3MHBA

Crystal structure of staphylococcal nuclease variant delta+phs l38a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mhbA00
5IGEA 4PNYA 5C4HA 2NUCA 5J22A 3HZXA 5JOBA 3BDCA 4J1MA 5IGGA 2OEOA 4R8NA 1SYBA 2F0IA 1A3VA 3BDLA 4QMGA 4G57A 1STHA 5CV5A 5C3WA 1SNPA 3PMFA 3P75A 4HMJA 3SK8A 1SYGA 1EZ8A 3QOLA 3SHLA 2EYJA 5C5MA 2F0WA 3SR1A 5E1FA 3NK9A 1EQVA 5C5LA 5JAVA 3E5SA 1EY4A 1EYCA 1SYEA 3D4WA 4ME5A 2PZUA 3OMCA 4H7BA 4PMBA 4EQNA 5IGFA 4WRDA 3NUCA 5KGUA 5CV9A 3V2TA 5I9PA 2EY5A 5KYIA 3QB3A 4KV6A 1ENCA 3D6CA 2F0HA 4NDXA 4KY5A 1EY6A 2F0DA 3ERQA 4K5XA 3MXPA 1STNA 2OXPA 4RKBA 4NKLA 4PMCA 3VA5A 5C3XA 1A3UA 4DF7A 3P1HA 3R3OA 5F2DA 4RKLA 5DAUA 3LX0A 5IIFA 3HEJA 5DEHA 2F0QA 1STBA 3MZ5A 3SK5A 2F0UA 4HTHA 5CV6A 5ISRA 4KY7A 2F0TA 3TP8A 1II3A 3MHBA 5E3FA 4KD3A 2SOBA 2F0PA 1SNOA 2F3WA 2O4XA 2HQEA 4DGZA 4KD4A 4ZQ3A 2RBMA 5KYLA 1JORA 1KAAA 3OMGA 5EKLA 2F0KA 3MVVA 3T13A 4DU9A 2SNSA 5CGKA 4KJOA 3T16A 1RKNA 2EY1A 1SYFA 4B9XA 4IALA 1SYDA 2EYHA 2F0MA 4MIUA 3C1EA 1TT2A 2LKVA 4N9TA 2OF1A 3TP7A 5K5PA 4K14A 1KDBA 3ITPA 5I9OA 2EYPA 3OWFA 5EGTA 5M9OA 1EY9A 4KJNA 1EZ6A 3EVQA 2F0NA 1STGA 2EYLA 5J39A 3D8GA 4ODGA 5HGTA 1U9RA 3EJIA 4QF4A 2EY6A 4K6DA 1SNQA 4I65A 5IGDA 1SYCA 2ENBA 1EY0A 1EY5A 5CV7A 4ZUIA 5I6YA 3SK6A 1A2TA 2WACA 4DFAA 3OSOA 4K8IA 2EYFA 2F0OA 3EROA 4IZ8A 3S9WA 2EYMA 2F0GA 2PYKA 4K2KA 4F8MA 5IGBA 3C1FA 4KY6A 3U9OA 1EY7A 4WORA 1KDAA 4ZUJA 4B9WA 1EYDA 2PW5A 3TP6A 2F0JA 3MEHA 3TP5A 3H6MA 2PQEA 1F2ZA 3DMUA 4NMZA 4E6IA 5NUCA 5IOCA 5KEEA 4K8JA 2EXZA 2PZTA 5C6AA 3SXHA 1STYA 1A2UA 5CV8A 4EQOA 1STAA 5KRUA 2F3VA 4IUNA 1KABA 2F0FA 5C4ZA 3D4DA 2F0SA 5KIXA 1A3TA 1JOKA 1KDCA 2M00A 4EQPA 5IODA 1EYAA 4K2LA 2PZWA 2PW7A 1TR5A 2EYOA 4QB4A 4NP5A 3NXWA 2RDFA 2F0LA 3DHQA 4KTAA 1IHZA 4LAAA 4K5WA 2SNMA 3TMEA 1AEXA 1JOOA 2KQ3A 2RKSA 4N9PA 5CR3A 5CC4A 3SK4A 3NP8A 4OL7A 5I6WA 4TRDA 1ENAA 4KHVA 5IGCA 1EY8A 1NSNS 4ID6A 4S3SA 1F2YA 4HMIA 3RUZA 2EY2A 3QOJA 5J1ZA 4EVOA 2F0VA 4J6HA 1SNMA 3NQTA 1SNCA 1TQOA 2F0EA 2KHSA 1SNDA 2QDBA 3NHHA 4K5VA 5CV4A 4YIJA 4F7XA 5EKKA 5HURA 1F2MA 1JOQA 1NUCA
chains in the Genus database with same CATH superfamily
4QJFA 1EEFD 5FLMG 3AFQA 2OEOA 4PZ8A 1TWGH 2LS01 4X3KA 2B63G 4RGOS 3EA6A 5C4XG 3H0GB 1W2BA 1EQVA 5KRUA 1N9WA 3D4WA 4PMBA 5BN5A 1EIYB 2ZM6L 1YI2A 3BJUA 4DV7L 1CA6A 1WOCA 3D6CA 1CQVA 1EY6A 4RKBA 1U5KA 1EYGA 2IX1A 1K0SA 1B1ZA 4JI0L 3A8KE 4AYBG 2IX3A 4H13C 2C5CA 3RD4A 1SLJA 2ZXOA 2JA7H 3PIP3 3NSWA 4L5QA 1PLFA 3ER0A 4YHHL 3M7GA 1I4GA 1B8AA 1X3PA 5E3FA 4KD3A 4BS9A 2SDFA 4DAYA 1KAAA 5EKLA 1JJGA 3L7ZC 4JI1L 4KJOA 1XX8A 3VR4A 1RKNA 5EPLA 3KJOA 1Y1VH 4IJLA 1SMXA 3KK7A 3HOXH 3KLRA 1WTRA 2RCNA 4IUPA 1Z7TA 4DR4Q 1WVLA 1AN8A 4LWCA 4IPGA 4IPCA 1HNXL 2Z8LA 1KRSA 4ALPA 1L1OC 2MHVA 4UY8C 1PH4A 4DAPA 2JA8H 1I50B 4OONA 5A35A 4X65L 3K59A 2UUAQ 2ASBA 1EWCA 3TRZA 1RD9D 3M3YH 1DOLA 2V4DA 1IBKQ 1GUGA 3DMUA 2KVMA 2OCEA 2WV6D 4K8JA 1F9SA 1BKBA 3FVQA 1B9MA 5BR8L 3B6YA 2K6AA 2VXWA 1LV9A 4DV6L 3RLFA 1HUMA 1TR5A 5AJ3L 1WD0A 1BUVT 3URYA 1CKOA 4BBRH 1KC8C 2IHFA 1JWMD 3E6ZX 3KDFA 1LLRD 1TY2A 4OL7A 5I6WA 4HR7B 4TRDA 3TREA 3E0JA 3L2PA 3FDTA 2M9VA 1A0IA 3UDFA 1QUQB 3GV3A 4JG2A 1KIXA 2XWBB 1TQOA 3NHHA 2YU9B 4K5VA 1D6EC 2DJGC 2E2IB 4LF4Q 2CH4W 4RG1A 1JOQA 2CW0C 1E7ZA 5J22A 5JJIA 4NXNL 2R93G 4R8NA 2NVTB 1PH9A 4C3JG 5JJLA 4BY7H 3IRBA 2KOLA 1BO0A 2C9OA 2OQ0A 1RTOA 1N33L 2F0WA 1XMQL 4LFAL 2CQOA 4DR1Q 5D65A 3U50C 1U4LA 5IGFA 4POFA 2MUYA 1I94Q 3E9HA 1XPOA 2NBFA 1SBBB 1J5EQ 3DLLA 2N78A 1PMRA 1KD1C 4UP7A 1QVCA 5T1GA 3WDNA 2F0UA 1VS0A 2OT2A 4LNQA 2L12A 3GTMB 3LNNA 2GVAA 2HQEA 1WCMG 4KD4A 1UNSA 3VR3A 2FHTA 2F0KA 1DZ1A 1B70B 3J7A5 1UWVA 1T5XD 4LFCL 3LGJA 4C56C 3CPFA 1PYSB 5JEAJ 2R7ZG 3MXUA 4QGUA 3OPOA 2M2LA 1VQKA 3D8GA 2FINB 1BF4A 1QJOA 1PH1A 1B4OA 2EY6A 2VQEQ 4FF2A 2IY5B 4DXGA 5C0XI 2A19A 2JJQA 3DEPA 2VQFL 3HKSA 3CRKC 3MXGA 4DR2L 3I8ZA 2N8NA 5DNFA 4DK1A 1SXTA 2HDMA 2F0OA 3T1YL 1I4RA 5IGBA 2K5DA 3U9OA 4IUQA 1VQ7A 4DNRB 4DUYL 4ZLTF 3TP5A 1IW7D 3H6MA 1CM9A 3BVMA 3RR5A 4V0BA 2LMCB 4Q0FA 1RDPD 4J8QA 3J81E 1HNZQ 5E4XA 4A3CH 3J81L 1QB5D 1WYDA 3KLWA 4FF3A 4N9PA 3GDEA 2OTJA 3NP8A 4DR3Q 4IN3A 2E2HH 1YNND 2LFNA 5AJ3Q 3CMAA 3W5OA 1HQRD 3K8AA 2KBNA 3GTQB 2NN6G 4XT3B 1ENFA 2XN9C 2KCCA 2WB1G 1CZGA 5BN4A 2I5LX 2PQAB 2JA5G 5IGGA 3RZDB 4A3BG 4IFDJ 5JVG3 4QIWB 1XTCD 1TXYA 3U58A 1GHJA 3S2HB 4JVZA 5FJ8G 5C5LA 5JAVA 2EJGC 1YHBA 4A3KH 4EQNA 1LACA 1TS3A 1ASZA 1ENCA 4A3EH 2E74C 4GN4B 2B39A 2H4OA 5LMUL 2RF4A 2I07B 4ULLA 2UXBL 1SE2A 1XMQQ 3M4OH 3HFZB 1EIHA 3M4YA 5DAUA 3U4ZA 5DM73 5FO8B 2F0QA 3UE0A 2A6ED 3HG9A 1OXTA 3J81c 1W3SA 1Y14B 3A74A 2HDLA 5C3EH 1MD2D 3T13A 3FKIG 4BA2I 3AB9A 1CI3M 4H44C 5M3FG 2L5TA 4KN4C 3T1HQ 4A3FH 2EYPA 4JI8Q 3M9BA 2AHOB 2HUGA 2XSCA 1STGA 4DK0A 2EYLA 1AW7A 3OW2A 4JI6L 3H09A 2K50A 1E0BA 1S5DD 3K58A 4BA1I 1QVGA 3HOWG 4JW0A 4WJ4A 3TDQA 2VUMB 3H0GH 4JOIC 4OIKA 2N55A 3S1RB 2EYMA 5IYCG 4JI3Q 1YJWA 2QEJC 3RZOB 3H3VI 4A3DH 4B9WA 3K7AB 2ES2A 3MA2B 2IL8A 1IKMA 1WTHA 4A3JG 2RVLA 2F4VQ 4DR2Q 3S15H 4QIWE 2QA4A 1E3PA 2NVYB 4LUZA 2NZ1D 2F0SA 3D0FA 1Q12A 1E1TA 2L55A 1PH7A 1XNRQ 1TWGB 1A6XA 4JI2Q 1TS5A 3FPPA 3OTOQ 1K8AC 1KQSA 1CT1D 1M4VA 4YWKA 2EY2A 4EVOA 1XWEA 1CZWA 2NVXB 2EE1A 2K1BA 4RMFA 1B7YB 1MHWC 1O7ZA 1D5XC 1VCIA 3VYTA 2F1MA 2NUCA 1Q90A 3NTKA 2A74C 2E76C 4J1MA 4PZ7A 4O1NA 3I4NG 1CTMA 1VQAA 2F0IA 4QY7A 1G2SA 2PI2A 1K0RA 3I73A 1J8IA 4C3IG 3RN2A 3SK8A 5JPNC 1G2TA 1RTNA 4YCVA 3OWEB 1DJRD 1U4MA 4H7BA 1EWIA 3T56B 2G9HD 4KK7A 1QUQA 1UUPA 1NAPA 1JB3A 4ZYSA 2F0DA 2XRSD 1Y1VB 4PMCA 3SDZA 3HOXB 4LK1C 4A3IB 1G8ZD 1SEBD 2ALYB 4Y52H 1JR0D 3ND8A 4L5RC 1PDQA 1UE6A 4L5TA 1II3A 3CRLC 2HD3A 1ZXTA 4X62L 1I4HA 2JA8B 3PUWA 1ET9A 3T16A 2JYOA 2MO0A 4DV0Q 2HHHQ 2YU9H 2KCMA 4IQZA 2EJMA 3KBGA 2QDLA 3CPWA 1YNNC 5HGTA 3NEMA 2BCOA 4XQQA 5BN3A 1HXYD 3VR6A 4I65A 1N34L 1JWSD 4P73A 2PMZE 3ND9A 3OHXC 2E8GA 4BBSH 4GNXB 3UDIA 2AQ1B 1QVFA 4WORA 5JJKA 5GQOA 3MEHA 1LTSD 3QG1A 5NUCA 2EXZA 3RNUA 2DNEA 1S5BD 4DUZQ 4QCLA 1KDCA 3KOJA 1K73C 4EQPA 3BVGA 5HY6A 2R3ZA 1KRTA 3QO2A 1FGUA 1JMCA 3NPPA 1PFSA 1VQCA 4JI5Q 4KTAA 2FXQA 2A6EC 1HR0W 4IOAA 1UEAB 3SK4A 1XNQQ 1ILQA 4DV2L 1L2FA 4HCEA 5D3DA 1LUZA 4HMIA 2P5ZX 2UUBQ 1EEID 5EKIA 3QWNA 5EPKA 2BA1A 4HSPA 1GKHA 4DV4L 4DA2A 3MXNB 4IUVA 1AP0A 2AUKA 1S4ZA 2B2VA 3K0YA 4A3MH 1QCBD 4B3RL 5M5YB 3DWPA 4G7OC 1A63A 2DGYA 3PMFA 4M1UB 3SHLA 5EPJA 5C5MA 4XXEA 1GHKA 3MWYW 2CQAA 4YY3L 2WAQB 3A8IE 1HNWL 1HPCA 3HOYG 3AMUA 1ESFA 3BZCA 3VA5A 5C0XH 3HP3A 4RGNA 1P8LA 5F2DA 1X55A 4XT1B 5GAHC 1OXXK 2AQ2B 2D5DA 1ZKOA 1YJ9A 1SE8A 2UXCQ 2B2TC 3MHBA 2Y0SG 5IYBH 5LMNW 3HOZG 4PQXA 3PO2G 3MVVA 4POGA 3DEOA 1I4PA 3JAMi 4HSVA 1SYDA 2A73B 4HEDA 4N9TA 4GKKQ 1TT2A 1VQDA 3HOUG 1U4PA 1PTOH 1D1KA 5I9OA 2DY7A 2Z1CA 1R4QB 3HKZB 1R4PB 1U9RA 4RCOA 1WTVA 4QUFA 4LF9Q 4RCNA 1ET6A 3PO3B 5CV7A 2BDNA 2WACA 3H3VC 1EFWA 3S2HH 3SVMA 4IJHA 2CWPA 2JK8A 1Q8KA 3S24A 3FEWX 3EIVA 1BCPD 3CKIB 1YNXA 1EYDA 4JYAQ 1I3QB 3J80i 2E2HB 2N88A 2K7VA 5C6AA 4I7AA 4L5SA 5CV8A 2B3GA 4EQOA 4JI4L 1IYUA 2MPMA 1DXMA 5EBCA 4B3MQ 1X3EA 1NR4A 3QJYA 1O7IA 4OXPA 1PRTC 3NTIA 2JA6G 1AEXA 5D3IB 1FNVA 1B3QA 1VQJA 4GOPC 3TEHB 3VDYA 1M8AA 2O5JC 3RUZA 1Y1WG 4A3KB 4DAMA 3PSIA 1C4QA 4LF8L 3CP0A 3OOCA 5HURA 1NUCA 2RHSB 4PMWA 1LO5D 3PIOA 4B3TL 5IP9H 1BQQT 4DXFA 2WFWA 1XXGA 4DV2Q 4CJ1B 4IOCA 4QMGA 1AE2A 3S1RH 3A55A 1WFQA 2FMCA 1VQLA 5E1FA 4LF6Q 3NK9A 3RZOH 1IKLA 1SYEA 5M5WH 3HKZE 3K7AH 2ZT9C 1KXLA 3NUCA 1OO9B 1PYBA 4TQUS 2F03A 3NBIA 1MSGA 1BNZA 5C3XA 1HHVA 3CAMA 2UXDQ 4PZ6A 3HEJA 4FO2A 1CQFA 1VQGA 3PUYA 5KNCA 4XYQA 1V8QA 2PCFB 5FO9B 5M3MG 2SOBA 2NTSA 2YYZA 3ONAB 3NWSA 1NNXA 3ICEA 1JE4A 4LF5L 3VYRA 1OXVA 1EQTA 4OO1H 2NVXH 4L63B 4A3DB 4DK6C 3KJPA 1HR0L 1K3RA 3NBHA 1F2LA 3K6OA 1Q7YC 4FF4A 2UUCQ 2E5LL 3S1QB 4ODGA 2A68D 2H1EA 3S15B 1TWHH 3PF4A 2Q8TA 3A5UA 2GA4B 1YJNA 1TWAB 4RAUC 5K36G 1A15A 2OWOA 5KNBA 3GTJB 4IZ8A 2KEDA 3S9WA 1BDOA 2EPBA 2XGTA 1HFNA 2X69A 5I2YA 2MJ8A 2F0JA 4CBVA 1DM0B 5DM63 3JC66 4IPDA 3KUPA 3IAYA 4KHPL 3M4QA 3I91A 3F2DA 3TSSA 4A3IH 3G48A 4IUNA 3G71A 1CKNA 1AE3A 1GD7A 5ELBA 1L0XB 4LW1A 4BXXG 3K80C 1NBWA 3LWUA 1TKWB 3ZYYX 1F9PA 2GVBA 4GNXA 3DHQA 2DNCA 4DV1L 1KTKA 1C9OA 1JWUD 2RA4A 3ULLA 4G7ZC 1MIUA 1NMGA 4R4OA 2A69D 4ZK9B 3HGBA 3J7ZC 2NYZD 1UE1A 2J7ZA 4A93G 1EQRA 2KHSA 5CV4A 5LMNL 4DR6Q 4P75A 4DV5L 5EQ0A 4AQYQ 1TWFB 4A3LG 1N36L 5IP7H 1TU2B 2KHJA 1MBYA 4R1JA 1QE6A 4RFBA 2WINB 2IPKD 2ZJRA 4R4QA 4KKUA 2J4XA 1SYGA 4TVAB 3A56A 4AH6A 4PG3A 3CC4A 3C2PA 4DK3C 2AQ3B 1NMFA 3QB3A 1B9NA 1BCPC 4KY5A 3H15A 2CVRA 4GKJL 5IY0A 2FFKB 4RHRA 3I70A 4IUUA 1X3FA 