3MHBA

Crystal structure of staphylococcal nuclease variant delta+phs l38a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLAVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mhbA00
1EY6A 2OF1A 3U9OA 3R3OA 4DGZA 3NHHA 3NQTA 4NMZA 4KY6A 3EVQA 4J6HA 4K5VA 4RKBA 5EGTA 4ZQ3A 3SHLA 1SYCA 2EYPA 4ZUIA 4KD3A 2O4XA 1SNPA 4N9PA 1STYA 4I65A 1EQVA 5C4HA 5ISRA 2F0QA 5IGCA 5KIXA 5KYLA 2F0EA 4PMCA 3NP8A 1EY0A 1EZ6A 4ME5A 2F0TA 4NP5A 4TRDA 3TP8A 4DFAA 2KQ3A 3EJIA 3SK6A 5J1ZA 5IGBA 1SNOA 1KDCA 3BDCA 2EY2A 2RDFA 4KJNA 5EKKA 1EY9A 3MZ5A 1F2ZA 2F0JA 2PQEA 2F0KA 2NUCA 4ZUJA 3TMEA 5I6WA 4R8NA 2PW7A 5KEEA 2SNSA 2F0FA 3SXHA 5C5MA 1TR5A 1SYDA 4N9TA 2F0NA 2EXZA 4PMBA 5JOBA 4KV6A 3HZXA 4B9XA 5IODA 1STBA 2RBMA 3PMFA 3OMCA 2F0PA 4MIUA 2M00A 3OSOA 5NUCA 1SNMA 3QOLA 1AEXA 2HQEA 1NUCA 5F2DA 4F7XA 2F0VA 5CV7A 5IGFA 1U9RA 5J22A 1TT2A 5DAUA 4K14A 4EQOA 4IALA 3TP7A 5CV9A 2F3WA 2F0IA 2PZWA 4KD4A 3D4DA 5EKLA 5C5LA 4K2KA 2SOBA 5C6AA 5I9PA 2EYLA 3MEHA 5C3XA 1TQOA 2F0UA 5I9OA 2EYMA 3RUZA 1EY8A 3EROA 4E6IA 1KDBA 2F3VA 3D6CA 1EYDA 3NUCA 1ENAA 4K5WA 1KDAA 1A3VA 5CV5A 3S9WA 1KABA 4K8JA 3D4WA 5J39A 3DHQA 3NXWA 4IUNA 4K5XA 1SYEA 1F2MA 4K2LA 3TP6A 1SYGA 2F0LA 5E1FA 4H7BA 1RKNA 2EY1A 3C1EA 3SR1A 3V2TA 5CV6A 5JAVA 1EYAA 1ENCA 1JOOA 1II3A 4KY7A 5KGUA 1SNQA 4ID6A 4KY5A 5C4ZA 2EYFA 3SK5A 1A3TA 1KAAA 4QMGA 3SK4A 4K6DA 3ITPA 3VA5A 3TP5A 1SNDA 3QB3A 5K5PA 2F0OA 4KTAA 3BDLA 1STGA 2WACA 3D8GA 1SYFA 4NDXA 2EY6A 4NKLA 4OL7A 5CV4A 5CV8A 3SK8A 1A2UA 1SNCA 1EYCA 3LX0A 1SYBA 3HEJA 2EYHA 3P1HA 4KJOA 4S3SA 1NSNS 2PZUA 3MVVA 5IGDA 3OMGA 4J1MA 3T16A 2ENBA 4DU9A 1JORA 1STHA 1JOQA 2PYKA 5CGKA 2F0SA 2LKVA 1A2TA 5IGEA 5KRUA 3ERQA 4IZ8A 2OEOA 4G57A 4DF7A 4YIJA 4HMJA 5C3WA 4B9WA 1IHZA 5IIFA 2QDBA 1STNA 2EY5A 4WORA 4EVOA 4K8IA 1EY4A 4RKLA 1EY5A 2F0MA 3C1FA 4EQPA 4KHVA 5HGTA 3DMUA 1STAA 2F0DA 5CC4A 3H6MA 5IGGA 4WRDA 3OWFA 2SNMA 2F0HA 4PNYA 5HURA 2RKSA 4QF4A 5CR3A 3MXPA 2F0GA 1F2YA 5E3FA 2OXPA 3T13A 1A3UA 3E5SA 2KHSA 5KYIA 3MHBA 5I6YA 3QOJA 3NK9A 2EYJA 3P75A 4F8MA 5IOCA 5M9OA 2PZTA 1JOKA 5DEHA 4QB4A 4HTHA 2EYOA 4HMIA 4LAAA 4ODGA 2F0WA 2PW5A 1EY7A 4EQNA 1EZ8A
chains in the Genus database with same CATH superfamily
1EY6A 2OF1A 4H0LC 5TSSA 4IO9A 3CCLA 4B08A 3NQTA 3TSSA 1FYCA 4A3FG 4V190 2Q2IA 1Y8NB 2O4XA 1E1OA 1MHWC 1RF2D 3A55A 2E5LQ 4A3BH 1CQFA 5ISRA 1GUNA 4O2DA 4J15A 1EY0A 2O2LD 2XGTA 3M7NA 1Y1VG 1VQPA 2EY2A 2JEBI 3CPWA 3BZCA 1RTNA 2JN4A 5AFWA 1Q82C 4FDBA 4F88A 3SXHA 4YHHQ 1TR5A 2NWGA 2B2TC 1C48A 4X64L 4DXFA 4O42A 2NB0A 3OMCA 5COYA 4X3TA 1O7ZA 3MEFA 1KRTA 5IT9L 5FJ8G 2E2HB 1LTAD 1UE5A 1D1IA 1E3PA 2K03A 3CP0A 4YCWA 4A4IA 3AEVA 4XYQA 4DUZQ 3TDQA 4Y7NB 3A7AB 1O78A 1Y1WB 2NVXB 4A3GB 4TSSA 3CCEA 4GOPA 1IBLL 4JBJA 1D5ZC 1SYEA 3TZUA 4X66L 1RD9D 2G9DA 1H9SA 1L0XB 1EYAA 2ICEC 4ID6A 3DUZA 3I70A 1NNXA 1VQDA 1HNWQ 4RHRA 4QIWE 2EYFA 4UY8C 1LO5D 2UXBQ 4B3RQ 1VDZA 2K6AA 5K5PA 3M3YB 4EX5A 4KTAA 1Y1WG 1PRTF 2I0QA 2JQOA 1U4PA 1NSNS 3P20A 4GNXC 2B2YC 3WDNA 4CJ2C 5C4JH 3I91A 1BCPC 2PYKA 3PUVA 4A3DB 1XWEA 3M4YA 3TQYA 3ZYYX 4NW2A 3I8ZA 1IHZA 1F9PA 1HR0Q 2K7VA 2UUAQ 5FLMH 4LWCA 2NN6I 4BY7B 4RGNA 1NR2A 4MNOA 3OWFA 5C0XH 4JI4Q 2LXJA 4QIWB 3DWAA 1TS2A 2KOLA 2F4VL 4A3DG 4JI5L 2HCIA 4JV5L 4LFAQ 2LS01 1JT8A 3GTKH 1YNXA 3SE0A 4C3HG 4FYDA 5CBEE 2RF4A 3PV0A 1J5EQ 2IX0A 4DK3C 1VF5C 2G5DA 3K81C 3JAMi 1B1ZA 5M3MH 2X69A 4A3IB 1UE7A 1H9MA 4DK1A 4JBKA 2ZTCA 2KENA 4C3IH 3L0OA 1H9RA 1LT3D 3I3CA 4L5RC 5KIXA 2VQEQ 5E4XA 1Y14B 1VQGA 3CKIB 3S24A 1H9KA 4U673 2XWBB 2ES2A 1Q1BA 2F0NA 2K5NA 4DUYL 5JOBA 3M85A 4B9XA 4K0KL 2B2UA 2B8GA 4BY1G 1JWMD 4A3IG 2JA6H 2M9VA 1N34Q 3NEMA 4DNIA 3KOJA 3TN2A 3CMEA 1IZ6A 2MUYA 2DN8A 4ZRZA 3Q24A 5I9OA 2L4NA 2EYMA 2BE5C 4K5WA 1YHQA 1A3VA 3D4WA 4UP7A 2WP8J 1VQNA 4R4IA 1SYGA 4X6AH 3CW2C 1EIFA 3S1QH 1PTOF 4DNRB 4DR7Q 1E24A 1BO0A 3G71A 3AFQA 2PO4A 1I6HH 3S2DB 2FXQA 1S72A 1DOMA 2FJ2A 1TWAB 4LMQD 1D2BA 4JI0L 3L9AX 4B3ML 1MGSA 4KJOA 3FP9A 3W1GA 1DONA 2B8FA 1TS4A 3VR4A 4RGTA 5BN3A 3M4OH 4R4OA 4POFA 1IBLQ 1VQCA 4DF7A 4DR1Q 3PO3H 3KDFB 1VQHA 4KK7A 5IYBH 3Q0AA 3S16H 4A93B 1IBKQ 1UAPA 5A2QL 2XSCA 5JPMC 4A75A 3MAQA 4DR2Q 3K5NA 1CQVA 5EJWA 4RAUC 3AU7A 1L1OA 1F2YA 2EE1A 4FXKC 1PHJA 2D9UA 4JI2L 2BH2A 4JI1L 1MJCA 5DNFA 1CKOA 4OX9L 1J6QA 3JAMc 3NHHA 1VQAA 4A93G 4ULLA 3K5MA 1Y69U 1ESFA 1CUKA 4XTCS 1A6XA 2PQAA 2VQFQ 4A3FH 3HOYB 1X54A 2IT1A 4HJ5A 2NVTB 2OTJA 1HA6A 3HOZB 1QUQB 2SDFA 5GADC 1Y1VH 4A3JH 3TMEA 1LTBD 3CXCA 3GTJB 2NVQH 4HCSA 3KYHC 4IPHA 4AYBE 4DR5Q 3H09A 4DAMA 1HQRD 2Z6KA 1DOLA 5FJ8H 2VXWA 4IUQA 3TP7A 3EN2A 2WV6D 1LABA 2HDMA 1GKHA 1TIID 3RN5A 2UU9Q 2AQ1B 3R8BA 4RWSC 3BVGA 3HOUB 3G6EA 3S9WA 5IYDG 4IUNA 1HFNA 2XRQD 1FNVA 5LMUL 4JCVE 3SR1A 3S17B 4GN5A 3UDXA 5KGUA 3A5UA 3T1HQ 1E0BA 3J81i 4L8JA 3GV6A 5LMNW 2E2HH 5E4WC 4K0KQ 3S15B 3CRLC 4KHPQ 2BOSA 2MGSA 5JEAH 4OWWB 2BA1A 1D5MC 2WAQG 3STBD 3UDGA 4NDXA 1XMOL 2EY6A 1PFNA 4Y7NH 4GS3A 2PPBC 3LX0A 4S3SA 1Y1WH 3HOUG 3E9IA 5FLXE 2NVXH 2K01A 3LGJA 2EDGA 3EIVA 5L37A 3CCRA 4JI7L 4IN3A 2JE6I 3A8KE 1F9SA 5IY0A 2R93B 5IGEA 4JI3Q 1JCKB 3DEOA 3PIOA 2XRSD 3A5ZB 1GM5A 1PMRA 2I46A 4OIJA 2PMZB 5H1SE 4A3LG 3D6WA 1BF4A 4RGOS 1HUMA 2H4OA 2ID0A 1XPRA 2F0HA 4KKSA 2RKSA 4OO1G 3MXUA 3T13A 4V0BA 5I6YA 2ALYB 3NWTA 1Q86C 4HR7B 1WTRA 3N6RA 4A3DH 2K4KA 1JE4A 1J9OA 4C3HH 1WCMB 3OHXC 2JA7B 4DR4Q 3GV3A 4L5QA 1V43A 1HPCA 1FNUA 4A3BB 3CD6A 1FJGQ 1G6PA 4ME5A 1KDCA 2WB1E 1O7YA 1OXVA 1YJWA 2QW7A 1MSHA 1RL2A 4G7OC 4DV2Q 4UP8A 4P73A 2B3GA 1WCMG 5DM63 5T1GA 4MIUA 1WTPA 3GTMH 4XT3B 4BY1H 4A3IH 3X3MA 5D14A 1MIUA 1NAPA 3K57A 3RLNA 1G6ZA 1EEID 4K2KA 4X3UA 3QWNA 2HHHL 1Z7TA 4EGVA 4KKTA 2RSOA 1Z6HA 4B3SL 2TMPA 1QVFA 1CTMA 2Q8IB 4DV0L 1VQBA 3J80E 1PTOD 4DR6L 1F2MA 4HJ9A 3J81c 2R7DA 4H7BA 2EY1A 2NTSA 5CV6A 1Q90A 4WJ4A 2NZOA 2QCPX 2O5IC 4G7ZC 1G91A 3ND8A 1I94L 2CWAA 3Q22A 1G51A 1S5DD 5IGDA 5C44B 4DAVA 4HJ8A 3CQZB 5C4JB 1IL8A 1CM9A 2XNAC 1WFQA 4AQYL 1WOCA 3K0YA 1K8AC 4QL5A 4YIJA 1ML0D 1Q1EA 2KCMA 4PG3A 1WTXA 4GKJQ 1PH4A 5JJLA 5ELNA 3V96A 2UXCL 2RA4A 1I4PA 1TWAH 2C9OA 1YHBA 3D0FA 3GP7A 4PNYA 3CMAA 3MWYW 3J81j 3NK9A 2JA5B 4F8MA 4IFDI 1RJTA 2E2IB 1PRTC 3GTKB 2BCOA 1EY7A 3DXJC 1Q46A 3KF6B 2B63G 4DV3Q 4DV5Q 2E5LL 1XXGA 4J6HA 2BH8A 4A93H 1CZGA 2WFWA 4IUUA 3G6JB 2VB2X 1QE6A 2X6LA 5IGBA 2Y0SE 5C0XJ 2RQXA 1SNOA 3VDYA 2JA5G 3U4ZA 1I4HA 1EY9A 1F2ZA 4YHHL 1QNKA 3I56A 2NN6H 2B2TA 4DPGA 3U50C 4N9TA 2QA4A 1TY2A 1XNRQ 2ZTEA 2RBMA 4C1NI 4GLVB 2M00A 2JA6B 1R4QB 4UP9A 4GZYC 5DLQE 3L2PA 1IYVA 2LFNA 2Q2UA 2A19A 4M8AA 5C5LA 2KCCA 1TY0A 2NVTH 1P16A 3H3VI 1BR9A 2EYLA 5C3EB 3HOZH 2ZXOA 2F1MA 1IKMA 2D2CC 3BS1A 3NUCA 3K5OA 1GUGA 4K8JA 3GTJH 3G7LA 1WVLA 2Y0SB 1YVCA 4X3SA 3CCSA 1HNWL 4WJWA 2DUDA 5JAVA 2MO1A 4QQBX 5CORA 2UXBL 4B3RL 2YV5A 1A15A 2A73B 3HKZE 1BCPD 1KAAA 2B2VC 5FOBB 1I6VC 4H44C 4LF5Q 3S2HB 4M1UB 1BBUA 1A2UA 4GNXA 3P1HA 2B2YA 2C5CA 3G4SA 1LT5D 2PZUA 4J1MA 2ZT9C 1V9PA 2ENBA 1TWHB 3HOUH 2YU9B 2A6HC 4R4QA 1CHPD 2QILA 2QKIC 1VQ7A 1TWGB 2JYOA 4DV4Q 1HR0L 3M4OB 2HD3A 2UUAL 2VUMB 3BVZA 3KLSA 3PO3B 1BBWA 3CC7A 1ET6A 3BYTB 1J8IA 1K8MA 2N3SA 4DAYB 3ICEA 1IYJB 3S15H 1K28A 1E7ZA 2IJ0A 3Q8DA 1SE2A 3RLOA 4JI4L 3MXGA 2F4IA 4A3LH 3CRKC 1X3FA 2SEBD 1YNNC 3HKZB 1I94Q 4LFAL 3MXNA 1CKNA 3PIP3 1J5EL 3J7YW 2R93H 1T5XD 2RVLA 3RZDB 5FK9C 4DKAC 1TS3A 4L6TB 1X3PA 2IWHA 1GJXA 4A76A 1JWSD 2VQEL 2HT1A 4A3FB 3BU2A 2I5HA 5KYLA 4Y52H 4PMCA 3NBHA 4Q5VA 4R4TA 3MTSA 4TRDA 2WKDA 2ZJQA 2E75C 1LLRD 3W1BA 2KUMA 2IY5B 2AWNA 1Y1VB 4NXMQ 2NUCA 1O7LA 3MFYA 4FP5D 1D8LA 3ZJYC 4X65Q 1N34L 4IFDG 2CHBD 1WCMH 4DR3Q 2BDOA 3W2DA 2IPKD 3SDZA 2JA7H 2BE5D 4F7XA 1TT2A 4QUCA 4EQOA 2MO0A 4BA2I 4HIMA 2Z4IA 1LT4D 2L12A 1B44D 2DNEA 1KQSA 5K36G 1EOTA 1ENAA 1ZXTA 4XQJA 1EQTA 3RD4A 5E7NA 2IX3A 2JA8B 4DR7L 1DM0B 2QEXA 3K5LA 5GROA 1D7QA 1RKNA 4QUFA 4TVAB 1JOOA 3GDEA 4QY7A 4XT1B 1C9OA 3A8IE 1HQMC 2AQ2B 4LF4Q 2L0CA 5IT9E 3UI2A 4NKLA 1CSQA 3AYHB 3RNUA 3U9SA 4JG2A 2JA8G 3L3OC 4O0AA 1A2TA 4DR1L 4IZ8A 3EA6A 4LUZA 1EQRA 1IBKL 4IQZA 3J7A5 3OW2A 3F2CA 5HGQA 4DR2L 2LXKA 1B3QA 3CCMA 5JEAJ 3DWQA 4IPGA 3S1MH 4LJZC 1R4PB 4QF4A 2OXPA 3OPOA 1PA6A 2FINB 5C44H 2KHSA 1GHJA 4FO2A 5ELFA 3F1ZA 1RHPA 1IYUA 4HIOA 2FFKB 2PZTA 3CQZH 2Q2TA 1PH1A 4WJ3M 5IYCG 4BBSG 1XX8A 1YI2A 4L63B 4C3HB 2B63H 3TEHB 2VQFL 1DCZA 3SHLA 1NR4A 1SYCA 1I3QH 1SNPA 4I65A 1AZQA 4LF8Q 2F0QA 1V1OA 5M5WB 2ZM6Q 3NQIA 3EJIA 4ILWA 2VNUD 3KLSX 2PQEA 1IBMQ 2JA5H 2DY7A 4IOAA 4RA8A 2L15A 4DR5L 2YTVA 4MTNA 2F0FA 2E2IH 1OXSC 3D31A 1TWCH 4A3CG 1ONLA 3BJUA 2B29A 1B8AA 5IP9G 5IODA 1KIXA 3I73A 3E3XA 1X6OA 3GTMB 4MN3A 3HOXB 4ZYSA 4BY1B 2L9HA 