3MHPA

Fnr-recruitment to the thylakoid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
b'SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase, leaf isozyme, chloroplastic
publication title Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 96
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mhpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3mhpA02
1W87A 4G5GA 4LC0A 4RD1A 2PLFA 3P27A 3CC7B 5DSZA 1UMKA 1VQNB 3OZUA 1BX1A 1QGYA 4RD4A 1S72B 1ZM3A 4G1VA 5TR9A 2C78A 1VQ9B 4RJLA 3OJWA 4MYUA 1QUEA 3AGPA 5H5JA 4ZV4A 4WQMA 3AVXA 4HE6A 1GAQA 1N8RD 4RD3A 4B4DA 1K9MD 2BN4A 1QUFA 3W2GA 4UAJA 3MCAA 4PC3A 4HE5A 3B78A 3OZWA 4C0SA 1JA1A 3WNBA 5KSWB 3QFCA 2BM0A 4PC7A 3LRXA 1FNMA 3CMEB 2YWGA 1AIPA 1FNCA 4R71A 1VQ5B 4M2LA 4J0QA 4K1XA 2C77A 5THXA 1D2EA 5TY0A 1R5OA 4LBWA 1GJRA 1A8PA 2VZLA 1KK2A 4RD2A 1XB2A 2AHOA 4RD0A 2QA4B 1VQPB 3AVWA 4LBZA 4YAFA 3QFRA 3FJOA 1BX0A 4P6VF 4TMXA 2XEXA 2ZITA 2CNDA 4BPRA 1QG0A 1YIJB 2RC6A 2BF4A 1EXMA 1FNBA 1YJNB 3AVUA 4QFMA 4M1KA 3CRZA 3WY9A 3A1FA 2BV3A 1GVHA 3LO8A 5FA6A 3W5VA 1KK3A 2BGIA 1VQ6B 1QFYA 1VQ8B 4F7DA 1M90D 2EIXA 2XNJA 1KRHA 1F60A 1Q86D 2X3UA 5TV2A 3CB4A 1YJWB 2YWEA 2XNCA 3CMAB 1QVFB 2B7BA 3QFSA 1G7TA 1YITB 1W35A 1Q82D 3ZZUA 3G71B 1QH0A 3B8HA 4ACBA 1CNEA 1OB2A 2J7KA 3E20A 3CCMB 1I7PA 1E62A 1EFCA 1EP1B 5GV7A 3AVTA 1Q81D 3W5UA 4IW3B 3ZBTA 1FNDA 2YWHA 3LVBA 4M0LA 2OTJB 4PC6A 3WXMA 1CNFA 1KK0A 3SJZA 3CD6B 4P3YA 1ELOA 1OGJA 3ZBUA 4N3NA 2E1RA 1OGIA 4ZGNB 1KJZA 4TMVA 1YI2B 2FX3A 1IJEA 1J9ZA 3CCQB 1IJFA 2QTZA 4N3GA 3JQRA 2OTLB 1FDRA 1TTTA 3U6BA 1JB9A 3WNDA 1JJ2B 4AC9A 3VO2A 5HXBA 2OK7A 4NBSA 3CCVB 3CW2A 1N0VC 4DQKA 1KC8D 1R5BA 1KQSB 1EP3B 1VQMB 1WDTA 1E64A 4TN1A 4FK8A 1EWYA 5JBQA 3WNCA 4ZCMA 1VQOB 4YAUA 4Y9RA 1FRQA 4TMWA 4Y9UA 1G7SA 1EFUA 1EP2B 4B43A 2QDXA 2BSAA 2DERA 1CQXA 2VNHA 2BMWA 1NJID 2GQFA 3CCSB 3QSYA 2VNIA 2VNJA 4Q7JB 