3MHPA

Fnr-recruitment to the thylakoid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase, leaf isozyme, chloroplastic
publication title Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 96
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mhpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3mhpA02
3AVXA 4B48A 4QFMA 4F7DA 2YWGA 1H85A 1VQLB 1GAWA 5TV2A 4QHYA 4YAFA 4RD4A 1EP1B 1Q82D 2ZITA 3LO8A 4EH1A 1QVFB 5H59A 3VNVA 5FA6A 1VQ6B 2BM1A 3CCSB 1IJFA 2DCUA 3U6BA 1CNFA 1XB2A 1FNMA 4P3YA 1WDTA 2DY1A 4IW3B 4TMZA 1VQKB 1JA0A 5KSWB 1VQ9B 2OTLB 1VQ5B 4UAJA 1NDHA 1KJZA 3OJXA 3WNCA 2EIXA 1ZUNB 2PLFA 4HE6A 5EMNA 1F20A 1EWYA 1BQEA 1VQ4B 1FNBA 3CCVB 3WNDA 1R5OA 5JBQA 1YJNB 2BVNA 3CPWB 1QGYA 3QFRA 2QTLA 3G4SB 3W5VA 2QMUA 4ZCLA 3ZZUA 1D1NA 1XE1A 1G7SA 3U2QA 3CMEB 1CNEA 2HCJB 4LBZA 4RCZA 2QTZA 3CCMB 3CRZA 1YHQB 1S72B 1DDGA 3W2GA 3CD6B 4RJLA 1TLLA 1VQOB 1FNDA 3I1FA 2CRVA 2AHOA 4RD6A 1DARA 5H5JA 3G6EB 3CCUB 3WY9A 3I56B 1QGAA 3JQQA 4LBVA 3VO2A 4N3GA 5TR9A 2B7CA 2NPFA 1W35A 4TMWA 3AVYA 1QVGB 3ZBUA 3WBKA 4PGOA 1YJ9B 1YJWB 1ZM9A 2VNKA 4WQMA 1QGZA 1SKQA 3P26A 1H42A 4ZCMA 4J0QA 3W2FA 2C77A 4YHBA 2EFGA 2HDNB 1J9ZA 1E64A 4HE5A 2B5OA 2OTJB 4M4SA 1Q81D 1B23P 4B43A 1ZM3A 1YIJB 3AVUA 4YAWA 3CW2A 1AIPA 3B8HA 3W5HA 1KQSB 1N0UA 1EXMA 2BM0A 2E1RA 1JB9A 2FX3A 1GR1A 2HMAA 1KTVA 3WBJA 1N8RD 1Q86D 2OK7A 1G7CA 1KK3A 3U6KA 1YI2B 1FNCA 3VO1A 2PMDA 2BGIA 3CCRB 3MCAA 3MMPA 4AF6A 2YWFA 3AVTA 1K9MD 3OZVA 1BX1A 1JJ2B 4ACBA 1BJKA 4ZV4A 3MHPA 1E63A 1DG1G 2R6HA 3FJOA 5GV7A 1OB5A 2BPOA 3CMAB 1W87A 2DERA 4B3XA 3ZZ0A 1W34A 1M90D 2VZLA 3E20A 3QFSA 4FWTA 3P27A 4M0LA 1M1KD 3WXMA 5DSZA 3LRXA 1QH0A 4TMXA 1FRQA 1TTTA 1QG0A 3ZC3A 1OB2A 3ZZTA 1F60A 4LBWA 1VQMB 3WYAA 4NBSA 1B2RA 4Y9RA 1N0VC 3QFTA 4H9GA 3V76A 3OJWA 4LC0A 2BSAA 1NJID 4NCNA 3AGQA 1D2EA 2YWHA 2QEXB 3W5UA 1ZM2A 4RD0A 4Q7JB 4DQKA 3CB4A 1QFZA 4K1XA 3G71B 4P6VF 3CCEB 1VQNB 2XEXA 5AN9A 3W2IA 1TUIA 1G7TA 2RC6A 2VNHA 2BN4A 2VNJA 3ZBTA 1K73D 1IB0A 3AVWA 1KRHA 1U2RA 4PC2A 1GAQA 1R5NA 1TVCA 3CC2B 1YITB 2CNDA 1GJRA 3JQPA 4AC9A 4YAUA 4RCYA 2QA4B 1EP3B 3OZUA 4B44A 1ELOA 2OK8A 1QFJA 2J7KA 3B82A 3CC7B 1DDIA 1R5BA 1D8TA 4C43A 4LBYA 1I7PA 1GVHA 1VQPB 3QSYA 1OGIA 3LYUA 1FDRA 1JNYA 1IJEA 4MYUA 4PC1A 1GO2A 1KK0A 1EFTA 3VMFA 4ZGQB 4N3NA 2BMWA 4B4DA 4B47A 3AVVA 4RD3A 3PENA 2QDXA 1K8AD 1CQXA 1EP2B 1W2BB 1HA3A 2BV3A 3WNBA 3QE2A 1JA1A 4FK8A 3CCQB 2DEUA 3SJZA 1KK1A 2PIAA 4AF7A 5THXA 4Y9UA 3B78A 3W2HA 2YWEA 4PC7A 4R71A 4YALA 1AMOA 2D74A 1UMKA 1A8PA 4RD2A 5GV8A 4TN1A 1ZM4A 3CCJB 1QFYA 2DETA 1Q7YD 4G1BA 1FRNA 4ZCIA 4M2LA 4G5GA 2C78A 1BX0A 4U9UA 3VNUA 2BF4A 4BPRA 2VNIA 1KK2A 3JQRA 1VQ7B 4C0SA 1EFUA 2BGJA 5HXBA 4TMTA 1OGJA 1VQ8B 4FN5A 2VYQA 4M53A 4TMVA 1KD1D 1G7RA 3QFCA 3CCLB 3ES9A 4ZGNB 2B7BA 3FPKA 3CXCB 1SM4A 4PC3A 2GPJA 1S0UA 4Y7CA 3CC4B 1QUFA 1QUEA 1QX4A 3J81k 3AGPA 1KC8D 4ACAA 3LVBA 4RD1A 3I55B 2X3UA 1E62A 2RC5A 3W2EA 5TY0A 3A1FA 2GQFA 4M1KA 4PC6A 3E1YE 3OW2B 2QN6A 4DQLA 1EFCA 4YAOA 3OZWA 4G1VA 2XNJA 2XNCA 4MYTA
chains in the Genus database with same CATH superfamily
1QH8A 1T1GA 1VSVA 1YE3A 2NYRA 3O91A 2MDTA 4JP2A 4Y2HA 2WK1A 2Y0PA 1N75A 3ASYA 4XSHA 3SE7A 4BO2A 3RS2A 3F3KA 3A2LA 3SJAA 4CF7A 1E9AA 1EM6A 4YRCA 1NSYA 3WLHA 2I6FA 2GJAA 4CMEA 5T57A 5JQGB 4IV5A 4EMUA 4GX5A 4GF5A 3NO4A 2YINC 4RFVA 5D00A 4KWIA 5KJFA 1WMAA 4F2GA 1XNRB 5FKJA 4ER6A 3JQ8A 3K92A 2XA2A 5K09A 3P9XA 3T7KA 3ZIAD 3GMTA 3VQTA 1E1MA 1CLEA 3SM3A 3KQSA 1D9ZA 1MG5A 3PDUA 1K0UA 4N4AA 1RR6A 2I55A 1Y48E 4X6UA 3PUMA 4MV5A 1GZUA 5A5DA 5BURA 4G5HA 4TYYA 2WSIA 3LHKA 5FI1B 4B35A 4ZXPA 4EJ6A 2R65A 5K0NA 1SD2A 1CNFA 3L0DA 4Z2AA 2C1XA 4ZHQF 5FEUA 1FMFA 1E1DA 3JZDA 4QPCA 4OI4A 4WLVA 3ADPA 4DWWA 2XB9A 2DY1A 2AEMA 3S8EA 1EBFA 2F1RA 2VXOA 1LWNA 3T3EA 3DFIA 5AW4A 5M5BA 2JW5A 3QYFA 2VDJA 4L95C 4QHTA 1U9JA 1ODIA 1OFUX 2LBPA 3RSCA 2COEA 3KX2A 3VBCA 1NF8A 1QIGA 2YJGA 2ACEA 2MSLA 3A04A 3D1VA 4ZALA 3RAGA 4D41A 2YZ2A 5JOQA 4A36A 3MB8A 1F0PA 1G64A 1NQVA 4EZIA 4LFBB 3VMMA 1QCDA 5C5IA 2H85A 3PTZA 2ZJ3A 4E12A 1L5OA 2JIPA 5L40A 5FBHA 5A5FA 2QZZA 4MCHA 2L42A 1FSFA 1MCZA 3D4BA 1KO4A 2I1VB 3SJCA 4M1TA 3WRYA 3WNDA 3OZSA 3ZYZA 4B3HA 5A5VA 3GPCA 3JRNA 1XAGA 3A2KA 5ALXA 3RUDA 3DZJA 4BP3A 5KOJB 3B1KA 2JFGA 1OU0A 3ITKA 1XRNA 3COWA 1NQOA 4YWHA 1M0TA 1RWBA 1Z9BA 3DO8A 3GEMA 3IR6A 4XZ3A 3ZLUA 1SXPA 3AFOA 3WLPA 1W6RA 2RG1A 1IPHA 2G6TA 4KUHA 4PW0A 3W6ZA 1SCBA 1IVYA 1OE0A 3ZNPA 1XQYA 1G21A 2JIOA 3ELUA 4U8GA 1ZUIA 4LFAB 1L6RA 1WD7A 2IVZA 3Q6MA 3OAAA 2BD0A 2VRWA 5DK6A 5EI5A 5BQ5A 3RIGA 5MGNA 2W6JA 1CF4A 3KVNA 1W9HA 3FCCA 3THXA 4MNTA 4G7XA 3KYIB 1XX6A 2WJJA 2HCJB 3IESA 4OSEA 2WWYA 2LPMA 2E4XA 1FU8A 2P41A 2GWRA 3ZY2A 3RUEA 1LQ2A 3T1OA 2LGJA 3JX9A 1P80A 5K4HA 4WXMA 4FFWA 2IU6A 1AQIA 1X19A 4G5SA 5AP9A 3RT9A 3HFSA 3K16A 4CKXA 4DIUA 3UM9A 3W2GA 1B8OA 1XZKA 1B6RA 3A6HA 3DW1X 3A7DA 2LKDA 2ETVA 4TVKA 5EKTA 1JG3A 5I5GA 5HE9A 4JLSA 2W6ID 3KUKA 3TBFA 4WCVA 1A9YA 4KXLA 4ZCQA 1FFSA 2GO1A 3GZNA 3M6IA 1BE8A 1BE6A 1PV1A 4GAEA 2JH3A 2HWUA 3GUYA 1PWZA 4NKRA 4R8LA 5DX1A 1RQRA 1JLLA 4LBVA 1U7ZA 2CMFA 3IUSA 1N57A 