1SDFA 3PQIA 2CQAA 4YCUA 1VCIA 2MQHA 2UU9L 4DA2A 1GOZA 1K0RA 3RUZA 4RCOA 2Q8TA 2K52A 5CV5A 1HFGA 5J39A 2JEAI 1GVPA 4LF9Q 3T1HL 2KECA 2PCFB 1CI3M 1M8AA 1L0WA 3HOXG 4KHPL 1II3A 2Z1CA 4JYAQ 1G8ZD 1E2VA 1P8LA 1XPOA 1B3AA 3QG1A 1BVSA 1XJVA 3ULPA 5IWAQ 5CV4A 1MBYA 3PF4A 3KLRA 5BR8Q 5C3EH 1C0AA 2EYHA 2EJMA 2IX1A 3R2IA 2VZAA 1V1PA 1I4RA 4ZCKA 4JI3L 4DU9A 1JORA 1OXUA 2CVRA 4P2CB 5KRUA 1MSGA 2OEOA 3HFZB 5LMNQ 4XQNA 1FVIA 1VS0A 3H15A 4HMJA 4POGA 3PIPA 3AMUA 3HP3A 1XNQQ 3HG9A 1B7YB 2OT2A 3S2HH 1STAA 4OO1I 1CZWA 1PYWD 2E8GA 2NVYB 3D4RA 1BBXC 1DGSA 1FL0A 3MXPA 3PUYA 1PYSB 2HCCA 5M9OA 3P75A 2TSSA 1TWHH 4KI0A 4QJFA 2YU9H 2K5WA 1X3GA 1TWGH 2FMCA 3ULLA 2VUMH 4DR4L 1F77A 4KY6A 1TWFB 5EGTA 1A63A 1FJGL 2EJGC 2UUBQ 2AHOB 1JICA 1YIJA 4ZLTF 4G4KA 4XIGS 2H1EA 2QGQA 1GO3E 5M5YH 1I50B 1ZYRC 1DZ1A 1B9MA 4CKCA 5A2QE 4DV2L 1RIPA 4ZAIA 1CFMA 1I4XA 3NELA 4IJHA 4CKEA 1K8GA 3BZKA 4DK0A 3RZDH 1HNZQ 5EPLA 3PMFA 4IFDH 3A7LA 3CHBD 4BA1I 2WAQE 2V4DA 3RR5A 1IXRA 3E6ZX 1T9HA 3FDTA 2PZWA 3QO2A 4KD4A 5D3IB 2ZXRA 1EUJA 1WTHA 2SOBA 1EFWA 5LL6S 3A56A 1PH2A 3IFTA 3GTOH 3K6OA 3EQLC 1N33Q 4LUOA 1WTQA 1S40A 2HIVA 3NE5B 5K36H 3GQBA 3HOWG 1SMYD 1TXYA 4HCEA 3C1EA 4CDFC 1ENCA 4KMUC 1B2TA 1HRJA 5C4ZA 5FKAC 1PH9A 2EZVA 1JJGA 3I72A 2WINB 4IUTA 1EU3A 3JC66 2WACA 2VW9A 2WAQB 5BN5A 4NPSA 1JOQA 4KN4C 3CCUA 3H3VH 2JA8H 4L5SA 2UXDQ 4EQ5A 3I4NB 2PMZE 2XWJB 4JVZA 2E2DC 5HY6A 1XYIA 1XPUA 4GKJL 1YZ6A 4GOPB 3H0GB 4JBMA 4JC0A 3FEWX 1STNA 3HGBA 4IUPA 1H9SB 1Q12A 5ELBA 3PGZA 1S3OA 1PRTD 1O80A 2A74C 3J7AF 1XMQQ 1SMXA 5KYIA 1EIGA 3FKIB 1U4RA 4HTHA 3I4NG 2GVBA 4LAAA 4DV3L 4DV5L 2A6EC 4DXGA 5IYCH 2VL6A 3H0GG 3R3OA 4BBSH 1CA6A 1FGBD 4HEDA 1LTTD 2AUKA 3PSIA 1S5ED 3WOFA 3D3RA 1GUWA 1PYBA 3OIPA 2F0TA 3CC4A 1EYGA 3FKIG 3NPPA 2RDFA 2RDHA 2UUCQ 1GHKA 4HN7A 1CKMA 1ZEQX 4P72A 2Z9HA 3I4LA 3HRZC 1XNRL 5KEEA 4BXXG 2GVAA 3AB9A 3LWEA 4A3CH 4AYBG 4LFBQ 1NMFA 1NTGA 3K80C 3LWUA 3ULJA 1NUCA 4X3KA 1KL9A 2H5XA 2EJFC 5GQOA 5EKLA 1WYDA 1VQKA 5M5WH 1Q8IA 1Z47A 4JI8Q 1HZCA 2A8VA 4LF6Q 3MA2B 1ILQA 3CPFA 3KLWA 3K0XA 3NXWA 1AH9A 3CCQA 1JMCA 1PV4A 2WKCA 3KK7A 1KD1C 1AE3A 4AIMA 5CMDA 2R7ZB 4LF5L 1QCBD 3HOXH 2B2VA 1A3TA 1QVCA 3DWPA 2A6HD 3K7UC 3QB3A 3BDLA 3CF5A 1PFMA 1Q3LA 1SYFA 3BZDB 2VY3A 1X55A 4JW0A 1SE4A 2L11A 4JI6Q 4DV4L 1IW7D 1SAPA 3JAML 1PXUA 3BVMA 2R7ZG 1YNND 1C7YA 1EFID 4B9WA 4ALPA 4OEMB 1LT6D 3C1FA 1VQ8A 3F2UA 4NXNQ 3S1NH 3GD7A 1SMYC 1HXYD 2FMMA 3S1MB 3FPUB 1B70B 1DOKA 2F52A 5CR3A 4A3KB 3TZDA 1KXLA 1JOKA 4CJ0B 2E2JH 2OWOA 1PZID 2ZJPA 1PZKD 4C2MH 1AP0A 4KKUA 3QIAA 4MZ9A 4PZ7A 3NTIA 5EBDA 3KUPA 2B63B 3T4AC 1FR3A 4ZQ3A 2Z4HA 2EYPA 4J8QA 4ZUIA 4RFBA 2N88A 1I3QB 1EQVA 4BBRB 4A3KG 3NP8A 3TP8A 1EZ6A 2NVYH 4NXML 3SK6A 3L7ZC 3A0JA 1PVOA 3BDCA 1L2FA 1N32Q 2F0JA 2WB1G 2F0KA 4X65L 2K33A 1L1OB 4HJAA 5LHY1 1TWCB 5GAGC 4DR3L 1B4OA 1LTRD 1S5CD 2YYZA 2MNAA 1WTWA 4GKKL 3OSOA 1TWFH 1AEXA 2C35B 5A35A 2K32A 1PZJD 4BBRG 4Q0FA 1LYLA 1YHAA 1VQMA 3D4DA 1Z9FA 1IKLA 3Q6SA 2PQAB 1I50H 1AN8A 2IW3A 2A5HA 2MPMA 4I7ZC 1EY8A 3EROA 1YJNA 1KDBA 1E2ZA 1EU4A 3D6CA 2OTLA 1QVGA 1KABA 4U68A 4DV1Q 3C3LA 1JB3A 1HTPA 2D5DA 5EBCA 5IT9c 4OWTB 1EEFD 4LF4L 4CDDC 1O7IA 4CHTB 1RDPD 4ME3A 3OIQA 1NJIC 2J7ZA 3VA5A 4RCNA 1STGA 1YITA 2R7FA 3AFPA 1SNCA 1SJHD 3HEJA 4LUVA 1D6EC 4GN3B 1FGUA 3OYYA 1HZ9A 1IL2A 3U4VA 2R92B 1TU2B 5M3MG 2GA4B 4G57A 5IYDH 4H13C 4C3IG 1YJ9A 2E76C 2LMCB 1UE6A 2A69D 4RKLA 3UDIA 2F0MA 2MJ8A 2F0DA 2PNHA 2CWPA 1BKBA 3E5SA 3FVQA 3IRBA 3WWVA 4QGUA 4YWLA 3S1RB 3VA7A 2R92G 4R8IA 5M3FG 3VR2A 3HZXA 3R2TA 2Q8RE 1EZ8A 3I4NH 3TS2A 2O5JC 1R9TH 3KBXA 4BWGB 5CBAE 1CT1D 2G9HD 3EVQA 3H0GH 1TKWB 4NB3A 1ILPA 1N8RC 4LF8L 2JK8A 3OOCA 4IUVA 2LSSA 1TVXA 4KD3A 4BS9A 2ZM6L 2K05A 3T1YQ 1IW7C 5IE8A 4NP5A 3C2PA 3N52A 1Y8OB 1IBML 2KQ3A 5M5YB 2AUJD 5EKKA 3H3VC 1HJPA 2A68D 3FKIH 4OO1H 3ND9A 4WFN3 3ERSX 1T5EA 3J81L 4BXXH 1JR0D 1PDQA 2B2WC 1BUVT 2RSNA 3RN2A 2CFMA 2K04A 5JVG3 1JQYD 3UE0A 4LNQA 3TREA 4YCVA 3NSWA 1CA5A 3GTOB 1G291 3VR5A 1ZKOA 4LF9L 4E6IA 3CCJA 2ASBA 2F3IA 2I5LX 5ELCA 3KDFA 1K83B 3NBIA 2F0LA 4JYAL 4H02A 3CCVA 1SNQA 3IAYA 4IFDJ 3A8JE 1VQ9A 5IWAL 3OTOQ 1DD2A 1LTGD 4GKKQ 1I4QA 1CSPA 5BR8L 3VYUA 3A74A 4X62Q 1EYCA 3P7JA 2QF7A 4P71A 3MVVA 3C46A 1SSOA 2F03A 4UPAA 1NCVA 5LMNL 3HS0C 2F0SA 2RCFA 1VQEA 4HJ7A 3TRZA 3PUXA 3KBGA 1VQFA 4DV7Q 1XNQL 2R7ZH 1AFPA 1MD2D 1SROA 2EY5A 4XDXA 4EVOA 4EQPA 1QUQA 4IPDA 2X6GA 1XTDA 2Z8LA 3VR3A 1GUTA 1SXTA 5IGGA 5AJ3Q 4FF2A 5HURA 5GAHC 4A3JG 1PTOB 3FHWA 2F0GA 5IOCA 4PZ8A 2EYJA 2NBFA 4ABNA 2KHJA 5ELEA 3GTLH 1K3BC 1LACA 2J4XA 4OGQC 3GTQH 4BBSB 1ZYRD 2UUBL 3Q23A 4RKBA 4IOCA 1Q7YC 3J7ZC 4N9PA 2AQ3B 4HSPA 1W6JA 1HZAA 1U0LA 2F0EA 2PI2E 3WOEA 2HUGA 5DM73 4A3KH 5J1ZA 4RH6A 4KJNA 1OTCA 4JOIC 1PH6A 5I6WA 4FF1A 1HNZL 2PW7A 4K6LA 3VYTA 2A69C 3PF5A 1W2BA 3OW7A 1BNZA 1SN8A 2KCNA 1VQ4A 1N36Q 5D3DA 5NUCA 5FO8B 3E0EA 4HAEA 5JEAG 1EIHA 2B39A 3KF8B 2DJGC 2HQEA 3QOLA 1NY4A 1LM0A 1HNXQ 3RMHA 1S5FD 3NTHA 1QZGA 4BBRH 5I2XA 2D62A 1SLJA 1N33L 4A3GG 2JXMB 1NE3A 2F0UA 3NTKA 4N8FA 3TBIB 5LL6X 4YY3Q 1SFOB 2BDNA 2F3VA 4XYOA 3UE1A 3F2BA 4K5XA 2IL8A 1K8OA 4PMWA 4R1JA 4O1NA 5JJKA 2NTTA 2PNRC 5T1IA 5G3LF 3E9HA 2A68C 4A3EB 4QMGA 2CW0C 4G7HC 3KJOA 1WJJA 2GN5A 4HIDA 4RHSA 3PIO3 1K3RA 4DV6Q 4LF7Q 3SVMA 2K5VA 2AMCB 1DXMA 3F8TA 2KCTA 3M4PA 1OO9B 1QZHA 1S4ZA 2UXDL 1UUPA 3J80i 2KHIA 1VF7A 1F9RA 3R93A 4C3JB 4C56C 5GAEC 4FF4A 5M5XB 1KRSA 1JWUD 1ENFA 1UNSA 4A3EG 2QDBA 1K9MC 2KEDA 4BY7G 1E1TA 1EY4A 1DYQA 4KHVA 5FLXc 2A6ED 3F2DA 1XMQL 3S1NB 2JA9A 1GXDC 3I90A 3K7AB 4FF3A 5EAYA 4C3JG 4JPBW 4GNXB 1I4GA 2E2JB 2F0WA 1OXXK 3NWSA 1V8QA 4C2MB 2R92H 3U9OA 1BCPB 2DNCA 5M3FH 4LK1C 3MC0B 2NYZD 4JBWA 4K5VA 3EFXD 3RZOB 2J0TD 4C1NK 1SR3A 1GUOA 1C4QA 2R6GA 2XIWA 2UUCL 2KEEA 4RMFA 3PO2B 4N8X1 2BA0A 3V05A 2K5HA 4R8NA 1HCZA 1X3EA 3S1RH 1KLGD 1U4LA 1XTCD 5C5MA 2EXZA 4LFBL 3MXNB 3KFUA 3E0JA 4KV6A 1CKNB 1EWIA 1VQLA 4X64Q 1EQQA 5IGFA 1B9NA 5F2DA 1S5BD 1JE5A 5EKIA 4P74A 4K14A 1L0YB 3S14H 4IALA 2K14A 3I4MB 3TS0A 3GTPB 4JI8L 1FNWA 2L5TA 2F3WA 2F0IA 4LF6L 1A62A 3PO2G 2MHVA 4FVMA 5C3XA 1TQOA 1VMPA 2CH4W 5JJZA 1QNUA 3A54A 5D65A 1ET9A 3NBHB 3BG3A 2YTYA 1WD0A 3W3AA 2N8NA 1E22A 2MFIA 3DHQA 4GOPC 1HUNA 4YWKA 4K2LA 1HZBA 4TKOB 3HOWB 3V2TA 4X66Q 1OXTA 2OCEA 3I4MG 5FO7B 1H95A 1M1KC 2Q2HA 3BYYB 1HA5A 2IHEA 4K6DA 1E2WA 1SNDA 1HR0W 1Y8PB 3DM1A 3D8GA 3HOVB 1UEBA 3M7GA 2DJFC 4JI6L 3J80c 4GLAC 3T53B 3G48A 3KF6A 1D1KA 4XQQA 3KJPA 4DNTB 4KLKA 3B6YA 1JJ2A 3O13A 1K83H 4OHJA 2N55A 2CKZB 4IPCA 2K50A 1I5FA 3J7AV 4GLXA 4NXNL 5IIFA 1ICFB 5IP7G 4CGYB 1NMGA 4K8IA 1EY5A 1U5KA 3HOVG 1UE1A 2EXDA 1QJOA 4UAIA 3K59A 3DM3A 1CK1A 2XN9C 4A3MB 2NN6G 3QJYA 1PH3A 4UHVA 2I5MX 1X32A 5KNBA 3MHBA 4L5TA 3QOJA 1WI5A 1PFSA 4F87A 2EYOA 2F4VQ 5CV7A 4JI5Q 2ATWA 1FD7D 4JV5Q 3IKJA 2L55A 4OIKA 1QOHA 1A0IA 1PLFA 1R9TB 3W5OA 4HIKA 3URYA 4HSVA 5C4XB 2FHTA 4YWMA 3HOYG 1VQJA 3I55A 1EIYB 2M2LA 2HDLA 5C4HA 4A3MG 3HOZG 1X3QA 1CHQD 1N32L 2ZTDA 4DFAA 5EPJA 4KN7C 1PTOH 2K5QA 2A1AA 5J3BA 5JVH3 4DK6C 4ZUJA 1BXTA 2Z0SA 1SYDA 2E74C 2ICIA 5C4XG 1K73C 2EOTA 3UDFA 4OXPA 1HHVA 4DUYQ 2B2UC 1ESRA 2RHSB 3T51B 1SNMA 4AYBB 5J22A 5FLXL 1JB7A 4FXDA 1RODA 1SJED 5CV9A 1BCPF 1MJEA 3PCOB 4A3GH 1KDAA 4DV1L 1N9WA 2QDLA 3GTGB 4CJ1B 4ZKCB 2DY8A 4DAYA 5G3LD 2OQKA 4LFCL 5C0XI 5IP9H 5JJIA 4IURA 4CBVA 3M3YH 3TP5A 1PH8A 2N78A 4UDUC 1PH5A 2CH4A 2KJXA 3GO5A 5CV8A 1C8CA 1EOVA 2ZJRA 1SFOH 2QEJC 1JC7A 4JI0Q 1TS5A 1GD7A 2R93G 2MP1A 4B3MQ 1STHA 1QB5D 3X3NA 1EL0A 5KNCA 1KNEA 2OQ0A 2AKWB 3AQQA 1RTOA 3FMCA 4CKBA 1X56A 4A3EH 1W3SA 5HGTA 1DJRD 4BY7H 2AWOA 1ASZA 4QCLA 3H6MA 2K28A 2KVMA 1L1OC 4Z9CB 1KAWA 3M9BA 1AE2A 4B3TL 5DEHA 4QB4A 3H94A 2K75A 4HMIA 1LTLA 2D0OA 4C3JH 4JI2Q 4EQNA 3GTLB 4JI1Q 2JA7G 1V1PB 2K5DA 4GN4B 4DGZA 3GTQB 2CQOA 5M5XH 4NMZA 4R4CA 4OX9Q 4A3BG 1U4MA 1ICWA 3T1YL 3VR6A 3JAME 1STYA 3BDOA 5IGCA 4RGMA 1SE3A 3J80L 3K7AH 1VMCA 4LW1A 3I4OA 4JK1C 1YNJD 1MI2A 2EIFA 1YEZA 4APVA 2SNSA 5I2YA 2WB1B 4PMBA 2ZXPA 2HIXA 2B2WA 3OWEB 4KHZA 2F0PA 3RZOH 5EQ0A 2F0VA 1A8VA 1M4VA 3HKSA 1SEBD 2Z6KC 2N49A 3CAMA 5DAUA 4R9WA 1VQ6A 3DEPA 3PO2H 1BDOA 1HH2P 4DAPA 1SBBB 1LTID 1EWHA 1ASYA 5E1FA 4OELB 1STEA 3OTOL 1B53A 1F2LA 3MFGA 2D0PA 2XTIA 3T56B 2IHFA 4ZKBB 1WTVA 4FXGC 5LMUQ 4KY5A 3S2DH 3SK5A 4X62L 2V1CC 3SK4A 1LV9A 1KNAA 3I4MH 3GTPH 4OONA 1LTSD 2F0OA 5C44G 4OL7A 4OWXB 4CDEC 1K0SA 1SYBA 1VQ5A 1XMOQ 2EQSA 3OMGA 1G2SA 3I2ZA 3T16A 5CGKA 1X65A 3KF8A 4I7AA 2LKVA 3QR8A 1MKHA 4JI7Q 3STBC 4DV7L 1PH7A 2DGYA 1RCVD 3HOWH 5FLMG 4MTKA 5M3MB 4FNFA 3H91A 1W6KA 2RHQB 4C3IB 5AJ3L 1WD1A 4LFCQ 3DMUA 2I07B 5IP7H 5C0XG 3ONAB 1LUZA 1QILA 2PI2A 5ELDA 1AW7A 1SRUA 3FRPB 3HOVH 3PUWA 4PV1C 5BN4A 5E3FA 4XXEA 1V1QA 1Q8KA 1QG7A 3NENA 4ODGA 4AH6A 1Q81C 2PW5A 3LNNA 3FPPA 5M3FB 2L1BA 2P5ZX 2EPBA 4DUZL 1H9JA 3HOYH 3SGIA 2VS1A 4PQXA 2CCZA 4A3MH 4JOIA 2Z6BA 3MZ5A 4IJLA 5FO9B 1GUSA 4ZK9B 1UWVA 2KA7A 2LY7A 3PUZA 2RDGA 1EWCA 3IFDA 4DN4M 1N36L 1KTKA 5CYUA 1HTLD 2JA6G 4B3TQ 3S1QB 2NZ1D 3K58A 1STBA 1PRTB 2NZHA 3VYSA 1SE8A 5C4XH 1HNXL 1BOSA 1D5XC 1I6HB 1U9RA 1B50A 3U58A 1NBWA 3RLFA 4TQUS 5C3EG 3DLLA 3S14B 4MHEA 2HQLA 5JPNC 5C6AA 5I9PA 4YY3L 3MEHA 2HHHQ 2Y0SG 1EYDA 5I4DA 2CW0D 1KC8C 2YTXA 3CC2A 4B3SQ 3TP6A 1PFBA 3S17H 4DV0Q 1QWYA 2R61A 4DR6Q 2VB3X 2JJQA 4KY7A 3S16B 3CU7A 5EPKA 1YNJC 3ER0A 3J81E 1UEAB 4DV6L 2KBNA 2WIIB 1PTOC 3ITPA 1KLUD 4LF7L 1KHIA 2RCNA 4RG1A 3EBEA 1WTOA 1M90C 3SK8A 5ELOA 3IL8A 2EVBA 1G2TA 1AZPA 2K1BA 1VQIA 1F9QA 2R3ZA 2VUMG 3GTGH 1BQQT 3ERQA 3VYRA 1VQOA 1X9NA 3PO3G 1JJCB 5C3WA 5IYBG 4AQYQ 2JSOA 3M4QA 2XVSA 4WORA 5CC4A 3HKZG 4WRDA 4PZ6A 2UXCQ 2SNMA 3I7FA 3K8AA 1A3UA 3SEBA 4CDCC 4A3JB 2NVQB 4P75A 5KNDA 2JP1A 1YBYA