1VF7A 1LT5D 5FOBB 2AKWB 3H94A 2CKZB 1O7YA 3CCQA 4C3HH 1GUSA 3IKJA 2SEBD 2L0CA 2F3WA 4X3TA 3F8TA 4BBSB 3STBD 5KYLA 1G6PA 2LXKA 3PF5A 3JAME 2OQKA 4ME3A 4GLAC 2F0MA 1HQMC 1LTLA 3I2ZA 4MIUA 4MTNA 4C2MH 3JAML 5C0XJ 1KLGD 2B2UA 4K14A 4FF1A 4JI7L 3ULJA 2C35B 5M9OA 3PGZA 1EY9A 5JEAG 1IL2A 3Q6SA 5JVH3 3AEVA 3EJIA 5C4JB 4QF4A 1VF5C 5M5YH 3J7AV 2QILA 1VMPA 1EY0A 2D62A 2B2WA 2ZM6Q 4JK1C 4DV7Q 2VZAA 5ELCA 4BY1G 3KF8B 2WIIB 1D8LA 2RHQB 1TWCB 4GN3B 2K05A 1BBUA 3TN2A 1XPRA 3J80E 4JI0Q 2LY7A 4ZUJA 2IWHA 3CCMA 3Q0AA 4RWSC 1RL2A 3LWEA 3TZUA 2IW3A 4YHHQ 2K32A 4NPSA 4DV3L 1CKMA 1STAA 1T5EA 2HT1A 4WJWA 2K28A 4HN7A 2B29A 3TS0A 3I4MH 5IODA 2PZWA 4IUTA 5CMDA 4JI1Q 4O42A 2RDFA 2AUJD 1S5CD 4OHJA 4A3MB 2LSSA 1E24A 4KHPQ 1PFMA 4EGVA 2EZVA 3GTOB 1CK1A 2MP1A 4KHVA 4DPGA 1HNXQ 4CJ0B 1YEZA 3X3MA 3NQTA 3CQZH 4F7XA 2EIFA 4I7ZC 3JAMc 3G6EA 4JBJA 4PNYA 4A75A 2A68C 1VQIA 1RJTA 1C8CA 4K0KL 4X65Q 2VUMG 3PO3H 5GADC 1Z6HA 2BE5D 1W6JA 5TSSA 3PCOB 4UP9A 2FMMA 2QKIC 3MEFA 4IFDG 1KLUD 2QW7A 1EQQA 2ZXPA 1E22A 2KJXA 1I3QH 1SMYD 5BR8Q 4WRDA 1N36Q 4DV6Q 3M4PA 1FR3A 5ELNA 3MXPA 2AWOA 4NKLA 1PTOB 4X66L 3J80c 1H9SB 5H1SE 1D5MC 2NVQB 3IFTA 1UAPA 1YZ6A 4OIJA 1V1PB 1YNJD 5CV6A 2I5MX 1EL0A 1JICA 1PXUA 3CW2C 3IL8A 4NW2A 1Y8PB 4OGQC 1PV4A 1TS4A 3OMGA 1SRUA 4GKJQ 2D0OA 3MC0B 2EYHA 4NXNQ 3KBXA 1KDBA 4LF7L 1CHPD 3H91A 5T1IA 2JA7G 1N33Q 2JSOA 3N52A 4LFAQ 1VQ8A 4F88A 1STEA 2Q2HA 1EY5A 3NELA 1WTOA 4K8IA 3V96A 2ZJPA 1KNAA 1QWYA 5C44H 4DR7L 1EY7A 1VQBA 3F2UA 3TP6A 1Y1VG 3I7FA 3VYSA 3HOXG 1OTCA 3MFYA 4A3GH 1TVXA 2HIXA 1STYA 1JT8A 3R2TA 2F0FA 4RGTA 3A54A 2MNAA 1EYAA 2I0QA 5D14A 3BU2A 1VQEA 3I56A 1WD1A 4V190 2K4KA 4LFCQ 1QNUA 2JA8G 3TZDA 1JOOA 4KN7C 5CR3A 2Z6KA 4A4IA 1QOHA 1ENAA 3STBC 5M5WB 3ULPA 2K5WA 2O5IC 1QG7A 1MI2A 1AH9A 2JN4A 2VQFQ 3S1QH 2R6GA 3GD7A 1F2MA 1R9TH 3HS0C 3GV6A 5IGEA 4L8JA 4BWGB 3Q24A 1TWAH 2VL6A 3T1YQ 5GROA 1CSPA 2NN6I 2JQOA 4RH6A 4BBRG 1D7QA 2R92H 4DUYQ 3P75A 3GTJH 1VQ6A 2R7DA 1EU3A 3QOLA 3C46A 1LM0A 1EOTA 3PUVA 2PZUA 1XJVA 1JB7A 2PMZB 2XNAC 3CCVA 4NDXA 1KNEA 2BH8A 2L15A 1JE5A 3R8BA 4NXML 2ZXRA 3MTSA 4IPHA 3J7YW 1PH5A 2WB1B 1TWHB 3CMEA 2E2DC 2DJFC 3ZJYC 4HTHA 5CYUA 4BY7G 4KY7A 4KKSA 3L9AX 5IYDH 3BYTB 3A0JA 4Y7NB 5EBDA 1PRTB 3S17B 2UU9L 1G291 4TKOB 4DGZA 3CCUA 2RBMA 1NJIC 4WJ3M 4GOPB 1HFGA 4XYOA 2EY1A 1Y1WH 1PH2A 4CJ2C 2D9UA 4KJNA 1EZ6A 1TWFH 3EVQA 1IZ6A 5CORA 1IW7C 1CHQD 2IHEA 3O13A 2ATWA 2ZTCA 3HOVH 4X64L 1HTLD 4HIKA 1V9PA 1D1IA 1L0WA 3PIPA 3RN5A 3I4LA 2BE5C 4XTCS 1O7LA 2HCIA 1U4RA 2WAQG 2CHBD 1IL8A 5LMUQ 2Q2UA 4FVMA 2UXBQ 1OXSC 3AYHB 3E0EA 2PW5A 3FKIB 1LTBD 1PVOA 3G4SA 5CBAE 1SMYC 2A8VA 1PFNA 2PZTA 1EWHA 1EUJA 1E1OA 2ID0A 1JJ2A 4G7HC 2Z0SA 1WJJA 1KABA 2MQHA 5KIXA 1JOKA 2BOSA 4DR5L 5FLMH 1TY0A 4OX9L 1B2TA 4N8X1 4JV5L 4UHVA 4NP5A 1MGSA 2B63H 1YNJC 1HZ9A 2KQ3A 3AU7A 2DUDA 5C4XH 4XIGS 5CC4A 5IWAL 4JI6Q 1DOMA 1VQOA 2WB1E 4KLKA 1F9RA 1SNDA 3S1NH 5C4JH 3J7AF 2XTIA 2YTYA 5I4DA 2JEAI 4P72A 4A3CG 2B2VC 1GJXA 5HGQA 1MJCA 3CCSA 4C1NK 5CV5A 5C3WA 2VB3X 4HAEA 4L6TB 1EZ8A 2EYJA 1TWCH 2K5NA 2N49A 4C1NI 4KI0A 1L0YB 2LXJA 4C3HB 4HJ9A 5EAYA 2FJ2A 1CSQA 1NTGA 1Z9FA 3OIQA 2NWGA 4KHZA 2D0PA 2PNRC 3VR2A 4LFBL 3W2DA 2F0HA 4X3UA 2K33A 1U0LA 3D3RA 1STNA 4C2MB 2MO1A 2AWNA 1YBYA 3R3OA 2JP1A 1SFOH 1VQ4A 3S1MB 1STBA 3I4NB 3BZKA 2F0TA 4CKBA 3W3AA 1L1OB 4YWLA 2CH4A 3KDFB 3GTOH 4A3KG 3RLOA 4DU9A 1Y69U 4YWMA 4B9XA 1SYFA 2KHIA 4A3EG 1EFID 1BBXC 1XMOL 1SR3A 2K5VA 4A76A 1XTDA 1H9SA 2PQAA 2R61A 2R7FA 1IBML 4RGMA 2I46A 1HH2P 1V1PA 3I4MB 3T53B 1QZHA 3MFGA 1H9KA 5C3EG 1ONLA 1ESRA 2F0GA 1KDAA 1Z47A 5E7NA 3K0XA 1HZCA 4EQ5A 4A3FG 2B2YA 3HRZC 1BCPB 5JPMC 4FXDA 1FYCA 3DXJC 3CQZB 1GUOA 2NVQH 4HCSA 4X62Q 3FMCA 3N6RA 3FP9A 4K2LA 2R93H 2EYOA 1YIJA 2TMPA 1K3BC 2RDHA 4C3JH 3H0GG 5KNDA 4K5WA 4OEMB 2SNMA 1QNKA 4A3DG 1TS2A 1Q1BA 2AMCB 5G3LF 3CD6A 2GN5A 4B08A 3CCLA 3EFXD 1N34Q 2QDBA 3Q22A 5ELFA 1FVIA 2RSNA 4WFN3 2KEEA 3HZXA 1JCKB 2NTTA 3BDCA 1DD2A 2OTLA 1EIGA 1I4XA 3S14B 1STHA 1PZJD 2D2CC 4Q5VA 4PV1C 4DR4L 1K8GA 1K83H 3TS2A 4DNTB 1WCMH 1V43A 3PUZA 1B53A 1VMCA 4CKCA 3ERQA 4K5XA 1LTTD 1X9NA 4YCUA 2R7ZH 2UUAL 2KENA 3QR8A 1EOVA 4XDXA 4H02A 1IBKL 4JBKA 1ZEQX 5A2QE 2O4XA 1PFBA 5A2QL 4Z9CB 3GTLB 2Q2TA 4DV4Q 2YV5A 4DNIA 5C44B 2K14A 4JCVE 1CA5A 1B3AA 4B3RQ 2X6LA 3HOYB 1F9QA 3PV0A 2F0NA 4HIMA 1A8VA 4A3GB 1K28A 3A5ZB 4UP8A 4JC0A 3GO5A 1K8MA 3CC7A 1GUWA 1DCZA 4YY3Q 4LF4L 1HNWQ 2VS1A 5DLQE 4APVA 2JE6I 1XMOQ 3GTPH 3H3VH 3DM1A 2Y0SB 3FHWA 3BDOA 1SJHD 1J9OA 1KAWA 1NE3A 1X65A 2EXDA 5M5XH 4DR1L 3HOUB 2NN6H 3SXHA 5ELDA 1ZYRD 1WTXA 2QGQA 3NE5B 5ELEA 1I94L 1R9TB 1A3TA 2JA5H 4HJ8A 4GZYC 4HJ5A 1J5EL 2MGSA 4QB4A 4GNXC 4NB3A 1H9JA 3K7UC 4Y7NH 4A3BH 3S17H 4BBSG 3K57A 4O2DA 2R92B 4FYDA 2MFIA 1FNUA 5FJ8H 1E2VA 1DOKA 3CCJA 1E2WA 1K9MC 4KMUC 1AZQA 1SNCA 2IT1A 2K5QA 1ILPA 2VY3A 3A7LA 3CF5A 3Q8DA 4QQBX 1E2ZA 2G9DA 1LTRD 1PZID 1BVSA 1YHAA 5IE8A 3S2DB 3A8JE 2I5HA 3D4RA 3U4VA 2JA6B 2L1BA 2ZTEA 2VQEL 1WTQA 4P2CB 3F2CA 3T51B 3I72A 1M1KC 4JI4Q 3FKIH 4X6AH 5CV9A 2EY5A 5M3FH 1Y1WB 5FO7B 4JBWA 1SSOA 1O80A 2Z4IA 1IYVA 4XQJA 1S72A 2EJFC 4A3MG 2Y0SE 1LABA 4ILWA 3MZ5A 5ISRA 4EX5A 3HOVB 4OWWB 3HOWH 1F77A 1HNZL 4UPAA 3K81C 2TSSA 4LF8Q 4ZQ3A 5IYCH 1BBWA 2E75C 1YHQA 2Z9HA 4B3TQ 5ELOA 4XQNA 2B2UC 3TP7A 2OF1A 2A6HD 4JBMA 4DR3L 5C0XG 3W1BA 4A3JH 3G6JB 4MN3A 1H95A 3MXNA 1SNQA 3UI2A 2B2WC 1L1OA 1A2TA 3K5OA 5IYBG 3U9SA 5M3MB 2B63B 2PYKA 4F8MA 3C3LA 1N32L 5C4XB 2F4IA 4JPBW 4OELB 1JC7A 3S1NB 5I2XA 4LF5Q 3S1MH 2QCPX 4ZKCB 4AYBB 3CC2A 3I4NH 2VW9A 1I5FA 3NXWA 4C3IH 4LAAA 4OWXB 3CXCA 3EQLC 1HR0Q 4MHEA 3S16H 4J15A 2E5LQ 4ID6A 1PYWD 2CCZA 1K8OA 3M7NA 3J80L 4R4CA 1VDZA 2K01A 5C4HA 5E4WC 3KLSA 5FLXE 4HJAA 3T1HL 1SYBA 1SFOB 4JI8L 2EQSA 1GO3E 5FLXL 1HRJA 4HMJA 3TQYA 1G51A 3SR1A 4CDFC 3QIAA 1PZKD 2XRQD 1I6HH 1UE7A 3I4OA 4DAVA 1ASYA 1YITA 2NB0A 5KYIA 1X54A 1FJGL 3GQBA 4R4TA 1BOSA 4A93B 2PI2E 4JI3L 3J81j 3GTGB 5LL6S 4DV1Q 1Q3LA 5IP9G 4RKLA 5GAGC 1ZYRC 3ERSX 2E2JB 4U673 3T4AC 5DEHA 2F4VL 1NY4A 1LT6D 1D2BA 1GXDC 4R9WA 5IT9E 1G6ZA 2F0PA 5LMNQ 1ICWA 4GS3A 5IT9L 4DV5Q 3GTKB 2F52A 2K03A 1XNRL 1HZAA 4JI2L 1ML0D 4O0AA 2LKVA 1MJEA 5K5PA 3OTOL 4AYBE 3I55A 1XPUA 1GUTA 1PH8A 3G7LA 1X32A 2HIVA 4P74A 4K6DA 3BYYB 3S14H 4DKAC 2R93B 5I6YA 4F87A 4ZCKA 3I90A 4C3JB 1CFMA 3EROA 3PUXA 5FLXc 5L37A 1Q81C 4K2KA 4OO1G 1FNWA 1D5ZC 2A69C 3PIO3 1F2ZA 1IYJB 2BDOA 2PNHA 3D4DA 4FP5D 4IO9A 4CHTB 2M00A 1N32Q 2DY8A 1VQFA 2K75A 4K6LA 4IURA 1RHPA 5LHY1 1LTGD 2Z6KC 1HA6A 4JI7Q 3MAQA 3GTLH 4BY1B 1K83B 4HIDA 2RDGA 3DM3A 1PTOD 1WCMB 3WWVA 2CFMA 5IT9c 2L11A 3HOYH 2A6HC 2L9HA 2ICEC 5LL6X 4A3IG 4ZAIA 4OWTB 2R7ZB 1FD7D 1FGBD 1X6OA 1VQ9A 3VA7A 4DV0L 2HHHL 1N8RC 3BDLA 4H0LC 1H9MA 1SNPA 3Q23A 5EJWA 3F2BA 3GP7A 3BS1A 1GOZA 2Q8IB 5JJZA 3KLSX 1WI5A 2RQXA 1PHJA 1EY4A 4DV3Q 3HOZH 3CHBD 4ME5A 3OMCA 3V05A 2NZOA 3PO2H 2QEXA 4MTKA 4IFDI 3V2TA 1XYIA 4R8IA 1WTPA 1PTOF 3HOUH 2OXPA 4ABNA 3EN2A 2XWJB 1G91A 5IP7G 1C48A 1SE4A 1V1OA 3SK5A 2EVBA 1VQ5A 1GUNA 4G4KA 3TP8A 1SAPA 1QILA 1FJGQ 2BH2A 4DUZL 1SJED 1SNOA 5J3BA 2L4NA 3GTPB 1HCZA 1QZGA 3F1ZA 4X3SA 4JI5L 3BZDB 4K0KQ 2N3SA 4CDCC 1AZPA 4OO1I 2A5HA 1XNQL 2WKDA 1LYLA 4UDUC 5M5XB 4HJ7A 4QL5A 2UUBL 5IGDA 3S2DH 1WTWA 2JA5B 2ENBA 3SEBA 3SK6A 4C3HG 2JA6H 3OSOA 3L3OC 4A3BB 2DN8A 3NWTA 4JOIA 3UDXA 4GN5A 2Z6BA 4X66Q 4LMQD 4CDEC 4RA8A 2EOTA 4NMZA 1BR9A 3AFPA 3KF6B 3DWQA 2J0TD 2JA7B 1YVCA 4DN4M 1I50H 2Q2IA 2JEBI 2RKSA 4LF7Q 3R93A 1LT3D 2VB2X 3D31A 1F2YA 4KKTA 2UXCL 3QOJA 5J1ZA 4B3SL 1LT4D 2F0VA 2F3IA 1O78A 3WOEA 2WKCA 1Q1EA 1HTPA 3NBHB 5M3FB 3EBEA 2H5XA 3X3NA 3K5NA 2KUMA 3I4MG 2B8GA 1PRTD 4GKKL 2NZHA 1C0AA 2ICIA 4DR7Q 2X6GA 1UE5A 4G57A 1S5FD 1SDFA 1I6VC 3KF8A 1DYQA 5M3MH 4LF9L 1A62A 3HOWB 4DAYB 1EYCA 1C7YA 1HUNA 1W6KA 1NCVA 5KGUA 1CUKA 2E2IH 4KV6A 4ZKBB 3M3YB 1B44D 1B50A 4MNOA 3HKZG 1FL0A 4CKEA 3KYHC 4DF7A 3P1HA 1X3GA 4A3JB 1CKNB 5COYA 2JXMB 2NVTH 4JYAL 3NENA 1VQNA 5IIFA 3PO3G 1KHIA 1DGSA 1PRTF 3CCEA 5GAEC 1VQPA 5K36H 2B8FA 5AFWA 5FK9C 4BBRB 4B3ML 3SE0A 1JORA 2EDGA 5CGKA 1J6QA 1Q86C 4CDDC 4UAIA 1PTOC 3OWFA 4HIOA 3VYUA 1AFPA 2KECA 4FNFA 1NR2A 3P7JA 4TSSA 1HJPA 3GTMH 1SYCA 3AQQA 3PQIA 2PO4A 4BXXH 4GLXA 2HQLA 4CGYB 4ZUIA 4BY7B 4DFAA 1X56A 4C3IB 2A1AA 1I4QA 4FXGC 3C1FA 1JQYD 4KY6A 4NXMQ 2HCCA 3S16B 1DONA 3L0OA 1GVPA 2B2YC 4A93H 2YTXA 2PQEA 4E6IA 4LF6L 3GTGH 5FKAC 1KL9A 3R2IA 4LUOA 4LUVA 2UU9Q 2VNUD 4A3LH 2E2JH 1HZBA 1S3OA 4R4IA 3D6WA 1IBLL 2KA7A 3K5MA 2JA9A 4U68A 3DWAA 1Y8NB 2UXDL 5C44G 3GTKH 5G3LD 3BVZA 1S5ED 1TIID 1EY8A 3SGIA 1I6HB 4S3SA 4P71A 2RSOA 1SNMA 3OYYA 4X64Q 1PH3A 1JJCB 4A3GG 4YIJA 4AIMA 2SNSA 2XVSA 1BXTA 3IFDA 4FXKC 5CBEE 2O2LD 4MZ9A 5JOBA 3BG3A 2RCFA 2ZTDA 1A3VA 1MKHA 4B3SQ 1H9RA 2WP8J 2UUCL 2CWAA 2ZJQA 3DUZA 1EU4A 3E5SA 1Y8OB 3FRPB 2PPBC 1UEBA 1RIPA 5I9PA 3M85A 3GTQH 4DR5Q 1M90C 1RCVD 3E9IA 4OX9Q 4JV5Q 1Q8IA 3OIPA 1A3UA 5JEAH 5IWAQ 3RZDH 3LX0A 3RMHA 2R92G 3KFUA 1HA5A 4FDBA 3CU7A 2K52A 2B2TA 1LTAD 2Z4HA 4BY1H 1MSHA 4IALA 1SE3A 1SROA 3C1EA 4M8AA 1V1QA 2IJ0A 4LJZC 2K04A 2CW0D 3ITPA 3E3XA 5EGTA 3NQIA 5J39A 1RODA 3P20A 4QUCA 1S40A 3VR5A 2IX0A 5IYDG 4ZRZA 2Q8RE 4DR6L 2WAQE 1OXUA 3UE1A 2YTVA 4AQYL 4LFBQ 4N8FA 3A7AB 1SN8A 2EYFA 3OW7A 1PA6A 3CCRA 2BA0A 1RF2D 3NTHA 3WOFA 1IXRA 3W1GA 2G5DA 1BCPF 1VQHA 5IOCA 5KEEA 4A3EB 1GM5A 2KCTA 1EIFA 1A2UA 2F3VA 5C4ZA 4GLVB 3J81i 2V1CC 3RLNA 3HOVG 1P16A 3M4OB 3UDGA 3TBIB 1Q46A 2PW7A 2VUMH 2F0LA 1IHZA 3TMEA 4YCWA 4IFDH 2QF7A 1ICFB 1T9HA 3FPUB 5IGCA 5C3EB 3I3CA 1NSNS 4GOPA 2XIWA 1X3QA 1IBMQ 3HOZB 3PO2B 1LTID 4J6HA 2KCNA 1VQMA 1IBLQ 2F0EA 1PH6A 2NVYH 2K5HA 3K5LA 5EKKA 4A3FB 1Q82C 3KF6A 4RHSA