2YBEA 4DCUA 2AJDA 1XDBA 3DNFA 3PNSA 3KLOA 5ALZA 5FULA 3H5AA 2C5BA 1UDAA 2ZBDA 4CHTA 1DE0A 2Z2KA 1U63A 1U1DA 2AVNA 1RDFA 1BRMA 2ZIXB 3WMXA 2Q3FA 2AQHA 4DARA 3WLKX 1KJWA 1M1NB 2VPPA 1I5RA 3EQZA 3LJKA 4OU4A 1FFEA 4H7FA 3NASA 5AKYA 2PMFA 1H42A 4AMYA 1L4YA 3A7EA 3PIRA 4OXQA 1U3DA 4U2EA 1DC4A 4YROA 4LRWA 1DAKA 1C9DB 1FSZA 4B83A 4YP6A 1YX2A 1GNLA 1P4GA 2HMYB 2PWAA 3WLTA 4MQLA 5A4IS 4E5PA 2QTCA 3J81A 3URKA 1PDOA 1DJNA 1L7XA 2FFHA 1KY4A 2O4CA 5BUSA 5AVWA 1B14A 1E7WA 3OJCA 2LV8A 2O2SA 1M54A 2GN0A 2J85A 2RH4A 4LDQA 5EWJA 4YP9A 4KKTA 1BS1A 4IZIA 3W8DA 3WMWA 1ZGAA 4P7KA 1Z25A 1M6WA 1KXJA 2AF4C 1HOXA 4PCAA 3UJ8A 4F4HA 3DDSA 3AR3A 1K7EB 1W49A 4F3TA 4DY4A 1ORHA 3AR6A 1PZNA 1JHYA 1KY2A 1V16A 3IP5A 3KLPX 3NPMA 3OKAA 4LMRA 4NCHA 1LJLA 3WJ2A 4BDSA 4GPZA 4UZEA 3G88A 2VHJA 2QA5A 2QAGA 1R27A 3CNLA 4MRMA 5A71A 4XRGA 3IAM1 1PZFA 1V47A 2V6BA 2HBRA 4ME6A 5DJ5A 2JC3A 4PSVA 1PVVA 3WKDA 1KYTA 2KJQA 4KNWA 1RAGA 4BNJA 4RS4A 1UXOA 1P60A 3EJ6A 1BN7A 1AXEA 1XD2B 1G7CA 3IDQA 4C9BA 4AIRA 4E1BA 4GPBA 1TYAE 3QBDA 3R3ZA 2EW1A 3F3YA 2O8VA 2ZIFA 4GBED 1DT5A 2QMEA 4OOXA 1XMPA 3GGGA 4C4XA 3CCRB 1XEWY 2AG5A 4A6PA 2JFWA 4ND5A 4C76A 2VDVE 4JUCA 4LECA 2AZMA 4U2GA 3UJBA 2X0FA 1QH1B 1X2EA 1YRAA 2AC2A 4YONB 4A73A 5KJCA 3H6KA 2XBMA 1T0UA 3UG6A 3D6NB 3X1ZA 4HK4A 3WLAA 1J56A 1YVEI 1P7YA 1DQZA 2ZR8A 4IILA 4UTZA 4X1OA 4N54A 5EUBA 3CZQA 4F8JA 2XCTB 1J1IA 3MD0A 4XUEA 3CP8A 2BHNA 4WKNA 2W4MA 3V4LA 3BEDA 1VM6A 3JQEA 4BFTA 1VYHA 1E1RA 1JR3D 2HJWA 4MCAA 2FSSA 3V42A 3ZYCA 4KR3A 1QQ7A 1H5QA 4Q1EA 1TT5B 5DI9A 2AVDA 3EVDA 1KQGA 2B21A 4MYCA 2ZT7A 1KS9A 4BFVA 1KYVA 3GJYA 3UK2A 3WK7A 1NXPA 5ALQA 3WXMA 4IJ5A 3PI6A 4WAUA 2QYHA 2ZSUA 1R9NA 4GUDA 4PPQA 1NAIA 4MW7A 3PGJA 5L3VA 1FRQA 4OQXA 2Q8NA 1U11A 3O3MB 4D9GA 1GQOA 2G9RA 2QVYX 3QQ5A 2IXFA 1EVZA 1Z56C 3R40A 1XZEA 4INPA 4XPIA 4AZ3A 3R20A 2LCFA 4C14A 1HKHA 3R6KA 2OC9A 4RKRA 1G291 4R3UC 3JAKA 3ZZTA 3O3NB 5P8WA 2V58A 2OFOA 3DDNA 1EDBA 1WKVA 4HQKA 4LBWA 1TGYA 4J7UA 4MUEA 3TX6A 4D9HA 1DJOA 5FV7A 5IYZB 4FGLA 2FPLA 2PGXA 3OOWA 2XIJA 1UC5B 4Z1MA 4ZEWA 3N6XA 4LC0A 9LDTA 3IALA 1SBCA 2L0XA 2Q9CA 4PYIA 1ICEA 1WCIB 5G4LA 2QM0A 2JD1A 4K03A 4PNHA 2ZP1A 4PYJA 1L5LA 3T1VA 3GJTA 5H3LA 4RC9A 2ONJA 3UMVA 1PQPA 4B2LA 1VI5A 3DP7A 2X5XA 1MAVA 3QVTA 2XDAA 3TF5A 2R2GA 5LXTA 3MINB 4B3MB 5TNXA 4PABA 2JVKA 4QYWA 4ZU3A 2BFFA 3JQCA 4G9EA 1VQNB 4AZVA 5JNSA 4V03A 4DLAA 4YRTA 2RHCA 2GCPA 1QZZA 3CONA 3H11B 4GMHA 2H9YA 1O9BA 3L4BC 5T5QA 4X8IA 1N0HA 1GUFA 3QNUA 3CCBA 4B71A 4DADA 3HDGA 4HWRA 2FA9A 3WMRA 2BN4A 4DPKA 3TLCA 4XX1A 2CLDX 2O8NA 3ZHXA 4Z7JA 4ZO7A 4YRPA 2B83A 3L6EA 5JD4A 1MMFB 1US8B 2P6RA 5THKA 2HZBA 1KDZA 1LV7A 1NVVR 2CVOA 3MMSA 1IUKA 1UINA 1Z73A 3E5MA 5JC8A 2GHQA 1IZYA 1ZA1A 2XXBA 3DLTA 3PUWA 3CC2B 3ZNNA 4EDFA 5LQNA 3HYSA 2HQOA 4RLSA 5AQ1A 3WGKA 3MFQA 4WDQA 1PI3A 4PLYA 2BEVB 3DT6A 3JQPA 4GGMX 1ZJJA 2Q5FA 1SD5A 4JVOA 4OG2A 3T06B 2F3SA 2B1RA 5LB4A 3OFNA 1JXOA 1WZEA 4XWAA 3G17A 3R0XA 3C3AA 3OSUA 3RTCA 4YPVA 5I7RA 3OJ0A 5FHRA 1EXWA 2Z6AA 3VU8A 4A8JC 3M5CA 3L07A 3T3IA 4HZIA 3EQ2A 4TYNA 1Z0AA 2WNIA 4FHZA 4MUGA 2QNIA 1LTHR 4IMPA 4QODA 4ERXA 2HF9A 1BWSA 2J33A 2Q29A 5HVNA 5EC8A 1NUAA 1XRRA 3K3PA 3V6MA 1CUYA 2AG6A 5E38A 2PN1A 4HNRA 1L4FA 1TQHA 4KQXA 4R40A 4YI5A 2J3JA 3TGWA 3R0VA 5DN6D 1MXFA 3D6JA 1PD0A 3LCRA 2G80A 4H77A 2ZIAA 1SGWA 4N8SA 3AF1A 3T94A 3L01A 3ORHA 2RONA 2GJRA 3HVIA 3NC4A 4K7JA 5GGYA 3UJCA 3UQYS 3ZEAA 2QRKA 4M9UA 4JOBA 2FCAA 2J3MA 2ZIUB 5DKFA 5G0SA 4I4LA 1E94E 1P5ZB 2MYTA 3TKYA 1HDGO 3DD5A 4YP1A 1C4XA 1LLDA 1U8CB 4II3A 1WW8A 3LCVB 4ZCRA 2FPOA 5B6PA 3IPRA 1PP4A 1RACA 2KPOA 4M76B 4MS3B 3KSRA 4HBGA 2QR3A 4I9FA 4BWFB 5KYGA 1HR0B 4AY2A 3BMOA 3EOZA 5CVCA 1TDJA 4PVCA 3GN2A 4LJRA 3HUUA 2JJ8A 4W9NC 3MGBA 1JLMA 3H4TA 5DVZA 4F97A 5L3QB 3DC7A 3R5XA 4ZREA 2Q4EA 1RPTA 3NWJA 4A6XA 4H7JA 4F3CA 2AG8A 3ELBA 4JP5A 1EVYA 2Q3LA 3CX6A 3OBBA 4BLUA 4YIHA 1TCVA 2XODA 3SHOA 4IZHA 3MJ4A 2DH6A 3LUGA 3R9XB 2WSLA 3IUPA 2VZ8A 4OXYA 4BXOB 5KAPA 1MXHA 4S1PA 1ZD1A 3V8PA 1UQRA 1V8OA 3CGWA 3SBOA 4BV8A 3FLMA 1ISIA 4O4IB 1S1CA 1OXXK 3D6FA 3S7TA 2W93A 3UWKA 2BHSA 4YJ2A 2O8EA 3ILHA 4RK1A 5EIXA 3U16A 1NVWQ 1VE6A 2OYSA 1AXGA 1C0LA 1K86A 4KMMA 3ER8A 4C4SA 5PGMA 3EFEA 4NZMA 5K3BA 4B3RB 1LBTA 3LQ2A 3CESA 1XU9A 2YY6A 2OSVA 2C94A 1P7CA 5COQA 2XMSA 3AETB 3AUKA 5IYZA 1J20A 2WF5A 3P9KA 4EEXA 4B31A 2XB6A 1OAOC 1V5WA 2IQ5A 3AUTA 3HMKA 4YR7A 5K8JB 3PA6A 1B73A 2FY8A 2V6GA 2RI0A 3QWAA 4KK4A 3U5TA 5BV8A 1OWOA 5FCDA 3DTVD 2ILVA 4HGZA 4RPJA 4K88A 3PR2B 1KIFA 1ODTC 3MELA 3UBMA 1T0HB 2XMGA 4EHNA 4ZK2A 3GA0A 1M8PA 5ALPA 1KDRA 1GFZA 4LNAA 1P5JA 2IYEA 1U0NA 4TV8F 4IY1A 4E88A 4RNCA 1GPH1 2V7QD 1BZYA 4NR0A 2JLWA 1YFJA 3EASA 3P4XA 4DKXA 1O58A 2Y0EA 2YDXA 1GDDA 3DWGA 4FW9A 5CB4B 4GYJA 4RHEA 1YFLA 1VLYA 1T35A 2VAPA 2VQDA 4Y2RA 2J7PD 4D0LB 1QS0B 2GXAA 3IAS6 1AXRA 1X6VA 3F97A 1PNVA 3HUTA 5JCXA 4RZXA 2Q4OA 4E7OA 3S4YA 1CTQA 2WJVA 1R0ZA 4R9UC 1QU3A 3DEKA 1A9QA 1SB8A 1KU6A 2FFQA 2FWBA 3H1EA 1SNYA 1JWAB 3N70A 2NNLD 3AFIA 4L15A 4LV6A 4DLSA 2L82A 4R4JA 3GELA 1BYIA 4LKOA 2NYAA 4E22A 1DUSA 4FN5A 2IEGA 3ETDA 1NIPA 