3W5HA 3VNVA 5H59A 2NPFA 1Q7YD 1D1NA 1G7CA 3B82A 2EFGA 4PC1A 2BPOA 1GR1A 2YWFA 2QEXB 3J81k 1ZM4A 1TLLA 1VQLB 3AVYA 3CXCB 4B44A 2DEUA 3OJXA 4G1BA 1SM4A 4U9UA 5GV8A 1FRNA 4B48A 3CCJB 1DARA 1N0UA 1D8TA 1E63A 4LBYA 4PC2A 4TMZA 2PMDA 4Y7CA 2QN6A 2R6HA 3W2FA 4YHBA 4H9GA 2B5OA 1ZM9A 4RD6A 3AVVA 1TVCA 1H42A 4YAWA 2QMUA 2HDNB 1G7RA 2OK8A 1KTVA 3CCEB 3OZVA 2DCUA 2GPJA 3AGQA 4FWTA 4YALA 1NDHA 1B23P 1S0UA 3V76A 3FPKA 2HMAA 4C43A 4ZCIA 2BVNA 1VQ7B 2CRVA 3VNUA 1GAWA 1B2RA 1K73D 1DG1G 2QTLA 1BJKA 4RCZA 4ZGQB 3CC2B 2RC5A 4PGOA 2BM1A 3E1YE 2PIAA 4RCYA 2B7CA 4B47A 3CCLB 1OB5A 3JQQA 4DQLA 4M53A 2DY1A 1IB0A 1TUIA 3CPWB 3U6KA 3CCRB 3WBKA 4ACAA 1R5NA 3WBJA 3MMPA 4M4SA 1EFTA 3ZZTA 1ZUNB 1VQ4B 1F20A 3I56B 1DDIA 3WYAA 4AF6A 2DETA 3LYUA 3W2IA 1H85A 1K8AD 4TMTA 4YAOA 4FN5A 1QVGB 4LBVA 3P26A 3W2EA 1BQEA 1QX4A 3MHPA 1DDGA 4MYTA 1HA3A 3QE2A 4ZCLA 1JA0A 4AF7A 1GO2A 3VMFA 3U2QA 2VYQA 1JNYA 3ES9A 1YHQB 1VQKB 3QFTA 3G6EB 1QFJA 1QFZA 1QGZA 1W2BB 3I55B 1KK1A 3JQPA 3ZC3A 1W34A 4EH1A 1QGAA 2D74A 4B3XA 3VO1A 1YJ9B 5AN9A 1KD1D 1SKQA 2VNKA 1AMOA 3ZZ0A 3CC4B 3G4SB 1U2RA 3CCUB 4NCNA 3W2HA 2HCJB 3I1FA 4QHYA 5EMNA 3OW2B 1XE1A 1ZM2A 2BGJA 3PENA 1M1KD
chains in the Genus database with same CATH superfamily
3I1YA 2Y1KA 4QJ3A 4GMKA 4M6WA 2VP6A 1XZHA 2JK0A 3UA4A 1K89A 2ZT6A 4QWMA 3WIVA 5ABPA 2GJ8A 1C4WA 1T6XA 4Y2RA 3AR6A 3NBXX 5CW1A 5HQJA 5E7QA 1XVUA 5J23A 4GOJA 4B3RB 2C2ZA 1UPCA 2XCUA 4R1QA 1ZUNA 3NFRA 5EVCA 1YF3A 3P5SA 2PAAA 2X1LA 2IP1A 3PQ4A 2J3LA 2A0KA 3C4QA 4AVZA 2P3OA 3M6AA 2YRXA 1C0IA 5EE0A 4F8YA 2ZUFA 2NNLD 2ZVJA 4L78A 2A8YA 3L7IA 3HXLA 3K05A 4LX0A 4LJ7A 1XZLA 3L6DA 1W36B 1TIPA 3IT3A 3OX3A 3V32A 1IUKA 1P4RA 3AWDA 4FMBB 1TECE 3ANXA 1O94D 3RAFC 2C58A 3T7JA 4M0MA 4QDXA 1L8QA 5AJWA 4MR9B 5GGYA 1U9ZA 3VH3A 1KDRA 4S1WA 5JJBA 4QASA 2EV9A 4UOZA 1ULHA 1DBQA 3OPYB 4XWTA 5FHRA 3Q39A 5TXGA 5IHPA 2ZBPA 4GVLA 