chains in the Genus database with same CATH topology
1EEFD 2OEOA 2LS01 4X3KA 4RGOS 3EA6A 3H0GB 1EQVA 5KRUA 3D4WA 5BN5A 4PMBA 1CA6A 3D6CA 1CQVA 1EY6A 4RKBA 2IX1A 1B1ZA 3A8KE 2IX3A 4H13C 2C5CA 3RD4A 2ZXOA 3PIP3 3NSWA 1PLFA 3M7GA 1I4GA 1X3PA 5E3FA 4KD3A 4BS9A 2SDFA 4DAYA 1KAAA 5EKLA 3L7ZC 3VR4A 4KJOA 1XX8A 1RKNA 5EPLA 3KK7A 3KLRA 1WTRA 4IUPA 1Z7TA 1WVLA 1AN8A 2Z8LA 2MHVA 4DAPA 1I50B 5A35A 3K59A 1EWCA 1RD9D 1DOLA 2V4DA 1GUGA 3DMUA 2KVMA 2WV6D 4K8JA 1F9SA 3FVQA 1B9MA 2K6AA 2VXWA 1LV9A 3RLFA 1HUMA 1TR5A 1WD0A 1BUVT 3URYA 1JWMD 3E6ZX 1LLRD 1TY2A 4OL7A 5I6WA 4HR7B 4TRDA 3E0JA 3FDTA 2M9VA 3GV3A 2XWBB 1TQOA 3NHHA 2YU9B 4K5VA 1D6EC 2E2IB 1JOQA 2CW0C 5J22A 4R8NA 2NVTB 4C3JG 2KOLA 1BO0A 2C9OA 1RTOA 2F0WA 5D65A 1U4LA 5IGFA 2MUYA 2NBFA 1SBBB 1PMRA 5T1GA 3WDNA 2F0UA 2OT2A 3GTMB 2L12A 3LNNA 2HQEA 4KD4A 1UNSA 3VR3A 2FHTA 2F0KA 1DZ1A 1T5XD 4C56C 5JEAJ 3MXUA 3OPOA 2M2LA 3D8GA 2FINB 1BF4A 1QJOA 1B4OA 2EY6A 4FF2A 4DXGA 5C0XI 3DEPA 3CRKC 3MXGA 3I8ZA 5DNFA 4DK1A 1SXTA 2HDMA 2F0OA 1I4RA 5IGBA 2K5DA 3U9OA 4IUQA 4DNRB 4ZLTF 3TP5A 1IW7D 3H6MA 1CM9A 3BVMA 4V0BA 2LMCB 4Q0FA 1RDPD 4J8QA 3J81E 5E4XA 3J81L 1QB5D 4FF3A 4N9PA 3NP8A 4IN3A 1YNND 2LFNA 1HQRD 3GTQB 2NN6G 4XT3B 1ENFA 2XN9C 2KCCA 5BN4A 1CZGA 5IGGA 3RZDB 4IFDJ 5JVG3 4QIWB 1XTCD 1GHJA 3S2HB 5C5LA 5JAVA 2EJGC 4EQNA 1LACA 1TS3A 1ENCA 2E74C 2B39A 2H4OA 2I07B 4ULLA 1SE2A 1EIHA 3M4YA 5DAUA 5DM73 5FO8B 2F0QA 2A6ED 3HG9A 1OXTA 2HDLA 1MD2D 3T13A 4BA2I 3AB9A 1CI3M 4H44C 2L5TA 4KN4C 2EYPA 2XSCA 2HUGA 4DK0A 1STGA 2EYLA 1AW7A 3H09A 1E0BA 1S5DD 3K58A 4BA1I 3TDQA 2VUMB 4OIKA 2N55A 3S1RB 2EYMA 2QEJC 3RZOB 4B9WA 3K7AB 3MA2B 2IL8A 1IKMA 2RVLA 2NVYB 2NZ1D 2F0SA 1Q12A 2L55A 1A6XA 1TWGB 1TS5A 3FPPA 1CT1D 1M4VA 2EY2A 4EVOA 1XWEA 1CZWA 2NVXB 2EE1A 2K1BA 1O7ZA 1D5XC 1VCIA 3VYTA 2F1MA 2NUCA 1Q90A 3NTKA 2A74C 2E76C 4J1MA 4O1NA 1CTMA 2F0IA 1G2SA 3I73A 1J8IA 4C3IG 3SK8A 5JPNC 1G2TA 1RTNA 3OWEB 1DJRD 1U4MA 4H7BA 3T56B 2G9HD 4KK7A 1UUPA 1NAPA 1JB3A 4ZYSA 2F0DA 2XRSD 1Y1VB 4PMCA 3SDZA 3HOXB 4LK1C 4A3IB 1G8ZD 1SEBD 1JR0D 3ND8A 1PDQA 1II3A 3CRLC 1ZXTA 1I4HA 2JA8B 3PUWA 1ET9A 3T16A 2JYOA 4IQZA 2EJMA 3KBGA 1YNNC 5HGTA 2BCOA 4XQQA 5BN3A 1HXYD 3VR6A 4I65A 1JWSD 3ND9A 3OHXC 2AQ1B 4WORA 3MEHA 1LTSD 3QG1A 5NUCA 2EXZA 2DNEA 1S5BD 4QCLA 1KDCA 4EQPA 3BVGA 2R3ZA 3QO2A 3NPPA 4KTAA 2A6EC 1UEAB 3SK4A 1ILQA 4HCEA 5D3DA 4HMIA 1EEID 5EKIA 3QWNA 5EPKA 2BA1A 4HSPA 4DA2A 4IUVA 1AP0A 2AUKA 1S4ZA 2B2VA 3K0YA 1QCBD 5M5YB 3DWPA 4G7OC 3PMFA 4M1UB 3SHLA 5EPJA 5C5MA 4XXEA 1GHKA 3MWYW 2CQAA 2WAQB 3A8IE 1HPCA 3AMUA 1ESFA 3VA5A 5C0XH 3HP3A 4RGNA 5F2DA 4XT1B 1OXXK 2AQ2B 2D5DA 1ZKOA 2B2TC 3MHBA 4PQXA 3MVVA 3DEOA 1I4PA 4HSVA 1SYDA 2A73B 4HEDA 4N9TA 1TT2A 1U4PA 1PTOH 1D1KA 5I9OA 2DY7A 2Z1CA 1R4QB 3HKZB 1R4PB 1U9RA 4RCOA 1WTVA 4QUFA 4RCNA 1ET6A 3PO3B 5CV7A 2BDNA 2WACA 3H3VC 3SVMA 3FEWX 1BCPD 3CKIB 1EYDA 1I3QB 2E2HB 2N88A 2K7VA 5C6AA 5CV8A 4EQOA 1IYUA 2MPMA 1DXMA 5EBCA 1NR4A 3QJYA 1PRTC 3NTIA 1AEXA 5D3IB 1FNVA 1M8AA 2O5JC 3RUZA 4A3KB 1C4QA 5HURA 3OOCA 1NUCA 4PMWA 1LO5D 1BQQT 4DXFA 1XXGA 4CJ1B 4QMGA 3A55A 2FMCA 5E1FA 3NK9A 1IKLA 1SYEA 2ZT9C 3NUCA 1OO9B 4TQUS 2F03A 3NBIA 1MSGA 1BNZA 5C3XA 1HHVA 3HEJA 4FO2A 1CQFA 3PUYA 5KNCA 4XYQA 1V8QA 2PCFB 5FO9B 2SOBA 2NTSA 2YYZA 3ONAB 3NWSA 1JE4A 3VYRA 1OXVA 1EQTA 4OO1H 4L63B 4A3DB 3NBHA 1F2LA 3K6OA 4FF4A 3S1QB 4ODGA 2A68D 2H1EA 3S15B 2Q8TA 2GA4B 1TWAB 4RAUC 5K36G 1A15A 5KNBA 3GTJB 4IZ8A 2KEDA 3S9WA 1BDOA 2EPBA 1HFNA 2X69A 5I2YA 2MJ8A 2F0JA 4CBVA 1DM0B 5DM63 3KUPA 3IAYA 3I91A 3TSSA 4IUNA 5ELBA 1L0XB 3LWUA 1TKWB 3ZYYX 1F9PA 3DHQA 2DNCA 1KTKA 1JWUD 2RA4A 4G7ZC 2A69D 4ZK9B 3HGBA 2NYZD 2J7ZA 2KHSA 5CV4A 5EQ0A 1TWFB 1TU2B 1MBYA 1QE6A 4RFBA 2WINB 2IPKD 4KKUA 2J4XA 1SYGA 3A56A 3C2PA 2AQ3B 3QB3A 1B9NA 1BCPC 4KY5A 2CVRA 2FFKB 4RHRA 3I70A 4IUUA 1VF7A 1LT5D 5FOBB 3H94A 1O7YA 1GUSA 3IKJA 2SEBD 2L0CA 2F3WA 4X3TA 4BBSB 5KYLA 3JAME 2F0MA 1HQMC 4MIUA 3JAML 5C0XJ 4FF1A 1KLGD 2B2UA 4K14A 5M9OA 1EY9A 5JEAG 3Q6SA 5JVH3 3EJIA 5C4JB 4QF4A 1VF5C 3J7AV 2QILA 1VMPA 1EY0A 2D62A 2B2WA 4JK1C 5ELCA 2WIIB 1TWCB 2K05A 3TN2A 3J80E 2LY7A 4ZUJA 2IWHA 3Q0AA 4RWSC 3LWEA 3TZUA 2IW3A 2K32A 1STAA 1T5EA 4WJWA 2K28A 4HN7A 5IODA 2PZWA 4IUTA 5CMDA 4O42A 2RDFA 2AUJD 1S5CD 4OHJA 4A3MB 1PFMA 4EGVA 2EZVA 3GTOB 1CK1A 2MP1A 4KHVA 4CJ0B 3X3MA 3NQTA 4F7XA 4I7ZC 4PNYA 2A68C 1RJTA 1C8CA 1Z6HA 2BE5D 1W6JA 5TSSA 2FMMA 2QKIC 4IFDG 1KLUD 2ZXPA 2KJXA 1SMYD 4WRDA 1FR3A 3MXPA 2AWOA 4NKLA 1PTOB 1H9SB 1D5MC 2NVQB 3IFTA 1UAPA 4OIJA 1V1PB 1YNJD 5CV6A 1EL0A 1JICA 1PXUA 3IL8A 4NW2A 1Y8PB 4OGQC 1TS4A 3OMGA 3MC0B 2EYHA 3KBXA 1KDBA 1CHPD 3H91A 5T1IA 2JSOA 3N52A 4F88A 1STEA 1EY5A 1WTOA 4K8IA 3V96A 1KNAA 1QWYA 1EY7A 3F2UA 3TP6A 3VYSA 3MFYA 1TVXA 1STYA 3R2TA 2F0FA 4RGTA 3A54A 1EYAA 5D14A 1WD1A 4V190 1QNUA 3TZDA 1JOOA 4KN7C 5CR3A 1QOHA 1ENAA 5M5WB 2K5WA 2O5IC 1QG7A 1MI2A 2R6GA 3GD7A 1F2MA 3HS0C 3GV6A 5IGEA 4L8JA 4BWGB 3Q24A 2NN6I 4RH6A 3P75A 1EU3A 3QOLA 3C46A 1EOTA 3PUVA 2PZUA 2PMZB 2XNAC 4NDXA 1KNEA 3R8BA 2ZXRA 3MTSA 3J7YW 2WB1B 1TWHB 2E2DC 4HTHA 5CYUA 4KY7A 4KKSA 3L9AX 3BYTB 4Y7NB 5EBDA 1PRTB 3S17B 1G291 4TKOB 4DGZA 2RBMA 1HFGA 4XYOA 2EY1A 4CJ2C 2D9UA 4KJNA 1EZ6A 3EVQA 5CORA 1IW7C 1CHQD 3O13A 1HTLD 1D1IA 3I4LA 2BE5C 4XTCS 1O7LA 2HCIA 1U4RA 2CHBD 1IL8A 4FVMA 1OXSC 2PW5A 3FKIB 1LTBD 5CBAE 1SMYC 1PFNA 2PZTA 1EWHA 2ID0A 4G7HC 1KABA 5KIXA 1JOKA 2BOSA 1TY0A 1B2TA 4NP5A 1MGSA 1YNJC 2KQ3A 3AU7A 4XIGS 5CC4A 1DOMA 1F9RA 1SNDA 3J7AF 5I4DA 2JEAI 2B2VC 1GJXA 4C1NK 5CV5A 5C3WA 2VB3X 4HAEA 4L6TB 1EZ8A 2EYJA 4C1NI 4KI0A 1L0YB 4C3HB 2FJ2A 3OIQA 2NWGA 4KHZA 2PNRC 3VR2A 3W2DA 2F0HA 4X3UA 2K33A 3D3RA 1STNA 4C2MB 2AWNA 3R3OA 2JP1A 3S1MB 1STBA 3I4NB 2F0TA 4CKBA 3W3AA 4DU9A 1Y69U 4B9XA 1SYFA 1EFID 1BBXC 1H9SA 2R61A 4RGMA 2I46A 1V1PA 3I4MB 3T53B 3MFGA 1H9KA 1ONLA 1ESRA 2F0GA 1KDAA 1Z47A 2B2YA 3HRZC 1BCPB 5JPMC 4FXDA 1FYCA 3DXJC 3CQZB 1GUOA 4HCSA 3FMCA 3N6RA 4K2LA 2EYOA 2TMPA 2RDHA 5KNDA 4K5WA 2SNMA 1QNKA 1TS2A 1Q1BA 5G3LF 4B08A 3EFXD 2QDBA 3Q22A 5ELFA 2RSNA 4WFN3 2KEEA 3HZXA 1JCKB 2NTTA 3BDCA 1DD2A 1EIGA 1I4XA 3S14B 1STHA 1PZJD 2D2CC 4Q5VA 4PV1C 4DNTB 1V43A 3PUZA 1B53A 1VMCA 4CKCA 3ERQA 4K5XA 1LTTD 4XDXA 1ZEQX 5A2QE 2O4XA 1PFBA 5A2QL 4Z9CB 3GTLB 5C44B 1CA5A 1B3AA 2X6LA 3HOYB 1F9QA 3PV0A 2F0NA 4A3GB 3GO5A 1K8MA 1GUWA 1DCZA 2JE6I 3DM1A 2Y0SB 3BDOA 1SJHD 1J9OA 3HOUB 2NN6H 3SXHA 5ELDA 1ZYRD 1WTXA 3NE5B 5ELEA 1R9TB 1A3TA 4GZYC 2MGSA 4QB4A 1H9JA 3K57A 2R92B 4FYDA 1FNUA 1E2VA 1DOKA 1E2WA 4KMUC 1AZQA 1SNCA 2IT1A 2K5QA 1ILPA 3A7LA 1E2ZA 2G9DA 1LTRD 1PZID 3S2DB 3A8JE 3D4RA 2JA6B 2L1BA 1WTQA 4P2CB 3T51B 3I72A 5CV9A 2EY5A 1Y1WB 5FO7B 4JBWA 1SSOA 1O80A 2Z4IA 1IYVA 4XQJA 2EJFC 1LABA 4ILWA 3MZ5A 5ISRA 3HOVB 1F77A 2TSSA 4ZQ3A 2E75C 4XQNA 2B2UC 3TP7A 2OF1A 2A6HD 5C0XG 3G6JB 4MN3A 3MXNA 1SNQA 3UI2A 2B2WC 1A2TA 3K5OA 3U9SA 5M3MB 2B63B 2PYKA 4F8MA 3C3LA 5C4XB 2F4IA 1JC7A 3S1NB 5I2XA 2QCPX 4ZKCB 4AYBB 3NXWA 4LAAA 3EQLC 4MHEA 4ID6A 1PYWD 1K8OA 3M7NA 3J80L 1VDZA 2K01A 5C4HA 5E4WC 3KLSA 5FLXE 1SYBA 1SFOB 5FLXL 1HRJA 4HMJA 3SR1A 3QIAA 1PZKD 2XRQD 4DAVA 2NB0A 5KYIA 3GQBA 1BOSA 4A93B 3GTGB 5LL6S 1Q3LA 4RKLA 1ZYRC 2E2JB 4U673 3T4AC 5DEHA 1LT6D 1D2BA 1GXDC 4R9WA 5IT9E 1G6ZA 2F0PA 1ICWA 5IT9L 3GTKB 2K03A 1ML0D 2LKVA 5K5PA 1GUTA 3G7LA 1X32A 4K6DA 3BYYB 2R93B 5I6YA 4F87A 3I90A 4C3JB 1CFMA 3EROA 3PUXA 4K2KA 4OO1G 1FNWA 1D5ZC 2A69C 3PIO3 1F2ZA 2BDOA 3D4DA 4FP5D 4CHTB 2M00A 2DY8A 4K6LA 4IURA 1RHPA 5LHY1 1LTGD 1HA6A 3MAQA 4BY1B 1K83B 2RDGA 1PTOD 1WCMB 2L11A 