1U0JA 3N6RA 1K8ZB 2BTOA 1PX0A 3QFCA 3ESRA 5CLQA 4HLQB 1U90A 3EWNA 3Q98A 4MR9B 2XMQA 4E33A 4ER3A 3S1LA 3UMGA 3OQMA 1Y5MA 3GRRA 5EERA 1E6EA 2X8BA 3LXXA 4LC1A 4MA0A 3D2LA 1CR1A 3I0MA 4EMBA 1W88A 1XR3A 3CPJB 3IMKA 4TZ0A 1Y9JA 3BEOA 4WECA 1Y9ZA 1BHSA 1ZNQO 1CQWA 3NFYA 2G5CA 1GUAA 1JT9A 4UVEA 3KL9A 1LKZA 3AEYA 4FD3A 4KPGA 5DI3A 4BMPB 1HL7A 3PDIB 3HVJA 4PYNA 4TL7A 4DKJA 4D82A 4L5AA 2XB2A 1OWMA 3LUAA 3P71T 3R6DA 5BNFA 1WXFA 5FB3A 3TZQA 4JI4B 2EZ9A 2HU8A 1A9XB 3P9NA 4NG4A 4XRRA 3AJAA 1I5OA 1UZUA 5DEOA 1YL6A 3LSTA 4BE7B 1A98A 4Y6LA 1XRPA 2G1JA 4MVJF 4C3VA 1A7KA 3AY6A 4RDXA 1ADJA 5FTLA 1DAHA 3KKPA 2W2OA 3JALA 4K81B 4V3BA 3HR7A 5CLGA 4Q03A 3SNHA 2Z5VA 4P3XA 3VR3A 4EJSA 2FP4A 3LCJA 1ABBA 1U0SY 3ZBQA 4M8KA 2ZB7A 1Z0JA 3DP9A 2NVUA 1KI3A 3BRQA 3H8JA 3CVJA 4WBXC 3VAZA 4D5GA 3I3OA 2FPMA 3SZMA 1OXSC 3HYTA 3IAS1 2GARA 1HE4A 3H9CA 4HFRA 4OFXA 4XWTA 4G1VA 2O7RA 3PJEA 2J5KA 1FPMA 3V2GA 5IJZA 2NACA 4DLNA 1AQNA 4FTWA 2YV4A 5JANA 1LI7A 3DKPA 3KKOA 2UXCB 1KQOA 2DJ5A 3V55A 3VKVA 3GCDA 3KSZO 3F8WA 3IBSA 3T5DA 3TCKA 2PBZA 4HX5A 2ID9A 3EFOA 1N4AA 4QLOA 4X0EA 3EUWA 1CUFA 3H2ZA 3ZCVA 4KBGA 1E1YA 4I4TB 3FHTA 1W1WA 4E13A 2RCNA 2ZYHA 1FXWA 1XK7A 4QDZA 4LI0A 3DBLA 1ENYA 4BL5A 1FLAA 2IYSA 4YAFA 3PIDA 3ENKA 4LPKA 1AV6A 1K5DA 3AEKB 4CL2A 2C07A 4NE7A 4MXDA 1NGSA 4B81A 4QBIA 3ZHQA 4YV1A 4ZU1X 2HHJA 3EIEA 5H59A 1IMOA 2QG4A 1OFUA 2HXYA 2FUG6 1II8A 2B8EA 3BTOA 5HTKA 4G84A 1ZP6A 1FL9A 4XB2A 5IFKA 1SA0B 5JVDF 2W42A 2JFOA 2PGLA 4DMCA 1L5WA 1RM5A 3OHPA 1D2RA 5H68A 1B1AA 4UHHA 2BEUA 4BMSA 2O0LA 3UHOA 1L4EA 1WV0A 3CP2A 3ESQA 2CXOA 1LBHA 2L69A 4M22A 1GYQA 1H1LA 4U00A 5F78A 1SIOA 4DAOA 4YP7A 2J3HA 5BMVF 4OX9B 1LJUA 2DHRA 1GLGA 1D0IA 4LGCA 4UOEA 1ZHHA 5JH7B 1EHIA 2AC4A 4L9SA 1DBVO 4KRFA 1XDWA 3DE4X 2OLKA 1OXKB 2P62A 4MRPA 4NCKA 1U0RA 1FTWA 3RO7A 3DTNA 1P17A 1JDJA 1NDHA 3Q3GE 3T1QA 3OJXA 4LGMA 1TUBA 4LXUA 3VHXA 4AWBA 4PRZA 1T8PA 2PJRA 1EVEA 5EA2A 5KHAA 3I2KA 3RNOA 3FMVA 5G4KB 3WDSA 3KWFA 3FUTA 4HX2A 3UMMA 4AKGA 2V4MA 1Z6TA 4GUAA 4WZ6A 4OJTA 3UHAA 3LZCA 5BNIA 4MQFB 5G0VA 1KI7A 1VMAA 1XMXA 3MC1A 3F4LA 1E60A 1HZEA 4C7OA 4H60A 3B5EA 5HMMA 2CCJA 1NN0A 1KDYA 1UM9B 2XF8A 2WSYB 3HR8A 3NORA 2FPPB 4FJ2A 3WGVA 1QQ5A 4N7MA 5AVOA 3ZWMA 3THYB 4I4NA 3NANA 3I4FA 4MTCA 3W3ZB 5FOVA 4L8JA 3JSXA 3M82A 3T9AA 4D45A 3KHSA 4AJPA 2WJIA 2H6EA 1CUXA 2PWBA 1O4WA 2JRCA 2H1SA 4V1CB 2Q7XA 5E7QA 4Z53A 3AHDA 3GJ8A 1F0YA 1NKSA 1JGTA 3RIYA 3AF6A 4UJ5A 1KZGB 4QV2A 1GL7A 5BO5A 2XDQB 3TE7A 2FUG1 2FQYA 3A11A 1T5HX 3HCAA 4GOOD 4P4UA 2DLDA 5DXAA 4N5NA 5M7EA 1PG0A 3NBUA 4O2AA 4RCZA 3LIIA 1SC9A 4JLDA 5FXMA 5EINA 3VISA 4S1NA 1IBMB 2WFZA 2A14A 1K6MA 1TF2A 2P3LA 4QXQA 2J3IA 3N05A 1C8KA 4JJ8A 2FF5A 3QX3A 3CLSC 5DWDA 3RANA 4NBLA 4CM8A 4TLBA 2V7TA 3PC2A 2TSYB 4RD6A 5A04A 1H94A 4DLVA 3FUVA 5ULLA 3FPPA 2H51A 4G0ZA 4E5SA 5KYNA 4V0MA 3I56B 4UM5A 1CUAA 2D3WA 3VR0A 1KMCA 3IVRA 4HN4B 2WJZB 4CMKA 2GDJA 5AHOA 3HLTA 3WYDA 4EW2A 2QPOA 4FR5A 4HGNA 2ZZFA 1JFVA 1GCUA 1SG9A 1XLTC 2WZDA 1Q74A 3S6JA 3V8QA 3RFVA 3HXLA 3PICA 1D09A 1YJWB 4E0BA 4NBKA 5DE3A 3L8YA 3HH8A 2X23A 3EGEA 4DNQA 5IM4F 3Q9LA 1I1NA 3OEYA 3BWXA 3LFHA 1Y9AA 1W36C 1K2WA 1PTJA 2Q28A 2WTBA 4EIWA 4Q4DA 5HKBA 5CPFA 2W8BA 2XRYA 2FWPA 1J9ZA 4M37A 5HFAA 2PLAA 1G4HA 3G82C 2M6RA 1AKWA 1K3FA 1WMDA 1ZX1A 3MT8A 1FDIA 3AVUA 3E4DA 9LDBA 3CH7A 3QITA 3VA7A 2VYVA 3N7TA 2HK8A 2YHBA 1X13A 3KXKA 4CV3A 3W8FA 3ND8A 3AVQA 3PPYA 4XOUA 2J45A 2FW8A 3STXA 1EBUA 3NNSA 4LX0A 3RLFA 1VYTA 5AK0A 3UAVA 1YE8A 1XMQB 2OLJA 3GMDA 1YDGA 1Z12A 1T5OA 2YVUA 2B5VA 4FIZA 1ORDA 4QUIA 4E07A 4LWPA 4BFYA 3Q3EA 1Y1KE 2GI4A 2GN9A 3BGIA 4GBMA 2WV7A 3KVVA 521PA 5J9FA 2I2CA 4C4TA 2V9PA 4CLXA 1HLDA 1JDBB 3L49A 1HC7A 2EWVA 2XB4A 3F9CA 1Q86D 2P7IA 4MB6A 2XYGA 4XQ9A 3OE7A 3WIBA 5LDDC 1JQBA 4HL6A 5EN4A 3TOVA 1GGJA 1NI5A 1BMFA 1B3BA 1RT9A 5EY5B 1JI3A 2W6CX 2IEIA 5HILA 1OW3B 1QG4A 1U8FO 2D54A 3EULA 3PNQA 1DTSA 3L18A 4HS4A 4OYHA 5G3YA 2XX3A 4Z3OA 1NU8A 4X45A 1Z8NA 6REQB 4UXJA 5FLKA 5FL7D 4LZAA 4FCCA 4F5YA 5IFLA 3CPSA 4MLPA 4X64B 1K9MD 4EF4A 5EIOA 2QRZA 3OOJA 2P11A 2HUNA 4P5PA 2D9RA 4YXWD 1GRQA 3B3GA 1VSUA 5H9VA 4IPTA 3WQZA 4C7KA 3SY8A 1I0ZA 3VR6A 5M29A 2XOXA 2AV6A 2EZ4A 5FR1A 4HNGA 2ZIEA 2YQ4A 3WZMA 2EATA 3AVOA 2X1VA 5EIBC 2XCLA 1D0SA 1UC9A 1MAUA 5B12A 4BLOA 4CM1A 2OHFA 3HG7A 4JKOA 4DV6B 4NP6A 3SCZA 3TMAA 4RQUA 3E20A 1DVRA 3JQ8B 1THGA 3RIMA 1L4NA 5J1SB 5CB8A 3BKXA 5AJWA 3MUNA 2V54A 4P25A 3HN6A 4YO8A 4BMXA 1QAQA 1I9CA 1DQRA 2CBGA 2HSEA 1E9BA 4HDOB 1I32A 1UXHA 421PA 3VFDA 1Z16A 3DQQA 1A82A 3PPWA 5E1OA 2NTEA 1BKYA 3UKJA 1TYBE 4H2DA 3Q3HA 3TIIA 2CN1A 4MUYA 2B2CA 1TX4B 3RJZA 4JI3B 1NTRA 3BZBA 4BBZA 3ICEA 1Z4QA 4B6SA 4P98A 4R2IA 3GQVA 2ZAMA 3UHPA 1I0LA 5H4GA 2NP7A 1JBKA 4MP6A 1VP3A 2J0SA 3K4QA 3DMRA 1FJHA 3HL4A 4G1CA 4R1TA 3QP9A 4DRZA 1I2AA 3WSWA 2R4UA 4KXFB 2GKOA 2EWWA 3B6MA 1RKQA 4Y6SA 3WWYA 1O5IA 2R6CA 4JSRA 2HF7A 2WUFA 4X07A 3FCUB 1L7OA 1JDSA 3O38A 2GYUA 3TQRA 3DC2A 4CMCA 2YWHA 4Z0PA 5C1IA 3B6JA 2BGMA 4IZOA 4DQKA 2QM8A 4Y2SA 1CRQA 1DOAA 4LZNA 2EGUA 1QRTA 3MJRA 4U4AA 2FK8A 1D07A 1PR9A 1Y3HA 2VTBA 3G2PA 2HPHA 3CX7A 