chains in the Genus database with same CATH topology
1EY6A 2OF1A 4H0LC 5TSSA 4B08A 3NQTA 3TSSA 1FYCA 4V190 1Y8NB 2O4XA 3A55A 1RF2D 1CQFA 5ISRA 1GUNA 1EY0A 2O2LD 3M7NA 2EY2A 2JEBI 1RTNA 5AFWA 4F88A 3SXHA 1TR5A 2NWGA 2B2TC 1C48A 4DXFA 4O42A 2NB0A 3OMCA 5COYA 4X3TA 1O7ZA 5IT9L 2E2HB 1LTAD 1D1IA 2K03A 4XYQA 3TDQA 4Y7NB 3A7AB 1O78A 1Y1WB 2NVXB 4A3GB 4TSSA 1D5ZC 1SYEA 3TZUA 1RD9D 2G9DA 1H9SA 1L0XB 1EYAA 2ICEC 4ID6A 3DUZA 3I70A 4RHRA 2EYFA 1LO5D 1VDZA 2K6AA 5K5PA 3M3YB 4KTAA 1PRTF 1U4PA 1NSNS 3P20A 2B2YC 3WDNA 4CJ2C 3I91A 1BCPC 2PYKA 3PUVA 4A3DB 1XWEA 3M4YA 3ZYYX 4NW2A 3I8ZA 1IHZA 1F9PA 2K7VA 2NN6I 4BY7B 4RGNA 1NR2A 3OWFA 5C0XH 4QIWB 3DWAA 1TS2A 2KOLA 2HCIA 2LS01 3SE0A 4C3HG 4FYDA 5CBEE 3PV0A 2IX0A 1VF5C 1B1ZA 2X69A 4A3IB 4DK1A 1H9MA 1H9RA 1LT3D 3I3CA 5KIXA 5E4XA 3CKIB 1H9KA 4U673 2XWBB 1Q1BA 2F0NA 5JOBA 3M85A 4B9XA 2B2UA 2B8GA 1JWMD 2M9VA 3TN2A 2MUYA 2DN8A 4ZRZA 3Q24A 5I9OA 2L4NA 2EYMA 2BE5C 4K5WA 1A3VA 3D4WA 2WP8J 1SYGA 1PTOF 4DNRB 1BO0A 2PO4A 3S2DB 1DOMA 2FJ2A 1TWAB 4LMQD 1D2BA 3L9AX 1MGSA 4KJOA 1DONA 2B8FA 1TS4A 3VR4A 4RGTA 5BN3A 4DF7A 4KK7A 3Q0AA 4A93B 1UAPA 5A2QL 2XSCA 5JPMC 3MAQA 3K5NA 1CQVA 5EJWA 4RAUC 3AU7A 1F2YA 2EE1A 4FXKC 2D9UA 5DNFA 3NHHA 4ULLA 3K5MA 1Y69U 1ESFA 4XTCS 1A6XA 3HOYB 2IT1A 2NVTB 1HA6A 3HOZB 2SDFA 3TMEA 1LTBD 3GTJB 4HCSA 3H09A 1HQRD 1DOLA 2VXWA 4IUQA 3TP7A 2WV6D 1LABA 2HDMA 1TIID 2AQ1B 3R8BA 4RWSC 3BVGA 3HOUB 3S9WA 4IUNA 1HFNA 2XRQD 1FNVA 3SR1A 3S17B 5KGUA 1E0BA 4L8JA 3GV6A 5E4WC 3S15B 3CRLC 2BOSA 2MGSA 5JEAH 2BA1A 1D5MC 4NDXA 2EY6A 1PFNA 2PPBC 3LX0A 4S3SA 5FLXE 2K01A 2EDGA 4IN3A 2JE6I 3A8KE 1F9SA 2R93B 5IGEA 1JCKB 3DEOA 2XRSD 1PMRA 2I46A 4OIJA 2PMZB 3D6WA 1BF4A 4RGOS 1HUMA 2H4OA 2ID0A 2F0HA 4KKSA 2RKSA 4OO1G 3MXUA 3T13A 4V0BA 5I6YA 3NWTA 4HR7B 1WTRA 3N6RA 1JE4A 1J9OA 1WCMB 3OHXC 2JA7B 3GV3A 1V43A 1HPCA 1FNUA 4A3BB 4ME5A 1KDCA 1O7YA 1OXVA 1MSHA 4G7OC 5DM63 5T1GA 4MIUA 1WTPA 4XT3B 3X3MA 5D14A 1NAPA 3K57A 1G6ZA 1EEID 4K2KA 4X3UA 3QWNA 1Z7TA 4EGVA 4KKTA 2RSOA 1Z6HA 2TMPA 1CTMA 2Q8IB 3J80E 1PTOD 1F2MA 4H7BA 2EY1A 2NTSA 5CV6A 1Q90A 2QCPX 2O5IC 4G7ZC 1G91A 3ND8A 3Q22A 1S5DD 5IGDA 5C44B 4DAVA 3CQZB 5C4JB 1IL8A 1CM9A 2XNAC 3K0YA 4YIJA 1ML0D 1Q1EA 1WTXA 3V96A 2RA4A 1I4PA 2C9OA 3GP7A 4PNYA 3MWYW 3NK9A 2JA5B 4F8MA 4IFDI 1RJTA 2E2IB 1PRTC 3GTKB 2BCOA 1EY7A 3DXJC 1XXGA 4J6HA 1CZGA 4IUUA 3G6JB 2VB2X 1QE6A 2X6LA 5IGBA 5C0XJ 2RQXA 1SNOA 1I4HA 1EY9A 1F2ZA 1QNKA 2NN6H 2B2TA 4N9TA 1TY2A 2RBMA 4C1NI 2M00A 2JA6B 1R4QB 4GZYC 1IYVA 2LFNA 4M8AA 5C5LA 2KCCA 1TY0A 1BR9A 2EYLA 5C3EB 2ZXOA 2F1MA 1IKMA 2D2CC 3BS1A 3NUCA 3K5OA 1GUGA 4K8JA 3G7LA 1WVLA 2Y0SB 4X3SA 4WJWA 5JAVA 5CORA 1A15A 2A73B 1BCPD 1KAAA 2B2VC 5FOBB 1I6VC 4H44C 3S2HB 4M1UB 1A2UA 3P1HA 2B2YA 2C5CA 1LT5D 2PZUA 4J1MA 2ZT9C 2ENBA 1TWHB 2YU9B 2A6HC 1CHPD 2QILA 2QKIC 1TWGB 2JYOA 3M4OB 2VUMB 3BVZA 3KLSA 3PO3B 1J8IA 1ET6A 3BYTB 1K8MA 2IJ0A 1SE2A 3MXGA 2F4IA 3CRKC 2SEBD 1YNNC 3HKZB 3MXNA 3PIP3 3J7YW 1T5XD 2RVLA 3RZDB 5FK9C 1TS3A 4L6TB 1X3PA 2IWHA 1GJXA 1JWSD 4A3FB 5KYLA 4PMCA 3NBHA 4Q5VA 3MTSA 4TRDA 2WKDA 2E75C 1LLRD 2KUMA 2AWNA 1Y1VB 2NUCA 1O7LA 3MFYA 4FP5D 4IFDG 2CHBD 2BDOA 3W2DA 2IPKD 3SDZA 2BE5D 4F7XA 1TT2A 4QUCA 4EQOA 4BA2I 2Z4IA 1LT4D 2L12A 1B44D 2DNEA 5K36G 1EOTA 1ENAA 1ZXTA 4XQJA 1EQTA 3RD4A 2IX3A 2JA8B 1DM0B 3K5LA 1RKNA 4QUFA 1JOOA 4XT1B 3A8IE 1HQMC 2AQ2B 2L0CA 5IT9E 3UI2A 4NKLA 3U9SA 3L3OC 1A2TA 4IZ8A 3EA6A 4IQZA 5JEAJ 3DWQA 4LJZC 1R4PB 4QF4A 2OXPA 3OPOA 2FINB 2KHSA 1GHJA 4FO2A 5ELFA 1RHPA 1IYUA 2FFKB 2PZTA 1XX8A 4L63B 4C3HB 1DCZA 3SHLA 1NR4A 1SYCA 1SNPA 4I65A 1AZQA 2F0QA 1V1OA 5M5WB 3NQIA 3EJIA 4ILWA 2VNUD 3KLSX 2PQEA 2DY7A 4RA8A 2F0FA 1OXSC 3D31A 1ONLA 5IODA 3I73A 3GTMB 4MN3A 3HOXB 4ZYSA 4BY1B 2L9HA 1SDFA 2CQAA 1VCIA 4DA2A 1GOZA 3RUZA 4RCOA 2Q8TA 5CV5A 1HFGA 5J39A 2JEAI 2KECA 2PCFB 1CI3M 1M8AA 1II3A 2Z1CA 1G8ZD 1E2VA 1B3AA 3QG1A 5CV4A 1MBYA 3KLRA 2EYHA 2EJMA 2IX1A 3R2IA 1V1PA 1I4RA 4DU9A 1JORA 1OXUA 2CVRA 4P2CB 5KRUA 1MSGA 2OEOA 4XQNA 4HMJA 3AMUA 3HP3A 3HG9A 2OT2A 1STAA 4OO1I 1CZWA 1PYWD 2NVYB 3D4RA 1BBXC 3MXPA 3PUYA 2HCCA 5M9OA 3P75A 2TSSA 4KI0A 2K5WA 2FMCA 1F77A 4KY6A 1TWFB 5EGTA 2EJGC 1JICA 4ZLTF 4G4KA 4XIGS 2H1EA 1I50B 1ZYRC 1DZ1A 1B9MA 4CKCA 5A2QE 4ZAIA 1CFMA 1I4XA 4CKEA 4DK0A 5EPLA 3PMFA 4IFDH 3A7LA 3CHBD 4BA1I 2V4DA 3E6ZX 3FDTA 2PZWA 3QO2A 4KD4A 5D3IB 2ZXRA 2SOBA 5LL6S 3A56A 3IFTA 3K6OA 3EQLC 1WTQA 3NE5B 5K36H 3GQBA 1SMYD 4HCEA 3C1EA 1ENCA 4KMUC 1B2TA 1HRJA 5C4ZA 5FKAC 2EZVA 3I72A 2WINB 4IUTA 1EU3A 2WACA 2WAQB 5BN5A 1JOQA 4KN4C 3I4NB 2XWJB 2E2DC 1XYIA 3H0GB 3FEWX 1STNA 3HGBA 4IUPA 1H9SB 1Q12A 5ELBA 1PRTD 1O80A 2A74C 3J7AF 5KYIA 1EIGA 3FKIB 1U4RA 4HTHA 4LAAA 2A6EC 4DXGA 3R3OA 1CA6A 1FGBD 4HEDA 1LTTD 2AUKA 1S5ED 3WOFA 3D3RA 1GUWA 3OIPA 2F0TA 3NPPA 2RDFA 2RDHA 1GHKA 4HN7A 1ZEQX 3I4LA 3HRZC 5KEEA 3AB9A 3LWEA 3LWUA 1NUCA 4X3KA 2EJFC 5EKLA 1Q8IA 1Z47A 3MA2B 1ILQA 3NXWA 2WKCA 3KK7A 5CMDA 2R7ZB 1QCBD 2B2VA 1A3TA 3DWPA 2A6HD 3QB3A 3BDLA 1PFMA 1Q3LA 1SYFA 3BZDB 1SE4A 2L11A 1IW7D 1SAPA 3JAML 1PXUA 3BVMA 1YNND 1EFID 4B9WA 1LT6D 3C1FA 3F2UA 3GD7A 1SMYC 1HXYD 2FMMA 3S1MB 3FPUB 1DOKA 5CR3A 4A3KB 3TZDA 1JOKA 4CJ0B 1PZID 1PZKD 1AP0A 4KKUA 3QIAA 3NTIA 5EBDA 3KUPA 2B63B 3T4AC 1FR3A 4ZQ3A 2Z4HA 2EYPA 4J8QA 4ZUIA 4RFBA 2N88A 1I3QB 1EQVA 4BBRB 3NP8A 3TP8A 1EZ6A 3SK6A 3L7ZC 3BDCA 2F0JA 2F0KA 2K33A 5LHY1 1TWCB 1B4OA 1LTRD 1S5CD 2YYZA 1WTWA 3OSOA 1AEXA 5A35A 2K32A 1PZJD 4Q0FA 3D4DA 1IKLA 3Q6SA 1AN8A 2IW3A 2A5HA 2MPMA 4I7ZC 1EY8A 3EROA 1KDBA 1E2ZA 1EU4A 3D6CA 1KABA 4U68A 3C3LA 1JB3A 1HTPA 2D5DA 5EBCA 1EEFD 4CHTB 1RDPD 3OIQA 2J7ZA 3VA5A 4RCNA 1STGA 1SNCA 1SJHD 3HEJA 1D6EC 2R92B 1TU2B 2GA4B 4G57A 4H13C 4C3IG 2E76C 2LMCB 2A69D 4RKLA 2F0MA 2MJ8A 2F0DA 3E5SA 3FVQA 3S1RB 3VA7A 4R8IA 3VR2A 3HZXA 3R2TA 2Q8RE 1EZ8A 2O5JC 3KBXA 4BWGB 5CBAE 1CT1D 2G9HD 3EVQA 1TKWB 1ILPA 3OOCA 4IUVA 4KD3A 1TVXA 4BS9A 2K05A 1IW7C 4NP5A 3C2PA 3N52A 1Y8OB 2KQ3A 5M5YB 2AUJD 5EKKA 3H3VC 2A68D 4OO1H 3ND9A 4WFN3 1T5EA 3J81L 1JR0D 1PDQA 2B2WC 1BUVT 2RSNA 2K04A 5JVG3 1JQYD 3NSWA 1CA5A 3GTOB 1G291 3VR5A 1ZKOA 4E6IA 5ELCA 1K83B 3NBIA 2F0LA 1SNQA 3IAYA 4IFDJ 3A8JE 1DD2A 1LTGD 1I4QA 3VYUA 1EYCA 3P7JA 2QF7A 3MVVA 3C46A 1SSOA 2F03A 1NCVA 3HS0C 2F0SA 3PUXA 3KBGA 1AFPA 1MD2D 2EY5A 4XDXA 4EVOA 4EQPA 2X6GA 5IGGA 3VR3A 1GUTA 1SXTA 2Z8LA 4FF2A 5HURA 1PTOB 2F0GA 5IOCA 2EYJA 2NBFA 4ABNA 5ELEA 1LACA 2J4XA 4OGQC 4BBSB 1ZYRD 3Q23A 4RKBA 4N9PA 2AQ3B 4HSPA 1W6JA 2F0EA 3WOEA 2HUGA 5DM73 5J1ZA 4RH6A 4KJNA 5I6WA 4FF1A 2PW7A 4K6LA 3VYTA 2A69C 3OW7A 1BNZA 2KCNA 5D3DA 5NUCA 5FO8B 4HAEA 5JEAG 1EIHA 2B39A 3QOLA 2HQEA 3RMHA 1S5FD 3NTHA 5I2XA 2D62A 2JXMB 3NTKA 2F0UA 3TBIB 5LL6X 1SFOB 2BDNA 2F3VA 4XYOA 4K5XA 2IL8A 1K8OA 4PMWA 4O1NA 2NTTA 2PNRC 5T1IA 5G3LF 2A68C 4A3EB 4QMGA 2CW0C 4G7HC 4RHSA 3PIO3 3SVMA 1DXMA 1OO9B 1S4ZA 1UUPA 1VF7A 1F9RA 3R93A 4C3JB 4C56C 4FF4A 5M5XB 1JWUD 1ENFA 1UNSA 2QDBA 2KEDA 1EY4A 1DYQA 4KHVA 2A6ED 3S1NB 1GXDC 3I90A 3K7AB 4FF3A 4C3JG 2E2JB 1I4GA 2F0WA 1OXXK 3NWSA 1V8QA 4C2MB 3U9OA 1BCPB 2DNCA 4LK1C 3MC0B 2NYZD 4JBWA 4K5VA 3EFXD 3RZOB 2J0TD 4C1NK 1GUOA 1C4QA 2R6GA 2XIWA 2KEEA 3PO2B 2BA0A 3V05A 4R8NA 1HCZA 1KLGD 1U4LA 1XTCD 5C5MA 2EXZA 3E0JA 4KV6A 5IGFA 1B9NA 5F2DA 1S5BD 5EKIA 4K14A 1L0YB 4IALA 3I4MB 3GTPB 1FNWA 2L5TA 2F3WA 2F0IA 2MHVA 4FVMA 5C3XA 1TQOA 1VMPA 5JJZA 1QNUA 3A54A 5D65A 1ET9A 3BG3A 1WD0A 3W3AA 3DHQA 1HUNA 4K2LA 4TKOB 3HOWB 3V2TA 1OXTA 5FO7B 3BYYB 1HA5A 4K6DA 1E2WA 1SNDA 1Y8PB 3DM1A 3D8GA 