2A6HC 2L9HA 2ICEC 5LL6X 4ZAIA 2R7ZB 1FD7D 1FGBD 3VA7A 3BDLA 4H0LC 1H9MA 1SNPA 3Q23A 5EJWA 3GP7A 3BS1A 1GOZA 2Q8IB 5JJZA 3KLSX 2RQXA 1EY4A 3CHBD 4ME5A 3OMCA 3V05A 4IFDI 3V2TA 1XYIA 4R8IA 1WTPA 1PTOF 2OXPA 4ABNA 2XWJB 1G91A 1C48A 1SE4A 1V1OA 3SK5A 2EVBA 1GUNA 4G4KA 3TP8A 1SAPA 1QILA 1SJED 1SNOA 2L4NA 3GTPB 1HCZA 4X3SA 3BZDB 1AZPA 4OO1I 2A5HA 2WKDA 4UDUC 5M5XB 5IGDA 1WTWA 2JA5B 2ENBA 3SEBA 3SK6A 4C3HG 3OSOA 3L3OC 4A3BB 2DN8A 3NWTA 4LMQD 4RA8A 2EOTA 4NMZA 1BR9A 3DWQA 2J0TD 2JA7B 4DN4M 2JEBI 2RKSA 3R93A 1LT3D 2VB2X 3D31A 1F2YA 4KKTA 3QOJA 5J1ZA 1LT4D 2F0VA 1O78A 3WOEA 2WKCA 1Q1EA 1HTPA 5M3FB 3X3NA 3K5NA 2KUMA 2B8GA 1PRTD 2ICIA 2X6GA 4G57A 1S5FD 1SDFA 1I6VC 3KF8A 1DYQA 3HOWB 1EYCA 1HUNA 1W6KA 1NCVA 5KGUA 4KV6A 4ZKBB 3M3YB 1B44D 1B50A 4CKEA 4DF7A 3P1HA 4A3JB 5COYA 2JXMB 5IIFA 1PRTF 5K36H 2B8FA 5AFWA 5FK9C 4BBRB 3SE0A 1JORA 2EDGA 5CGKA 4UAIA 1PTOC 3OWFA 3VYUA 1AFPA 2KECA 4FNFA 1NR2A 3P7JA 4TSSA 1SYCA 2PO4A 4CGYB 4ZUIA 4BY7B 4DFAA 4C3IB 1I4QA 4FXGC 3C1FA 1JQYD 4KY6A 2HCCA 3S16B 1DONA 2B2YC 2PQEA 4E6IA 5FKAC 3R2IA 2VNUD 3D6WA 2KA7A 3K5MA 4U68A 3DWAA 1Y8NB 5G3LD 3BVZA 1S5ED 1TIID 1EY8A 1I6HB 4S3SA 2RSOA 1SNMA 4YIJA 2SNSA 2XVSA 1BXTA 3IFDA 4FXKC 5CBEE 2O2LD 5JOBA 3BG3A 1A3VA 1H9RA 2WP8J 3DUZA 1EU4A 3E5SA 1Y8OB 3FRPB 2PPBC 5I9PA 3M85A 1RCVD 1Q8IA 3OIPA 1A3UA 5JEAH 3LX0A 3RMHA 1HA5A 3CU7A 2B2TA 1LTAD 2Z4HA 1MSHA 4IALA 1SE3A 3C1EA 4M8AA 2IJ0A 4LJZC 2K04A 2CW0D 3ITPA 5EGTA 3NQIA 5J39A 1RODA 3P20A 4QUCA 3VR5A 2IX0A 4ZRZA 2Q8RE 1OXUA 3A7AB 2EYFA 3OW7A 2BA0A 1RF2D 3NTHA 3WOFA 1BCPF 5IOCA 5KEEA 4A3EB 1A2UA 2F3VA 5C4ZA 3M4OB 3TBIB 2PW7A 2F0LA 1IHZA 3TMEA 4IFDH 2QF7A 3FPUB 5IGCA 5C3EB 3I3CA 1NSNS 2XIWA 1X3QA 3HOZB 3PO2B 1LTID 4J6HA 2KCNA 2F0EA 3K5LA 5EKKA 4A3FB 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGE A;  4PNY A;  5C4H A;  2NUC A;  5J22 A;  3HZX A;  5JOB A;  3BDC A;  4J1M A;  5IGG A;  2OEO A;  4R8N A;  1SYB A;  2F0I A;  1A3V A;  3BDL A;  4QMG A;  4G57 A;  1STH A;  5CV5 A;  5C3W A;  1SNP A;  3PMF A;  3P75 A;  4HMJ A;  3SK8 A;  1SYG A;  1EZ8 A;  3QOL A;  3SHL A;  2EYJ A;  5C5M A;  2F0W A;  3SR1 A;  5E1F A;  3NK9 A;  1EQV A;  5C5L A;  5JAV A;  3E5S A;  1EY4 A;  1EYC A;  1SYE A;  3D4W A;  4ME5 A;  2PZU A;  3OMC A;  4H7B A;  4PMB A;  4EQN A;  5IGF A;  4WRD A;  3NUC A;  5KGU A;  5CV9 A;  3V2T A;  5I9P A;  2EY5 A;  5KYI A;  3QB3 A;  4KV6 A;  1ENC A;  3D6C A;  2F0H A;  4NDX A;  4KY5 A;  1EY6 A;  2F0D A;  3ERQ A;  4K5X A;  3MXP A;  1STN A;  2OXP A;  4RKB A;  4NKL A;  4PMC A;  3VA5 A;  5C3X A;  1A3U A;  4DF7 A;  3P1H A;  3R3O A;  5F2D A;  4RKL A;  5DAU A;  3LX0 A;  5IIF A;  3HEJ A;  5DEH A;  2F0Q A;  1STB A;  3MZ5 A;  3SK5 A;  2F0U A;  4HTH A;  5CV6 A;  5ISR A;  4KY7 A;  2F0T A;  3TP8 A;  1II3 A;  3MHB A;  5E3F A;  4KD3 A;  2SOB A;  2F0P A;  1SNO A;  2F3W A;  2O4X A;  2HQE A;  4DGZ A;  4KD4 A;  4ZQ3 A;  2RBM A;  5KYL A;  1JOR A;  1KAA A;  3OMG A;  5EKL A;  2F0K A;  3MVV A;  3T13 A;  4DU9 A;  2SNS A;  5CGK A;  4KJO A;  3T16 A;  1RKN A;  2EY1 A;  1SYF A;  4B9X A;  4IAL A;  1SYD A;  2EYH A;  2F0M A;  4MIU A;  3C1E A;  1TT2 A;  2LKV A;  4N9T A;  2OF1 A;  3TP7 A;  5K5P A;  4K14 A;  1KDB A;  3ITP A;  5I9O A;  2EYP A;  3OWF A;  5EGT A;  5M9O A;  1EY9 A;  4KJN A;  1EZ6 A;  3EVQ A;  2F0N A;  1STG A;  2EYL A;  5J39 A;  3D8G A;  4ODG A;  5HGT A;  1U9R A;  3EJI A;  4QF4 A;  2EY6 A;  4K6D A;  1SNQ A;  4I65 A;  5IGD A;  1SYC A;  2ENB A;  1EY0 A;  1EY5 A;  5CV7 A;  4ZUI A;  5I6Y A;  3SK6 A;  1A2T A;  2WAC A;  4DFA A;  3OSO A;  4K8I A;  2EYF A;  2F0O A;  3ERO A;  4IZ8 A;  3S9W A;  2EYM A;  2F0G A;  2PYK A;  4K2K A;  4F8M A;  5IGB A;  3C1F A;  4KY6 A;  3U9O A;  1EY7 A;  4WOR A;  1KDA A;  4ZUJ A;  4B9W A;  1EYD A;  2PW5 A;  3TP6 A;  2F0J A;  3MEH A;  3TP5 A;  3H6M A;  2PQE A;  1F2Z A;  3DMU A;  4NMZ A;  4E6I A;  5NUC A;  5IOC A;  5KEE A;  4K8J A;  2EXZ A;  2PZT A;  5C6A A;  3SXH A;  1STY A;  1A2U A;  5CV8 A;  4EQO A;  1STA A;  5KRU A;  2F3V A;  4IUN A;  1KAB A;  2F0F A;  5C4Z A;  3D4D A;  2F0S A;  5KIX A;  1A3T A;  1JOK A;  1KDC A;  2M00 A;  4EQP A;  5IOD A;  1EYA A;  4K2L A;  2PZW A;  2PW7 A;  1TR5 A;  2EYO A;  4QB4 A;  4NP5 A;  3NXW A;  2RDF A;  2F0L A;  3DHQ A;  4KTA A;  1IHZ A;  4LAA A;  4K5W A;  2SNM A;  3TME A;  1AEX A;  1JOO A;  2KQ3 A;  2RKS A;  4N9P A;  5CR3 A;  5CC4 A;  3SK4 A;  3NP8 A;  4OL7 A;  5I6W A;  4TRD A;  1ENA A;  4KHV A;  5IGC A;  1EY8 A;  1NSN S;  4ID6 A;  4S3S A;  1F2Y A;  4HMI A;  3RUZ A;  2EY2 A;  3QOJ A;  5J1Z A;  4EVO A;  2F0V A;  4J6H A;  1SNM A;  3NQT A;  1SNC A;  1TQO A;  2F0E A;  2KHS A;  1SND A;  2QDB A;  3NHH A;  4K5V A;  5CV4 A;  4YIJ A;  4F7X A;  5EKK A;  5HUR A;  1F2M A;  1JOQ A;  1NUC A; 
#chains in the Genus database with same CATH topology
 4QJF A;  1EEF D;  5FLM G;  3AFQ A;  2OEO A;  4PZ8 A;  1TWG H;  2LS0 1;  4X3K A;  2B63 G;  4RGO S;  3EA6 A;  5C4X G;  3H0G B;  1W2B A;  1EQV A;  5KRU A;  1N9W A;  3D4W A;  4PMB A;  5BN5 A;  1EIY B;  2ZM6 L;  1YI2 A;  3BJU A;  4DV7 L;  1CA6 A;  1WOC A;  3D6C A;  1CQV A;  1EY6 A;  4RKB A;  1U5K A;  1EYG A;  2IX1 A;  1K0S A;  1B1Z A;  4JI0 L;  3A8K E;  4AYB G;  2IX3 A;  4H13 C;  2C5C A;  3RD4 A;  1SLJ A;  2ZXO A;  2JA7 H;  3PIP 3;  3NSW A;  4L5Q A;  1PLF A;  3ER0 A;  4YHH L;  3M7G A;  1I4G A;  1B8A A;  1X3P A;  5E3F A;  4KD3 A;  4BS9 A;  2SDF A;  4DAY A;  1KAA A;  5EKL A;  1JJG A;  3L7Z C;  4JI1 L;  4KJO A;  1XX8 A;  3VR4 A;  1RKN A;  5EPL A;  3KJO A;  1Y1V H;  4IJL A;  1SMX A;  3KK7 A;  3HOX H;  3KLR A;  1WTR A;  2RCN A;  4IUP A;  1Z7T A;  4DR4 Q;  1WVL A;  1AN8 A;  4LWC A;  4IPG A;  4IPC A;  1HNX L;  2Z8L A;  1KRS A;  4ALP A;  1L1O C;  2MHV A;  4UY8 C;  1PH4 A;  4DAP A;  2JA8 H;  1I50 B;  4OON A;  5A35 A;  4X65 L;  3K59 A;  2UUA Q;  2ASB A;  1EWC A;  3TRZ A;  1RD9 D;  3M3Y H;  1DOL A;  2V4D A;  1IBK Q;  1GUG A;  3DMU A;  2KVM A;  2OCE A;  2WV6 D;  4K8J A;  1F9S A;  1BKB A;  3FVQ A;  1B9M A;  5BR8 L;  3B6Y A;  2K6A A;  2VXW A;  1LV9 A;  4DV6 L;  3RLF A;  1HUM A;  1TR5 A;  5AJ3 L;  1WD0 A;  1BUV T;  3URY A;  1CKO A;  4BBR H;  1KC8 C;  2IHF A;  1JWM D;  3E6Z X;  3KDF A;  1LLR D;  1TY2 A;  4OL7 A;  5I6W A;  4HR7 B;  4TRD A;  3TRE A;  3E0J A;  3L2P A;  3FDT A;  2M9V A;  1A0I A;  3UDF A;  1QUQ B;  3GV3 A;  4JG2 A;  1KIX A;  2XWB B;  1TQO A;  3NHH A;  2YU9 B;  4K5V A;  1D6E C;  2DJG C;  2E2I B;  4LF4 Q;  2CH4 W;  4RG1 A;  1JOQ A;  2CW0 C;  1E7Z A;  5J22 A;  5JJI A;  4NXN L;  2R93 G;  4R8N A;  2NVT B;  1PH9 A;  4C3J G;  5JJL A;  4BY7 H;  3IRB A;  2KOL A;  1BO0 A;  2C9O A;  2OQ0 A;  1RTO A;  1N33 L;  2F0W A;  1XMQ L;  4LFA L;  2CQO A;  4DR1 Q;  5D65 A;  3U50 C;  1U4L A;  5IGF A;  4POF A;  2MUY A;  1I94 Q;  3E9H A;  1XPO A;  2NBF A;  1SBB B;  1J5E Q;  3DLL A;  2N78 A;  1PMR A;  1KD1 C;  4UP7 A;  1QVC A;  5T1G A;  3WDN A;  2F0U A;  1VS0 A;  2OT2 A;  4LNQ A;  2L12 A;  3GTM B;  3LNN A;  2GVA A;  2HQE A;  1WCM G;  4KD4 A;  1UNS A;  3VR3 A;  2FHT A;  2F0K A;  1DZ1 A;  1B70 B;  3J7A 5;  1UWV A;  1T5X D;  4LFC L;  3LGJ A;  4C56 C;  3CPF A;  1PYS B;  5JEA J;  2R7Z G;  3MXU A;  4QGU A;  3OPO A;  2M2L A;  1VQK A;  3D8G A;  2FIN B;  1BF4 A;  1QJO A;  1PH1 A;  1B4O A;  2EY6 A;  2VQE Q;  4FF2 A;  2IY5 B;  4DXG A;  5C0X I;  2A19 A;  2JJQ A;  3DEP A;  2VQF L;  3HKS A;  3CRK C;  3MXG A;  4DR2 L;  3I8Z A;  2N8N A;  5DNF A;  4DK1 A;  1SXT A;  2HDM A;  2F0O A;  3T1Y L;  1I4R A;  5IGB A;  2K5D A;  3U9O A;  4IUQ A;  1VQ7 A;  4DNR B;  4DUY L;  4ZLT F;  3TP5 A;  1IW7 D;  3H6M A;  1CM9 A;  3BVM A;  3RR5 A;  4V0B A;  2LMC B;  4Q0F A;  1RDP D;  4J8Q A;  3J81 E;  1HNZ Q;  5E4X A;  4A3C H;  3J81 L;  1QB5 D;  1WYD A;  3KLW A;  4FF3 A;  4N9P A;  3GDE A;  2OTJ A;  3NP8 A;  4DR3 Q;  4IN3 A;  2E2H H;  1YNN D;  2LFN A;  5AJ3 Q;  3CMA A;  3W5O A;  1HQR D;  3K8A A;  2KBN A;  3GTQ B;  2NN6 G;  4XT3 B;  1ENF A;  2XN9 C;  2KCC A;  2WB1 G;  1CZG A;  5BN4 A;  2I5L X;  2PQA B;  2JA5 G;  5IGG A;  3RZD B;  4A3B G;  4IFD J;  5JVG 3;  4QIW B;  1XTC D;  1TXY A;  3U58 A;  1GHJ A;  3S2H B;  4JVZ A;  5FJ8 G;  5C5L A;  5JAV A;  2EJG C;  1YHB A;  4A3K H;  4EQN A;  1LAC A;  1TS3 A;  1ASZ A;  1ENC A;  4A3E H;  2E74 C;  4GN4 B;  2B39 A;  2H4O A;  5LMU L;  2RF4 A;  2I07 B;  4ULL A;  2UXB L;  1SE2 A;  1XMQ Q;  3M4O H;  3HFZ B;  1EIH A;  3M4Y A;  5DAU A;  3U4Z A;  5DM7 3;  5FO8 B;  2F0Q A;  3UE0 A;  2A6E D;  3HG9 A;  1OXT A;  3J81 c;  1W3S A;  1Y14 B;  3A74 A;  2HDL A;  5C3E H;  1MD2 D;  3T13 A;  3FKI G;  4BA2 