1JKFA 1GNSA 1MDBA 1NVFA 1JB1A 3ODGA 4Y1RA 1A2OA 4F21A 5FX2A 4YWJA 5KCZA 1TZJA 3JD4A 5FBWB 3VZQA 5I9NA 1N3YA 1G21B 4P3OA 3D5EA 2C2YA 4V0QA 1OT3A 2WMOB 4IUCS 1JEDA 4EA9A 5B1YA 5KNCA 5EKDA 5TQJA 1ZD3A 1T4GA 1VBMA 2DUUA 2PKYX 4J0JA 4KYUA 4Q3KA 3EXIA 4JQOA 2XBUA 5EMKA 3W7BA 5DYTA 3IPCA 5LQUA 1PJQA 2IE8A 5AXCA 4Q4HA 3V46A 5B3JC 1O0SA 2VPXA 1RYZA 5AM0A 2CB0A 3RADC 5BV1A 3GSIA 1VB3A 2B99A 2D1YA 3LYHA 3QTLA 2GVDC 3VNSA 5GVRA 4E4YA 4YMVA 4UU8A 5DLQC 1HFJA 4D92A 4S1VA 1GQYA 4NAVA 4WZBA 5KWIA 5HK8A 4CWAA 5B1IA 1GCIA 3QPDA 1CUJA 1J5XA 5LOVA 3TSZA 3GZNB 4MZXA 3STHA 3WA6A 2UXBB 4UU1A 3OEEA 2YV3A 4B44A 5AK3A 5JNWA 2OK8A 3SN6A 5LQCA 3KQUA 1YKFA 3Q11A 2J7KA 2XGSA 1JLLB 5JE8A 1UIMA 3CH6A 3HMQA 2J6HA 4WZZA 4IDHA 3TL6A 4C6SA 5JCZA 3MJHA 5HEKA 1HMPA 4M9SA 1H2RS 3JQBA 3VSDA 3U17A 1G6HA 3WKEA 1Y5IA 1J21A 1NN5A 4DA7A 3A1PA 1I7PA 4IS2A 1GVHA 5K6AA 4NV0A 3QSYA 4XQCA 1E6KA 5EQDA 3GL9A 3FGZA 2XT6A 5AXBA 3OURA 4TLDA 1APBA 2ZWPA 1NURA 3ROZA 5KWVA 1JI0A 3OE1A 2H1VA 5KTSA 4LJ4A 4JASB 2FR8A 5HDQA 2XY4A 4LTMA 2BGLA 3MOIA 4P54A 2H54A 4WFKA 1AC5A 2XQFA 3L93A 1ISPA 1QE5A 4F1JA 4JCCA 2XCSB 3BXPA 5B7PA 3N07A 3HEBA 1A5BB 1SUIA 2QLTA 3F1LA 2J09A 2PVSA 5EWJB 1S6YA 4RGBA 2MCFA 1H2EA 2WVHA 2FHSA 1P2FA 3ZD8A 1EA5A 1KZLA 3CUYA 3HK2A 1T5SA 4L5YA 2HA2A 3CWQA 4V0SA 5C7IO 3FJYA 1V16B 3BXZA 4RL6A 4Z7NB 1H9AA 4RZIA 3Q0EA 4EFNA 2QAGB 4MRMB 5JHHB 2AK2A 3TI9A 4M21A 4PF1A 1YB2A 2JG3A 1N07A 4WWVA 2WE8A 5FPKA 5BNWA 4A15A 4IVQA 4OQZA 2QN1A 2QLMA 5CT8A 5G0UA 3SKBA 3UAWA 2QTRA 4P35A 4B0PA 5CT4A 4ZC8A 1Y37A 3OT1A 2NVOA 3RNLA 1P4RA 4XQFA 5JS8A 4JUFA 2YHAA 1Y7TA 4D80A 1C50A 2OECA 2JRLA 2QD1A 2X0IA 3L6UA 4PXAA 3VGJA 4RPCA 4AZTA 4B33A 4ED9A 1T34A 5DEIA 3PTLA 3ZGXA 3F7TA 4O08A 4HH1A 1Q0HA 3IQZA 3ZWAA 3BS4A 2ZM5A 3A8JA 3ZD6A 2DWUA 1U3UA 3B9QA 4TL9A 4N82A 2J87A 5ABPA 3RTDA 1EXVA 5KNDA 1PS0A 3G2QA 4UW9A 3WNVA 5EGSA 2IC5A 2HRBA 3FNRA 3O4HA 4YGXB 1OFIA 1P18A 3SE0A 2OG2A 1PKVA 4MHTA 2ZANA 2VA9A 1YDEA 3LHSA 4EMSA 4TKUB 5JT1A 1EU1A 2WG0A 4CQMA 1RC8A 1CDEA 3B3AA 3KG2A 2YZMA 1QYDA 3X1MA 3WKAA 3EZ9A 3NUQA 3EW9A 4XLCA 1KSHA 1NT2A 1B4DA 4CQNA 3DOCA 4UD6A 2YCBA 1USVA 3B7PA 4A26A 1JIVA 2BYTA 3K0HA 5CNKA 3F6BX 1NR5A 2D2IA 3OC6A 3H13A 3AIKA 4NONA 3NAMA 3O8QA 1IN4A 2HMUA 3AZOA 5T41A 1LB1B 5THQA 5CXUA 4KITB 1IIBA 1UOEA 4G5GA 2JA2A 2B9VA 1VECA 1EDOA 3G89A 3M4ZA 4JJGA 4M8SA 4RM2A 4ZPJA 1ML4A 4A5OA 1G5QA 1X3SA 1B0ZA 3A05A 3HA3A 4RH0A 4AZ3B 1BA3A 4DIMA 2E48A 2YCLA 4XPIB 4B09A 2VNIA 4X54A 1UJ4A 5EXPA 4D4KA 2FGKA 2ATXA 1I1OA 2CNKA 3C97A 3ORFA 3JAKB 1PDWA 2VSXA 3MJCA 3OPNA 3IXLA 2F8MA 4NMHA 4PZ0A 4ZZ1A 2QUKA 3SVLA 1BHO1 3C15C 2VSOA 4BX9A 4RM3A 1JHAA 1MVLA 4AUKA 2B4YA 3RVQA 2OZKA 1OGJA 3JTMA 4A6DA 3W1VA 3MD9A 5F12A 4X0CA 4YT5A 5ADVA 5TPZD 3EZXA 2RH9B 1FDUA 2WWTA 1Q57A 4EGAA 1OLSA 5TGTA 4QXMA 4DSOA 2XA1A 2I5PO 4YDQA 5JECA 3TW4A 3D5TA 4UEKA 3DBHA 1PTKA 1B2LA 3O95A 4NMLA 3RAPR 3TZHA 2Q7OE 2FJUA 3PGXA 4C4OA 4KI0A 3E6AA 3G0GA 3IP1A 4X65B 1TXGA 1D04A 1U9ZA 1XCGB 1U3CA 3TTVA 5LXTB 2WIBA 5JS6A 1SHJA 5TX7A 1T0PA 3AGPA 1KMMA 4ACAA 1WG8A 1WNTA 4U2CA 2IHKA 1CY7A 1T4CA 2OMKA 5BWCA 2IOFA 5E8JA 5KTOA 4O4IF 3HXOA 4DMHA 4W8OA 5BWLA 1F4PA 1E62A 1WPQA 3QTBA 2OA0A 3W2EA 2Q2OA 1QTNA 3R7BA 1N32B 4QGBA 5L7YA 3OM0A 3IVAA 1WTHD 4JI2B 4F2DA 1Y3BE 4M9CA 1CR6A 5K0FA 3EEBA 4E46A 4YCLA 4PX3A 2VBCA 3E2IA 4X93A 3H65A 5DF1A 3A58B 1L8OA 2EGGA 1YZNA 5K9ZA 3AEXA 5KYUA 1ZWKA 3Q9UA 2WM8A 2O5CA 2IYXA 1EFCA 1J9EA 3IV9A 3WGUA 5BWBA 1S9HA 3ZXIA 1JYSA 4CM3A 2F59A 2GPWA 5I51A 3FM9A 1NRKA 1OB0A 4WUVA 2R2AA 5INTA 1Y6RA 4MYTA 4TS9A 4B48A 4CMBA 4DREA 4F7WA 1TO1E 2VJBA 2FH5B 1P0PA 1XU7A 4ZVRA 4KQMA 3VKUA 3Q12A 2OD9A 2JI4A 3E9YA 4NK5A 2PS1A 4OQDA 5DRTA 5BORA 1JHVA 3P2KA 4M9ZA 2Q5JA 2OAQ1 1SBZA 1R3UA 2WWWA 4ZGBA 2PRKA 1JWLA 3DV9A 4FBMA 4UZFA 3KKMA 3PIIA 4DIDA 2CL0X 1LNQA 2CLSA 2J9GA 2Z30A 4XH9B 4KIWA 3GJZA 4IMRA 3WWCA 4A2QA 3UC9A 1JXQA 1PX2A 3K32A 4FYVA 4C2BA 4LXTA 4L4RA 3FCOA 4X85A 3H2KA 1SY7A 1WU7A 1I33A 2ZR0A 4DR6B 1KFBB 4KQGA 3ZU6A 5L7WA 2P2NA 1GGNA 4UD2A 1PU2A 1I36A 4CN9A 3V80A 1Y3DE 3I9NA 1OC4A 5C31A 3DCNA 4QXOA 3ZIAA 3QEBZ 4L8VA 3WGYA 1W0CA 1EA7A 3JWPA 4ESHA 4RTLA 5CFPA 4LDAA 5AJTA 1JA0A 1S01A 5ILQA 4BECA 1NE2A 2IP4A 4V39A 1KQFA 3WL3A 1OIXA 3IP7A 4BCDA 2XYRA 3W06A 4EG7A 5LJLA 3TQFA 3UV6A 1OOEA 1KJZA 4KQ9A 4HLCA 2Z98A 3BMOB 2VDWB 4LW8A 2VHXA 2LKCA 3IBYA 4DNXA 5CK5A 2FNAA 4BZPA 5F23A 3DAYA 5HW0A 2C9YA 5DSXA 3PE6A 2E4UA 2J8ZA 3F8SA 3E84A 1M83A 2O1SA 5AD1A 2XXAA 2JKZA 4FI3C 1XL1A 1EQ2A 1RNLA 3A8TA 4J6FA 3ZKWA 3UVEA 2E5WA 4ZC1A 5MHTA 4FDMA 1TYZA 1M3SA 2JPDA 4DF3A 2AI3A 4CM6A 3G4SB 2Q5LA 5BUZA 5LQJA 4D8WA 3KV3O 3GA5A 5G3ZA 4WY8A 3E1KA 2GCNA 2X6WA 2QMOA 2G9QA 2W83A 1NBAA 3AY3A 2IU0A 5JWRA 1W6UA 3U09A 4MIOA 4YJ2B 2O8EB 1W9MA 3AESB 1GVNB 1ZN2A 2GX6A 3QUSA 3PFCA 3T61A 5C81A 1N05A 2O0JA 1VE9A 3WO0A 3WQSB 1TPZA 4BJ1A 2OWDA 4DQUA 4YBZA 2VWHA 2O54A 1VIVA 1UUFA 1YQXA 4XM3A 1XTKA 1WZIA 2PKRA 3NP7A 1YBMA 2I4TA 4NI5A 4Y2VA 1G8SA 1S3SA 4WNAA 1EFPA 1T25A 3PJGA 5CR9A 4CLEA 2VBGA 3DF7A 5JZ9A 1WSDA 2YOHA 1POXA 2EW2A 4DLTA 1FMTA 1DDGA 3D4NA 1NW5A 4M9RA 