR2 A;  3BYY B;  2SNS A;  2G9H D;  4IUU A;  1QCB D;  5C6A A;  2E2J B;  4ULL A;  4HR7 B;  3M3Y B;  2TMP A;  4H13 C;  2N88 A;  1CM9 A;  4KD3 A;  1OXS C;  1CA5 A;  1LT3 D;  3K57 A;  3BS1 A;  2B2Y A;  3MHB A;  2AUK A;  3D6W A;  2O4X A;  1GHK A;  1LT5 D;  3OMC A;  3A8I E;  1UUP A;  4QF4 A;  1SE2 A;  1VF7 A;  3DEP A;  3M85 A;  3SDZ A;  1MBY A;  3G6J B;  3WOF A;  3CQZ B;  3GTL B;  2EY1 A;  3TSS A;  1IYU A;  2L11 A;  2FMC A;  3MXG A;  1YNJ C;  2C9O A;  5CV9 A;  5G3L F;  1QWY A;  4A3G B;  3E0J A;  2CW0 C;  1PRT D;  4OGQ C;  1A6X A;  3ITP A;  4BY7 B;  2NB0 A;  4G7O C;  5DAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...