4DR2B 5D00A 2JI7A 3EWAA 4WJLA 3QBVA 3NJRA 1B0UA 1QOQB 3BE8A 1IMJA 1Y4ZA 4KIFA 5H7XA 3N05A 4NULA 3EPJA 2NP7A 3I4CA 2WMDA 4CUZA 3CMEB 3IP6A 1MPXA 4GAEA 4D9HA 1GGNA 3FFXA 3JQAA 4FM9A 1FP4A 2ZTVA 5EKXA 1JLLA 2HC9A 2KI5A 1G4HA 1GZDA 4GBMA 3UAWA 5LP6B 3HBNA 3OAAA 5CEJA 2BEKA 4RZXA 3SYKA 4LN1A 4BP8A 1K4YA 5THXA 5CLFA 2C8VA 4G36A 4E21A 1TCBA 2P6PA 1FX0A 3N2ZB 4ZRDA 3HB4X 1DRJA 3F6CA 5G2OA 4P2BA 3S28A 4A8JC 5DF1A 4AY4A 4KFCA 3AJ8A 3MIZA 5A4IS 5CBKA 4S12A 5EQJB 2YN2A 5BQ5A 3INGA 4E33A 4C22A 5FLXA 1ADGA 5K01A 3AM1A 1GQSA 4JJ6A 5B57C 1F2UA 1JHYA 1B6GA 3PGKA 4FSHA 3WLRA 4EG5A 5J4HA 5ILOA 2GKGA 3ICVA 4UVGA 4YWHA 2RBGA 2PMCA 1I1QB 3KALA 1GJRA 2DFTA 2WWRA 2WSMA 2WA1A 3LPDA 4AWXA 1OZGA 2VF5X 2HAEA 4N3CA 1ISRA 1GQ2A 3DXZA 4BQFA 2NSJA 1CUIA 1EI9A 5FAKA 4MICA 1MGPA 3IQXA 2Z8ZA 4HZIA 4TWBA 1LEHA 8ABPA 4RD0A 5EP4A 3C3BA 1JEYA 5KOHA 2CJPA 1GLNA 2Y0BA 5DO9A 3FBTA 5AM4A 3DOEA 5IWCA 3KK0A 4YASA 3E8MA 3QPWA 4HAXA 3TLGA 3WYFA 2C2YA 3I8XA 3H9JA 1J21A 4KP7A 1A9RA 3B5EA 4JU8A 1T5TA 3HWWA 3AYZB 4YAFA 4DDUA 1JIUA 3SLNA 3G9TA 2JFPA 3L82B 9ATCA 3FNBA 3ND5A 4XWWA 1WCYA 3HFSA 1U9IA 3UV7A 2ZITA 2WPDD 1J8QA 4IDBA 1BRMA 1AY0A 2QENA 1U9JA 5IZCC 4BB6A 4JLUA 1F8FA 1W30A 5K0SA 1ZJ5A 3CH6A 3IQEA 1D9ZA 1NN1A 3DOIA 1ZD4A 2B20A 1K63A 1N1MA 3REGA 1E3MA 1CQJA 3SQNA 1O57A 3WV4A 1PHRA 1VBFA 3ED5A 2J7PA 5BV7A 3RSGA 3RU3A 1XZJA 3H5RA 2HDOA 3LC1O 5HJ5A 4NBKA 4OGFA 3BHJA 4WBNF 1PTKA 2VHUA 1SELA 2XUPA 1XDZA 4KIJA 1Z2OX 5FPYA 3PGXA 4O4IB 3RT1A 5FB3A 3TKLA 4JMLA 5C18A 4AULA 1WHTA 5D2CA 2F55A 4AJ9A 4CM4B 4RC9A 2JDID 3KZXA 3JXEA 6ABPA 4JFRA 1M34B 3ESZA 3OIYA 4HYTA 2XNJA 1W19A 2HFJA 3OZEA 1ND6A 1SVSA 3L43A 3P9ZA 1NMSA 1FDIA 5KYKA 2Z2KA 4YCDA 5JSUA 2HZ7A 5AVXA 1GQOA 3I73A 2M1XA 3DA8A 1G5QA 1U7TA 4JFAA 3VX4A 4E0BA 3PFHA 3CLSD 4OHPA 4PAGA 3ZW7A 3M6MD 4BIIA 5L95A 2VT6A 2HYIC 1QO9A 3LBIA 3OQNA 3ZJUA 1GYPA 1Z33A 3HDJA 3ND9A 