4TOIA 4MWBA 6LDHA 4MROA 4DUZB 1FQWA 2ZR7A 4BJ5A 3WAJA 2C7OA 2O06A 2ZUUA 4G85A 3IHTA 4FOTA 3FGOA 1BDJA 3WP0A 1JPNA 3K73O 1GU1A 4DLXA 4KAJA 4M0PA 2X2FA 4GLJA 2ZL5A 1RPNA 5H83A 1ZHFA 1Z2EA 1JEJA 1DXQA 1OD6A 1OA0A 3DVQX 4ER7A 1GPKA 2FWAA 3DNPA 3F6PA 1JSRA 1OXMA 1ZGJA 2IGBA 3VR2A 4DIOA 4JUDX 1JMKC 2QZPA 2AJCA 4ZQGA 1U1GA 1KZ9A 5F5NA 1P0CA 4FW8A 1A9TA 3UAXA 3GNQA 1W44A 5JH7F 3QKSA 4AS3A 5B7NA 1WY5A 1C41A 1AK9A 3DYBA 3AM4A 4U2KA 4V0ME 2VJDA 2PJZA 2SKCA 2PG3A 2EDCA 2GTPA 3AP2A 3CZPA 2Q6LA 1TOAA 3BMNA 1FUYB 2LD4A 3BF8A 1RZRD 4L28A 1AQLA 2CHQA 1WRBA 5TQ0A 1ZISA 1AK1A 4UPVA 3U48A 1OTHA 2XCOA 2OV3A 2OCIA 4RF5A 1QR2A 4WCFA 1VFPA 3C1TA 3UC5A 1GA6A 3QU2A 4F4JA 1B23P 2ILTA 4ZAGA 3KEOA 3UMRA 4JSTA 4XSGA 1ZOSA 4B3FX 2QORA 5ICMA 3IV7A 1QFMA 3G7UA 2GREA 5HX7A 1SXIA 1W88B 2H52A 4IYJA 3ISJA 4MOWA 1VL1A 1T91A 4K6OA 2HXGA 1SVIA 2FR0A 4MKHA 4HNSA 4B40A 2HMSA 4J0EA 4MJLA 3Q6RA 2B34A 3GOQA 4JWKA 5LIRA 2NT4A 1NXVA 4EKEA 4MUHA 3ZTYA 2GJ4A 2W0SA 3TRDA 2GD0A 2CDNA 2ZXHA 1OI2A 2FUKA 2DJIA 1VLQA 4J4TA 4FFOA 4C7BA 3NRJA 3DAPA 3MPUA 4JXJA 1YTUA 2FN7A 1P0FA 2AN4A 4UE2A 5BWMA 3OA0A 4D4JA 1T5LA 2FPGA 1BIFA 2IOFK 4IDCA 3JALB 4M1ZA 4R8VA 2NU8A 1I10A 3JD1A 3O8NA 3T3PB 4EJSB 2FP4B 2DQYA 5AW3A 1D4ZA 3TR5A 1N2SA 2ODQA 5H80A 3GDGA 2QTFA 2NVUB 3ZD7A 3DE7X 2PV0A 2GUGA 2J3QA 4KLNA 3RE1A 1W47A 3JQ9C 3UB4A 5CVJA 3OZVA 2X1MA 1ENOA 2HLHA 1U8ZA 3IIEA 2R48A 5HZBA 3K8QA 3RUCA 1DSSG 1W2GA 4NESA 4R81A 1DRJA 4UAVA 1K98A 2ZEJA 3PXEA 3PPVA 3EFOB 4FGSA 1LBSA 1JZSA 4GECA 4GWGA 2B61A 3W78A 1YC5A 1J24A 3B38A 2BPOA 4B3GA 1E5LA 1FRVA 2PGJA 3Q2OA 4KLZA 4HGRA 1G1AA 3H9GA 4GX1A 1G0NA 4PXSA 5IG2A 1JR2A 1DAMA 2IY8A 1I4EB 1XTQA 2KX7A 3GD7A 2O3RA 3ZZ0A 3HZOA 5E1BA 5ALIA 3ESZA 4OA5A 2FX2A 3K53A 1JR3A 4YPFA 4GGOA 1UMDA 1KI4A 2GDZA 3JQAA 3JCZA 1JAXA 1G8PA 3OEHD 1II8B 5KYWA 3W4IA 2QSUA 3LE8A 2ODWA 5K0GA 1Q7GA 3AF2A 4MX8A 3ZEIA 4K6HA 5C35A 5B1EA 2BEUB 3BE4A 3Q88A 1SXJA 4IOMA 1H1LB 1I80A 3U5ZB 1PR0A 2OGUA 4AMBA 5IDWA 2QYOA 2DULA 3SZ3A 1PO7A 2C3MA 4UNPA 3AERB 3V4RA 3ESXA 3I83A 3LI2A 1NA5A 1YXMA 2DFVA 2WHRA 4IIGA 2CE2X 4L9AA 4CTOA 1IPFA 3GRZA 4H08A 5ALHA 7REQB 2UZ4A 1ZMOA 3QVGA 2OGSA 2IS2A 4MR8A 3VHXB 2BSAA 2E1BA 1TUBB 3LTEA 4H4DA 1HUQA 4K40A 4MKRA 3ZX5A 5IJ0A 4TL8A 1GPJA 5EJ6A 2LE0A 5DM70 2NN3C 4X97A 1DAFA 2VHZA 3GOHA 3QK7A 2JEZA 1NVTA 4GOMD 5IC6A 2GZAA 2IPOA 2B1GA 1SZDA 4I9HA 3TNDA 2YNMD 1DXYA 4G1MB 1KZ4A 5HP4A 1OH5A 4Y18A 1RRGA 1B0PA 5KQMA 4Q1AA 4C7OB 5EJ7A 1UDWA 2JFNA 5LYJF 1J0XO 3B6IA 6NULA 1WCYA 1G6Q1 2Y0CA 1NJ5A 4MUJA 1KMQA 1LA2A 2V4DA 1AB6A 2B6HA 3KK0A 3N8KA 4LUCA 4PG7A 1YGPA 4LXYA 4TKZA 1G7TA 2C9BA 3HN7A 4G1EB 5FFNA 2W5UA 1N6OA 1VIYA 3A0UA 3EEOA 4PBSA 3ZIDA 5ENZA 4A8TA 2EX0A 3QHQA 4MWGA 3VH3A 1HNXB 3HB1A 1DKOA 5FTWA 1QIDA 2I7VA 3A31A 4F5DA 4DM4A 1CC1S 1MEEA 4Y2TA 2ACWA 4QGFA 3VNRA 4QQFA 4BRUA 1NZJA 4QQKA 5A7HA 3VZDA 3DLHA 1KZYC 4KAFA 4X24A 1TKRA 1L4BA 4GOXA 1OU4A 4L5BA 5EVJA 3ZWOA 4QRHA 3TTXA 4HEJA 4AROA 1OIVA 1B93A 4I3GA 1XAIA 4O2AB 4DA0A 3AYZB 3F96A 3ABSB 1XE3A 3Q4GA 3LCUA 2O2GA 4J0DA 2P2CA 3G0IA 2RGAA 4XLHA 1DQNA 5K0JA 4CF5A 2NM0A 1JHRA 2J07A 3Q7QA 4JB8A 4OHXA 5HF6A 5L95A 4YEJA 1SHTX 3HM2A 3RY8A 1T2VA 5BW6B 2ONZA 4RXMA 5D51S 2JN9A 3FGNA 4CM8B 2OGZA 2D0IA 1X7WA 2V6MA 1QO0A 3BD6A 4LOLA 2HHHB 3PFFA 4Q16A 3BH0A 4LRTB 4MK4A 5CFNA 3FKSD 1KPIA 1X77A 5AKEA 1YOBA 4XEHA 3B82A 1DKRA 2PT6A 3EB9A 3RFXA 3SFTA 3BERA 3N53A 4EY7A 3HZHA 3MG9A 2OBXA 4DLUA 4PHTA 3NGXA 1CXZA 2D7JA 1LSJA 2IZ6A 4HJXA 1GGHA 4L22A 1XAHA 3G59A 2YWRA 3MOGA 2JARA 4ND1A 3OG9A 4X05A 4GOKA 4ALIA 4KQ1A 1VZ3A 3HNOA 4J0CA 3JQDA 4JBLA 4QO8A 1Q50A 4EF5A 2VJMA 4UFNA 2WTMA 2Q4BA 4RSMA 3ZQUA 1EUQA 2PUDA 3M5PA 3NHSA 3OIUA 3PGA1 1HBJA 5EIAA 4EPTA 1V8DA 2W8BB 5C1PA 3IMEA 1TZ2A 3UANA 5LD2B 3PRKE 2BMWA 5DN6A 1GPMA 2B98A 3VU0A 3P9QA 3QGMA 3ETCA 3E18A 2J0UA 4P83A 4RSGA 2NUTA 1XD8A 2AX4A 3M3DA 2G83A 2DH5A 4HGPA 3U1BA 3LK7A 2QL9A 1YVPA 1C9NA 4RTJA 3GLRA 1INLA 3HDHA 3LX4A 5FTJA 2Y1OA 4CMEC 2OBRA 1O97D 2MIIA 4EX6A 1OR8A 5FLEX 3LKBA 1WOOA 3HU2A 4CW7A 2BV3A 4LXHA 2R0QC 2WNHA 3QE2A 1G18A 3GEHA 4BO8A 1G6KA 3CTPA 1ATIA 4JI8B 4K1LA 4JJEA 1BQ3A 1X7YB 3KB6A 3ZE7A 1KK1A 3SJZA 3F5MA 1IVSA 4ARIA 2QSZA 1UMBB 5AVJA 2GPNA 4KV9A 3RC7A 4F4DA 1DFIA 2DY0A 4E70A 4IDNA 1CDDA 2I6SA 3N0WA 5CGZA 1RYNA 1WUIS 3H8SA 5AT1A 5JCOA 3UOGA 3P9ZA 2ZREA 5KTRA 3W2HA 2H29A 4H1TA 1YRQA 4LG1A 4N3CA 5CLLA 1N2XA 1F6BA 5DXJA 1B42A 2FTKE 4EGCB 2CXHA 3D7SA 1IQ0A 1G5PA 4INAA 3HVKA 1YIDA 4H35A 3WGQA 1U5CA 4F71A 3D2CA 3WLFA 3HBMA 3ESYA 5IULC 2QB5A 1AQUA 4C0BA 2H2FA 1X86B 3OQBA 1WF3A 2HFJA 3NHPA 4RJIA 5ESRA 5F35A 2R00A 4OXNA 1VXOA 2BUCA 4HRVA 4M8LA 1K63A 2RB4A 3NKVA 1JJ7A 5BSHA 2FUCA 2WWFA 3BHNA 3U80A 4CZ2A 1JQLB 4E51A 4S05A 2WPNA 1B43A 3SNKA 3A6JA 2IH5A 2J08A 1KAGA 1ZW6A 1PFGA 1R66A 4KJXA 4BNNA 4FEGA 1W75A 2BMAA 3CJTA 1YKGA 2CB9A 1T26A 4E2XA 2PDAA 3BPSA 4BGVA 3MCZA 3UK1A 5BN4A 4TMYA 3QWFA 3DTVA 4G5RA 5HF5A 4MKGA 2EHJA 3IT2A 2JD2A 1P4MA 2QTWB 2ZRBA 1QRRA 1RXIA 1N7GA 2IODA 3VX4A 5K0EA 4MDFA 2NO4A 1UAYA 3PFHA 4P7FA 2V7QA 5H81A 3QX9A 3UJHA 3JQRA 2FZEA 2E0IA 1VQ7B 1UPTA 1EUCA 1QG2A 