3HOVB 3M7GA 3T53B 1D1KA 4XQQA 4DNTB 3O13A 4OHJA 2N55A 3J7AV 5IIFA 4CGYB 4K8IA 1EY5A 4UAIA 1QJOA 3K59A 1CK1A 2XN9C 4A3MB 2NN6G 3QJYA 1X32A 5KNBA 3MHBA 3QOJA 4F87A 2EYOA 5CV7A 1FD7D 3IKJA 2L55A 4OIKA 1QOHA 1PLFA 1R9TB 3URYA 4HSVA 5C4XB 2FHTA 2M2LA 2HDLA 5C4HA 1X3QA 1CHQD 4DFAA 5EPJA 4KN7C 1PTOH 2K5QA 5JVH3 4ZUJA 1BXTA 1SYDA 2E74C 2ICIA 2EOTA 1HHVA 2B2UC 1ESRA 3T51B 1SNMA 4AYBB 5J22A 5FLXL 4FXDA 1RODA 1SJED 5CV9A 1BCPF 1KDAA 3GTGB 4CJ1B 4ZKCB 2DY8A 4DAYA 5G3LD 5C0XI 4IURA 4CBVA 3TP5A 4UDUC 2KJXA 3GO5A 5CV8A 1C8CA 2QEJC 1JC7A 1TS5A 2MP1A 1STHA 1QB5D 3X3NA 1EL0A 5KNCA 1KNEA 1RTOA 3FMCA 4CKBA 5HGTA 1DJRD 2AWOA 4QCLA 3H6MA 2K28A 2KVMA 4Z9CB 5DEHA 4QB4A 3H94A 4HMIA 4EQNA 3GTLB 1V1PB 2K5DA 4DGZA 3GTQB 4NMZA 1U4MA 1ICWA 3VR6A 3JAME 1STYA 3BDOA 5IGCA 4RGMA 1SE3A 3J80L 1VMCA 4JK1C 1YNJD 1MI2A 2SNSA 5I2YA 2WB1B 4PMBA 2ZXPA 2B2WA 3OWEB 4KHZA 2F0PA 5EQ0A 2F0VA 1M4VA 1SEBD 5DAUA 4R9WA 3DEPA 1BDOA 4DAPA 1SBBB 1LTID 1EWHA 5E1FA 1STEA 1B53A 1F2LA 3MFGA 4ZKBB 3T56B 1WTVA 4FXGC 4KY5A 3SK5A 3SK4A 1LV9A 1KNAA 1LTSD 2F0OA 4OL7A 1SYBA 3OMGA 1G2SA 3T16A 5CGKA 3KF8A 2LKVA 1RCVD 5M3MB 4FNFA 3H91A 1W6KA 4C3IB 1WD1A 3DMUA 2I07B 5C0XG 3ONAB 1QILA 5ELDA 1AW7A 3FRPB 3PUWA 4PV1C 5BN4A 5E3FA 4XXEA 1QG7A 4ODGA 2PW5A 3LNNA 3FPPA 5M3FB 2L1BA 2EPBA 1H9JA 4PQXA 3MZ5A 5FO9B 1GUSA 4ZK9B 2KA7A 2LY7A 3PUZA 2RDGA 1EWCA 3IFDA 4DN4M 1KTKA 5CYUA 1HTLD 3S1QB 2NZ1D 3K58A 1STBA 1PRTB 3VYSA 1BOSA 1D5XC 1I6HB 1U9RA 1B50A 3RLFA 4TQUS 3S14B 4MHEA 5JPNC 5C6AA 5I9PA 3MEHA 1EYDA 5I4DA 2CW0D 3TP6A 1PFBA 1QWYA 2R61A 2VB3X 4KY7A 3S16B 3CU7A 5EPKA 1YNJC 3J81E 1UEAB 2WIIB 1PTOC 3ITPA 1KLUD 1WTOA 3SK8A 3IL8A 2EVBA 1G2TA 1AZPA 2K1BA 1F9QA 2R3ZA 1BQQT 3ERQA 3VYRA 5C3WA 2JSOA 2XVSA 4WORA 5CC4A 4WRDA 2SNMA 1A3UA 3SEBA 4A3JB 2NVQB 5KNDA 2JP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  2OF1 A;  3U9O A;  3R3O A;  4DGZ A;  3NHH A;  3NQT A;  4NMZ A;  4KY6 A;  3EVQ A;  4J6H A;  4K5V A;  4RKB A;  5EGT A;  4ZQ3 A;  3SHL A;  1SYC A;  2EYP A;  4ZUI A;  4KD3 A;  2O4X A;  1SNP A;  4N9P A;  1STY A;  4I65 A;  1EQV A;  5C4H A;  5ISR A;  2F0Q A;  5IGC A;  5KIX A;  5KYL A;  2F0E A;  4PMC A;  3NP8 A;  1EY0 A;  1EZ6 A;  4ME5 A;  2F0T A;  4NP5 A;  4TRD A;  3TP8 A;  4DFA A;  2KQ3 A;  3EJI A;  3SK6 A;  5J1Z A;  5IGB A;  1SNO A;  1KDC A;  3BDC A;  2EY2 A;  2RDF A;  4KJN A;  5EKK A;  1EY9 A;  3MZ5 A;  1F2Z A;  2F0J A;  2PQE A;  2F0K A;  2NUC A;  4ZUJ A;  3TME A;  5I6W A;  4R8N A;  2PW7 A;  5KEE A;  2SNS A;  2F0F A;  3SXH A;  5C5M A;  1TR5 A;  1SYD A;  4N9T A;  2F0N A;  2EXZ A;  4PMB A;  5JOB A;  4KV6 A;  3HZX A;  4B9X A;  5IOD A;  1STB A;  2RBM A;  3PMF A;  3OMC A;  2F0P A;  4MIU A;  2M00 A;  3OSO A;  5NUC A;  1SNM A;  3QOL A;  1AEX A;  2HQE A;  1NUC A;  5F2D A;  4F7X A;  2F0V A;  5CV7 A;  5IGF A;  1U9R A;  5J22 A;  1TT2 A;  5DAU A;  4K14 A;  4EQO A;  4IAL A;  3TP7 A;  5CV9 A;  2F3W A;  2F0I A;  2PZW A;  4KD4 A;  3D4D A;  5EKL A;  5C5L A;  4K2K A;  2SOB A;  5C6A A;  5I9P A;  2EYL A;  3MEH A;  5C3X A;  1TQO A;  2F0U A;  5I9O A;  2EYM A;  3RUZ A;  1EY8 A;  3ERO A;  4E6I A;  1KDB A;  2F3V A;  3D6C A;  1EYD A;  3NUC A;  1ENA A;  4K5W A;  1KDA A;  1A3V A;  5CV5 A;  3S9W A;  1KAB A;  4K8J A;  3D4W A;  5J39 A;  3DHQ A;  3NXW A;  4IUN A;  4K5X A;  1SYE A;  1F2M A;  4K2L A;  3TP6 A;  1SYG A;  2F0L A;  5E1F A;  4H7B A;  1RKN A;  2EY1 A;  3C1E A;  3SR1 A;  3V2T A;  5CV6 A;  5JAV A;  1EYA A;  1ENC A;  1JOO A;  1II3 A;  4KY7 A;  5KGU A;  1SNQ A;  4ID6 A;  4KY5 A;  5C4Z A;  2EYF A;  3SK5 A;  1A3T A;  1KAA A;  4QMG A;  3SK4 A;  4K6D A;  3ITP A;  3VA5 A;  3TP5 A;  1SND A;  3QB3 A;  5K5P A;  2F0O A;  4KTA A;  3BDL A;  1STG A;  2WAC A;  3D8G A;  1SYF A;  4NDX A;  2EY6 A;  4NKL A;  4OL7 A;  5CV4 A;  5CV8 A;  3SK8 A;  1A2U A;  1SNC A;  1EYC A;  3LX0 A;  1SYB A;  3HEJ A;  2EYH A;  3P1H A;  4KJO A;  4S3S A;  1NSN S;  2PZU A;  3MVV A;  5IGD A;  3OMG A;  4J1M A;  3T16 A;  2ENB A;  4DU9 A;  1JOR A;  1STH A;  1JOQ A;  2PYK A;  5CGK A;  2F0S A;  2LKV A;  1A2T A;  5IGE A;  5KRU A;  3ERQ A;  4IZ8 A;  2OEO A;  4G57 A;  4DF7 A;  4YIJ A;  4HMJ A;  5C3W A;  4B9W A;  1IHZ A;  5IIF A;  2QDB A;  1STN A;  2EY5 A;  4WOR A;  4EVO A;  4K8I A;  1EY4 A;  4RKL A;  1EY5 A;  2F0M A;  3C1F A;  4EQP A;  4KHV A;  5HGT A;  3DMU A;  1STA A;  2F0D A;  5CC4 A;  3H6M A;  5IGG A;  4WRD A;  3OWF A;  2SNM A;  2F0H A;  4PNY A;  5HUR A;  2RKS A;  4QF4 A;  5CR3 A;  3MXP A;  2F0G A;  1F2Y A;  5E3F A;  2OXP A;  3T13 A;  1A3U A;  3E5S A;  2KHS A;  5KYI A;  3MHB A;  5I6Y A;  3QOJ A;  3NK9 A;  2EYJ A;  3P75 A;  4F8M A;  5IOC A;  5M9O A;  2PZT A;  1JOK A;  5DEH A;  4QB4 A;  4HTH A;  2EYO A;  4HMI A;  4LAA A;  4ODG A;  2F0W A;  2PW5 A;  1EY7 A;  4EQN A;  1EZ8 A; 
#chains in the Genus database with same CATH topology
 1EY6 A;  2OF1 A;  4H0L C;  5TSS A;  4IO9 A;  3CCL A;  4B08 A;  3NQT A;  3TSS A;  1FYC A;  4A3F G;  4V19 0;  2Q2I A;  1Y8N B;  2O4X A;  1E1O A;  1MHW C;  1RF2 D;  3A55 A;  2E5L Q;  4A3B H;  1CQF A;  5ISR A;  1GUN A;  4O2D A;  4J15 A;  1EY0 A;  2O2L D;  2XGT A;  3M7N A;  1Y1V G;  1VQP A;  2EY2 A;  2JEB I;  3CPW A;  3BZC A;  1RTN A;  2JN4 A;  5AFW A;  1Q82 C;  4FDB A;  4F88 A;  3SXH A;  4YHH Q;  1TR5 A;  2NWG A;  2B2T C;  1C48 A;  4X64 L;  4DXF A;  4O42 A;  2NB0 A;  3OMC A;  5COY A;  4X3T A;  1O7Z A;  3MEF A;  1KRT A;  5IT9 L;  5FJ8 G;  2E2H B;  1LTA D;  1UE5 A;  1D1I A;  1E3P A;  2K03 A;  3CP0 A;  4YCW A;  4A4I A;  3AEV A;  4XYQ A;  4DUZ Q;  3TDQ A;  4Y7N B;  3A7A B;  1O78 A;  1Y1W B;  2NVX B;  4A3G B;  4TSS A;  3CCE A;  4GOP A;  1IBL L;  4JBJ A;  1D5Z C;  1SYE A;  3TZU A;  4X66 L;  1RD9 D;  2G9D A;  1H9S A;  1L0X B;  1EYA A;  2ICE C;  4ID6 A;  3DUZ A;  3I70 A;  1NNX A;  1VQD A;  1HNW Q;  4RHR A;  4QIW E;  2EYF A;  4UY8 C;  1LO5 D;  2UXB Q;  4B3R Q;  1VDZ A;  2K6A A;  5K5P A;  3M3Y B;  4EX5 A;  4KTA A;  1Y1W G;  1PRT F;  2I0Q A;  2JQO A;  1U4P A;  1NSN S;  3P20 A;  4GNX C;  2B2Y C;  3WDN A;  4CJ2 C;  5C4J H;  3I91 A;  1BCP C;  2PYK A;  3PUV A;  4A3D B;  1XWE A;  3M4Y A;  3TQY A;  3ZYY X;  4NW2 A;  3I8Z A;  1IHZ A;  1F9P A;  1HR0 Q;  2K7V A;  2UUA Q;  5FLM H;  4LWC A;  2NN6 I;  4BY7 B;  4RGN A;  1NR2 A;  4MNO A;  3OWF A;  5C0X H;  4JI4 Q;  2LXJ A;  4QIW B;  3DWA A;  1TS2 A;  2KOL A;  2F4V L;  4A3D G;  4JI5 L;  2HCI A;  4JV5 L;  4LFA Q;  2LS0 1;  1JT8 A;  3GTK H;  1YNX A;  3SE0 A;  4C3H G;  4FYD A;  5CBE E;  2RF4 A;  3PV0 A;  1J5E Q;  2IX0 A;  4DK3 C;  1VF5 C;  2G5D A;  3K81 C;  3JAM i;  1B1Z A;  5M3M H;  2X69 A;  4A3I B;  1UE7 A;  1H9M A;  4DK1 A;  4JBK A;  2ZTC A;  2KEN A;  4C3I H;  3L0O A;  1H9R A;  1LT3 D;  3I3C A;  4L5R C;  5KIX A;  2VQE Q;  5E4X A;  1Y14 B;  1VQG A;  3CKI B;  3S24 A;  1H9K A;  4U67 3;  2XWB B;  2ES2 A;  1Q1B A;  2F0N A;  2K5N A;  4DUY L;  5JOB A;  3M85 A;  4B9X A;  4K0K L;  2B2U A;  2B8G A;  4BY1 G;  1JWM D;  4A3I G;  2JA6 H;  2M9V A;  1N34 Q;  3NEM A;  4DNI A;  3KOJ A;  3TN2 A;  3CME A;  1IZ6 A;  2MUY A;  2DN8 A;  4ZRZ A;  3Q24 A;  5I9O A;  2L4N A;  2EYM A;  2BE5 C;  4K5W A;  1YHQ A;  1A3V A;  3D4W A;  4UP7 A;  2WP8 J;  1VQN A;  4R4I A;  1SYG A;  4X6A H;  3CW2 C;  1EIF A;  3S1Q H;  1PTO F;  4DNR B;  4DR7 Q;  1E24 A;  1BO0 A;  3G71 A;  3AFQ A;  2PO4 A;  1I6H H;  3S2D B;  2FXQ A;  1S72 A;  1DOM A;  2FJ2 A;  1TWA B;  4LMQ D;  1D2B A;  4JI0 L;  3L9A X;  4B3M L;  1MGS A;  4KJO A;  3FP9 A;  3W1G A;  1DON A;  2B8F A;  1TS4 A;  3VR4 A;  4RGT A;  5BN3 A;  3M4O H;  4R4O A;  4POF A;  1IBL Q;  1VQC A;  4DF7 A;  4DR1 Q;  3PO3 H;  3KDF B;  1VQH A;  4KK7 A;  5IYB H;  3Q0A A;  3S16 H;  4A93 B;  1IBK Q;  1UAP A;  5A2Q L;  2XSC A;  5JPM C;  4A75 A;  3MAQ A;  4DR2 Q;  3K5N A;  1CQV A;  5EJW A;  4RAU C;  3AU7 A;  1L1O A;  1F2Y A;  2EE1 A;  4FXK C;  1PHJ A;  2D9U A;  4JI2 L;  2BH2 A;  4JI1 L;  1MJC A;  5DNF A;  1CKO A;  4OX9 L;  1J6Q A;  3JAM c;  3NHH A;  1VQA A;  4A93 G;  4ULL A;  3K5M A;  1Y69 U;  1ESF A;  1CUK A;  4XTC S;  1A6X A;  2PQA A;  2VQF Q;  4A3F H;  3HOY B;  1X54 A;  2IT1 A;  4HJ5 A;  2NVT B;  2OTJ A;  1HA6 A;  3HOZ B;  1QUQ B;  2SDF A;  5GAD C;  1Y1V H;  4A3J H;  3TME A;  1LTB D;  3CXC A;  3GTJ B;  2NVQ H;  4HCS A;  3KYH C;  4IPH A;  4AYB E;  4DR5 Q;  3H09 A;  4DAM A;  1HQR D;  2Z6K A;  1DOL A;  5FJ8 H;  2VXW A;  4IUQ A;  3TP7 A;  3EN2 A;  2WV6 D;  1LAB A;  2HDM A;  1GKH A;  1TII D;  3RN5 A;  2UU9 Q;  2AQ1 B;  3R8B A;  4RWS C;  3BVG A;  3HOU B;  3G6E A;  3S9W A;  5IYD G;  4IUN A;  1HFN A;  2XRQ D;  1FNV