1W76A 4R51A 1SWVA 3SZOA 1JBEA 2NO1A 1W35A 1N0HA 3OJCA 1X8KA 2WILA 3BH7A 4O2LA 5BN3A 1AKQA 1ZK2A 2PWZA 4MI6A 4RELA 5CUQA 3VC3A 1QXSA 3NPAA 1NY5A 1ST3A 3KE9A 1KYIA 2WJVA 2GCIA 5H9VA 2XVZA 5ICFA 3V8RA 4WUVA 1TADA 3OCVA 3KQOA 5DNCA 2AEJA 2C0PA 3HY6A 4H2DA 4MCHA 3DAPA 1MR3F 4NPHA 1VG1A 3CUKA 3LDUA 3K1ZA 1JQAA 4RESA 1WPGA 1EFCA 2QZ4A 4UOEA 3V55A 1GAXA 3AVTA 4CM9A 1JFVA 3MSCA 4WD3A 4CTKA 3KO8A 3TUJC 1G1MA 1W29A 1CC1S 3WQHA 2ZULA 1T3ZA 4LJ4A 3C15C 3HJCA 4DE5A 3QKTA 1XRLA 2QAGA 5HR5A 2NT4A 2ODQA 4OI0A 2ID8A 4C6TB 1SCDA 2D0OB 2R8ZA 3K5HA 4X0EA 1A7UA 4RM0A 1VPLA 4IIBA 4YT8A 4KSCA 1FS4A 3LVBA 3DUFB 4C78A 2E82A 1QB7A 1RYBA 4L0MA 4F6RA 2ODNA 2K5UA 4I55B 2PZLA 3MJ4A 4YJ2A 1CZUA 2ZUVA 1KK0A 1NVXQ 5KU1A 5CNIA 2X0JA 1JQ5A 2P9TA 2RGNC 4K6GA 1LDBA 1P39A 1A77A 1K2WA 3CURA 4KUHA 5B1SA 2UZ1B 3TR5A 3C85A 1FYXA 3H9BA 3Q2OA 1L5NA 3ROGA 3KQUA 3ZBUA 3B1XA 1O0CA 1UXHA 2I7VA 1L7PA 3P20A 5IN5A 3ZWYA 4AN0A 5B4TA 4KSYA 3LUJA 2PQ0A 2AEEA 1SG6A 1JA9A 3O2NA 3A04A 3VZPA 4GMHA 4N01A 1K6EA 1Z56C 4FDLA 2XB6A 3CCQB 4V0KA 1UM8A 2CXTA 1R64A 3IKJA 1V9LA 1IZZA 4EF4A 3HJAA 3H8SA 1V4VA 3N2NA 3MGBA 3NHJA 4L4RA 5BN4B 1YS6A 2WAMA 1DQZA 2IIBA 3ICCA 4V0NA 4JHLA 1U5BA 2C03A 2C83A 3MMXA 4YUXA 5C31A 2VJKA 3A06A 1JTVA 3D64A 2RKWA 3SYLA 4ATNA 2WZDA 2OLKA 2PH5A 4I4TF 4FEEA 1LNQA 1YMQA 3PNVA 5FL3A 4B7XA 3AKDA 4YRTA 4W5OA 3TRKA 3JS5A 1NHWA 1G2OA 1AN0A 3AILA 1NVKA 1MTZA 1SXJD 4FR2A 1TCCA 4L3OA 4PHTA 1UANA 5I9LA 1GPAA 1PEKE 2NV6A 2Z0MA 4A1OA 4UTVA 1FQKA 4FYHA 5EJMA 1EFAA 3UWSA 3NWOA 3BTUA 2C4UA 2Q49A 1U1DA 2YW2A 1ZRHA 3PQFA 3ULKA 3BRWA 3JWGA 2J3KA 4OB7A 1F6DA 1ORTA 4B3BA 1LBTA 5CDYA 5LM3A 5B1DA 3UHAA 1EP9A 2HM7A 3I9NA 2R65A 4FMCB 1H2FA 1Q7RA 4BWVA 2EKDA 3BGIA 4KAXA 1J1ZA 1NZJA 1UC9A 1P5FA 1WXEA 3MS2A 3R5FA 3KSMA 4TMFA 4DUZB 2BMJA 3PEYA 2R7LA 2C5FA 4F71A 3HRIA 1XD9A 4NP6A 3ZEIA 2QVZX 4MQFB 5E1DA 4S1NA 1LSOA 5IAEA 4CTMA 