I;  3AB9 A;  1CI3 M;  4H44 C;  5M3F G;  2L5T A;  4KN4 C;  3T1H Q;  4A3F H;  2EYP A;  4JI8 Q;  3M9B A;  2AHO B;  2HUG A;  2XSC A;  1STG A;  4DK0 A;  2EYL A;  1AW7 A;  3OW2 A;  4JI6 L;  3H09 A;  2K50 A;  1E0B A;  1S5D D;  3K58 A;  4BA1 I;  1QVG A;  3HOW G;  4JW0 A;  4WJ4 A;  3TDQ A;  2VUM B;  3H0G H;  4JOI C;  4OIK A;  2N55 A;  3S1R B;  2EYM A;  5IYC G;  4JI3 Q;  1YJW A;  2QEJ C;  3RZO B;  3H3V I;  4A3D H;  4B9W A;  3K7A B;  2ES2 A;  3MA2 B;  2IL8 A;  1IKM A;  1WTH A;  4A3J G;  2RVL A;  2F4V Q;  4DR2 Q;  3S15 H;  4QIW E;  2QA4 A;  1E3P A;  2NVY B;  4LUZ A;  2NZ1 D;  2F0S A;  3D0F A;  1Q12 A;  1E1T A;  2L55 A;  1PH7 A;  1XNR Q;  1TWG B;  1A6X A;  4JI2 Q;  1TS5 A;  3FPP A;  3OTO Q;  1K8A C;  1KQS A;  1CT1 D;  1M4V A;  4YWK A;  2EY2 A;  4EVO A;  1XWE A;  1CZW A;  2NVX B;  2EE1 A;  2K1B A;  4RMF A;  1B7Y B;  1MHW C;  1O7Z A;  1D5X C;  1VCI A;  3VYT A;  2F1M A;  2NUC A;  1Q90 A;  3NTK A;  2A74 C;  2E76 C;  4J1M A;  4PZ7 A;  4O1N A;  3I4N G;  1CTM A;  1VQA A;  2F0I A;  4QY7 A;  1G2S A;  2PI2 A;  1K0R A;  3I73 A;  1J8I A;  4C3I G;  3RN2 A;  3SK8 A;  5JPN C;  1G2T A;  1RTN A;  4YCV A;  3OWE B;  1DJR D;  1U4M A;  4H7B A;  1EWI A;  3T56 B;  2G9H D;  4KK7 A;  1QUQ A;  1UUP A;  1NAP A;  1JB3 A;  4ZYS A;  2F0D A;  2XRS D;  1Y1V B;  4PMC A;  3SDZ A;  3HOX B;  4LK1 C;  4A3I B;  1G8Z D;  1SEB D;  2ALY B;  4Y52 H;  1JR0 D;  3ND8 A;  4L5R C;  1PDQ A;  1UE6 A;  4L5T A;  1II3 A;  3CRL C;  2HD3 A;  1ZXT A;  4X62 L;  1I4H A;  2JA8 B;  3PUW A;  1ET9 A;  3T16 A;  2JYO A;  2MO0 A;  4DV0 Q;  2HHH Q;  2YU9 H;  2KCM A;  4IQZ A;  2EJM A;  3KBG A;  2QDL A;  3CPW A;  1YNN C;  5HGT A;  3NEM A;  2BCO A;  4XQQ A;  5BN3 A;  1HXY D;  3VR6 A;  4I65 A;  1N34 L;  1JWS D;  4P73 A;  2PMZ E;  3ND9 A;  3OHX C;  2E8G A;  4BBS H;  4GNX B;  3UDI A;  2AQ1 B;  1QVF A;  4WOR A;  5JJK A;  5GQO A;  3MEH A;  1LTS D;  3QG1 A;  5NUC A;  2EXZ A;  3RNU A;  2DNE A;  1S5B D;  4DUZ Q;  4QCL A;  1KDC A;  3KOJ A;  1K73 C;  4EQP A;  3BVG A;  5HY6 A;  2R3Z A;  1KRT A;  3QO2 A;  1FGU A;  1JMC A;  3NPP A;  1PFS A;  1VQC A;  4JI5 Q;  4KTA A;  2FXQ A;  2A6E C;  1HR0 W;  4IOA A;  1UEA B;  3SK4 A;  1XNQ Q;  1ILQ A;  4DV2 L;  1L2F A;  4HCE A;  5D3D A;  1LUZ A;  4HMI A;  2P5Z X;  2UUB Q;  1EEI D;  5EKI A;  3QWN A;  5EPK A;  2BA1 A;  4HSP A;  1GKH A;  4DV4 L;  4DA2 A;  3MXN B;  4IUV A;  1AP0 A;  2AUK A;  1S4Z A;  2B2V A;  3K0Y A;  4A3M H;  1QCB D;  4B3R L;  5M5Y B;  3DWP A;  4G7O C;  1A63 A;  2DGY A;  3PMF A;  4M1U B;  3SHL A;  5EPJ A;  5C5M A;  4XXE A;  1GHK A;  3MWY W;  2CQA A;  4YY3 L;  2WAQ B;  3A8I E;  1HNW L;  1HPC A;  3HOY G;  3AMU A;  1ESF A;  3BZC A;  3VA5 A;  5C0X H;  3HP3 A;  4RGN A;  1P8L A;  5F2D A;  1X55 A;  4XT1 B;  5GAH C;  1OXX K;  2AQ2 B;  2D5D A;  1ZKO A;  1YJ9 A;  1SE8 A;  2UXC Q;  2B2T C;  3MHB A;  2Y0S G;  5IYB H;  5LMN W;  3HOZ G;  4PQX A;  3PO2 G;  3MVV A;  4POG A;  3DEO A;  1I4P A;  3JAM i;  4HSV A;  1SYD A;  2A73 B;  4HED A;  4N9T A;  4GKK Q;  1TT2 A;  1VQD A;  3HOU G;  1U4P A;  1PTO H;  1D1K A;  5I9O A;  2DY7 A;  2Z1C A;  1R4Q B;  3HKZ B;  1R4P B;  1U9R A;  4RCO A;  1WTV A;  4QUF A;  4LF9 Q;  4RCN A;  1ET6 A;  3PO3 B;  5CV7 A;  2BDN A;  2WAC A;  3H3V C;  1EFW A;  3S2H H;  3SVM A;  4IJH A;  2CWP A;  2JK8 A;  1Q8K A;  3S24 A;  3FEW X;  3EIV A;  1BCP D;  3CKI B;  1YNX A;  1EYD A;  4JYA Q;  1I3Q B;  3J80 i;  2E2H B;  2N88 A;  2K7V A;  5C6A A;  4I7A A;  4L5S A;  5CV8 A;  2B3G A;  4EQO A;  4JI4 L;  1IYU A;  2MPM A;  1DXM A;  5EBC A;  4B3M Q;  1X3E A;  1NR4 A;  3QJY A;  1O7I A;  4OXP A;  1PRT C;  3NTI A;  2JA6 G;  1AEX A;  5D3I B;  1FNV A;  1B3Q A;  1VQJ A;  4GOP C;  3TEH B;  3VDY A;  1M8A A;  2O5J C;  3RUZ A;  1Y1W G;  4A3K B;  4DAM A;  3PSI A;  1C4Q A;  4LF8 L;  3CP0 A;  3OOC A;  5HUR A;  1NUC A;  2RHS B;  4PMW A;  1LO5 D;  3PIO A;  4B3T L;  5IP9 H;  1BQQ T;  4DXF A;  2WFW A;  1XXG A;  4DV2 Q;  4CJ1 B;  4IOC A;  4QMG A;  1AE2 A;  3S1R H;  3A55 A;  1WFQ A;  2FMC A;  1VQL A;  5E1F A;  4LF6 Q;  3NK9 A;  3RZO H;  1IKL A;  1SYE A;  5M5W H;  3HKZ E;  3K7A H;  2ZT9 C;  1KXL A;  3NUC A;  1OO9 B;  1PYB A;  4TQU S;  2F03 A;  3NBI A;  1MSG A;  1BNZ A;  5C3X A;  1HHV A;  3CAM A;  2UXD Q;  4PZ6 A;  3HEJ A;  4FO2 A;  1CQF A;  1VQG A;  3PUY A;  5KNC A;  4XYQ A;  1V8Q A;  2PCF B;  5FO9 B;  5M3M G;  2SOB A;  2NTS A;  2YYZ A;  3ONA B;  3NWS A;  1NNX A;  3ICE A;  1JE4 A;  4LF5 L;  3VYR A;  1OXV A;  1EQT A;  4OO1 H;  2NVX H;  4L63 B;  4A3D B;  4DK6 C;  3KJP A;  1HR0 L;  1K3R A;  3NBH A;  1F2L A;  3K6O A;  1Q7Y C;  4FF4 A;  2UUC Q;  2E5L L;  3S1Q B;  4ODG A;  2A68 D;  2H1E A;  3S15 B;  1TWH H;  3PF4 A;  2Q8T A;  3A5U A;  2GA4 B;  1YJN A;  1TWA B;  4RAU C;  5K36 G;  1A15 A;  2OWO A;  5KNB A;  3GTJ B;  4IZ8 A;  2KED A;  3S9W A;  1BDO A;  2EPB A;  2XGT A;  1HFN A;  2X69 A;  5I2Y A;  2MJ8 A;  2F0J A;  4CBV A;  1DM0 B;  5DM6 3;  3JC6 6;  4IPD A;  3KUP A;  3IAY A;  4KHP L;  3M4Q A;  3I91 A;  3F2D A;  3TSS A;  4A3I H;  3G48 A;  4IUN A;  3G71 A;  1CKN A;  1AE3 A;  1GD7 A;  5ELB A;  1L0X B;  4LW1 A;  4BXX G;  3K80 C;  1NBW A;  3LWU A;  1TKW B;  3ZYY X;  1F9P A;  2GVB A;  4GNX A;  3DHQ A;  2DNC A;  4DV1 L;  1KTK A;  1C9O A;  1JWU D;  2RA4 A;  3ULL A;  4G7Z C;  1MIU A;  1NMG A;  4R4O A;  2A69 D;  4ZK9 B;  3HGB A;  3J7Z C;  2NYZ D;  1UE1 A;  2J7Z A;  4A93 G;  1EQR A;  2KHS A;  5CV4 A;  5LMN L;  4DR6 Q;  4P75 A;  4DV5 L;  5EQ0 A;  4AQY Q;  1TWF B;  4A3L G;  1N36 L;  5IP7 H;  1TU2 B;  2KHJ A;  1MBY A;  4R1J A;  1QE6 A;  4RFB A;  2WIN B;  2IPK D;  2ZJR A;  4R4Q A;  4KKU A;  2J4X A;  1SYG A;  4TVA B;  3A56 A;  4AH6 A;  4PG3 A;  3CC4 A;  3C2P A;  4DK3 C;  2AQ3 B;  1NMF A;  3QB3 A;  1B9N A;  1BCP C;  4KY5 A;  3H15 A;  2CVR A;  4GKJ L;  5IY0 A;  2FFK B;  4RHR A;  3I70 A;  4IUU A;  1X3F A;  1VF7 A;  1LT5 D;  5FOB B;  2AKW B;  3H94 A;  2CKZ B;  1O7Y A;  3CCQ A;  4C3H H;  1GUS A;  3IKJ A;  2SEB D;  2L0C A;  2F3W A;  4X3T A;  3F8T A;  4BBS B;  3STB D;  5KYL A;  1G6P A;  2LXK A;  3PF5 A;  3JAM E;  2OQK A;  4ME3 A;  4GLA C;  2F0M A;  1HQM C;  1LTL A;  3I2Z A;  4MIU A;  4MTN A;  4C2M H;  3JAM L;  5C0X J;  1KLG D;  2B2U A;  4K14 A;  4FF1 A;  4JI7 L;  3ULJ A;  2C35 B;  5M9O A;  3PGZ A;  1EY9 A;  5JEA G;  1IL2 A;  3Q6S A;  5JVH 3;  3AEV A;  3EJI A;  5C4J B;  4QF4 A;  1VF5 C;  5M5Y H;  3J7A V;  2QIL A;  1VMP A;  1EY0 A;  2D62 A;  2B2W A;  2ZM6 Q;  4JK1 C;  4DV7 Q;  2VZA A;  5ELC A;  4BY1 G;  3KF8 B;  2WII B;  1D8L A;  2RHQ B;  1TWC B;  4GN3 B;  2K05 A;  1BBU A;  3TN2 A;  1XPR A;  3J80 E;  4JI0 Q;  2LY7 A;  4ZUJ A;  2IWH A;  3CCM A;  3Q0A A;  4RWS C;  1RL2 A;  3LWE A;  3TZU A;  2IW3 A;  4YHH Q;  2K32 A;  4NPS A;  4DV3 L;  1CKM A;  1STA A;  1T5E A;  2HT1 A;  4WJW A;  2K28 A;  4HN7 A;  2B29 A;  3TS0 A;  3I4M H;  5IOD A;  2PZW A;  4IUT A;  5CMD A;  4JI1 Q;  4O42 A;  2RDF A;  2AUJ D;  1S5C D;  4OHJ A;  4A3M B;  2LSS A;  1E24 A;  4KHP Q;  1PFM A;  4EGV A;  2EZV A;  3GTO B;  1CK1 A;  2MP1 A;  4KHV A;  4DPG A;  1HNX Q;  4CJ0 B;  1YEZ A;  3X3M A;  3NQT A;  3CQZ H;  4F7X A;  2EIF A;  4I7Z C;  3JAM c;  3G6E A;  4JBJ A;  4PNY A;  4A75 A;  2A68 C;  1VQI A;  1RJT A;  1C8C A;  4K0K L;  4X65 Q;  2VUM G;  3PO3 H;  5GAD C;  1Z6H A;  2BE5 D;  1W6J A;  5TSS A;  3PCO B;  4UP9 A;  2FMM A;  2QKI C;  3MEF A;  4IFD G;  1KLU D;  2QW7 A;  1EQQ A;  2ZXP A;  1E22 A;  2KJX A;  1I3Q H;  1SMY D;  5BR8 Q;  4WRD A;  1N36 Q;  4DV6 Q;  3M4P A;  1FR3 A;  5ELN A;  3MXP A;  2AWO A;  4NKL A;  1PTO B;  4X66 L;  3J80 c;  1H9S B;  5H1S E;  1D5M C;  2NVQ B;  3IFT A;  1UAP A;  1YZ6 A;  4OIJ A;  1V1P B;  1YNJ D;  5CV6 A;  2I5M X;  1EL0 A;  1JIC A;  1PXU A;  3CW2 C;  3IL8 A;  4NW2 A;  1Y8P B;  4OGQ C;  1PV4 A;  1TS4 A;  3OMG A;  1SRU A;  4GKJ Q;  2D0O A;  3MC0 B;  2EYH A;  4NXN Q;  3KBX A;  1KDB A;  4LF7 L;  1CHP D;  3H91 A;  5T1I A;  2JA7 G;  1N33 Q;  2JSO A;  3N52 A;  4LFA Q;  1VQ8 A;  4F88 A;  1STE A;  2Q2H A;  1EY5 A;  3NEL A;  1WTO A;  4K8I A;  3V96 A;  2ZJP A;  1KNA A;  1QWY A;  5C44 H;  4DR7 L;  1EY7 A;  1VQB A;  3F2U A;  3TP6 A;  1Y1V G;  3I7F A;  3VYS A;  3HOX G;  1OTC A;  3MFY A;  4A3G H;  1TVX A;  2HIX A;  1STY A;  1JT8 A;  3R2T A;  2F0F A;  4RGT A;  3A54 A;  2MNA A;  1EYA A;  2I0Q A;  5D14 A;  3BU2 A;  1VQE A;  3I56 A;  1WD1 A;  4V19 0;  2K4K A;  4LFC Q;  1QNU A;  2JA8 G;  3TZD A;  1JOO A;  4KN7 C;  5CR3 A;  2Z6K A;  4A4I A;  1QOH A;  1ENA A;  3STB C;  5M5W B;  3ULP A;  2K5W A;  2O5I C;  1QG7 A;  1MI2 A;  1AH9 