A;  5LMU L;  4JCV E;  3SR1 A;  3S17 B;  4GN5 A;  3UDX A;  5KGU A;  3A5U A;  3T1H Q;  1E0B A;  3J81 i;  4L8J A;  3GV6 A;  5LMN W;  2E2H H;  5E4W C;  4K0K Q;  3S15 B;  3CRL C;  4KHP Q;  2BOS A;  2MGS A;  5JEA H;  4OWW B;  2BA1 A;  1D5M C;  2WAQ G;  3STB D;  3UDG A;  4NDX A;  1XMO L;  2EY6 A;  1PFN A;  4Y7N H;  4GS3 A;  2PPB C;  3LX0 A;  4S3S A;  1Y1W H;  3HOU G;  3E9I A;  5FLX E;  2NVX H;  2K01 A;  3LGJ A;  2EDG A;  3EIV A;  5L37 A;  3CCR A;  4JI7 L;  4IN3 A;  2JE6 I;  3A8K E;  1F9S A;  5IY0 A;  2R93 B;  5IGE A;  4JI3 Q;  1JCK B;  3DEO A;  3PIO A;  2XRS D;  3A5Z B;  1GM5 A;  1PMR A;  2I46 A;  4OIJ A;  2PMZ B;  5H1S E;  4A3L G;  3D6W A;  1BF4 A;  4RGO S;  1HUM A;  2H4O A;  2ID0 A;  1XPR A;  2F0H A;  4KKS A;  2RKS A;  4OO1 G;  3MXU A;  3T13 A;  4V0B A;  5I6Y A;  2ALY B;  3NWT A;  1Q86 C;  4HR7 B;  1WTR A;  3N6R A;  4A3D H;  2K4K A;  1JE4 A;  1J9O A;  4C3H H;  1WCM B;  3OHX C;  2JA7 B;  4DR4 Q;  3GV3 A;  4L5Q A;  1V43 A;  1HPC A;  1FNU A;  4A3B B;  3CD6 A;  1FJG Q;  1G6P A;  4ME5 A;  1KDC A;  2WB1 E;  1O7Y A;  1OXV A;  1YJW A;  2QW7 A;  1MSH A;  1RL2 A;  4G7O C;  4DV2 Q;  4UP8 A;  4P73 A;  2B3G A;  1WCM G;  5DM6 3;  5T1G A;  4MIU A;  1WTP A;  3GTM H;  4XT3 B;  4BY1 H;  4A3I H;  3X3M A;  5D14 A;  1MIU A;  1NAP A;  3K57 A;  3RLN A;  1G6Z A;  1EEI D;  4K2K A;  4X3U A;  3QWN A;  2HHH L;  1Z7T A;  4EGV A;  4KKT A;  2RSO A;  1Z6H A;  4B3S L;  2TMP A;  1QVF A;  1CTM A;  2Q8I B;  4DV0 L;  1VQB A;  3J80 E;  1PTO D;  4DR6 L;  1F2M A;  4HJ9 A;  3J81 c;  2R7D A;  4H7B A;  2EY1 A;  2NTS A;  5CV6 A;  1Q90 A;  4WJ4 A;  2NZO A;  2QCP X;  2O5I C;  4G7Z C;  1G91 A;  3ND8 A;  1I94 L;  2CWA A;  3Q22 A;  1G51 A;  1S5D D;  5IGD A;  5C44 B;  4DAV A;  4HJ8 A;  3CQZ B;  5C4J B;  1IL8 A;  1CM9 A;  2XNA C;  1WFQ A;  4AQY L;  1WOC A;  3K0Y A;  1K8A C;  4QL5 A;  4YIJ A;  1ML0 D;  1Q1E A;  2KCM A;  4PG3 A;  1WTX A;  4GKJ Q;  1PH4 A;  5JJL A;  5ELN A;  3V96 A;  2UXC L;  2RA4 A;  1I4P A;  1TWA H;  2C9O A;  1YHB A;  3D0F A;  3GP7 A;  4PNY A;  3CMA A;  3MWY W;  3J81 j;  3NK9 A;  2JA5 B;  4F8M A;  4IFD I;  1RJT A;  2E2I B;  1PRT C;  3GTK B;  2BCO A;  1EY7 A;  3DXJ C;  1Q46 A;  3KF6 B;  2B63 G;  4DV3 Q;  4DV5 Q;  2E5L L;  1XXG A;  4J6H A;  2BH8 A;  4A93 H;  1CZG A;  2WFW A;  4IUU A;  3G6J B;  2VB2 X;  1QE6 A;  2X6L A;  5IGB A;  2Y0S E;  5C0X J;  2RQX A;  1SNO A;  3VDY A;  2JA5 G;  3U4Z A;  1I4H A;  1EY9 A;  1F2Z A;  4YHH L;  1QNK A;  3I56 A;  2NN6 H;  2B2T A;  4DPG A;  3U50 C;  4N9T A;  2QA4 A;  1TY2 A;  1XNR Q;  2ZTE A;  2RBM A;  4C1N I;  4GLV B;  2M00 A;  2JA6 B;  1R4Q B;  4UP9 A;  4GZY C;  5DLQ E;  3L2P A;  1IYV A;  2LFN A;  2Q2U A;  2A19 A;  4M8A A;  5C5L A;  2KCC A;  1TY0 A;  2NVT H;  1P16 A;  3H3V I;  1BR9 A;  2EYL A;  5C3E B;  3HOZ H;  2ZXO A;  2F1M A;  1IKM A;  2D2C C;  3BS1 A;  3NUC A;  3K5O A;  1GUG A;  4K8J A;  3GTJ H;  3G7L A;  1WVL A;  2Y0S B;  1YVC A;  4X3S A;  3CCS A;  1HNW L;  4WJW A;  2DUD A;  5JAV A;  2MO1 A;  4QQB X;  5COR A;  2UXB L;  4B3R L;  2YV5 A;  1A15 A;  2A73 B;  3HKZ E;  1BCP D;  1KAA A;  2B2V C;  5FOB B;  1I6V C;  4H44 C;  4LF5 Q;  3S2H B;  4M1U B;  1BBU A;  1A2U A;  4GNX A;  3P1H A;  2B2Y A;  2C5C A;  3G4S A;  1LT5 D;  2PZU A;  4J1M A;  2ZT9 C;  1V9P A;  2ENB A;  1TWH B;  3HOU H;  2YU9 B;  2A6H C;  4R4Q A;  1CHP D;  2QIL A;  2QKI C;  1VQ7 A;  1TWG B;  2JYO A;  4DV4 Q;  1HR0 L;  3M4O B;  2HD3 A;  2UUA L;  2VUM B;  3BVZ A;  3KLS A;  3PO3 B;  1BBW A;  3CC7 A;  1ET6 A;  3BYT B;  1J8I A;  1K8M A;  2N3S A;  4DAY B;  3ICE A;  1IYJ B;  3S15 H;  1K28 A;  1E7Z A;  2IJ0 A;  3Q8D A;  1SE2 A;  3RLO A;  4JI4 L;  3MXG A;  2F4I A;  4A3L H;  3CRK C;  1X3F A;  2SEB D;  1YNN C;  3HKZ B;  1I94 Q;  4LFA L;  3MXN A;  1CKN A;  3PIP 3;  1J5E L;  3J7Y W;  2R93 H;  1T5X D;  2RVL A;  3RZD B;  5FK9 C;  4DKA C;  1TS3 A;  4L6T B;  1X3P A;  2IWH A;  1GJX A;  4A76 A;  1JWS D;  2VQE L;  2HT1 A;  4A3F B;  3BU2 A;  2I5H A;  5KYL A;  4Y52 H;  4PMC A;  3NBH A;  4Q5V A;  4R4T A;  3MTS A;  4TRD A;  2WKD A;  2ZJQ A;  2E75 C;  1LLR D;  3W1B A;  2KUM A;  2IY5 B;  2AWN A;  1Y1V B;  4NXM Q;  2NUC A;  1O7L A;  3MFY A;  4FP5 D;  1D8L A;  3ZJY C;  4X65 Q;  1N34 L;  4IFD G;  2CHB D;  1WCM H;  4DR3 Q;  2BDO A;  3W2D A;  2IPK D;  3SDZ A;  2JA7 H;  2BE5 D;  4F7X A;  1TT2 A;  4QUC A;  4EQO A;  2MO0 A;  4BA2 I;  4HIM A;  2Z4I A;  1LT4 D;  2L12 A;  1B44 D;  2DNE A;  1KQS A;  5K36 G;  1EOT A;  1ENA A;  1ZXT A;  4XQJ A;  1EQT A;  3RD4 A;  5E7N A;  2IX3 A;  2JA8 B;  4DR7 L;  1DM0 B;  2QEX A;  3K5L A;  5GRO A;  1D7Q A;  1RKN A;  4QUF A;  4TVA B;  1JOO A;  3GDE A;  4QY7 A;  4XT1 B;  1C9O A;  3A8I E;  1HQM C;  2AQ2 B;  4LF4 Q;  2L0C A;  5IT9 E;  3UI2 A;  4NKL A;  1CSQ A;  3AYH B;  3RNU A;  3U9S A;  4JG2 A;  2JA8 G;  3L3O C;  4O0A A;  1A2T A;  4DR1 L;  4IZ8 A;  3EA6 A;  4LUZ A;  1EQR A;  1IBK L;  4IQZ A;  3J7A 5;  3OW2 A;  3F2C A;  5HGQ A;  4DR2 L;  2LXK A;  1B3Q A;  3CCM A;  5JEA J;  3DWQ A;  4IPG A;  3S1M H;  4LJZ C;  1R4P B;  4QF4 A;  2OXP A;  3OPO A;  1PA6 A;  2FIN B;  5C44 H;  2KHS A;  1GHJ A;  4FO2 A;  5ELF A;  3F1Z A;  1RHP A;  1IYU A;  4HIO A;  2FFK B;  2PZT A;  3CQZ H;  2Q2T A;  1PH1 A;  4WJ3 M;  5IYC G;  4BBS G;  1XX8 A;  1YI2 A;  4L63 B;  4C3H B;  2B63 H;  3TEH B;  2VQF L;  1DCZ A;  3SHL A;  1NR4 A;  1SYC A;  1I3Q H;  1SNP A;  4I65 A;  1AZQ A;  4LF8 Q;  2F0Q A;  1V1O A;  5M5W B;  2ZM6 Q;  3NQI A;  3EJI A;  4ILW A;  2VNU D;  3KLS X;  2PQE A;  1IBM Q;  2JA5 H;  2DY7 A;  4IOA A;  4RA8 A;  2L15 A;  4DR5 L;  2YTV A;  4MTN A;  2F0F A;  2E2I H;  1OXS C;  3D31 A;  1TWC H;  4A3C G;  1ONL A;  3BJU A;  2B29 A;  1B8A A;  5IP9 G;  5IOD A;  1KIX A;  3I73 A;  3E3X A;  1X6O A;  3GTM B;  4MN3 A;  3HOX B;  4ZYS A;  4BY1 B;  2L9H A;  1SDF A;  3PQI A;  2CQA A;  4YCU A;  1VCI A;  2MQH A;  2UU9 L;  4DA2 A;  1GOZ A;  1K0R A;  3RUZ A;  4RCO A;  2Q8T A;  2K52 A;  5CV5 A;  1HFG A;  5J39 A;  2JEA I;  1GVP A;  4LF9 Q;  3T1H L;  2KEC A;  2PCF B;  1CI3 M;  1M8A A;  1L0W A;  3HOX G;  4KHP L;  1II3 A;  2Z1C A;  4JYA Q;  1G8Z D;  1E2V A;  1P8L A;  1XPO A;  1B3A A;  3QG1 A;  1BVS A;  1XJV A;  3ULP A;  5IWA Q;  5CV4 A;  1MBY A;  3PF4 A;  3KLR A;  5BR8 Q;  5C3E H;  1C0A A;  2EYH A;  2EJM A;  2IX1 A;  3R2I A;  2VZA A;  1V1P A;  1I4R A;  4ZCK A;  4JI3 L;  4DU9 A;  1JOR A;  1OXU A;  2CVR A;  4P2C B;  5KRU A;  1MSG A;  2OEO A;  3HFZ B;  5LMN Q;  4XQN A;  1FVI A;  1VS0 A;  3H15 A;  4HMJ A;  4POG A;  3PIP A;  3AMU A;  3HP3 A;  1XNQ Q;  3HG9 A;  1B7Y B;  2OT2 A;  3S2H H;  1STA A;  4OO1 I;  1CZW A;  1PYW D;  2E8G A;  2NVY B;  3D4R A;  1BBX C;  1DGS A;  1FL0 A;  3MXP A;  3PUY A;  1PYS B;  2HCC A;  5M9O A;  3P75 A;  2TSS A;  1TWH H;  4KI0 A;  4QJF A;  2YU9 H;  2K5W A;  1X3G A;  1TWG H;  2FMC A;  3ULL A;  2VUM H;  4DR4 L;  1F77 A;  4KY6 A;  1TWF B;  5EGT A;  1A63 A;  1FJG L;  2EJG C;  2UUB Q;  2AHO B;  1JIC A;  1YIJ A;  4ZLT F;  4G4K A;  4XIG S;  2H1E A;  2QGQ A;  1GO3 E;  5M5Y H;  1I50 B;  1ZYR C;  1DZ1 A;  1B9M A;  4CKC A;  5A2Q E;  4DV2 L;  1RIP A;  4ZAI A;  1CFM A;  1I4X A;  3NEL A;  4IJH A;  4CKE A;  1K8G A;  3BZK A;  4DK0 A;  3RZD H;  1HNZ Q;  5EPL A;  3PMF A;  4IFD H;  3A7L A;  3CHB D;  4BA1 I;  2WAQ E;  2V4D A;  3RR5 A;  1IXR A;  3E6Z X;  1T9H A;  3FDT A;  2PZW A;  3QO2 A;  4KD4 A;  5D3I B;  2ZXR A;  1EUJ A;  1WTH A;  2SOB A;  1EFW A;  5LL6 S;  3A56 A;  1PH2 A;  3IFT A;  3GTO H;  3K6O A;  3EQL C;  1N33 Q;  4LUO A;  1WTQ A;  1S40 A;  2HIV A;  3NE5 B;  5K36 H;  3GQB A;  3HOW G;  1SMY D;  1TXY A;  4HCE A;  3C1E A;  4CDF C;  1ENC A;  4KMU C;  1B2T A;  1HRJ A;  5C4Z A;  5FKA C;  1PH9 A;  2EZV A;  1JJG A;  3I72 A;  2WIN B;  4IUT A;  1EU3 A;  3JC6 6;  2WAC A;  2VW9 A;  2WAQ B;  5BN5 A;  4NPS A;  1JOQ A;  4KN4 C;  3CCU A;  3H3V H;  2JA8 H;  4L5S A;  2UXD Q;  4EQ5 A;  3I4N B;  2PMZ E;  2XWJ B;  4JVZ A;  2E2D C;  5HY6 A;  1XYI A;  1XPU A;  4GKJ L;  1YZ6 A;  4GOP B;  3H0G B;  4JBM A;  4JC0 A;  3FEW X;  1STN A;  3HGB A;  4IUP A;  1H9S B;  1Q12 A;  5ELB A;  3PGZ A;  1S3O A;  1PRT D;  1O80 A;  2A74 C;  3J7A F;  1XMQ Q;  1SMX A;  5KYI A;  1EIG A;  3FKI B;  1U4R A;  4HTH A;  3I4N G;  2GVB A;  4LAA A;  4DV3 L;  4DV5 L;  2A6E C;  4DXG A;  5IYC H;  2VL6 A;  3H0G G;  3R3O A;  4BBS H;  1CA6 A;  1FGB D;  4HED A;  1LTT D;  2AUK A;  3PSI A;  1S5E D;  3WOF A;  3D3R A;  1GUW A;  1PYB A;  3OIP A;  2F0T A;  3CC4 A;  1EYG A;  3FKI G;  3NPP A;  2RDF A;  2RDH A;  2UUC Q;  1GHK A;  4HN7 A;  1CKM A;  1ZEQ X;  4P72 