2D1SA 2GEFA 3ENQA 4DL9A 5B5SA 4HY3A 3EN0A 2NIPA 1MZVA 1XZ8A 2FPXA 1AS3A 1NQ5A 2WMYA 5FPTA 2IKSA 3ESAA 3JWHA 4NU5A 1ACMA 2E6UX 4AJ4A 4ND4A 621PA 4U2DA 3C24A 1XZBA 1KD1D 4CN8A 3OQNA 3CCLB 1KE1A 5J3OA 1J06A 2EJTA 4OBXA 1SUCA 3RDPA 2I3BA 1UCFA 3R76A 4RELA 4DY6A 3ZJ5A 4M1MA 3ET5A 3QEOA 1HQDA 1OCEA 2XI4A 5TSDA 4WW0A 3LYLA 1G5FA 4BLWA 2AT1A 4QWWA 4CMIA 3E9CA 3ZS8A 1IFXA 4PNPA 1DFHA 1K28D 1CY2A 3G0CA 3QKRA 2VJNA 5JAQA 3N6VA 2VTBB 4P0QB 4HQOA 3WLEA 3KQMA 2TS1A 3PUZA 1F4LA 3WLNA 4Y1RB 2XWJI 3OZDA 1S5PA 3U4MA 2ALJA 2C04A 2X1HA 3JVEA 3EPPA 5DYIA 2XKAA 3X1KA 4WKGA 3FMOB 3A1FA 3SEAA 5JHGB 1TYCA 4JXXA 2HNAA 1HWYA 3NJ4A 1V5VA 2X8LA 2IUEA 2HK6A 1TJYA 1RWQA 5F52A 5LN1A 4C20A 3EXIB 4Q4HB 1D2AA 3HO8A 3LNTA 1VLVA 4UCQA 1ZINA 1P2BA 2V45A 3BULA 3GEIA 1U9IC 4PCLA 4ZI7F 4DVJA 1NAHA 4QIHA 3AKEA 1YVUA 3FHCB 3RHTA 3DM5A 5FL3A 3ASVA 2W6OA 3EXEA 3H3FA 4RVCA 5F7JA 2UYCA 1VRWA 3S0JA 3I37X 3AQIA 4DLWA 4WZBB 2ZTGA 1VPVA 3Q7PA 4F7DA 1Q0SA 5BW4A 1DJPA 2BSXA 1IOLA 4QOIA 1LFDB 1S2LA 4WSOA 5J59A 5JZBA 1NBIA 5CFQA 2I7CA 1VXRA 3AHHA 4C04A 3N8GA 2QAGC 5FHQA 1RVV1 1BS2A 4MS4A 1TAUA 4JC0A 1QLHA 1P44A 1O89A 2QJFA 4BU0A 1W94A 2CWDA 2C9DA 4Z8XA 3W04A 4RF2A 1JXAA 2IV2X 1V8BA 4BVKA 1ZKDA 4COKA 1VGVA 3GBPA 3QENA 4RF4A 2J6BA 2O1XA 4L2IA 1WZUA 3SKYA 1WW3A 4CG0A 3I5AA 2ZTMA 4RDCA 2BM1A 3T4PA 2PX8A 5GINE 5GOZA 1YJBA 1XQ6A 2I1LA 5JFOA 1ID1A 3BA6A 1TQ4A 3EZFA 1Y42X 4A2WA 5CBKA 1DKMA 2PZ8A 1K3UB 2ZS7A 3NEAA 3U0VA 5CIYA 5FBKA 3LKVA 3UMCA 2PUCA 1YDWA 4QYIA 3OUUA 1VYUA 5AWFC 4TX1A 1SHKA 1CUBA 1DUVG 1ZN7A 3F7NA 4GKBA 3HDTA 4QU9A 4IJKA 3IUYA 2EIXA 1AUPA 5LXTF 2HGSA 2AF3C 1JDTA 1J8MF 1KETA 1O6ZA 4RADA 2LTAA 1Y8ZA 4US2R 2FFAA 3QWHA 2ZKIA 2GAOA 3AB8A 4LYJA 2A4MA 3CUWA 3R74A 1DPGA 1TCBA 4YVFA 3I53A 4I1SA 3L1IA 4JB3A 4K0KB 3EIWA 4H7HA 4XORA 3CPWB 4WBNA 4EW1A 2O2CA 1J9GA 1OYVA 3SHWA 3EA4A 3OT1B 4ZQFA 5JPCA 4KODA 1GG5A 1TB4A 2ZJ1A 2FKNA 4FXPA 4LDZA 4OLJA 3CE9A 4L07A 5A3VA 4YV7A 2AR0A 4X7PA 1LVUA 4FXOA 3B2NA 2D3TA 3LQEA 1NC1A 2N46A 1DBQA 1CR0A 3OT4A 4YMSA 1BWQA 3AV3A 4NARA 2QTGA 4TT3D 2Q45A 3VM6A 1LXCA 3W9YA 1MV5A 3T56B 1LW7A 1P3DA 1DBWA 3D7RA 4WOCA 4RTOA 1M2OA 1GV0A 1QR6A 2B7LA 2G77B 2VAWA 2CJPA 1E9SA 3E2MA 3H0EA 4J1SA 2JCSA 4Q9HA 5T6BA 3TM4A 1JFTA 3H9NA 3GJSA 2Y2VA 4F84A 2PL9A 4CQMB 4Y9TA 3WG9A 2I2WA 1AKEA 3NG1A 2QUIA 4UEJA 5KI6A 2GR9A 1U7OA 4GVPA 3NHZA 4ZEVA 3C7TA 4MS1A 5EJGA 5FAKA 3CVWA 4RJLA 2R7AA 8ATCA 2I4RA 5CB4F 3NIGB 2A9JA 1PJLA 2GJ9A 2HJVA 3HWRA 4P1ZA 1C7EA 4HT3B 4D4HA 3L4JA 2XNKA 4O4LF 2HC9A 3O8QB 4XCXA 4YJ3A 1SPBS 3VO2A 1C2YA 1HT1E 2WB4A 3TL2A 1UOQA 2H4FA 5H70A 1GQSA 2Q27A 3AUJB 2DPXA 1R1DA 5LQRA 1NSTA 3D3WA 4A1OA 3PK0A 3TVDA 3B1JA 3DZBA 2GPAA 3KB1A 1SVMA 1PFUA 3BRSA 3ASUA 4FJ1A 1GGEA 1PLJA 3GLKA 1YJ9B 4NENA 2WNSA 3LDFA 2QUBA 4PGGA 5HHTA 4EK9A 1M6YA 3CZ4A 1TAGA 4IDDA 4IWXA 5C7YA 2DZDA 3KEMA 4HJRA 4IIHA 2IPMA 4F8EA 4OQLA 2Z5GA 5HIIA 4LF4B 4NX2A 2FG6C 5D5PA 1VG1A 5FI3A 1T1RA 1YI1A 4AN0A 4B4KA 1SBTA 2DAPA 3YASA 1LY1A 1YQDA 4EGFA 3U7GA 5FAXA 1N7JA 2BMVA 1E98A 4L0QA 3WK8A 3LWZA 1JQJC 1I6LA 2JIZD 3Q8KA 4QQRA 4KR7A 3OC0A 3PDJA 3J7AC 1OLSB 1U81A 9ATCA 1YE5A 4O1MA 3DBHB 4R2XA 3X1XA 1EZZA 1VJRA 2NSDA 1XOIA 2Y27A 3Q5GA 3IDOA 3IVXA 2XNHA 4O0MA 5JRZA 1N0UA 3IE1A 4KDRA 3TNJA 2GT1A 1EXMA 3MUFA 1NVDA 1Z62A 1ZRHA 2NXNA 2Z2ZA 4D9EA 5DCWA 5JNTA 3PEYA 1TMOA 1G8JA 3N8DA 1T4CB 3EBLA 1Z6XA 4DQXA 3BQJA 3PCTA 3QHAA 1DWOA 1RBZA 3BCHA 1C2TA 3IJRA 4FOOA 4XPZA 2BHRA 4E1AA 4YHHB 2OV2A 4MWZA 1CZKA 5HFJA 2GBLC 2I1QA 3QWBA 1CRWG 4DYHA 3R4CA 5A5GA 1QO7A 1TMYA 2DG2A 1YI2B 4PAOA 3QW4B 5DGTA 1FNCA 3VO1A 4RVUA 4C0KA 5IYZF 3UV3A 3IQHX 1DKQA 3NMUF 4KN5A 4LWQA 2IRWA 2PFSA 4FE4A 4AF6A 1RU3A 5EIBD 1I51A 1FJXA 1KPHA 4I99A 1JSLA 4JC4A 4A5SA 2QUJA 3K6KA 5JAOA 2QR2A 2SNIE 1N2EA 3QLVC 3KQNA 1BX1A 4IIEA 4D6YA 3PNYA 2RI1A 2CNWA 4ACBA 3D54D 2RG7A 1Y7LA 1FQKA 4P58A 4K6MA 1Y1RA 1R10A 2Q49A 3SR0A 1JH9A 4H59A 4XLAA 3VVLA 5B3LA 1JJAA 3O3OB 4IHQA 1FNSA 3HJRA 3VPCA 5FL7A 1CJBA 2DT5A 1DNPA 2K5UA 1R0LA 2ZWVA 4JVNA 5EE5B 1ND5A 1MT3A 3BK7A 3LLVA 4D98A 2PE5A 1RE0A 1R0XA 2UDPA 5FQNA 4A92A 4J0HA 1PFQA 1R4MA 1D2CA 1KVRA 2PZJA 1E6CA 4MRNA 4NRDA 3A3BA 1J8DA 2X53S 1IM8A 1W34A 1NIJA 1OGYA 1K06A 1Q11A 1ZJ6A 2FQWA 3CS3A 5CG2A 4JYMA 4L3WA 1Y9EA 1BFUA 4ZDJA 2ZM6B 3T1YB 2NVWA 3B8EA 3DB1A 2CFCA 3REQA 3A2NA 3LRXA 4PS0A 3MJDA 2C5HA 1YRYE 4OHPA 4JOSA 2ZJFA 3QPUA 4HDMA 5LSAA 2YN0A 4PO3X 1K8YB 4BV2A 3LXUX 2Q8QA 1DV1A 1X9IA 2OB1A 2BZGA 2QD3A 2JB9A 1FFGA 1CZUA 2VPZA 1MC4A 5DCUA 4HNAA 3TXYA 4UBLA 3WIOA 3ZJYA 1ZMBA 1MABB 2WWVD 3LNNA 4MYRA 2RB5A 3MUOA 3T6KA 4BO5A 3WYAA 3TRIA 3QX7A 1DIBA 2OV1A 2G67A 4G3XA 5EVCA 4D3SA 2O0KA 3SBDA 2IXAA 4FYPA 5EFOA 2NO1A 3MK31 2P4EA 4FFNA 2V74B 4BQPA 4LAFA 4LHWA 3SQXA 5AOCA 1YDHA 4KXUA 1HQYE 1Z68A 1SXJE 1HDRA 2WWHA 1E32A 4Q93A 4TXLA 1P5HA 2XXAB 1SUSA 3DA8A 4Q7JB 3E3MA 1EX1A 1G19A 3H2BA 4NMMA 1T29A 3WLSA 3ZKWB 5LNK6 3IUEA 3ZVRA 2CD7A 2Q0SA 3PTAA 3RRZA 4RHFA 3LY7A 3ZQJA 3V48A 5H7XA 1TLTA 3LDGA 4HDCA 3OF3A 1RQ7A 3ZCTA 3L8FA 2VPYA 5LZ4A 4NHOA 3KWMA 4WNIA 2I4NA 1H05A 5DNEA 5E0KB 5ESDA 1QO9A 2J3KA 2W11A 1PZGA 