A;  2JN4 A;  2VQF Q;  3S1Q H;  2R6G A;  3GD7 A;  1F2M A;  1R9T H;  3HS0 C;  3GV6 A;  5IGE A;  4L8J A;  4BWG B;  3Q24 A;  1TWA H;  2VL6 A;  3T1Y Q;  5GRO A;  1CSP A;  2NN6 I;  2JQO A;  4RH6 A;  4BBR G;  1D7Q A;  2R92 H;  4DUY Q;  3P75 A;  3GTJ H;  1VQ6 A;  2R7D A;  1EU3 A;  3QOL A;  3C46 A;  1LM0 A;  1EOT A;  3PUV A;  2PZU A;  1XJV A;  1JB7 A;  2PMZ B;  2XNA C;  3CCV A;  4NDX A;  1KNE A;  2BH8 A;  2L15 A;  1JE5 A;  3R8B A;  4NXM L;  2ZXR A;  3MTS A;  4IPH A;  3J7Y W;  1PH5 A;  2WB1 B;  1TWH B;  3CME A;  2E2D C;  2DJF C;  3ZJY C;  4HTH A;  5CYU A;  4BY7 G;  4KY7 A;  4KKS A;  3L9A X;  5IYD H;  3BYT B;  3A0J A;  4Y7N B;  5EBD A;  1PRT B;  3S17 B;  2UU9 L;  1G29 1;  4TKO B;  4DGZ A;  3CCU A;  2RBM A;  1NJI C;  4WJ3 M;  4GOP B;  1HFG A;  4XYO A;  2EY1 A;  1Y1W H;  1PH2 A;  4CJ2 C;  2D9U A;  4KJN A;  1EZ6 A;  1TWF H;  3EVQ A;  1IZ6 A;  5COR A;  1IW7 C;  1CHQ D;  2IHE A;  3O13 A;  2ATW A;  2ZTC A;  3HOV H;  4X64 L;  1HTL D;  4HIK A;  1V9P A;  1D1I A;  1L0W A;  3PIP A;  3RN5 A;  3I4L A;  2BE5 C;  4XTC S;  1O7L A;  2HCI A;  1U4R A;  2WAQ G;  2CHB D;  1IL8 A;  5LMU Q;  2Q2U A;  4FVM A;  2UXB Q;  1OXS C;  3AYH B;  3E0E A;  2PW5 A;  3FKI B;  1LTB D;  1PVO A;  3G4S A;  5CBA E;  1SMY C;  2A8V A;  1PFN A;  2PZT A;  1EWH A;  1EUJ A;  1E1O A;  2ID0 A;  1JJ2 A;  4G7H C;  2Z0S A;  1WJJ A;  1KAB A;  2MQH A;  5KIX A;  1JOK A;  2BOS A;  4DR5 L;  5FLM H;  1TY0 A;  4OX9 L;  1B2T A;  4N8X 1;  4JV5 L;  4UHV A;  4NP5 A;  1MGS A;  2B63 H;  1YNJ C;  1HZ9 A;  2KQ3 A;  3AU7 A;  2DUD A;  5C4X H;  4XIG S;  5CC4 A;  5IWA L;  4JI6 Q;  1DOM A;  1VQO A;  2WB1 E;  4KLK A;  1F9R A;  1SND A;  3S1N H;  5C4J H;  3J7A F;  2XTI A;  2YTY A;  5I4D A;  2JEA I;  4P72 A;  4A3C G;  2B2V C;  1GJX A;  5HGQ A;  1MJC A;  3CCS A;  4C1N K;  5CV5 A;  5C3W A;  2VB3 X;  4HAE A;  4L6T B;  1EZ8 A;  2EYJ A;  1TWC H;  2K5N A;  2N49 A;  4C1N I;  4KI0 A;  1L0Y B;  2LXJ A;  4C3H B;  4HJ9 A;  5EAY A;  2FJ2 A;  1CSQ A;  1NTG A;  1Z9F A;  3OIQ A;  2NWG A;  4KHZ A;  2D0P A;  2PNR C;  3VR2 A;  4LFB L;  3W2D A;  2F0H A;  4X3U A;  2K33 A;  1U0L A;  3D3R A;  1STN A;  4C2M B;  2MO1 A;  2AWN A;  1YBY A;  3R3O A;  2JP1 A;  1SFO H;  1VQ4 A;  3S1M B;  1STB A;  3I4N B;  3BZK A;  2F0T A;  4CKB A;  3W3A A;  1L1O B;  4YWL A;  2CH4 A;  3KDF B;  3GTO H;  4A3K G;  3RLO A;  4DU9 A;  1Y69 U;  4YWM A;  4B9X A;  1SYF A;  2KHI A;  4A3E G;  1EFI D;  1BBX C;  1XMO L;  1SR3 A;  2K5V A;  4A76 A;  1XTD A;  1H9S A;  2PQA A;  2R61 A;  2R7F A;  1IBM L;  4RGM A;  2I46 A;  1HH2 P;  1V1P A;  3I4M B;  3T53 B;  1QZH A;  3MFG A;  1H9K A;  5C3E G;  1ONL A;  1ESR A;  2F0G A;  1KDA A;  1Z47 A;  5E7N A;  3K0X A;  1HZC A;  4EQ5 A;  4A3F G;  2B2Y A;  3HRZ C;  1BCP B;  5JPM C;  4FXD A;  1FYC A;  3DXJ C;  3CQZ B;  1GUO A;  2NVQ H;  4HCS A;  4X62 Q;  3FMC A;  3N6R A;  3FP9 A;  4K2L A;  2R93 H;  2EYO A;  1YIJ A;  2TMP A;  1K3B C;  2RDH A;  4C3J H;  3H0G G;  5KND A;  4K5W A;  4OEM B;  2SNM A;  1QNK A;  4A3D G;  1TS2 A;  1Q1B A;  2AMC B;  5G3L F;  3CD6 A;  2GN5 A;  4B08 A;  3CCL A;  3EFX D;  1N34 Q;  2QDB A;  3Q22 A;  5ELF A;  1FVI A;  2RSN A;  4WFN 3;  2KEE A;  3HZX A;  1JCK B;  2NTT A;  3BDC A;  1DD2 A;  2OTL A;  1EIG A;  1I4X A;  3S14 B;  1STH A;  1PZJ D;  2D2C C;  4Q5V A;  4PV1 C;  4DR4 L;  1K8G A;  1K83 H;  3TS2 A;  4DNT B;  1WCM H;  1V43 A;  3PUZ A;  1B53 A;  1VMC A;  4CKC A;  3ERQ A;  4K5X A;  1LTT D;  1X9N A;  4YCU A;  2R7Z H;  2UUA L;  2KEN A;  3QR8 A;  1EOV A;  4XDX A;  4H02 A;  1IBK L;  4JBK A;  1ZEQ X;  5A2Q E;  2O4X A;  1PFB A;  5A2Q L;  4Z9C B;  3GTL B;  2Q2T A;  4DV4 Q;  2YV5 A;  4DNI A;  5C44 B;  2K14 A;  4JCV E;  1CA5 A;  1B3A A;  4B3R Q;  2X6L A;  3HOY B;  1F9Q A;  3PV0 A;  2F0N A;  4HIM A;  1A8V A;  4A3G B;  1K28 A;  3A5Z B;  4UP8 A;  4JC0 A;  3GO5 A;  1K8M A;  3CC7 A;  1GUW A;  1DCZ A;  4YY3 Q;  4LF4 L;  1HNW Q;  2VS1 A;  5DLQ E;  4APV A;  2JE6 I;  1XMO Q;  3GTP H;  3H3V H;  3DM1 A;  2Y0S B;  3FHW A;  3BDO A;  1SJH D;  1J9O A;  1KAW A;  1NE3 A;  1X65 A;  2EXD A;  5M5X H;  4DR1 L;  3HOU B;  2NN6 H;  3SXH A;  5ELD A;  1ZYR D;  1WTX A;  2QGQ A;  3NE5 B;  5ELE A;  1I94 L;  1R9T B;  1A3T A;  2JA5 H;  4HJ8 A;  4GZY C;  4HJ5 A;  1J5E L;  2MGS A;  4QB4 A;  4GNX C;  4NB3 A;  1H9J A;  3K7U C;  4Y7N H;  4A3B H;  3S17 H;  4BBS G;  3K57 A;  4O2D A;  2R92 B;  4FYD A;  2MFI A;  1FNU A;  5FJ8 H;  1E2V A;  1DOK A;  3CCJ A;  1E2W A;  1K9M C;  4KMU C;  1AZQ A;  1SNC A;  2IT1 A;  2K5Q A;  1ILP A;  2VY3 A;  3A7L A;  3CF5 A;  3Q8D A;  4QQB X;  1E2Z A;  2G9D A;  1LTR D;  1PZI D;  1BVS A;  1YHA A;  5IE8 A;  3S2D B;  3A8J E;  2I5H A;  3D4R A;  3U4V A;  2JA6 B;  2L1B A;  2ZTE A;  2VQE L;  1WTQ A;  4P2C B;  3F2C A;  3T51 B;  3I72 A;  1M1K C;  4JI4 Q;  3FKI H;  4X6A H;  5CV9 A;  2EY5 A;  5M3F H;  1Y1W B;  5FO7 B;  4JBW A;  1SSO A;  1O80 A;  2Z4I A;  1IYV A;  4XQJ A;  1S72 A;  2EJF C;  4A3M G;  2Y0S E;  1LAB A;  4ILW A;  3MZ5 A;  5ISR A;  4EX5 A;  3HOV B;  4OWW B;  3HOW H;  1F77 A;  1HNZ L;  4UPA A;  3K81 C;  2TSS A;  4LF8 Q;  4ZQ3 A;  5IYC H;  1BBW A;  2E75 C;  1YHQ A;  2Z9H A;  4B3T Q;  5ELO A;  4XQN A;  2B2U C;  3TP7 A;  2OF1 A;  2A6H D;  4JBM A;  4DR3 L;  5C0X G;  3W1B A;  4A3J H;  3G6J B;  4MN3 A;  1H95 A;  3MXN A;  1SNQ A;  3UI2 A;  2B2W C;  1L1O A;  1A2T A;  3K5O A;  5IYB G;  3U9S A;  5M3M B;  2B63 B;  2PYK A;  4F8M A;  3C3L A;  1N32 L;  5C4X B;  2F4I A;  4JPB W;  4OEL B;  1JC7 A;  3S1N B;  5I2X A;  4LF5 Q;  3S1M H;  2QCP X;  4ZKC B;  4AYB B;  3CC2 A;  3I4N H;  2VW9 A;  1I5F A;  3NXW A;  4C3I H;  4LAA A;  4OWX B;  3CXC A;  3EQL C;  1HR0 Q;  4MHE A;  3S16 H;  4J15 A;  2E5L Q;  4ID6 A;  1PYW D;  2CCZ A;  1K8O A;  3M7N A;  3J80 L;  4R4C A;  1VDZ A;  2K01 A;  5C4H A;  5E4W C;  3KLS A;  5FLX E;  4HJA A;  3T1H L;  1SYB A;  1SFO B;  4JI8 L;  2EQS A;  1GO3 E;  5FLX L;  1HRJ A;  4HMJ A;  3TQY A;  1G51 A;  3SR1 A;  4CDF C;  3QIA A;  1PZK D;  2XRQ D;  1I6H H;  1UE7 A;  3I4O A;  4DAV A;  1ASY A;  1YIT A;  2NB0 A;  5KYI A;  1X54 A;  1FJG L;  3GQB A;  4R4T A;  1BOS A;  4A93 B;  2PI2 E;  4JI3 L;  3J81 j;  3GTG B;  5LL6 S;  4DV1 Q;  1Q3L A;  5IP9 G;  4RKL A;  5GAG C;  1ZYR C;  3ERS X;  2E2J B;  4U67 3;  3T4A C;  5DEH A;  2F4V L;  1NY4 A;  1LT6 D;  1D2B A;  1GXD C;  4R9W A;  5IT9 E;  1G6Z A;  2F0P A;  5LMN Q;  1ICW A;  4GS3 A;  5IT9 L;  4DV5 Q;  3GTK B;  2F52 A;  2K03 A;  1XNR L;  1HZA A;  4JI2 L;  1ML0 D;  4O0A A;  2LKV A;  1MJE A;  5K5P A;  3OTO L;  4AYB E;  3I55 A;  1XPU A;  1GUT A;  1PH8 A;  3G7L A;  1X32 A;  2HIV A;  4P74 A;  4K6D A;  3BYY B;  3S14 H;  4DKA C;  2R93 B;  5I6Y A;  4F87 A;  4ZCK A;  3I90 A;  4C3J B;  1CFM A;  3ERO A;  3PUX A;  5FLX c;  5L37 A;  1Q81 C;  4K2K A;  4OO1 G;  1FNW A;  1D5Z C;  2A69 C;  3PIO 3;  1F2Z A;  1IYJ B;  2BDO A;  2PNH A;  3D4D A;  4FP5 D;  4IO9 A;  4CHT B;  2M00 A;  1N32 Q;  2DY8 A;  1VQF A;  2K75 A;  4K6L A;  4IUR A;  1RHP A;  5LHY 1;  1LTG D;  2Z6K C;  1HA6 A;  4JI7 Q;  3MAQ A;  3GTL H;  4BY1 B;  1K83 B;  4HID A;  2RDG A;  3DM3 A;  1PTO D;  1WCM B;  3WWV A;  2CFM A;  5IT9 c;  2L11 A;  3HOY H;  2A6H C;  2L9H A;  2ICE C;  5LL6 X;  4A3I G;  4ZAI A;  4OWT B;  2R7Z B;  1FD7 D;  1FGB D;  1X6O A;  1VQ9 A;  3VA7 A;  4DV0 L;  2HHH L;  1N8R C;  3BDL A;  4H0L C;  1H9M A;  1SNP A;  3Q23 A;  5EJW A;  3F2B A;  3GP7 A;  3BS1 A;  1GOZ A;  2Q8I B;  5JJZ A;  3KLS X;  1WI5 A;  2RQX A;  1PHJ A;  1EY4 A;  4DV3 Q;  3HOZ H;  3CHB D;  4ME5 A;  3OMC A;  3V05 A;  2NZO A;  3PO2 H;  2QEX A;  4MTK A;  4IFD I;  3V2T A;  1XYI A;  4R8I A;  1WTP A;  1PTO F;  3HOU H;  2OXP A;  4ABN A;  3EN2 A;  2XWJ B;  1G91 A;  5IP7 G;  1C48 A;  1SE4 A;  1V1O A;  3SK5 A;  2EVB A;  1VQ5 A;  1GUN A;  4G4K A;  3TP8 A;  1SAP A;  1QIL A;  1FJG Q;  2BH2 A;  4DUZ L;  1SJE D;  1SNO A;  5J3B A;  2L4N A;  3GTP B;  1HCZ A;  1QZG A;  3F1Z A;  4X3S A;  4JI5 L;  3BZD B;  4K0K Q;  2N3S A;  4CDC C;  1AZP A;  4OO1 I;  2A5H A;  1XNQ L;  2WKD A;  1LYL A;  4UDU C;  5M5X B;  4HJ7 A;  4QL5 A;  2UUB L;  5IGD A;  3S2D H;  1WTW A;  2JA5 B;  2ENB A;  3SEB A;  3SK6 A;  4C3H G;  2JA6 H;  3OSO A;  3L3O C;  4A3B B;  2DN8 A;  3NWT A;  4JOI A;  3UDX A;  4GN5 A;  2Z6B A;  4X66 Q;  4LMQ D;  4CDE C;  4RA8 A;  2EOT A;  4NMZ A;  1BR9 A;  3AFP A;  3KF6 B;  3DWQ A;  2J0T D;  2JA7 B;  1YVC A;  4DN4 M;  1I50 H;  2Q2I A;  2JEB I;  2RKS A;  4LF7 Q;  3R93 A;  1LT3 D;  2VB2 X;  3D31 A;  1F2Y A;  4KKT A;  2UXC L;  3QOJ A;  5J1Z A;  4B3S L;  1LT4 D;  2F0V A;  2F3I