1YDHA 5B7GA 3G49A 6ADHA 2UYGA 1PFGA 1E92A 3SS7X 1YL7A 3GNSA 3W05A 4MUAA 4PHGA 3GDWA 3VNVA 4N76A 1QH9A 5DTQA 4NXNB 2FWMX 4Y1RA 1M6NA 2FZ4A 1BGWA 2YUTA 4MS1B 2E3JA 4R98A 4ZA2A 2P7HA 4NNOA 1O8CA 3SZ3A 1BPLA 2AD1A 3FKSA 2OVBA 3MTQA 5GM2A 3K0SA 3WP0A 1WOSA 1R4NA 3M3PA 2UZAA 3W9YA 4MB6A 2QQGA 1CLUA 3CY6A 5TDHA 3O5AA 3WB2A 4DJ5X 4RMIA 4D44A 2GDJA 1KBQA 1QYDA 5DM2A 3O91A 2ABWA 4V3BA 1EFPB 3EXHC 3FPSA 1L7XA 3KQVA 4HPJB 2EZ4A 4YJ3B 2FX5A 1BE1A 5LD2B 4DPLA 2Y68A 1B43A 1SUDA 2B98A 4ENUA 5AVSA 3U7JA 4F9EA 1MC1A 2DQZA 3LDGA 4UTXA 1R6BX 3QWHA 4TMZA 4X20B 2OC4A 3U19A 4FP9A 3DAOA 2R6HA 5THKA 3H2IA 2IS4A 3WYEA 3FZNA 3H9EO 4XQCA 1GSHA 1A4UA 1NN3A 3OVMA 4YROA 4V03A 5GJWC 2QM3A 1MABA 2IYRA 4CMEA 4TZ6A 1ETHA 1XDDA 2IKSA 1GA4A 1XF1A 1GFIA 2HRCA 5DP1A 1EB9A 4L5JA 1HEIA 1PQUA 1S2OA 4D8YA 2IBTA 1JWAB 3FMGA 4UBMA 3HGQA 2RJOA 2HLPA 3QV1A 1MDBA 2V97A 3OCJA 2JFWA 3K1YA 1JVSA 1JJAA 3AGQA 5FL7A 2HY7A 3HMQA 3NNDA 2V98A 3H3JA 4LOJA 5AVTA 1W48A 4AK9A 1FL9A 4UJ3A 2E5WA 3T3OA 1LD3A 1I8DA 3JQFA 5J9FA 3OCYA 3WL5A 2AZXA 4P2GA 3SLDA 2QD3A 3C97A 4G0XA 5DI9A 1HDIA 2FPOA 5C4IA 3TQIA 3Q11A 3QU5A 1RAIA 2OD2A 5BYBA 2P75A 5H82A 1MHTA 4BO3A 4FXUA 4UZUA 1Q0SA 1HTWA 5IWAB 3T0GA 3BA6A 1YS4A 4DCOA 3DF7A 3KXLA 4NYIR 4B80A 4H17A 2AVDA 2NM0A 3GFQA 3GG2A 4ND2A 3G82C 2IV2X 2OCDA 2ON6A 3A9RA 3EVBA 3VOBA 1Y1LA 2QYTA 2QNIA 4R01A 2PSHA 9LDBA 3UGKA 1IJBA 3FTDA 3NIGB 1MPTA 4P08A 2X76A 3D3WB 1UJ5A 2AMJA 2VXYA 3TZKA 4UMEA 3EQ8A 2BKAA 2FEOA 2GILA 2XVYA 4JROA 4L8VA 5KQPA 5JTUA 3RBAA 1M1NA 3A4NA 4ISCA 4MVYA 5KC9A 4IZ6A 3DXYA 2QHXA 3ASRA 3ZJVA 4XARA 4B34A 1JQ3A 3CCRB 1MIOA 1W8IA 4GICA 2ONCA 1HYGA 2HXSA 1BXRB 5BR7A 4B3IA 4YV7A 1R8QA 1D5WA 4HDCA 2YWBA 5JEDA 3WMFA 3MMPA 3NU1A 4LDZA 4JEMA 2GBLC 1E9CA 2WVJA 1NIPA 1VHLA 1VLVA 3UNXA 4UMDA 1V6SA 4Z9FA 2ZDGA 2RHTA 3OCCA 2FE4A 2J0EA 5DRTA 5EXDA 2IW1A 2XQIA 1I30A 2REXB 3GAMA 3D31A 