2FZ5A 4FINA 3RK0A 4DQVA 5JJ5A 2X4DA 1RI2A 3DMTA 2VDOB 1SWWA 3GLGA 2R68A 1SKMA 5IS2A 1JIIA 1RLJA 1DTEA 5JS1A 1U2PA 4KPEC 1V41E 4IDOA 3JQ6A 2VDRB 1IB0A 4D57A 1X0XA 4QARA 3G7SA 1T24A 3VC1A 5A4JA 3G68A 3TO5A 4KL8S 2G08A 4LJSA 1Z7WA 2JIMA 1U8XX 4R2LA 2B35A 3TZLA 2B1JA 3BWBA 2CZQA 1EFPB 4WNAB 4EHJA 3OTWA 4AN4A 1K7CA 4FFPA 2GM3A 1FXWF 1G9TA 2XWQA 2QJOA 3NJRA 2LZJA 3R5FA 4HZUA 2HCRA 5EQTA 3SQNA 4QYTA 3NYQA 1FW8A 4HN9A 4KW7A 4GIBA 3Q7TA 4OHOA 4MP8A 4NOMA 3BJZA 4CLHA 4OM7A 4CLRA 3SIRA 1VMEA 1MO6A 1VLHA 2QLLA 3PWZA 1DLJA 1JUDA 2A57A 3NEJA 4QICA 4L1KA 5SY9A 5F7ZA 5TJ9A 4BNUA 1K0FA 4IP0A 5L45A 4HDAA 4PE5B 3RIEA 4KE9A 4BN0A 1QVVA 2G1UA 1GTVA 4YRBA 1B41A 2FSPA 1R0KA 3FRIA 1V4BA 4ZWNA 2VBSA 1J0CA 4IM7A 4WASA 3M9LA 3I5UA 1JIXA 4CIBA 4MEBA 3HQ4O 3E1GA 4R9NA 1J1UA 1KVTA 5LNK1 1H3FA 3HDVA 3FSRA 4RKEA 4EB0A 1C29B 1PZMA 2B8WA 1OFHA 3JWGA 5BVGA 3BIFA 3HNRA 5DYYA 3SMQA 1FDRA 3KKEA 3I6MA 1LK0A 3UW1A 5JLJA 4D96A 3KLNA 2W6QA 2O8DA 4XIIA 5KQLA 4I36A 4NVRA 1IJEA 1I8TA 2MR6A 3BMNB 3B52X 2EW8A 3LQKA 2HB6A 3PC4A 2GKSA 1Y7HA 3C3CA 5TQ0B 4DEYA 1Z39A 5DHPA 3OOYA 5DCLA 1E2QA 3BHIA 4L3OA 5HDBB 4WCFB 5FQOA 2GEVA 4U39A 3GARA 3OQHA 4F6CA 3NUGA 5DWQA 2JJ2D 1YQGA 3HJFA 2PUEA 2IHZA 1TU4A 1H0RA 4IQGA 2GOYA 4QTUB 1U0GA 2A3NA 3IIMA 3OO0A 4KX3A 2P0AA 3TR0A 1HT2E 3MM4A 2NAPA 3AG5A 1EB9A 2DUNA 5H0IA 3D3JA 5DW0A 3GRVA 1TT7A 2HK7A 1C7ZA 2Y67A 1QU2A 1EGAA 4X9XA 1CQXA 1G8FA 3SF0A 4NCJA 3DBOB 3D6MA 2ZSDA 1VHWA 1C0EA 3MPOA 1KQPA 4C3OB 4EW6A 2HUPA 2H3HA 3MQ2A 2PGOA 1O95D 1Q17A 3G9XA 2DEUA 1GITA 3QVLA 4AKHA 1CVIA 1RI3A 4TS4A 2H63A 4I1UA 5A3JA 2G36A 3PXUA 3KJNA 4QNMA 3GLHA 3E05A 1CF9A 3DLPX 5BSYA 2ODAA 3BMXA 3IOMA 2O2EA 2FPGB 1Y0YA 3DOOA 1BHQ1 5E2BA 2NU8B 4F6RA 3QLUC 3B78A 1EHCA 1IY1A 1I30A 3CC8A 3EARA 5BW8A 5LFAA 1OJ7A 4Q3AA 4DJJA 1ORVA 2J6IA 1MEOA 2NNWB 5LVAA 3H4VA 1IK4A 3NHYA 4JLOA 3DDWA 1K5GA 3DTYA 4WBSA 4CRWB 4F4IA 1U9YA 4DOMA 2C98A 2WYHA 3BUSA 2ENUA 1YUMA 2PLRA 3TLZA 1YVRA 3GHYA 1MPXA 5U4XA 1TE2A 3V2UA 2GKGA 3IAUA 3WIEA 1JFRA 2XPCA 4L9RA 1V7ZA 4X7RA 5AKJA 5LQDA 4ZKEA 2X6RA 3U4QA 2RGBA 4L51A 5J3JA 4Q3CA 4X3CA 2AXPA 1G3RA 1QB7A 1QRDA 2JGRA 2PJUA 3A70A 2XMZA 3PX3A 5LBUA 1NBME 1Q7CA 1U5BA 1JTFA 5DT9A 2KYRA 1QFYA 2HJSA 3COSA 1OH8A 4M7WA 1NP7A 2Y1GA 3KQKA 2QIOA 3K35A 3QPCA 2ZSJA 1E99A 1MQSA 3EEFA 3KT6A 2FZ4A 3PB3A 4QELA 4RCVA 3RAEC 1CZLA 1VPDA 3U0BA 1UMDB 3JQAB 4KIGA 2F55A 5LZ5A 4L75A 4C2UA 5KYWB 3R5KA 3HNPA 3RTEA 3W90A 1WTAA 3VNUA 4OAOA 3O2SB 4U1RA 3NHRA 7GPBA 4Q3DA 2QZSA 3HBNA 4G6IA 4US1R 4E2FA 1SXJB 1DXHA 3QEKA 1E79D 2G63A 2N75A 4BVJA 5H3CA 2Q6VA 2Y66A 3ZPXA 4XVUA 5IWCA 3IIKA 2YWJA 2VNSA 2YWDA 2IUYA 4Y67A 2NUBA 3D6UA 2BWJA 5EGNA 2AN1A 4E11A 1MB4A 3QVGB 1I7QB 1UWKA 1G66A 4M53A 1OI7A 4MR8B 4BDTA 1RYYA 3D8HA 4JI1B 3ZE0B 4K5QA 4CQLA 5IJ0B 4NFHA 4XGIA 1SUPA 1W19A 3OTHA 1J0EA 1QFSA 1KWKA 4HQFA 1T9GR 4BB6A 3A6GA 3BMQA 3GJ4A 4G86A 4S2UA 4WZAA 3VH1A 3BXFA 1R74A 2FDRA 3OZEA 3ERCA 1S0UA 4KXWA 2FFRA 1YB6A 2QRVA 3FPHA 2C5GA 2XMBA 2HA7A 5JZSA 3OZFA 5C51B 1A8IA 3SBXA 1HYHA 2GRAA 4JYAB 4R8SA 4S24A 1R50A 3A1EA 3PPXA 5DV9A 3Q39A 1R6UA 4FZJA 4GZ6A 4PNEA 4XFKA 5KWJA 2PWYA 3HBFA 4OEHA 1TC1A 3K0CA 3W3AH 4FFDA 4C5CA 1QVZA 1IM2A 1MKYA 3W9SA 1U2TA 1OZFA 4GICA 3K72B 2OPBA 2WT4A 3L7MA 4GDFA 1DCMA 1P62B 1RM3A 2DTEA 8ADHA 4EELA 1PR5A 3O92A 1GZ3A 1ZWLA 3GXBA 3IUQA 4LI3X 3P2JA 5IUKC 4BNKA 3TZ6A 3HHEA 5IH7A 3ESBA 3FTDA 5J1TB 2UUAB 1WW2A 4MDYA 4HEQA 3BCDA 2P9CA 3M6FA 2BONA 3R3VA 1CERA 1PF7E 1QYXA 1X8LA 2H4XA 2Z9CA 3AOEA 5HQTA 1VMKA 3ILSA 5EE3A 1GSHA 3ZTWA 1SBIA 2AZTA 1ISGA 1TUGA 3A8KA 1NLUA 3KAPA 1A88A 2E9SA 2J9ZB 1J97A 2BP7B 2QE7D 1IBSA 1L7NA 3B6KA 1Q1QA 3HA2A 3SEJA 3QKUA 4NBWA 4CG2A 2F1IA 1YAJA 1A50B 1JX6A 5A06A 2ZK7A 3RD5A 2E4AA 3ND9A 1XA3A 2O2IA 2X9VA 3EQ6A 1IM5A 1K68A 1L7BA 1ZS9A 1LPBB 1UBJS 1X7WB 1YJ5A 2BKEA 4G8JA 4JWTA 4JAVC 1VG0B 3DFMA 3THRA 2QHXA 1QRUA 2ZYWX 5F1YA 1FW6A 4H6PA 4ZIRA 2P8SA 2X8JA 3SI7A 3T4UA 2HIAA 3LGXA 1THZA 1R9GA 2V0NA 5LZ7A 4DYVA 4JY7A 1E3DA 5IYNA 1IN8A 1TEXA 2BKUA 2J48A 3EY4A 2Y2UA 2GZ2A 3O8BA 3Q87B 1KMHA 2Q3JA 4XJVA 4H0NA 1WXXA 5DMHA 3SPXA 3HJUA 1ZL2A 4V0NA 2WPDA 1P2TA 2WYOA 1V3VA 1K8XB 1E1LA 1VDMA 1RYFA 2QS9A 4URVR 3L6OO 3M89A 1IY9A 3WHLA 5BUCA 3OTIA 4K6KA 1F8FA 4EHAA 5TMPA 4OL9A 3PJFA 2QKYA 5AM5A 1NJ6A 2D4AA 2FZKA 4HX9A 1FNMA 2F1OA 4WXEA 4E3WA 4TXHA 1QIHA 2OTLB 2MMCA 4H3SA 1Z5VA 4YRQA 5DGHA 3ROMA 2F1LA 1H4TA 3AIIA 1QHEA 3BL5A 2J59A 2NUTB 2R3SA 3FFBA 3FCAA 4P31A 4BJ3A 2OCPA 4CODB 1UFRA 3P0HA 2YMMA 1F1JA 3S8MA 4B85A 3I9LA 1JEAA 2Q0XA 3JYHA 4NECA 3R3SA 1KAEA 3VTZA 4AYXA 4JX8A 4XX0A 3TB6A 4BMYA 4B2IA 2P27A 5BMOA 1WEKA 2XTMA 5I4IA 3E9DA 2WR8A 1FNBA 1CQPA 2BGGA 3ASTA 1FMJA 1DIAA 2YYAA 1HE2A 4PYMA 3EDYA 2BCEA 5K2MA 4AY5A 4BP9A 4LMBA 1IJBA 3MTJA 5CH5A 1QGYA 1NP3A 3HFGA 1FUKA 1ZSYA 4RZ2A 2DOKA 2ZUVA 4D74A 2AUMA 2ECKA 4EKDA 4OK6A 3GAZA 1Z8FA 3SG0A 1Y9DA 3FFWA 1HNZB 2VQSA 2UUBB 3H1BA 4OX9Y 3B1XA 1CYDA 2DSTA 2RARA 1M10A 1G55A 3QUCA 3T3GA 3DEZA 5JTUA 3ST7A 3NDBB 2XE8A 3FYHA 4I5EA 1I3NA 1M34A 3HJHA 3KOOA 1N5MA 2PUAA 3PCRB 2E21A 4HZGA 2W2LA 4QBKA 2PKQP 3VU9A 2QM3A 2GAAA 