A;  1O78 A;  3WOE A;  2WKC A;  1Q1E A;  1HTP A;  3NBH B;  5M3F B;  3EBE A;  2H5X A;  3X3N A;  3K5N A;  2KUM A;  3I4M G;  2B8G A;  1PRT D;  4GKK L;  2NZH A;  1C0A A;  2ICI A;  4DR7 Q;  2X6G A;  1UE5 A;  4G57 A;  1S5F D;  1SDF A;  1I6V C;  3KF8 A;  1DYQ A;  5M3M H;  4LF9 L;  1A62 A;  3HOW B;  4DAY B;  1EYC A;  1C7Y A;  1HUN A;  1W6K A;  1NCV A;  5KGU A;  1CUK A;  2E2I H;  4KV6 A;  4ZKB B;  3M3Y B;  1B44 D;  1B50 A;  4MNO A;  3HKZ G;  1FL0 A;  4CKE A;  3KYH C;  4DF7 A;  3P1H A;  1X3G A;  4A3J B;  1CKN B;  5COY A;  2JXM B;  2NVT H;  4JYA L;  3NEN A;  1VQN A;  5IIF A;  3PO3 G;  1KHI A;  1DGS A;  1PRT F;  3CCE A;  5GAE C;  1VQP A;  5K36 H;  2B8F A;  5AFW A;  5FK9 C;  4BBR B;  4B3M L;  3SE0 A;  1JOR A;  2EDG A;  5CGK A;  1J6Q A;  1Q86 C;  4CDD C;  4UAI A;  1PTO C;  3OWF A;  4HIO A;  3VYU A;  1AFP A;  2KEC A;  4FNF A;  1NR2 A;  3P7J A;  4TSS A;  1HJP A;  3GTM H;  1SYC A;  3AQQ A;  3PQI A;  2PO4 A;  4BXX H;  4GLX A;  2HQL A;  4CGY B;  4ZUI A;  4BY7 B;  4DFA A;  1X56 A;  4C3I B;  2A1A A;  1I4Q A;  4FXG C;  3C1F A;  1JQY D;  4KY6 A;  4NXM Q;  2HCC A;  3S16 B;  1DON A;  3L0O A;  1GVP A;  2B2Y C;  4A93 H;  2YTX A;  2PQE A;  4E6I A;  4LF6 L;  3GTG H;  5FKA C;  1KL9 A;  3R2I A;  4LUO A;  4LUV A;  2UU9 Q;  2VNU D;  4A3L H;  2E2J H;  1HZB A;  1S3O A;  4R4I A;  3D6W A;  1IBL L;  2KA7 A;  3K5M A;  2JA9 A;  4U68 A;  3DWA A;  1Y8N B;  2UXD L;  5C44 G;  3GTK H;  5G3L D;  3BVZ A;  1S5E D;  1TII D;  1EY8 A;  3SGI A;  1I6H B;  4S3S A;  4P71 A;  2RSO A;  1SNM A;  3OYY A;  4X64 Q;  1PH3 A;  1JJC B;  4A3G G;  4YIJ A;  4AIM A;  2SNS A;  2XVS A;  1BXT A;  3IFD A;  4FXK C;  5CBE E;  2O2L D;  4MZ9 A;  5JOB A;  3BG3 A;  2RCF A;  2ZTD A;  1A3V A;  1MKH A;  4B3S Q;  1H9R A;  2WP8 J;  2UUC L;  2CWA A;  2ZJQ A;  3DUZ A;  1EU4 A;  3E5S A;  1Y8O B;  3FRP B;  2PPB C;  1UEB A;  1RIP A;  5I9P A;  3M85 A;  3GTQ H;  4DR5 Q;  1M90 C;  1RCV D;  3E9I A;  4OX9 Q;  4JV5 Q;  1Q8I A;  3OIP A;  1A3U A;  5JEA H;  5IWA Q;  3RZD H;  3LX0 A;  3RMH A;  2R92 G;  3KFU A;  1HA5 A;  4FDB A;  3CU7 A;  2K52 A;  2B2T A;  1LTA D;  2Z4H A;  4BY1 H;  1MSH A;  4IAL A;  1SE3 A;  1SRO A;  3C1E A;  4M8A A;  1V1Q A;  2IJ0 A;  4LJZ C;  2K04 A;  2CW0 D;  3ITP A;  3E3X A;  5EGT A;  3NQI A;  5J39 A;  1ROD A;  3P20 A;  4QUC A;  1S40 A;  3VR5 A;  2IX0 A;  5IYD G;  4ZRZ A;  2Q8R E;  4DR6 L;  2WAQ E;  1OXU A;  3UE1 A;  2YTV A;  4AQY L;  4LFB Q;  4N8F A;  3A7A B;  1SN8 A;  2EYF A;  3OW7 A;  1PA6 A;  3CCR A;  2BA0 A;  1RF2 D;  3NTH A;  3WOF A;  1IXR A;  3W1G A;  2G5D A;  1BCP F;  1VQH A;  5IOC A;  5KEE A;  4A3E B;  1GM5 A;  2KCT A;  1EIF A;  1A2U A;  2F3V A;  5C4Z A;  4GLV B;  3J81 i;  2V1C C;  3RLN A;  3HOV G;  1P16 A;  3M4O B;  3UDG A;  3TBI B;  1Q46 A;  2PW7 A;  2VUM H;  2F0L A;  1IHZ A;  3TME A;  4YCW A;  4IFD H;  2QF7 A;  1ICF B;  1T9H A;  3FPU B;  5IGC A;  5C3E B;  3I3C A;  1NSN S;  4GOP A;  2XIW A;  1X3Q A;  1IBM Q;  3HOZ B;  3PO2 B;  1LTI D;  4J6H A;  2KCN A;  1VQM A;  1IBL Q;  2F0E A;  1PH6 A;  2NVY H;  2K5H A;  3K5L A;  5EKK A;  4A3F B;  1Q82 C;  3KF6 A;  4RHS A; 
#chains in the Genus database with same CATH homology
 1EEF D;  2OEO A;  2LS0 1;  4X3K A;  4RGO S;  3EA6 A;  3H0G B;  1EQV A;  5KRU A;  3D4W A;  5BN5 A;  4PMB A;  1CA6 A;  3D6C A;  1CQV A;  1EY6 A;  4RKB A;  2IX1 A;  1B1Z A;  3A8K E;  2IX3 A;  4H13 C;  2C5C A;  3RD4 A;  2ZXO A;  3PIP 3;  3NSW A;  1PLF A;  3M7G A;  1I4G A;  1X3P A;  5E3F A;  4KD3 A;  4BS9 A;  2SDF A;  4DAY A;  1KAA A;  5EKL A;  3L7Z C;  3VR4 A;  4KJO A;  1XX8 A;  1RKN A;  5EPL A;  3KK7 A;  3KLR A;  1WTR A;  4IUP A;  1Z7T A;  1WVL A;  1AN8 A;  2Z8L A;  2MHV A;  4DAP A;  1I50 B;  5A35 A;  3K59 A;  1EWC A;  1RD9 D;  1DOL A;  2V4D A;  1GUG A;  3DMU A;  2KVM A;  2WV6 D;  4K8J A;  1F9S A;  3FVQ A;  1B9M A;  2K6A A;  2VXW A;  1LV9 A;  3RLF A;  1HUM A;  1TR5 A;  1WD0 A;  1BUV T;  3URY A;  1JWM D;  3E6Z X;  1LLR D;  1TY2 A;  4OL7 A;  5I6W A;  4HR7 B;  4TRD A;  3E0J A;  3FDT A;  2M9V A;  3GV3 A;  2XWB B;  1TQO A;  3NHH A;  2YU9 B;  4K5V A;  1D6E C;  2E2I B;  1JOQ A;  2CW0 C;  5J22 A;  4R8N A;  2NVT B;  4C3J G;  2KOL A;  1BO0 A;  2C9O A;  1RTO A;  2F0W A;  5D65 A;  1U4L A;  5IGF A;  2MUY A;  2NBF A;  1SBB B;  1PMR A;  5T1G A;  3WDN A;  2F0U A;  2OT2 A;  3GTM B;  2L12 A;  3LNN A;  2HQE A;  4KD4 A;  1UNS A;  3VR3 A;  2FHT A;  2F0K A;  1DZ1 A;  1T5X D;  4C56 C;  5JEA J;  3MXU A;  3OPO A;  2M2L A;  3D8G A;  2FIN B;  1BF4 A;  1QJO A;  1B4O A;  2EY6 A;  4FF2 A;  4DXG A;  5C0X I;  3DEP A;  3CRK C;  3MXG A;  3I8Z A;  5DNF A;  4DK1 A;  1SXT A;  2HDM A;  2F0O A;  1I4R A;  5IGB A;  2K5D A;  3U9O A;  4IUQ A;  4DNR B;  4ZLT F;  3TP5 A;  1IW7 D;  3H6M A;  1CM9 A;  3BVM A;  4V0B A;  2LMC B;  4Q0F A;  1RDP D;  4J8Q A;  3J81 E;  5E4X A;  3J81 L;  1QB5 D;  4FF3 A;  4N9P A;  3NP8 A;  4IN3 A;  1YNN D;  2LFN A;  1HQR D;  3GTQ B;  2NN6 G;  4XT3 B;  1ENF A;  2XN9 C;  2KCC A;  5BN4 A;  1CZG A;  5IGG A;  3RZD B;  4IFD J;  5JVG 3;  4QIW B;  1XTC D;  1GHJ A;  3S2H B;  5C5L A;  5JAV A;  2EJG C;  4EQN A;  1LAC A;  1TS3 A;  1ENC A;  2E74 C;  2B39 A;  2H4O A;  2I07 B;  4ULL A;  1SE2 A;  1EIH A;  3M4Y A;  5DAU A;  5DM7 3;  5FO8 B;  2F0Q A;  2A6E D;  3HG9 A;  1OXT A;  2HDL A;  1MD2 D;  3T13 A;  4BA2 I;  3AB9 A;  1CI3 M;  4H44 C;  2L5T A;  4KN4 C;  2EYP A;  2XSC A;  2HUG A;  4DK0 A;  1STG A;  2EYL A;  1AW7 A;  3H09 A;  1E0B A;  1S5D D;  3K58 A;  4BA1 I;  3TDQ A;  2VUM B;  4OIK A;  2N55 A;  3S1R B;  2EYM A;  2QEJ C;  3RZO B;  4B9W A;  3K7A B;  3MA2 B;  2IL8 A;  1IKM A;  2RVL A;  2NVY B;  2NZ1 D;  2F0S A;  1Q12 A;  2L55 A;  1A6X A;  1TWG B;  1TS5 A;  3FPP A;  1CT1 D;  1M4V A;  2EY2 A;  4EVO A;  1XWE A;  1CZW A;  2NVX B;  2EE1 A;  2K1B A;  1O7Z A;  1D5X C;  1VCI A;  3VYT A;  2F1M A;  2NUC A;  1Q90 A;  3NTK A;  2A74 C;  2E76 C;  4J1M A;  4O1N A;  1CTM A;  2F0I A;  1G2S A;  3I73 A;  1J8I A;  4C3I G;  3SK8 A;  5JPN C;  1G2T A;  1RTN A;  3OWE B;  1DJR D;  1U4M A;  4H7B A;  3T56 B;  2G9H D;  4KK7 A;  1UUP A;  1NAP A;  1JB3 A;  4ZYS A;  2F0D A;  2XRS D;  1Y1V B;  4PMC A;  3SDZ A;  3HOX B;  4LK1 C;  4A3I B;  1G8Z D;  1SEB D;  1JR0 D;  3ND8 A;  1PDQ A;  1II3 A;  3CRL C;  1ZXT A;  1I4H A;  2JA8 B;  3PUW A;  1ET9 A;  3T16 A;  2JYO A;  4IQZ A;  2EJM A;  3KBG A;  1YNN C;  5HGT A;  2BCO A;  4XQQ A;  5BN3 A;  1HXY D;  3VR6 A;  4I65 A;  1JWS D;  3ND9 A;  3OHX C;  2AQ1 B;  4WOR A;  3MEH A;  1LTS D;  3QG1 A;  5NUC A;  2EXZ A;  2DNE A;  1S5B D;  4QCL A;  1KDC A;  4EQP A;  3BVG A;  2R3Z A;  3QO2 A;  3NPP A;  4KTA A;  2A6E C;  1UEA B;  3SK4 A;  1ILQ A;  4HCE A;  5D3D A;  4HMI A;  1EEI D;  5EKI A;  3QWN A;  5EPK A;  2BA1 A;  4HSP A;  4DA2 A;  4IUV A;  1AP0 A;  2AUK A;  1S4Z A;  2B2V A;  3K0Y A;  1QCB D;  5M5Y B;  3DWP A;  4G7O C;  3PMF A;  4M1U B;  3SHL A;  5EPJ A;  5C5M A;  4XXE A;  1GHK A;  3MWY W;  2CQA A;  2WAQ B;  3A8I E;  1HPC A;  3AMU A;  1ESF A;  3VA5 A;  5C0X H;  3HP3 A;  4RGN A;  5F2D A;  4XT1 B;  1OXX K;  2AQ2 B;  2D5D A;  1ZKO A;  2B2T C;  3MHB A;  4PQX A;  3MVV A;  3DEO A;  1I4P A;  4HSV A;  1SYD A;  2A73 B;  4HED A;  4N9T A;  1TT2 A;  1U4P A;  1PTO H;  1D1K A;  5I9O A;  2DY7 A;  2Z1C A;  1R4Q B;  3HKZ B;  1R4P B;  1U9R A;  4RCO A;  1WTV A;  4QUF A;  4RCN A;  1ET6 A;  3PO3 B;  5CV7 A;  2BDN A;  2WAC A;  3H3V C;  3SVM A;  3FEW X;  1BCP D;  3CKI B;  1EYD A;  1I3Q B;  2E2H B;  2N88 A;  2K7V A;  5C6A A;  5CV8 A;  4EQO A;  1IYU A;  2MPM A;  1DXM A;  5EBC A;  1NR4 A;  3QJY A;  1PRT C;  3NTI A;  1AEX A;  5D3I B;  1FNV A;  1M8A A;  2O5J C;  3RUZ A;  4A3K B;  1C4Q A;  5HUR A;  3OOC A;  1NUC A;  4PMW A;  1LO5 D;  1BQQ T;  4DXF A;  1XXG A;  4CJ1 B;  4QMG A;  3A55 A;  2FMC A;  5E1F A;  3NK9 A;  1IKL A;  1SYE A;  2ZT9 C;  3NUC A;  1OO9 B;  4TQU S;  2F03 A;  3NBI A;  1MSG A;  1BNZ A;  5C3X A;  1HHV A;  3HEJ A;  4FO2 A;  1CQF A;  3PUY A;  5KNC A;  4XYQ A;  1V8Q A;  2PCF B;  5FO9 B;  2SOB A;  2NTS A;  2YYZ A;  3ONA B;  3NWS A;  1JE4 A;  3VYR A;  1OXV A;  1EQT A;  4OO1 H;  4L63 B;  4A3D B;  3NBH A;  1F2L A;  3K6O A;  4FF4 A;  3S1Q B;  4ODG A;  2A68 D;  2H1E A;  3S15 B;  2Q8T A;  2GA4 B;  1TWA B;  4RAU C;  5K36 G;  1A15 A;  5KNB A;  3GTJ B;  4IZ8 A;  2KED A;  3S9W A;  1BDO A;  2EPB A;  1HFN A;  2X69 A;  5I2Y A;  2MJ8 A;  2F0J A;  4CBV A;  1DM0 B;  5DM6 3;  3KUP A;  3IAY A;  3I91 A;  3TSS A;  4IUN A;  5ELB A;  1L0X B;  3LWU A;  1TKW B;  3ZYY X;  1F9P A;  3DHQ A;  2DNC A;  1KTK A;  1JWU D;  2RA4 A;  