A;  2Z9H A;  3I4L A;  3HRZ C;  1XNR L;  5KEE A;  4BXX G;  2GVA A;  3AB9 A;  3LWE A;  4A3C H;  4AYB G;  4LFB Q;  1NMF A;  1NTG A;  3K80 C;  3LWU A;  3ULJ A;  1NUC A;  4X3K A;  1KL9 A;  2H5X A;  2EJF C;  5GQO A;  5EKL A;  1WYD A;  1VQK A;  5M5W H;  1Q8I A;  1Z47 A;  4JI8 Q;  1HZC A;  2A8V A;  4LF6 Q;  3MA2 B;  1ILQ A;  3CPF A;  3KLW A;  3K0X A;  3NXW A;  1AH9 A;  3CCQ A;  1JMC A;  1PV4 A;  2WKC A;  3KK7 A;  1KD1 C;  1AE3 A;  4AIM A;  5CMD A;  2R7Z B;  4LF5 L;  1QCB D;  3HOX H;  2B2V A;  1A3T A;  1QVC A;  3DWP A;  2A6H D;  3K7U C;  3QB3 A;  3BDL A;  3CF5 A;  1PFM A;  1Q3L A;  1SYF A;  3BZD B;  2VY3 A;  1X55 A;  4JW0 A;  1SE4 A;  2L11 A;  4JI6 Q;  4DV4 L;  1IW7 D;  1SAP A;  3JAM L;  1PXU A;  3BVM A;  2R7Z G;  1YNN D;  1C7Y A;  1EFI D;  4B9W A;  4ALP A;  4OEM B;  1LT6 D;  3C1F A;  1VQ8 A;  3F2U A;  4NXN Q;  3S1N H;  3GD7 A;  1SMY C;  1HXY D;  2FMM A;  3S1M B;  3FPU B;  1B70 B;  1DOK A;  2F52 A;  5CR3 A;  4A3K B;  3TZD A;  1KXL A;  1JOK A;  4CJ0 B;  2E2J H;  2OWO A;  1PZI D;  2ZJP A;  1PZK D;  4C2M H;  1AP0 A;  4KKU A;  3QIA A;  4MZ9 A;  4PZ7 A;  3NTI A;  5EBD A;  3KUP A;  2B63 B;  3T4A C;  1FR3 A;  4ZQ3 A;  2Z4H A;  2EYP A;  4J8Q A;  4ZUI A;  4RFB A;  2N88 A;  1I3Q B;  1EQV A;  4BBR B;  4A3K G;  3NP8 A;  3TP8 A;  1EZ6 A;  2NVY H;  4NXM L;  3SK6 A;  3L7Z C;  3A0J A;  1PVO A;  3BDC A;  1L2F A;  1N32 Q;  2F0J A;  2WB1 G;  2F0K A;  4X65 L;  2K33 A;  1L1O B;  4HJA A;  5LHY 1;  1TWC B;  5GAG C;  4DR3 L;  1B4O A;  1LTR D;  1S5C D;  2YYZ A;  2MNA A;  1WTW A;  4GKK L;  3OSO A;  1TWF H;  1AEX A;  2C35 B;  5A35 A;  2K32 A;  1PZJ D;  4BBR G;  4Q0F A;  1LYL A;  1YHA A;  1VQM A;  3D4D A;  1Z9F A;  1IKL A;  3Q6S A;  2PQA B;  1I50 H;  1AN8 A;  2IW3 A;  2A5H A;  2MPM A;  4I7Z C;  1EY8 A;  3ERO A;  1YJN A;  1KDB A;  1E2Z A;  1EU4 A;  3D6C A;  2OTL A;  1QVG A;  1KAB A;  4U68 A;  4DV1 Q;  3C3L A;  1JB3 A;  1HTP A;  2D5D A;  5EBC A;  5IT9 c;  4OWT B;  1EEF D;  4LF4 L;  4CDD C;  1O7I A;  4CHT B;  1RDP D;  4ME3 A;  3OIQ A;  1NJI C;  2J7Z A;  3VA5 A;  4RCN A;  1STG A;  1YIT A;  2R7F A;  3AFP A;  1SNC A;  1SJH D;  3HEJ A;  4LUV A;  1D6E C;  4GN3 B;  1FGU A;  3OYY A;  1HZ9 A;  1IL2 A;  3U4V A;  2R92 B;  1TU2 B;  5M3M G;  2GA4 B;  4G57 A;  5IYD H;  4H13 C;  4C3I G;  1YJ9 A;  2E76 C;  2LMC B;  1UE6 A;  2A69 D;  4RKL A;  3UDI A;  2F0M A;  2MJ8 A;  2F0D A;  2PNH A;  2CWP A;  1BKB A;  3E5S A;  3FVQ A;  3IRB A;  3WWV A;  4QGU A;  4YWL A;  3S1R B;  3VA7 A;  2R92 G;  4R8I A;  5M3F G;  3VR2 A;  3HZX A;  3R2T A;  2Q8R E;  1EZ8 A;  3I4N H;  3TS2 A;  2O5J C;  1R9T H;  3KBX A;  4BWG B;  5CBA E;  1CT1 D;  2G9H D;  3EVQ A;  3H0G H;  1TKW B;  4NB3 A;  1ILP A;  1N8R C;  4LF8 L;  2JK8 A;  3OOC A;  4IUV A;  2LSS A;  1TVX A;  4KD3 A;  4BS9 A;  2ZM6 L;  2K05 A;  3T1Y Q;  1IW7 C;  5IE8 A;  4NP5 A;  3C2P A;  3N52 A;  1Y8O B;  1IBM L;  2KQ3 A;  5M5Y B;  2AUJ D;  5EKK A;  3H3V C;  1HJP A;  2A68 D;  3FKI H;  4OO1 H;  3ND9 A;  4WFN 3;  3ERS X;  1T5E A;  3J81 L;  4BXX H;  1JR0 D;  1PDQ A;  2B2W C;  1BUV T;  2RSN A;  3RN2 A;  2CFM A;  2K04 A;  5JVG 3;  1JQY D;  3UE0 A;  4LNQ A;  3TRE A;  4YCV A;  3NSW A;  1CA5 A;  3GTO B;  1G29 1;  3VR5 A;  1ZKO A;  4LF9 L;  4E6I A;  3CCJ A;  2ASB A;  2F3I A;  2I5L X;  5ELC A;  3KDF A;  1K83 B;  3NBI A;  2F0L A;  4JYA L;  4H02 A;  3CCV A;  1SNQ A;  3IAY A;  4IFD J;  3A8J E;  1VQ9 A;  5IWA L;  3OTO Q;  1DD2 A;  1LTG D;  4GKK Q;  1I4Q A;  1CSP A;  5BR8 L;  3VYU A;  3A74 A;  4X62 Q;  1EYC A;  3P7J A;  2QF7 A;  4P71 A;  3MVV A;  3C46 A;  1SSO A;  2F03 A;  4UPA A;  1NCV A;  5LMN L;  3HS0 C;  2F0S A;  2RCF A;  1VQE A;  4HJ7 A;  3TRZ A;  3PUX A;  3KBG A;  1VQF A;  4DV7 Q;  1XNQ L;  2R7Z H;  1AFP A;  1MD2 D;  1SRO A;  2EY5 A;  4XDX A;  4EVO A;  4EQP A;  1QUQ A;  4IPD A;  2X6G A;  1XTD A;  2Z8L A;  3VR3 A;  1GUT A;  1SXT A;  5IGG A;  5AJ3 Q;  4FF2 A;  5HUR A;  5GAH C;  4A3J G;  1PTO B;  3FHW A;  2F0G A;  5IOC A;  4PZ8 A;  2EYJ A;  2NBF A;  4ABN A;  2KHJ A;  5ELE A;  3GTL H;  1K3B C;  1LAC A;  2J4X A;  4OGQ C;  3GTQ H;  4BBS B;  1ZYR D;  2UUB L;  3Q23 A;  4RKB A;  4IOC A;  1Q7Y C;  3J7Z C;  4N9P A;  2AQ3 B;  4HSP A;  1W6J A;  1HZA A;  1U0L A;  2F0E A;  2PI2 E;  3WOE A;  2HUG A;  5DM7 3;  4A3K H;  5J1Z A;  4RH6 A;  4KJN A;  1OTC A;  4JOI C;  1PH6 A;  5I6W A;  4FF1 A;  1HNZ L;  2PW7 A;  4K6L A;  3VYT A;  2A69 C;  3PF5 A;  1W2B A;  3OW7 A;  1BNZ A;  1SN8 A;  2KCN A;  1VQ4 A;  1N36 Q;  5D3D A;  5NUC A;  5FO8 B;  3E0E A;  4HAE A;  5JEA G;  1EIH A;  2B39 A;  3KF8 B;  2DJG C;  2HQE A;  3QOL A;  1NY4 A;  1LM0 A;  1HNX Q;  3RMH A;  1S5F D;  3NTH A;  1QZG A;  4BBR H;  5I2X A;  2D62 A;  1SLJ A;  1N33 L;  4A3G G;  2JXM B;  1NE3 A;  2F0U A;  3NTK A;  4N8F A;  3TBI B;  5LL6 X;  4YY3 Q;  1SFO B;  2BDN A;  2F3V A;  4XYO A;  3UE1 A;  3F2B A;  4K5X A;  2IL8 A;  1K8O A;  4PMW A;  4R1J A;  4O1N A;  5JJK A;  2NTT A;  2PNR C;  5T1I A;  5G3L F;  3E9H A;  2A68 C;  4A3E B;  4QMG A;  2CW0 C;  4G7H C;  3KJO A;  1WJJ A;  2GN5 A;  4HID A;  4RHS A;  3PIO 3;  1K3R A;  4DV6 Q;  4LF7 Q;  3SVM A;  2K5V A;  2AMC B;  1DXM A;  3F8T A;  2KCT A;  3M4P A;  1OO9 B;  1QZH A;  1S4Z A;  2UXD L;  1UUP A;  3J80 i;  2KHI A;  1VF7 A;  1F9R A;  3R93 A;  4C3J B;  4C56 C;  5GAE C;  4FF4 A;  5M5X B;  1KRS A;  1JWU D;  1ENF A;  1UNS A;  4A3E G;  2QDB A;  1K9M C;  2KED A;  4BY7 G;  1E1T A;  1EY4 A;  1DYQ A;  4KHV A;  5FLX c;  2A6E D;  3F2D A;  1XMQ L;  3S1N B;  2JA9 A;  1GXD C;  3I90 A;  3K7A B;  4FF3 A;  5EAY A;  4C3J G;  4JPB W;  4GNX B;  1I4G A;  2E2J B;  2F0W A;  1OXX K;  3NWS A;  1V8Q A;  4C2M B;  2R92 H;  3U9O A;  1BCP B;  2DNC A;  5M3F H;  4LK1 C;  3MC0 B;  2NYZ D;  4JBW A;  4K5V A;  3EFX D;  3RZO B;  2J0T D;  4C1N K;  1SR3 A;  1GUO A;  1C4Q A;  2R6G A;  2XIW A;  2UUC L;  2KEE A;  4RMF A;  3PO2 B;  4N8X 1;  2BA0 A;  3V05 A;  2K5H A;  4R8N A;  1HCZ A;  1X3E A;  3S1R H;  1KLG D;  1U4L A;  1XTC D;  5C5M A;  2EXZ A;  4LFB L;  3MXN B;  3KFU A;  3E0J A;  4KV6 A;  1CKN B;  1EWI A;  1VQL A;  4X64 Q;  1EQQ A;  5IGF A;  1B9N A;  5F2D A;  1S5B D;  1JE5 A;  5EKI A;  4P74 A;  4K14 A;  1L0Y B;  3S14 H;  4IAL A;  2K14 A;  3I4M B;  3TS0 A;  3GTP B;  4JI8 L;  1FNW A;  2L5T A;  2F3W A;  2F0I A;  4LF6 L;  1A62 A;  3PO2 G;  2MHV A;  4FVM A;  5C3X A;  1TQO A;  1VMP A;  2CH4 W;  5JJZ A;  1QNU A;  3A54 A;  5D65 A;  1ET9 A;  3NBH B;  3BG3 A;  2YTY A;  1WD0 A;  3W3A A;  2N8N A;  1E22 A;  2MFI A;  3DHQ A;  4GOP C;  1HUN A;  4YWK A;  4K2L A;  1HZB A;  4TKO B;  3HOW B;  3V2T A;  4X66 Q;  1OXT A;  2OCE A;  3I4M G;  5FO7 B;  1H95 A;  1M1K C;  2Q2H A;  3BYY B;  1HA5 A;  2IHE A;  4K6D A;  1E2W A;  1SND A;  1HR0 W;  1Y8P B;  3DM1 A;  3D8G A;  3HOV B;  1UEB A;  3M7G A;  2DJF C;  4JI6 L;  3J80 c;  4GLA C;  3T53 B;  3G48 A;  3KF6 A;  1D1K A;  4XQQ A;  3KJP A;  4DNT B;  4KLK A;  3B6Y A;  1JJ2 A;  3O13 A;  1K83 H;  4OHJ A;  2N55 A;  2CKZ B;  4IPC A;  2K50 A;  1I5F A;  3J7A V;  4GLX A;  4NXN L;  5IIF A;  1ICF B;  5IP7 G;  4CGY B;  1NMG A;  4K8I A;  1EY5 A;  1U5K A;  3HOV G;  1UE1 A;  2EXD A;  1QJO A;  4UAI A;  3K59 A;  3DM3 A;  1CK1 A;  2XN9 C;  4A3M B;  2NN6 G;  3QJY A;  1PH3 A;  4UHV A;  2I5M X;  1X32 A;  5KNB A;  3MHB A;  4L5T A;  3QOJ A;  1WI5 A;  1PFS A;  4F87 A;  2EYO A;  2F4V Q;  5CV7 A;  4JI5 Q;  2ATW A;  1FD7 D;  4JV5 Q;  3IKJ A;  2L55 A;  4OIK A;  1QOH A;  1A0I A;  1PLF A;  1R9T B;  3W5O A;  4HIK A;  3URY A;  4HSV A;  5C4X B;  2FHT A;  4YWM A;  3HOY G;  1VQJ A;  3I55 A;  1EIY B;  2M2L A;  2HDL A;  5C4H A;  4A3M G;  3HOZ G;  1X3Q A;  1CHQ D;  1N32 L;  2ZTD A;  4DFA A;  5EPJ A;  4KN7 C;  1PTO H;  2K5Q A;  2A1A A;  5J3B A;  5JVH 3;  4DK6 C;  4ZUJ A;  1BXT A;  2Z0S A;  1SYD A;  2E74 C;  2ICI A;  5C4X G;  1K73 C;  2EOT A;  3UDF A;  4OXP A;  1HHV A;  4DUY Q;  2B2U C;  1ESR A;  2RHS B;  3T51 B;  1SNM A;  4AYB B;  5J22 A;  5FLX L;  1JB7 A;  4FXD A;  1ROD A;  1SJE D;  5CV9 A;  1BCP F;  1MJE A;  3PCO B;  4A3G H;  1KDA A;  4DV1 L;  1N9W A;  2QDL A;  3GTG B;  4CJ1 B;  4ZKC B;  2DY8 A;  4DAY A;  5G3L D;  2OQK A;  4LFC L;  5C0X I;  5IP9 H;  5JJI A;  4IUR A;  4CBV A;  3M3Y H;  3TP5 A;  1PH8 A;  2N78 A;  4UDU C;  1PH5 A;  2CH4 A;  2KJX A;  3GO5 A;  5CV8 A;  1C8C A;  1EOV A;  2ZJR A;  1SFO H;  2QEJ C;  1JC7 A;  4JI0 Q;  1TS5 A;  1GD7 A;  2R93 G;  2MP1 A;  4B3M Q;  1STH A;  1QB5 D;  3X3N A;  1EL0 A;  5KNC A;  1KNE A;  2OQ0 A;  2AKW B;  3AQQ A;  1RTO A;  3FMC A;  4CKB A;  1X56 A;  4A3E H;  1W3S A;  5HGT A;  1DJR