1MRNA 2AZDA 4URHA 3STWA 3EBPA 1J42A 2C96A 1ODCA 1DIRA 5J40A 4BZXA 4XE5A 2IYWA 5DTMA 1SUWA 4Y6RA 2VAMA 3AHFA 3ZX4A 5EJ2A 3KHKA 5F2NA 5HK9A 3HCBA 3PF8A 4PBTA 4Z4WA 2ZE5A 1CJUC 1PVDA 1H0SA 1DEKA 4FSXA 1ETHA 5AVQA 1R16A 1NYQA 3C48A 5EHQA 5ICEA 3SVTA 4KVAA 3JD3A 1ECBA 3DBRA 1AX9A 1FLVA 2R7KA 2ZI5A 2Q99A 4KIFA 5G40A 4Z0NA 1K5HA 5I3ZA 5K05A 2HA4A 3TTYA 3VHRA 2HHLA 4IZ6A 4ND3A 4OI1A 2AR7A 4XJTA 5BN4B 1S4QA 2Y1LA 1CY1A 2GHIA 3DTVB 3OCWA 1TVMA 4GPTA 3TUZC 1XEWX 3OJEA 4RACA 2PUTA 4QVGA 2GNPA 3M1AA 5HNKA 2NU9A 4CG1A 5JSUA 2E37A 4D2IA 1WF6A 4PIMA 4PAWA 4HNVA 1K9VF 4FMCB 5AM3A 4LF7B 3A36A 3VGPA 4C5AA 3E5NA 2I03A 4GS5A 2AD1A 1MO3A 5J43A 1TA0A 5C4MA 1G5TA 1EUCB 4K9RA 2D3NA 2ATVA 4ZMBA 4ARUA 2G40A 4OGWA 4XDGA 2I7DA 4IFTA 4EMTA 3ZDQA 1TTQB 1NUUA 3PF9A 3TD6A 4MVJH 5EIWA 2WILA 2RBKA 3HSSA 3UH0A 1PQUA 2I9KA 3DHYA 2V7XA 1JKJA 3OFVA 3QE9Y 4S04A 2HQ1A 5DNVA 5DTRA 5AVKA 4EI2A 1Z5PA 3VU3A 4G0PA 1Q2XA 1LDNA 4IEIA 1RZRA 3ONEA 3GP5A 2G4VA 2WINI 1PJZA 2VXBA 4CMIB 2QRPA 1RTKA 1K2VN 2I3ZA 4OUKX 2OBBA 1TU3A 5DNCA 1P73A 2EC5A 1QK3A 1S2OA 3QKRB 2GBFA 4MI3A 3TRKA 4B7CA 4CM5A 2E89A 4Q0MA 4P3IA 4YCNA 1R9MA 3DEHA 5DTEA 4QUEA 1MLDA 3FOCA 3GRKA 3JQBC 5IBQA 4KSYA 5TEVA 4V0KA 3VKGA 2A9QA 4ZQCB 2DFKB 2P5YA 3KR9A 4CIWA 4GP7A 1JU3A 4KFUA 3UH1A 2IZ7A 4TV9A 3I2YX 3IXQA 4Y1FA 1V26A 2G8NA 3ESDA 1REQA 4KLRA 4AD8A 2JCVA 3U6KA 2G0AA 3QPBA 3IQFA 1N5OX 5AM4A 2EQ5A 4IMJB 1BGWA 2GCOA 3CVOA 1KJ9A 4DBLE 2DUMA 1EG2A 4D9FA 1ILWA 3MMPA 3TGPA 1SG0A 2C2OA 3HB9A 3RWOA 1ABFA 1MF7A 3GFRA 3MGCA 3QOYA 2A1TR 2W2TA 3QSGA 4HB0A 3GUHA 3B2EA 3TW8A 4PRLA 2EJWA 3CSUA 3EXEB 5IDYA 1JQAA 2PEYA 3A3NA 4C89A 3KCNA 3NHAA 1FFBA 1GFIA 1UZAA 4BQEA 1Y80A 2ERXA 1XKTA 1U0OC 3PL1A 5DMXA 2X85A 1EB8A 4Q7KA 3FJOA 5IKXA 3IAHA 4RHXA 2HN9A 3DEAA 1JHPA 4X3PA 3BB3A 4EKNB 3OD5A 4EKIA 1F8YA 3N8IA 4C3UA 1Q77A 3LW8A 4MS4B 1ZGCA 3UK7A 2WP8J 3UBTA 2I8CA 1GTL1 4OAQA 1K7SN 2ZB4A 2C54A 1KP2A 3KB2A 4RFSA 2P79A 3V8MA 5IASA 2AOWA 3D7KA 1E96A 1VKHA 1M2NA 4NOLA 1H0KA 1D2GA 1Y4AE 2JLYA 1VCIA 4JOQA 1JBQA 1NV8A 5FWAA 1SU4A 3ZV4A 3KQQA 2WAYA 4L2IB 1VPWA 1ZMXA 2NZYA 5ALDA 2H2WA 2R7NA 5DYNA 1VJDA 2FWMX 5BT8A 3MWGA 3C6XA 4XYLA 1R8XA 5FUVA 2C4KA 1Z28A 4KWHA 1FDSA 3SXJA 1ZAKA 3LP8A 4XIJA 4UULA 4P82A 3WFZA 4QYIB 2QUZA 1L9XA 4B3BA 3U3JA 4FGUA 1BQ4A 2UZIR 4HFJA 1ZJ5A 4I5FA 5K01A 4PPYA 4FX5A 1MRZA 1PR3A 2X7XA 2EFCB 3K70C 3PXCX 3MHTA 1KAMA 4HEA6 2AEFA 3WWEA 2ID7A 1ZJWA 4ITRC 4JMLA 5FO0A 1YTLA 2C5AA 4QQNA 2H00A 2OAEA 3KSDO 1H93A 3UUFA 1LX6A 3MS4A 5J4LA 3F9RA 3IQEA 3L8MA 1J8VA 2FRXA 4EATA 1GCGA 1Z17A 4FHGA 4K46A 3G6WA 3FDXA 1ND6A 4K1XA 2PX0A 1FYXA 3UAYA 1FFWA 1KDTA 3R44A 1KQNA 3VZPA 3FOWA 5CH8A 2HPAA 3TQIA 3ISVA 4GPD1 3L4BA 4WBNB 6ABPA 4TXJA 1KNXA 4XW2A 4GOJA 3RASA 3QVMA 3OH8A 3ZHTA 4U3JB 2Z83A 1UAAA 1MFZA 1Y4SA 1UKAA 3RRNA 3ANYB 1QQBA 3HGTA 3BL6A 3O2QB 2BI8A 2J9XB 3ZBTA 2P77A 2QJTA 3IC5A 1N0WA 1LNSA 2CNLA 3T1HB 3BD7A 2HHAA 4RMGA 2X3FA 4UDNA 2ZKLA 2C95A 5E8RA 1SCKA 1M2OB 1R5NA 1H8ED 3ICOA 4FD2A 1U9CA 5AKIA 5CAEB 2WZCA 3QBVA 1O77A 3G0OA 1A9SA 3PNPA 4G5FA 4I6EA 3UCXA 4EY3A 1ICIA 2GCGA 3BSSA 4RIIA 4G5OA 4EFLA 1S2NA 3A26A 5EE0A 2CSXA 2PA3A 4LGYA 1QPBA 2ONKA 4AQ7A 1NRXA 4DJAA 2PS0A 4RK5A 1T9CA 5F98A 4MS1B 3EF0A 3FBGA 5JNRA 2X2OA 4X44A 1VLOA 5JBNA 2ET6A 3Q40A 3PZBA 5KB3A 3QEMA 2R6FA 3HRHA 3GRPA 3GA7A 4PAQA 1M5TA 1YHNA 4N47A 3OO1A 2LNDA 5LWQA 5GADl 3HXQA 4HEA1 4YJ3B 2O2XA 2XSZD 3NW9A 4JJ6A 5CJJA 4EEKA 3T7CA 1L8QA 1YB4A 3QRWA 1SMKA 4IQ0A 1RXVA 1AF4A 3U62A 1XMOB 5AK4A 1R5BA 1LUAA 3T7TA 2XZTA 3D3WB 3M6VA 3C3KA 2W2MA 4Y2GA 4LEIA 1FIUA 1XYYA 2ZZQA 1LV8A 2RDMA 3OE5A 5E2AA 3Q3AA 4H1HA 3UJPA 5KTTA 4U6NA 4NAHA 2FZCA 3NHJA 2G1AA 4NENB 2CXSA 4EAQA 5J23A 3FKSA 2OXIA 3WB1A 1NW7A 3EZ7A 3TG2A 2Q2QA 3IAFA 1G0OA 1JNYA 2C8LA 2UZ1A 2Y9PB 4MQMA 1PGOA 4EJMA 3PDCA 4QAQA 1KKUA 1RHRA 3CUKA 3KO8A 4OBWA 5IT5A 4UBMA 2B4AA 3OX2A 3MF4A 4OVKA 1GTJ1 1FYVA 3NWBA 4S12A 1I3CA 1YS1X 5EP2A 3PI7A 4AP6A 1R8SA 1PGQA 3RYIB 3LT1A 1G38A 4J43A 4H1WA 2AXEA 4J07A 3SC2A 5JYBA 1YS7A 2C2ZA 2HCBA 2HXSA 5AK5A 3OQPA 1CQZA 1X70A 4RD3A 2CC2A 1OZGA 3UAZA 4W9NA 1RC0A 2C5LA 3SF8B 4B4WA 3TSCA 1GAEO 3C3XA 5AVUA 1V8FA 1TJNA 4JLAA 3K09A 4CTJA 1R7RA 3GLSA 2P9QA 1W581 4QKQA 3B5JA 5C37A 2ABWA 3WADA 1O4VA 5GIOE 4MVJG 1U1CA 3GIDA 2C1ZA 2HT1A 3PCXA 2XKBA 3B36A 1N7HA 4PYOA 1XFOA 4BCBA 2HY7A 4E03A 3L05A 4EGQA 3IDSA 4R9RA 1L4HA 1ZK3A 5ARBA 3DMDA 4KPYA 7AT1A 4YR9A 4IFIA 2B4TO 4PTZA 1NB0A 3HY4A 4I50A 4XOTA 3DKKA 1GG9A 2J9FA 4O5OA 4BQOA 2C2WA 4EA6A 3EIFA 3HEAA 3RK4A 1VQ1A 3C5EA 4OOSA 2WU3A 3ET4A 4BLQA 2CYCA 3OQ1A 4MINA 3ONWA 2OQVA 4OP2A 1XVAA 4P4SA 1SQSA 1FTSA 1SKYE 4EQZA 4MAMA 4AZWA 3ETEA 2DKFA 1WAMA 1MA0A 4RY0A 1USIA 2QJRA 2RK6A 1CY8A 1D2NA 1OAOA 2JLVA 2DBQA 4C0HA 2R85A 1T8WA 2PUJA 3UUGA 5EXDA 2AMLA 4RVGA 5D1HA 4BNXA 3PQ7A 3PQCA 4GM0A 3V33A 4GHWA 4HH0A 3AIMA 4NBNA 3BCSA 2GCIA 3CF4A 3LGSA 1ZONA 2A7XA 2A94A 2B6NA 1PBNA 2P2YA 2VJPA 3CCJB 1P5FA 3CG0A 2IBTA 1R4MB 2I2BA 2XTJA 1HXHA 1QP7A 3FZEA 2NTVA 3NHMA 4HV4A 1KFCB 3K8YA 1YQ9A 1XVLA 4PPNA 3VJMA 4G1BA 4Y2JA 2I3AA 2DSNA 4HS9A 2Z43A 3HP4A 3V7WA 2VWQA</