4G7Z C;  2A69 D;  4ZK9 B;  3HGB A;  2NYZ D;  2J7Z A;  2KHS A;  5CV4 A;  5EQ0 A;  1TWF B;  1TU2 B;  1MBY A;  1QE6 A;  4RFB A;  2WIN B;  2IPK D;  4KKU A;  2J4X A;  1SYG A;  3A56 A;  3C2P A;  2AQ3 B;  3QB3 A;  1B9N A;  1BCP C;  4KY5 A;  2CVR A;  2FFK B;  4RHR A;  3I70 A;  4IUU A;  1VF7 A;  1LT5 D;  5FOB B;  3H94 A;  1O7Y A;  1GUS A;  3IKJ A;  2SEB D;  2L0C A;  2F3W A;  4X3T A;  4BBS B;  5KYL A;  3JAM E;  2F0M A;  1HQM C;  4MIU A;  3JAM L;  5C0X J;  4FF1 A;  1KLG D;  2B2U A;  4K14 A;  5M9O A;  1EY9 A;  5JEA G;  3Q6S A;  5JVH 3;  3EJI A;  5C4J B;  4QF4 A;  1VF5 C;  3J7A V;  2QIL A;  1VMP A;  1EY0 A;  2D62 A;  2B2W A;  4JK1 C;  5ELC A;  2WII B;  1TWC B;  2K05 A;  3TN2 A;  3J80 E;  2LY7 A;  4ZUJ A;  2IWH A;  3Q0A A;  4RWS C;  3LWE A;  3TZU A;  2IW3 A;  2K32 A;  1STA A;  1T5E A;  4WJW A;  2K28 A;  4HN7 A;  5IOD A;  2PZW A;  4IUT A;  5CMD A;  4O42 A;  2RDF A;  2AUJ D;  1S5C D;  4OHJ A;  4A3M B;  1PFM A;  4EGV A;  2EZV A;  3GTO B;  1CK1 A;  2MP1 A;  4KHV A;  4CJ0 B;  3X3M A;  3NQT A;  4F7X A;  4I7Z C;  4PNY A;  2A68 C;  1RJT A;  1C8C A;  1Z6H A;  2BE5 D;  1W6J A;  5TSS A;  2FMM A;  2QKI C;  4IFD G;  1KLU D;  2ZXP A;  2KJX A;  1SMY D;  4WRD A;  1FR3 A;  3MXP A;  2AWO A;  4NKL A;  1PTO B;  1H9S B;  1D5M C;  2NVQ B;  3IFT A;  1UAP A;  4OIJ A;  1V1P B;  1YNJ D;  5CV6 A;  1EL0 A;  1JIC A;  1PXU A;  3IL8 A;  4NW2 A;  1Y8P B;  4OGQ C;  1TS4 A;  3OMG A;  3MC0 B;  2EYH A;  3KBX A;  1KDB A;  1CHP D;  3H91 A;  5T1I A;  2JSO A;  3N52 A;  4F88 A;  1STE A;  1EY5 A;  1WTO A;  4K8I A;  3V96 A;  1KNA A;  1QWY A;  1EY7 A;  3F2U A;  3TP6 A;  3VYS A;  3MFY A;  1TVX A;  1STY A;  3R2T A;  2F0F A;  4RGT A;  3A54 A;  1EYA A;  5D14 A;  1WD1 A;  4V19 0;  1QNU A;  3TZD A;  1JOO A;  4KN7 C;  5CR3 A;  1QOH A;  1ENA A;  5M5W B;  2K5W A;  2O5I C;  1QG7 A;  1MI2 A;  2R6G A;  3GD7 A;  1F2M A;  3HS0 C;  3GV6 A;  5IGE A;  4L8J A;  4BWG B;  3Q24 A;  2NN6 I;  4RH6 A;  3P75 A;  1EU3 A;  3QOL A;  3C46 A;  1EOT A;  3PUV A;  2PZU A;  2PMZ B;  2XNA C;  4NDX A;  1KNE A;  3R8B A;  2ZXR A;  3MTS A;  3J7Y W;  2WB1 B;  1TWH B;  2E2D C;  4HTH A;  5CYU A;  4KY7 A;  4KKS A;  3L9A X;  3BYT B;  4Y7N B;  5EBD A;  1PRT B;  3S17 B;  1G29 1;  4TKO B;  4DGZ A;  2RBM A;  1HFG A;  4XYO A;  2EY1 A;  4CJ2 C;  2D9U A;  4KJN A;  1EZ6 A;  3EVQ A;  5COR A;  1IW7 C;  1CHQ D;  3O13 A;  1HTL D;  1D1I A;  3I4L A;  2BE5 C;  4XTC S;  1O7L A;  2HCI A;  1U4R A;  2CHB D;  1IL8 A;  4FVM A;  1OXS C;  2PW5 A;  3FKI B;  1LTB D;  5CBA E;  1SMY C;  1PFN A;  2PZT A;  1EWH A;  2ID0 A;  4G7H C;  1KAB A;  5KIX A;  1JOK A;  2BOS A;  1TY0 A;  1B2T A;  4NP5 A;  1MGS A;  1YNJ C;  2KQ3 A;  3AU7 A;  4XIG S;  5CC4 A;  1DOM A;  1F9R A;  1SND A;  3J7A F;  5I4D A;  2JEA I;  2B2V C;  1GJX A;  4C1N K;  5CV5 A;  5C3W A;  2VB3 X;  4HAE A;  4L6T B;  1EZ8 A;  2EYJ A;  4C1N I;  4KI0 A;  1L0Y B;  4C3H B;  2FJ2 A;  3OIQ A;  2NWG A;  4KHZ A;  2PNR C;  3VR2 A;  3W2D A;  2F0H A;  4X3U A;  2K33 A;  3D3R A;  1STN A;  4C2M B;  2AWN A;  3R3O A;  2JP1 A;  3S1M B;  1STB A;  3I4N B;  2F0T A;  4CKB A;  3W3A A;  4DU9 A;  1Y69 U;  4B9X A;  1SYF A;  1EFI D;  1BBX C;  1H9S A;  2R61 A;  4RGM A;  2I46 A;  1V1P A;  3I4M B;  3T53 B;  3MFG A;  1H9K A;  1ONL A;  1ESR A;  2F0G A;  1KDA A;  1Z47 A;  2B2Y A;  3HRZ C;  1BCP B;  5JPM C;  4FXD A;  1FYC A;  3DXJ C;  3CQZ B;  1GUO A;  4HCS A;  3FMC A;  3N6R A;  4K2L A;  2EYO A;  2TMP A;  2RDH A;  5KND A;  4K5W A;  2SNM A;  1QNK A;  1TS2 A;  1Q1B A;  5G3L F;  4B08 A;  3EFX D;  2QDB A;  3Q22 A;  5ELF A;  2RSN A;  4WFN 3;  2KEE A;  3HZX A;  1JCK B;  2NTT A;  3BDC A;  1DD2 A;  1EIG A;  1I4X A;  3S14 B;  1STH A;  1PZJ D;  2D2C C;  4Q5V A;  4PV1 C;  4DNT B;  1V43 A;  3PUZ A;  1B53 A;  1VMC A;  4CKC A;  3ERQ A;  4K5X A;  1LTT D;  4XDX A;  1ZEQ X;  5A2Q E;  2O4X A;  1PFB A;  5A2Q L;  4Z9C B;  3GTL B;  5C44 B;  1CA5 A;  1B3A A;  2X6L A;  3HOY B;  1F9Q A;  3PV0 A;  2F0N A;  4A3G B;  3GO5 A;  1K8M A;  1GUW A;  1DCZ A;  2JE6 I;  3DM1 A;  2Y0S B;  3BDO A;  1SJH D;  1J9O A;  3HOU B;  2NN6 H;  3SXH A;  5ELD A;  1ZYR D;  1WTX A;  3NE5 B;  5ELE A;  1R9T B;  1A3T A;  4GZY C;  2MGS A;  4QB4 A;  1H9J A;  3K57 A;  2R92 B;  4FYD A;  1FNU A;  1E2V A;  1DOK A;  1E2W A;  4KMU C;  1AZQ A;  1SNC A;  2IT1 A;  2K5Q A;  1ILP A;  3A7L A;  1E2Z A;  2G9D A;  1LTR D;  1PZI D;  3S2D B;  3A8J E;  3D4R A;  2JA6 B;  2L1B A;  1WTQ A;  4P2C B;  3T51 B;  3I72 A;  5CV9 A;  2EY5 A;  1Y1W B;  5FO7 B;  4JBW A;  1SSO A;  1O80 A;  2Z4I A;  1IYV A;  4XQJ A;  2EJF C;  1LAB A;  4ILW A;  3MZ5 A;  5ISR A;  3HOV B;  1F77 A;  2TSS A;  4ZQ3 A;  2E75 C;  4XQN A;  2B2U C;  3TP7 A;  2OF1 A;  2A6H D;  5C0X G;  3G6J B;  4MN3 A;  3MXN A;  1SNQ A;  3UI2 A;  2B2W C;  1A2T A;  3K5O A;  3U9S A;  5M3M B;  2B63 B;  2PYK A;  4F8M A;  3C3L A;  5C4X B;  2F4I A;  1JC7 A;  3S1N B;  5I2X A;  2QCP X;  4ZKC B;  4AYB B;  3NXW A;  4LAA A;  3EQL C;  4MHE A;  4ID6 A;  1PYW D;  1K8O A;  3M7N A;  3J80 L;  1VDZ A;  2K01 A;  5C4H A;  5E4W C;  3KLS A;  5FLX E;  1SYB A;  1SFO B;  5FLX L;  1HRJ A;  4HMJ A;  3SR1 A;  3QIA A;  1PZK D;  2XRQ D;  4DAV A;  2NB0 A;  5KYI A;  3GQB A;  1BOS A;  4A93 B;  3GTG B;  5LL6 S;  1Q3L A;  4RKL A;  1ZYR C;  2E2J B;  4U67 3;  3T4A C;  5DEH A;  1LT6 D;  1D2B A;  1GXD C;  4R9W A;  5IT9 E;  1G6Z A;  2F0P A;  1ICW A;  5IT9 L;  3GTK B;  2K03 A;  1ML0 D;  2LKV A;  5K5P A;  1GUT A;  3G7L A;  1X32 A;  4K6D A;  3BYY B;  2R93 B;  5I6Y A;  4F87 A;  3I90 A;  4C3J B;  1CFM A;  3ERO A;  3PUX A;  4K2K A;  4OO1 G;  1FNW A;  1D5Z C;  2A69 C;  3PIO 3;  1F2Z A;  2BDO A;  3D4D A;  4FP5 D;  4CHT B;  2M00 A;  2DY8 A;  4K6L A;  4IUR A;  1RHP A;  5LHY 1;  1LTG D;  1HA6 A;  3MAQ A;  4BY1 B;  1K83 B;  2RDG A;  1PTO D;  1WCM B;  2L11 A;  2A6H C;  2L9H A;  2ICE C;  5LL6 X;  4ZAI A;  2R7Z B;  1FD7 D;  1FGB D;  3VA7 A;  3BDL A;  4H0L C;  1H9M A;  1SNP A;  3Q23 A;  5EJW A;  3GP7 A;  3BS1 A;  1GOZ A;  2Q8I B;  5JJZ A;  3KLS X;  2RQX A;  1EY4 A;  3CHB D;  4ME5 A;  3OMC A;  3V05 A;  4IFD I;  3V2T A;  1XYI A;  4R8I A;  1WTP A;  1PTO F;  2OXP A;  4ABN A;  2XWJ B;  1G91 A;  1C48 A;  1SE4 A;  1V1O A;  3SK5 A;  2EVB A;  1GUN A;  4G4K A;  3TP8 A;  1SAP A;  1QIL A;  1SJE D;  1SNO A;  2L4N A;  3GTP B;  1HCZ A;  4X3S A;  3BZD B;  1AZP A;  4OO1 I;  2A5H A;  2WKD A;  4UDU C;  5M5X B;  5IGD A;  1WTW A;  2JA5 B;  2ENB A;  3SEB A;  3SK6 A;  4C3H G;  3OSO A;  3L3O C;  4A3B B;  2DN8 A;  3NWT A;  4LMQ D;  4RA8 A;  2EOT A;  4NMZ A;  1BR9 A;  3DWQ A;  2J0T D;  2JA7 B;  4DN4 M;  2JEB I;  2RKS A;  3R93 A;  1LT3 D;  2VB2 X;  3D31 A;  1F2Y A;  4KKT A;  3QOJ A;  5J1Z A;  1LT4 D;  2F0V A;  1O78 A;  3WOE A;  2WKC A;  1Q1E A;  1HTP A;  5M3F B;  3X3N A;  3K5N A;  2KUM A;  2B8G A;  1PRT D;  2ICI A;  2X6G A;  4G57 A;  1S5F D;  1SDF A;  1I6V C;  3KF8 A;  1DYQ A;  3HOW B;  1EYC A;  1HUN A;  1W6K A;  1NCV A;  5KGU A;  4KV6 A;  4ZKB B;  3M3Y B;  1B44 D;  1B50 A;  4CKE A;  4DF7 A;  3P1H A;  4A3J B;  5COY A;  2JXM B;  5IIF A;  1PRT F;  5K36 H;  2B8F A;  5AFW A;  5FK9 C;  4BBR B;  3SE0 A;  1JOR A;  2EDG A;  5CGK A;  4UAI A;  1PTO C;  3OWF A;  3VYU A;  1AFP A;  2KEC A;  4FNF A;  1NR2 A;  3P7J A;  4TSS A;  1SYC A;  2PO4 A;  4CGY B;  4ZUI A;  4BY7 B;  4DFA A;  4C3I B;  1I4Q A;  4FXG C;  3C1F A;  1JQY D;  4KY6 A;  2HCC A;  3S16 B;  1DON A;  2B2Y C;  2PQE A;  4E6I A;  5FKA C;  3R2I A;  2VNU D;  3D6W A;  2KA7 A;  3K5M A;  4U68 A;  3DWA A;  1Y8N B;  5G3L D;  3BVZ A;  1S5E D;  1TII D;  1EY8 A;  1I6H B;  4S3S A;  2RSO A;  1SNM A;  4YIJ A;  2SNS A;  2XVS A;  1BXT A;  3IFD A;  4FXK C;  5CBE E;  2O2L D;  5JOB A;  3BG3 A;  1A3V A;  1H9R A;  2WP8 J;  3DUZ A;  1EU4 A;  3E5S A;  1Y8O B;  3FRP B;  2PPB C;  5I9P A;  3M85 A;  1RCV D;  1Q8I A;  3OIP A;  1A3U A;  5JEA H;  3LX0 A;  3RMH A;  1HA5 A;  3CU7 A;  2B2T A;  1LTA D;  2Z4H A;  1MSH A;  4IAL A;  1SE3 A;  3C1E A;  4M8A A;  2IJ0 A;  4LJZ C;  2K04 A;  2CW0 D;  3ITP A;  5EGT A;  3NQI A;  5J39 A;  1ROD A;  3P20 A;  4QUC A;  3VR5 A;  2IX0 A;  4ZRZ A;  2Q8R E;  1OXU A;  3A7A B;  2EYF A;  3OW7 A;  2BA0 A;  1RF2 D;  3NTH A;  3WOF A;  1BCP F;  5IOC A;  5KEE A;  4A3E B;  1A2U A;  2F3V A;  5C4Z A;  3M4O B;  3TBI B;  2PW7 A;  2F0L A;  1IHZ A;  3TME A;  4IFD H;  2QF7 A;  3FPU B;  5IGC A;  5C3E B;  3I3C A;  1NSN S;  2XIW A;  1X3Q A;  3HOZ B;  3PO2 B;  1LTI D;  4J6H A;  2KCN A;  2F0E A;  3K5L A;  5EKK A;  4A3F B;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...