5JS7A 3NIFB 3PZRA 4LKOA 1O0SA 2NU9B 4CEJA 3HMKA 3SKXA 2H31A 4JUIA 2QRMA 4PU0A 2DYIA 2BELA 4LSWA 3EODA 1K2VN 3H0KA 3AIKA 4IWYA 2C9MA 3HYSA 4KWCA 4WEQA 5E6UB 4KE7A 5DLYA 5EUBA 1A4RA 3PI6A 2VI5A 3COYA 4IS3A 4WSOA 1PX2A 2RB5A 5TPWB 4EEZA 4PG8A 3GLFA 3HADA 3MD9A 1PT8A 3A3YA 1E5LA 3LY5A 2JBAA 4MLZA 4QBKA 4UAGA 4CKCB 1Z4IA 3IO3A 1MTOA 4F85A 3MQ4A 3HB1A 4Q4JA 4LY3A 1PSWA 4RAQA 1JAIA 3KJFA 4GRIA 3L6EA 5BT9A 2Q5IA 4W9NA 4HADA 4QU9A 1V4BA 1XZBA 5EXPA 4TTAA 1UKCA 1W94A 5TGDA 3K5PA 1L7DA 1R6XA 4PFKA 3OTHA 4RAOA 4ZREA 1XNRB 5FR1A 3OTIA 2FPKA 5COQA 3VJRA 3ZY2A 3WQRA 2O9JA 2ZJ1A 4G0VA 2RGRA 1SC6A 1SIUA 3LX4A 4BQEA 1YV9A 1SD1A 3EQ7A 3F5SA 3TF5A 2W22A 5DK6A 4QM7A 5AOCA 4UFPA 1KSGA 3R9KA 1RYZA 4BZXA 4R2LA 3RI3A 5FCDA 1QQ7A 2AE1A 1OZFA 1AD2A 3VR1A 3NBAA 3D5QA 2ZWVA 4CNQA 1YJ9B 3TW0A 1DV2A 2CBXA 2HJHA 3T3EA 1CUWA 4U2DA 1IBCA 4XIGS 3R76A 4DMLA 4QJ5A 4E3WA 1FFEA 3IAAA 5E9WA 1W4ZA 1GKIA 2FUG1 2ADMA 2XVAA 4G2NA 3ONNA 3PC2A 4X45A 4DSOA 2ZZMA 2C88A 2H17A 1V7QA 2XDAA 2ZJ5A 2UVPA 4U7HA 3HB9A 3MJEA 5GONB 5T8KA 1X7YB 3GXBA 3S81A 4MLDA 4YJDA 2Q07A 5KMGA 5ITSA 1GNQA 1EJ2A 2SCUA 3HLTA 3MIIA 4FMDF 4R3NA 1II9A 1D09A 1TYBE 1WPQA 2XODA 4X41A 1TZBA 3ANYB 3WA6A 2FW1A 1IOZA 1Q15A 1ZS9A 4MVJA 3L05A 2KMLA 2ZXIA 3OW2B 4ZCSA 4B4KA 4Z0TA 3OM8A 3KOOA 1JIVA 2GHQA 3E7PA 2A5LA 2WYRA 4CIWA 3AINA 2WWFA 4L4SA 5IK2D 5EWLB 1R6UA 4R4JA 4WNIA 3DM5A 4O2AF 1ZGHA 3DAFA 3ZHOA 2FYTA 2HDWA 2YHSA 4AW9A 4EARA 5FBZA 3ZS8A 2GJRA 1J5XA 2O0HA 1QQ5A 2C59A 2W00A 3FPGA 2W70A 3UUGA 3I9MA 4BMSA 2BTOA 1MORA 2CY0A 1WTCA 3A8TA 5SYNA 4HYEA 3QOXA 1HL3A 4DHEA 2OV1A 4DV0B 2P6NA 1J7KA 4ZKDA 1WUKS 2FLWA 5BPFA 1COWD 1NOKA 1JEAA 1RADA 2Q5LA 7ADHA 5ISMA 3H2ZA 3LY9A 4ZVRA 2OBRA 4ESEA 2P2SA 1XD2B 3CCBA 4CEIB 4QAJA 3OF5A 5A3SA 4RDHA 5BW8A 3LTNC 4CCYB 4RKRA 5B2ZA 4O8ZA 1ZHHA 2XECA 4L6CA 4U5QA 4EGCB 1V6AA 4OY3A 4QT0A 1KR2A 4PO8A 4HZGA 4Q1CA 1TC1A 