D;  4BY7 H;  2AWO A;  1ASZ A;  4QCL A;  3H6M A;  2K28 A;  2KVM A;  1L1O C;  4Z9C B;  1KAW A;  3M9B A;  1AE2 A;  4B3T L;  5DEH A;  4QB4 A;  3H94 A;  2K75 A;  4HMI A;  1LTL A;  2D0O A;  4C3J H;  4JI2 Q;  4EQN A;  3GTL B;  4JI1 Q;  2JA7 G;  1V1P B;  2K5D A;  4GN4 B;  4DGZ A;  3GTQ B;  2CQO A;  5M5X H;  4NMZ A;  4R4C A;  4OX9 Q;  4A3B G;  1U4M A;  1ICW A;  3T1Y L;  3VR6 A;  3JAM E;  1STY A;  3BDO A;  5IGC A;  4RGM A;  1SE3 A;  3J80 L;  3K7A H;  1VMC A;  4LW1 A;  3I4O A;  4JK1 C;  1YNJ D;  1MI2 A;  2EIF A;  1YEZ A;  4APV A;  2SNS A;  5I2Y A;  2WB1 B;  4PMB A;  2ZXP A;  2HIX A;  2B2W A;  3OWE B;  4KHZ A;  2F0P A;  3RZO H;  5EQ0 A;  2F0V A;  1A8V A;  1M4V A;  3HKS A;  1SEB D;  2Z6K C;  2N49 A;  3CAM A;  5DAU A;  4R9W A;  1VQ6 A;  3DEP A;  3PO2 H;  1BDO A;  1HH2 P;  4DAP A;  1SBB B;  1LTI D;  1EWH A;  1ASY A;  5E1F A;  4OEL B;  1STE A;  3OTO L;  1B53 A;  1F2L A;  3MFG A;  2D0P A;  2XTI A;  3T56 B;  2IHF A;  4ZKB B;  1WTV A;  4FXG C;  5LMU Q;  4KY5 A;  3S2D H;  3SK5 A;  4X62 L;  2V1C C;  3SK4 A;  1LV9 A;  1KNA A;  3I4M H;  3GTP H;  4OON A;  1LTS D;  2F0O A;  5C44 G;  4OL7 A;  4OWX B;  4CDE C;  1K0S A;  1SYB A;  1VQ5 A;  1XMO Q;  2EQS A;  3OMG A;  1G2S A;  3I2Z A;  3T16 A;  5CGK A;  1X65 A;  3KF8 A;  4I7A A;  2LKV A;  3QR8 A;  1MKH A;  4JI7 Q;  3STB C;  4DV7 L;  1PH7 A;  2DGY A;  1RCV D;  3HOW H;  5FLM G;  4MTK A;  5M3M B;  4FNF A;  3H91 A;  1W6K A;  2RHQ B;  4C3I B;  5AJ3 L;  1WD1 A;  4LFC Q;  3DMU A;  2I07 B;  5IP7 H;  5C0X G;  3ONA B;  1LUZ A;  1QIL A;  2PI2 A;  5ELD A;  1AW7 A;  1SRU A;  3FRP B;  3HOV H;  3PUW A;  4PV1 C;  5BN4 A;  5E3F A;  4XXE A;  1V1Q A;  1Q8K A;  1QG7 A;  3NEN A;  4ODG A;  4AH6 A;  1Q81 C;  2PW5 A;  3LNN A;  3FPP A;  5M3F B;  2L1B A;  2P5Z X;  2EPB A;  4DUZ L;  1H9J A;  3HOY H;  3SGI A;  2VS1 A;  4PQX A;  2CCZ A;  4A3M H;  4JOI A;  2Z6B A;  3MZ5 A;  4IJL A;  5FO9 B;  1GUS A;  4ZK9 B;  1UWV A;  2KA7 A;  2LY7 A;  3PUZ A;  2RDG A;  1EWC A;  3IFD A;  4DN4 M;  1N36 L;  1KTK A;  5CYU A;  1HTL D;  2JA6 G;  4B3T Q;  3S1Q B;  2NZ1 D;  3K58 A;  1STB A;  1PRT B;  2NZH A;  3VYS A;  1SE8 A;  5C4X H;  1HNX L;  1BOS A;  1D5X C;  1I6H B;  1U9R A;  1B50 A;  3U58 A;  1NBW A;  3RLF A;  4TQU S;  5C3E G;  3DLL A;  3S14 B;  4MHE A;  2HQL A;  5JPN C;  5C6A A;  5I9P A;  4YY3 L;  3MEH A;  2HHH Q;  2Y0S G;  1EYD A;  5I4D A;  2CW0 D;  1KC8 C;  2YTX A;  3CC2 A;  4B3S Q;  3TP6 A;  1PFB A;  3S17 H;  4DV0 Q;  1QWY A;  2R61 A;  4DR6 Q;  2VB3 X;  2JJQ A;  4KY7 A;  3S16 B;  3CU7 A;  5EPK A;  1YNJ C;  3ER0 A;  3J81 E;  1UEA B;  4DV6 L;  2KBN A;  2WII B;  1PTO C;  3ITP A;  1KLU D;  4LF7 L;  1KHI A;  2RCN A;  4RG1 A;  3EBE A;  1WTO A;  1M90 C;  3SK8 A;  5ELO A;  3IL8 A;  2EVB A;  1G2T A;  1AZP A;  2K1B A;  1VQI A;  1F9Q A;  2R3Z A;  2VUM G;  3GTG H;  1BQQ T;  3ERQ A;  3VYR A;  1VQO A;  1X9N A;  3PO3 G;  1JJC B;  5C3W A;  5IYB G;  4AQY Q;  2JSO A;  3M4Q A;  2XVS A;  4WOR A;  5CC4 A;  3HKZ G;  4WRD A;  4PZ6 A;  2UXC Q;  2SNM A;  3I7F A;  3K8A A;  1A3U A;  3SEB A;  4CDC C;  4A3J B;  2NVQ B;  4P75 A;  5KND A;  2JP1 A;  1YBY A; 
#chains in the Genus database with same CATH homology
 1EY6 A;  2OF1 A;  4H0L C;  5TSS A;  4B08 A;  3NQT A;  3TSS A;  1FYC A;  4V19 0;  1Y8N B;  2O4X A;  3A55 A;  1RF2 D;  1CQF A;  5ISR A;  1GUN A;  1EY0 A;  2O2L D;  3M7N A;  2EY2 A;  2JEB I;  1RTN A;  5AFW A;  4F88 A;  3SXH A;  1TR5 A;  2NWG A;  2B2T C;  1C48 A;  4DXF A;  4O42 A;  2NB0 A;  3OMC A;  5COY A;  4X3T A;  1O7Z A;  5IT9 L;  2E2H B;  1LTA D;  1D1I A;  2K03 A;  4XYQ A;  3TDQ A;  4Y7N B;  3A7A B;  1O78 A;  1Y1W B;  2NVX B;  4A3G B;  4TSS A;  1D5Z C;  1SYE A;  3TZU A;  1RD9 D;  2G9D A;  1H9S A;  1L0X B;  1EYA A;  2ICE C;  4ID6 A;  3DUZ A;  3I70 A;  4RHR A;  2EYF A;  1LO5 D;  1VDZ A;  2K6A A;  5K5P A;  3M3Y B;  4KTA A;  1PRT F;  1U4P A;  1NSN S;  3P20 A;  2B2Y C;  3WDN A;  4CJ2 C;  3I91 A;  1BCP C;  2PYK A;  3PUV A;  4A3D B;  1XWE A;  3M4Y A;  3ZYY X;  4NW2 A;  3I8Z A;  1IHZ A;  1F9P A;  2K7V A;  2NN6 I;  4BY7 B;  4RGN A;  1NR2 A;  3OWF A;  5C0X H;  4QIW B;  3DWA A;  1TS2 A;  2KOL A;  2HCI A;  2LS0 1;  3SE0 A;  4C3H G;  4FYD A;  5CBE E;  3PV0 A;  2IX0 A;  1VF5 C;  1B1Z A;  2X69 A;  4A3I B;  4DK1 A;  1H9M A;  1H9R A;  1LT3 D;  3I3C A;  5KIX A;  5E4X A;  3CKI B;  1H9K A;  4U67 3;  2XWB B;  1Q1B A;  2F0N A;  5JOB A;  3M85 A;  4B9X A;  2B2U A;  2B8G A;  1JWM D;  2M9V A;  3TN2 A;  2MUY A;  2DN8 A;  4ZRZ A;  3Q24 A;  5I9O A;  2L4N A;  2EYM A;  2BE5 C;  4K5W A;  1A3V A;  3D4W A;  2WP8 J;  1SYG A;  1PTO F;  4DNR B;  1BO0 A;  2PO4 A;  3S2D B;  1DOM A;  2FJ2 A;  1TWA B;  4LMQ D;  1D2B A;  3L9A X;  1MGS A;  4KJO A;  1DON A;  2B8F A;  1TS4 A;  3VR4 A;  4RGT A;  5BN3 A;  4DF7 A;  4KK7 A;  3Q0A A;  4A93 B;  1UAP A;  5A2Q L;  2XSC A;  5JPM C;  3MAQ A;  3K5N A;  1CQV A;  5EJW A;  4RAU C;  3AU7 A;  1F2Y A;  2EE1 A;  4FXK C;  2D9U A;  5DNF A;  3NHH A;  4ULL A;  3K5M A;  1Y69 U;  1ESF A;  4XTC S;  1A6X A;  3HOY B;  2IT1 A;  2NVT B;  1HA6 A;  3HOZ B;  2SDF A;  3TME A;  1LTB D;  3GTJ B;  4HCS A;  3H09 A;  1HQR D;  1DOL A;  2VXW A;  4IUQ A;  3TP7 A;  2WV6 D;  1LAB A;  2HDM A;  1TII D;  2AQ1 B;  3R8B A;  4RWS C;  3BVG A;  3HOU B;  3S9W A;  4IUN A;  1HFN A;  2XRQ D;  1FNV A;  3SR1 A;  3S17 B;  5KGU A;  1E0B A;  4L8J A;  3GV6 A;  5E4W C;  3S15 B;  3CRL C;  2BOS A;  2MGS A;  5JEA H;  2BA1 A;  1D5M C;  4NDX A;  2EY6 A;  1PFN A;  2PPB C;  3LX0 A;  4S3S A;  5FLX E;  2K01 A;  2EDG A;  4IN3 A;  2JE6 I;  3A8K E;  1F9S A;  2R93 B;  5IGE A;  1JCK B;  3DEO A;  2XRS D;  1PMR A;  2I46 A;  4OIJ A;  2PMZ B;  3D6W A;  1BF4 A;  4RGO S;  1HUM A;  2H4O A;  2ID0 A;  2F0H A;  4KKS A;  2RKS A;  4OO1 G;  3MXU A;  3T13 A;  4V0B A;  5I6Y A;  3NWT A;  4HR7 B;  1WTR A;  3N6R A;  1JE4 A;  1J9O A;  1WCM B;  3OHX C;  2JA7 B;  3GV3 A;  1V43 A;  1HPC A;  1FNU A;  4A3B B;  4ME5 A;  1KDC A;  1O7Y A;  1OXV A;  1MSH A;  4G7O C;  5DM6 3;  5T1G A;  4MIU A;  1WTP A;  4XT3 B;  3X3M A;  5D14 A;  1NAP A;  3K57 A;  1G6Z A;  1EEI D;  4K2K A;  4X3U A;  3QWN A;  1Z7T A;  4EGV A;  4KKT A;  2RSO A;  1Z6H A;  2TMP A;  1CTM A;  2Q8I B;  3J80 E;  1PTO D;  1F2M A;  4H7B A;  2EY1 A;  2NTS A;  5CV6 A;  1Q90 A;  2QCP X;  2O5I C;  4G7Z C;  1G91 A;  3ND8 A;  3Q22 A;  1S5D D;  5IGD A;  5C44 B;  4DAV A;  3CQZ B;  5C4J B;  1IL8 A;  1CM9 A;  2XNA C;  3K0Y A;  4YIJ A;  1ML0 D;  1Q1E A;  1WTX A;  3V96 A;  2RA4 A;  1I4P A;  2C9O A;  3GP7 A;  4PNY A;  3MWY W;  3NK9 A;  2JA5 B;  4F8M A;  4IFD I;  1RJT A;  2E2I B;  1PRT C;  3GTK B;  2BCO A;  1EY7 A;  3DXJ C;  1XXG A;  4J6H A;  1CZG A;  4IUU A;  3G6J B;  2VB2 X;  1QE6 A;  2X6L A;  5IGB A;  5C0X J;  2RQX A;  1SNO A;  1I4H A;  1EY9 A;  1F2Z A;  1QNK A;  2NN6 H;  2B2T A;  4N9T A;  1TY2 A;  2RBM A;  4C1N I;  2M00 A;  2JA6 B;  1R4Q B;  4GZY C;  1IYV A;  2LFN A;  4M8A A;  5C5L A;  2KCC A;  1TY0 A;  1BR9 A;  2EYL A;  5C3E B;  2ZXO A;  2F1M A;  1IKM A;  2D2C C;  3BS1 A;  3NUC A;  3K5O A;  1GUG A;  4K8J A;  3G7L A;  1WVL A;  2Y0S B;  4X3S A;  4WJW A;  5JAV A;  5COR A;  1A15 A;  2A73 B;  1BCP D;  1KAA A;  2B2V C;  5FOB B;  1I6V C;  4H44 C;  3S2H B;  4M1U B;  1A2U A;  3P1H A;  2B2Y A;  2C5C A;  1LT5 D;  2PZU A;  4J1M A;  2ZT9 C;  2ENB A;  1TWH B;  2YU9 B;  2A6H C;  1CHP D;  2QIL A;  2QKI C;  1TWG B;  2JYO A;  3M4O B;  2VUM B;  3BVZ A;  3KLS A;  3PO3 B;  1J8I A;  1ET6 A;  3BYT B;  1K8M A;  2IJ0 A;  1SE2 A;  3MXG A;  2F4I A;  3CRK C;  2SEB D;  1YNN C;  3HKZ B;  3MXN A;  3PIP 3;  3J7Y W;  1T5X D;  2RVL A;  3RZD B;  5FK9 C;  1TS3 A;  4L6T B;  1X3P A;  2IWH A;  1GJX A;  1JWS D;  4A3F B;  5KYL A;  4PMC A;  3NBH A;  4Q5V A;  3MTS A;  4TRD A;  2WKD A;  2E75 C;  1LLR D;  2KUM A;  2AWN A;  1Y1V B;  2NUC A;  1O7L A;  3MFY A;  4FP5 D;  4IFD G;  2CHB D;  2BDO A;  3W2D A;  2IPK D;  3SDZ A;  2BE5 D;  4F7X A;  1TT2 A;  4QUC A;  4EQO A;  4BA2 I;  2Z4I A;  1LT4 D;  2L12 A;  1B44 D;  2DNE A;  5K36 G;  1EOT A;  1ENA A;  1ZXT A;  4XQJ A;  1EQT A;  3RD4 A;  2IX3 A;  2JA8 B;  1DM0 B;  3K5L A;  1RKN A;  4QUF A;  1JOO A;  4XT1 B;  3A8I E;  1HQM C;  2AQ2 B;  2L0C A;  5IT9 E;  3UI2 A;  4NKL A;  3U9S A;  3L3O C;  1A2T A;  4IZ8 A;  3EA6 A;  4IQZ A;  5JEA J;  3DWQ A;  4LJZ C;  1R4P B;  4QF4 A;  2OXP A;  3OPO A;  2FIN B;  2KHS A;  1GHJ A;  4FO2 A;  5ELF A;  1RHP A;  1IYU A;  2FFK B;  2PZT A;  1XX8 A;  4L63 B;  4C3H B;  1DCZ A;  3SHL A;  1NR4 A;  1SYC A;  1SNP A;  4I65 A;  1AZQ A;  2F0Q A;  1V1O A;  5M5W B;  3NQI A;  3EJI A;  4ILW A;  2VNU D;  3KLS X;  2PQE A;  2DY7 A;  4RA8 A;  2F0F A;  1OXS C;  3D31 A;  1ONL A;  5IOD A;  3I73 A;  3GTM B;  4MN3 A;  3HOX B;  4ZYS A;  4BY1 B;  2L9H A;  1SDF A;  2CQA A;  1VCI A;  4DA2 A;  1GOZ A;  3RUZ A;  4RCO A;  2Q8T A;  5CV5 A;  1HFG A;  5J39 A;  2JEA I;  2KEC A;  2PCF B;  1CI3 M;  1M8A A;  1II3 A;  2Z1C A;  1G8Z D;  1E2V A;  1B3A A;  3QG1 A;  5CV4 A;  1MBY A;  3KLR A;  2EYH A;  2EJM A;  2IX1 A;  3R2I A;  1V1P A;  1I4R A;  4DU9 A;  1JOR A;  1OXU A;  2CVR A;  4P2C B;  5KRU A;  1MSG A;  2OEO A;  4XQN A;  4HMJ A;  3AMU A;  3HP3 A;  3HG9 A;  2OT2 A;  1STA A;  4OO1 I;  1CZW A;  1PYW D;  2NVY B;  3D4R A;  1BBX C;  3MXP A;  3PUY A;  2HCC A;  5M9O A;  3P75 A;  2TSS A;  4KI0 A;  2K5W A;  2FMC A;  1F77 A;  4KY6 A;  1TWF B;  5EGT A;  2EJG C;  1JIC A;  4ZLT F;  4G4K A;  4XIG S;  2H1E A;  1I50 B;  1ZYR C;  1DZ1 A;  1B9M A;  4CKC A;  5A2Q E;  4ZAI A;  1CFM A;  1I4X A;  4CKE A;  4DK0 A;  5EPL A;  3PMF A;  4IFD H;  3A7L A;  3CHB D;  4BA1 I;  2V4D A;  3E6Z X;  3FDT A;  2PZW A;  3QO2 A;  4KD4 A;  5D3I B;  2ZXR A;  2SOB A;  5LL6 S;  3A56 A;  3IFT A;  3K6O A;  3EQL C;  1WTQ A;  3NE5 B;  5K36 H;  3GQB A;  1SMY D;  4HCE A;  3C1E A;  1ENC A;  4KMU C;  1B2T A;  1HRJ A;  5C4Z A;  5FKA C;  2EZV A;  3I72 A;  2WIN B;  4IUT A;  1EU3 A;  2WAC A;  2WAQ B;  5BN5 A;  1JOQ A;  4KN4 C;  3I4N B;  2XWJ B;  2E2D C;  1XYI A;  3H0G B;  3FEW X;  1STN A;  3HGB A;  4IUP A;  1H9S B;  1Q12 A;  5ELB A;  1PRT D;  1O80 A;  2A74 C;  3J7A F;  5KYI A;  1EIG A;  3FKI B;  1U4R A;  4HTH A;  4LAA A;  2A6E C;  4DXG A;  3R3O A;  1CA6 A;  1FGB D;  4HED A;  1LTT D;  2AUK A;  1S5E D;  3WOF A;  3D3R A;  1GUW A;  3OIP A;  2F0T A;  3NPP A;  2RDF A;  2RDH A;  1GHK A;  4HN7 A;  1ZEQ X;  3I4L A;  3HRZ C;  5KEE A;  3AB9 A;  3LWE A;  3LWU A;  1NUC A;  4X3K A;  2EJF C;  5EKL A;  1Q8I A;  1Z47 A;  3MA2 B;  1ILQ A;  3NXW A;  2WKC A;  3KK7 A;  5CMD A;  2R7Z B;  1QCB D;  2B2V A;  1A3T A;  3DWP A;  2A6H D;  3QB3 A;  3BDL A;  1PFM A;  1Q3L A;  1SYF A;  3BZD B;  1SE4 A;  2L11 A;  1IW7 D;  1SAP A;  3JAM L;  1PXU A;  3BVM A;  1YNN D;  1EFI D;  4B9W A;  1LT6 D;  3C1F A;  3F2U A;  3GD7 A;  1SMY C;  1HXY D;  2FMM A;  3S1M B;  3FPU B;  1DOK A;  5CR3 A;  4A3K B;  3TZD A;  1JOK A;  4CJ0 B;  1PZI D;  1PZK D;  1AP0 A;  4KKU A;  3QIA A;  3NTI A;  5EBD A;  3KUP A;  2B63 B;  3T4A C;  1FR3 A;  4ZQ3 A;  2Z4H A;  2EYP A;  4J8Q A;  4ZUI A;  4RFB A;  2N88 A;  1I3Q B;  1EQV A;  4BBR B;  3NP8 A;  3TP8 A;  1EZ6 A;  3SK6 A;  3L7Z C;  3BDC A;  2F0J A;  2F0K A;  2K33 A;  5LHY 1;  1TWC B;  1B4O A;  1LTR D;  1S5C D;  2YYZ A;  1WTW A;  3OSO A;  1AEX A;  5A35 A;  2K32 A;  1PZJ D;  4Q0F A;  3D4D A;  1IKL A;  3Q6S A;  1AN8 A;  2IW3 A;  2A5H A;  2MPM A;  4I7Z C;  1EY8 A;  3ERO A;  1KDB A;  1E2Z A;  1EU4 A;  3D6C A;  1KAB A;  4U68 A;  3C3L A;  1JB3 A;  1HTP A;  2D5D A;  5EBC A;  1EEF D;  4CHT B;  1RDP D;  3OIQ A;  2J7Z A;  3VA5 A;  4RCN A;  1STG A;  1SNC A;  1SJH D;  3HEJ A;  1D6E C;  2R92 B;  1TU2 B;  2GA4 B;  4G57 A;  4H13 C;  4C3I G;  2E76 C;  2LMC B;  2A69 D;  4RKL A;  2F0M A;  2MJ8 A;  2F0D A;  3E5S A;  3FVQ A;  3S1R B;  3VA7 A;  4R8I A;  3VR2 A;  3HZX A;  3R2T A;  2Q8R E;  1EZ8 A;  2O5J C;  3KBX A;  4BWG B;  5CBA E;  1CT1 D;  2G9H D;  3EVQ A;  1TKW B;  1ILP A;  3OOC A;  4IUV A;  4KD3 A;  1TVX A;  4BS9 A;  2K05 A;  1IW7 C;  4NP5 A;  3C2P A;  3N52 A;  1Y8O B;  2KQ3 A;  5M5Y B;  2AUJ D;  5EKK A;  3H3V C;  2A68 D;  4OO1 H;  3ND9 A;  4WFN 3;  1T5E A;  3J81 L;  1JR0 D;  1PDQ A;  2B2W C;  1BUV T;  2RSN A;  2K04 A;  5JVG 3;  1JQY D;  3NSW A;  1CA5 A;  3GTO B;  1G29 1;  3VR5 A;  1ZKO A;  4E6I A;  5ELC A;  1K83 B;  3NBI A;  2F0L A;  1SNQ A;  3IAY A;  4IFD J;  3A8J E;  1DD2 A;  1LTG D;  1I4Q A;  3VYU A;  1EYC A;  3P7J A;  2QF7 A;  3MVV A;  3C46 A;  1SSO A;  2F03 A;  1NCV A;  3HS0 C;  2F0S A;  3PUX A;  3KBG A;  1AFP A;  1MD2 D;  2EY5 A;  4XDX A;  4EVO A;  4EQP A;  2X6G A;  5IGG A;  3VR3 A;  1GUT A;  1SXT A;  2Z8L A;  4FF2 A;  5HUR A;  1PTO B;  2F0G A;  5IOC A;  2EYJ A;  2NBF A;  4ABN A;  5ELE A;  1LAC A;  2J4X A;  4OGQ C;  4BBS B;  1ZYR D;  3Q23 A;  4RKB A;  4N9P A;  2AQ3 B;  4HSP A;  1W6J A;  2F0E A;  3WOE A;  2HUG A;  5DM7 3;  5J1Z A;  4RH6 A;  4KJN A;  5I6W A;  4FF1 A;  2PW7 A;  4K6L A;  3VYT A;  2A69 C;  3OW7 A;  1BNZ A;  2KCN A;  5D3D A;  5NUC A;  5FO8 B;  4HAE A;  5JEA G;  1EIH A;  2B39 A;  3QOL A;  2HQE A;  3RMH A;  1S5F D;  3NTH A;  5I2X A;  2D62 A;  2JXM B;  3NTK A;  2F0U A;  3TBI B;  5LL6 X;  1SFO B;  2BDN A;  2F3V A;  4XYO A;  4K5X A;  2IL8 A;  1K8O A;  4PMW A;  4O1N A;  2NTT A;  2PNR C;  5T1I A;  5G3L F;  2A68 C;  4A3E B;  4QMG A;  2CW0 C;  4G7H C;  4RHS A;  3PIO 3;  3SVM A;  1DXM A;  1OO9 B;  1S4Z A;  1UUP A;  1VF7 A;  1F9R A;  3R93 A;  4C3J B;  4C56 C;  4FF4 A;  5M5X B;  1JWU D;  1ENF A;  1UNS A;  2QDB A;  2KED A;  1EY4 A;  1DYQ A;  4KHV A;  2A6E D;  3S1N B;  1GXD C;  3I90 A;  3K7A B;  4FF3 A;  4C3J G;  2E2J B;  1I4G A;  2F0W A;  1OXX K;  3NWS A;  1V8Q A;  4C2M B;  3U9O A;  1BCP B;  2DNC A;  4LK1 C;  3MC0 B;  2NYZ D;  4JBW A;  4K5V A;  3EFX D;  3RZO B;  2J0T D;  4C1N K;  1GUO A;  1C4Q A;  2R6G A;  2XIW A;  2KEE A;  3PO2 B;  2BA0 A;  3V05 A;  4R8N A;  1HCZ A;  1KLG D;  1U4L A;  1XTC D;  5C5M A;  2EXZ A;  3E0J A;  4KV6 A;  5IGF A;  1B9N A;  5F2D A;  1S5B D;  5EKI A;  4K14 A;  1L0Y B;  4IAL A;  3I4M B;  3GTP B;  1FNW A;  2L5T A;  2F3W A;  2F0I A;  2MHV A;  4FVM A;  5C3X A;  1TQO A;  1VMP A;  5JJZ A;  1QNU A;  3A54 A;  5D65 A;  1ET9 A;  3BG3 A;  1WD0 A;  3W3A A;  3DHQ A;  1HUN A;  4K2L A;  4TKO B;  3HOW B;  3V2T A;  1OXT A;  5FO7 B;  3BYY B;  1HA5 A;  4K6D A;  1E2W A;  1SND A;  1Y8P B;  3DM1 A;  3D8G A;  3HOV B;  3M7G A;  3T53 B;  1D1K A;  4XQQ A;  4DNT B;  3O13 A;  4OHJ A;  2N55 A;  3J7A V;  5IIF A;  4CGY B;  4K8I A;  1EY5 A;  4UAI A;  1QJO A;  3K59 A;  1CK1 A;  2XN9 C;  4A3M B;  2NN6 G;  3QJY A;  1X32 A;  5KNB A;  3MHB A;  3QOJ A;  4F87 A;  2EYO A;  5CV7 A;  1FD7 D;  3IKJ A;  2L55 A;  4OIK A;  1QOH A;  1PLF A;  1R9T B;  3URY A;  4HSV A;  5C4X B;  2FHT A;  2M2L A;  2HDL A;  5C4H A;  1X3Q A;  1CHQ D;  4DFA A;  5EPJ A;  4KN7 C;  1PTO H;  2K5Q A;  5JVH 3;  4ZUJ A;  1BXT A;  1SYD A;  2E74 C;  2ICI A;  2EOT A;  1HHV A;  2B2U C;  1ESR A;  3T51 B;  1SNM A;  4AYB B;  5J22 A;  5FLX L;  4FXD A;  1ROD A;  1SJE D;  5CV9 A;  1BCP F;  1KDA A;  3GTG B;  4CJ1 B;  4ZKC B;  2DY8 A;  4DAY A;  5G3L D;  5C0X I;  4IUR A;  4CBV A;  3TP5 A;  4UDU C;  2KJX A;  3GO5 A;  5CV8 A;  1C8C A;  2QEJ C;  1JC7 A;  1TS5 A;  2MP1 A;  1STH A;  1QB5 D;  3X3N A;  1EL0 A;  5KNC A;  1KNE A;  1RTO A;  3FMC A;  4CKB A;  5HGT A;  1DJR D;  2AWO A;  4QCL A;  3H6M A;  2K28 A;  2KVM A;  4Z9C B;  5DEH A;  4QB4 A;  3H94 A;  4HMI A;  4EQN A;  3GTL B;  1V1P B;  2K5D A;  4DGZ A;  3GTQ B;  4NMZ A;  1U4M A;  1ICW A;  3VR6 A;  3JAM E;  1STY A;  3BDO A;  5IGC A;  4RGM A;  1SE3 A;  3J80 L;  1VMC A;  4JK1 C;  1YNJ D;  1MI2 A;  2SNS A;  5I2Y A;  2WB1 B;  4PMB A;  2ZXP A;  2B2W A;  3OWE B;  4KHZ A;  2F0P A;  5EQ0 A;  2F0V A;  1M4V A;  1SEB D;  5DAU A;  4R9W A;  3DEP A;  1BDO A;  4DAP A;  1SBB B;  1LTI D;  1EWH A;  5E1F A;  1STE A;  1B53 A;  1F2L A;  3MFG A;  4ZKB B;  3T56 B;  1WTV A;  4FXG C;  4KY5 A;  3SK5 A;  3SK4 A;  1LV9 A;  1KNA A;  1LTS D;  2F0O A;  4OL7 A;  1SYB A;  3OMG A;  1G2S A;  3T16 A;  5CGK A;  3KF8 A;  2LKV A;  1RCV D;  5M3M B;  4FNF A;  3H91 A;  1W6K A;  4C3I B;  1WD1 A;  3DMU A;  2I07 B;  5C0X G;  3ONA B;  1QIL A;  5ELD A;  1AW7 A;  3FRP B;  3PUW A;  4PV1 C;  5BN4 A;  5E3F A;  4XXE A;  1QG7 A;  4ODG A;  2PW5 A;  3LNN A;  3FPP A;  5M3F B;  2L1B A;  2EPB A;  1H9J A;  4PQX A;  3MZ5 A;  5FO9 B;  1GUS A;  4ZK9 B;  2KA7 A;  2LY7 A;  3PUZ A;  2RDG A;  1EWC A;  3IFD A;  4DN4 M;  1KTK A;  5CYU A;  1HTL D;  3S1Q B;  2NZ1 D;  3K58 A;  1STB A;  1PRT B;  3VYS A;  1BOS A;  1D5X C;  1I6H B;  1U9R A;  1B50 A;  3RLF A;  4TQU S;  3S14 B;  4MHE A;  5JPN C;  5C6A A;  5I9P A;  3MEH A;  1EYD A;  5I4D A;  2CW0 D;  3TP6 A;  1PFB A;  1QWY A;  2R61 A;  2VB3 X;  4KY7 A;  3S16 B;  3CU7 A;  5EPK A;  1YNJ C;  3J81 E;  1UEA B;  2WII B;  1PTO C;  3ITP A;  1KLU D;  1WTO A;  3SK8 A;  3IL8 A;  2EVB A;  1G2T A;  1AZP A;  2K1B A;  1F9Q A;  2R3Z A;  1BQQ T;  3ERQ A;  3VYR A;  5C3W A;  2JSO A;  2XVS A;  4WOR A;  5CC4 A;  4WRD A;  2SNM A;  1A3U A;  3SEB A;  4A3J B;  2NVQ B;  5KND A;  2JP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...