1JA1A 1RHMA 2H7XA 1PR4A 3SKYA 5F35A 2E4AA 1NJ1A 3NRCA 1G2QA 3UH1A 3Q0TA 1L5LA 4P3XA 3LQ2A 2X2OA 5FI3A 1USWA 3WLAA 5AICA 4DLBA 4DMCA 5EIAA 1OBHA 2C4NA 1HDGO 5EL0A 3C7CB 3D3KA 4KU4A 4XDZA 2PV7A 4WK4B 5FLKA 1VQ5B 3J7TA 4M2LA 4J0QA 3L7YA 4QVGA 4UZFA 1O1YA 1WULS 4OOVA 1TW3A 1NPDA 2ZRNA 2ZT8A 3DMRA 4YWJA 3TVYA 1UKYA 2NYVA 4GRAA 3ZGZA 1HLPA 4WX2B 4HAWA 4Q93A 3RS5A 1YVEI 1V16A 3FYUA 4FDUA 5EMJA 2QUBA 1FMCA 5COAA 5A5VA 2BHRA 2WK1A 4BN5A 5E0OA 5KKCA 3QKWA 2Q4EA 3WI7A 4P8RA 3HWRA 4A1FA 1RXYA 1VXRA 5EMHA 5IFLA 4Y6SA 4D8WA 1A8PA 2VZLA 4X8IA 1KK2A 3PGJA 3K8OE 1L5FA 3NRJA 3BUSA 3Q6IA 4KRXA 4D0NA 1F9AA 2OY0A 3UB4A 4HV4A 1U0TA 4FBMA 2PKYX 2NQ2C 3ONEA 1MENA 4BVLA 3AMVA 1FTSA 4Q1FA 1RHKA 4D74A 2C4HA 4KDCA 4CV1A 4LOHA 1BOOA 1WZCA 4YJFA 3HLKA 5G0TA 4B32A 1Y7PA 2QV0A 4FGKA 4JKYA 4OM7A 3BT7A 4QEZA 3V48A 3FSGD 4Q02A 4A2CA 4JNKA 4B2PA 3KFXA 3E70C 4W5HA 2YZNA 2INGX 3UWPA 3GA5A 3P8ZA 2OGZA 4PXAA 1ZW6A 4RS3A 5KNBD 4BEWA 1V0JA 3HL4A 2O2YA 3W1VA 1MGOA 3ZTWA 4N18A 4O4HB 4BOYA 1HC7A 2NXEA 3AIMA 3KIPA 3TZLA 4KPYA 1U2EA 2ACEA 1JFRA 1U2QA 3EVDA 1YA6A 3E5NA 2NU7B 4CQLB 4FFRA 4RPGA 3V00A 3F4LA 4A4DA 5DOZA 3RVNA 1XZAA 1SU7A 2HX1A 5DCYA 2ZRBA 3F7NA 2B3TA 3P9QA 4HP8A 1LGYA 3NVDA 5C7IO 3LO8A 2B4TO 5B37A 5KTPA 4KR6A 2LCQA 2H65A 3UPDA 3ILYA 1Q1BA 3OWXA 2J6BA 3V5NA 4ILEA 4II7A 1W5BA 3DE3X 1JPVA 4CKXA 5IYZB 3ETEA 1HMYA 1FXUA 3ORHA 2ZBDA 1OAKA 3FMVA 1D1SA 1FOEB 3B38A 2BZ0A 2VDNB 4YQFA 3GPCA 3EEYA 1RXCA 2FR1A 1T3HA 4WDRA 5G4KB 5BWBA 1V8ZA 3DZFA 1TJ4A 2HF8A 3BIWA 3OU2A 4NS4A 2VF7A 4P93A 4WKGA 3ZXYA 2PGDA 1Y81A 3F3MA 2ANBA 3L18A 1MJFA 4MVJH 1DCKA 2JHPA 5FQOA 1FTNA 1XA4A 4QJIA 1JDPA 2FEAA 1ZCFA 3CONA 3CVJA 2X5NA 3IDOA 3L8DA 3GVIA 4FYIA 4LTDA 3SICE 4W7IA 4F5ZA 2A3NA 2JLXA 5CCDA 2B4RO 3Q3AA 1OD6A 1TAHA 1OFUA 1RABA 2JAHA 3L1IA 2VJLA 3NE5B 4JUFA 3RT9A 3SSOA 4CKBB 4DKJA 4AYTA 4A0FA 2A5GA 3N07A 2QRKA 3IKLA 2QP4A 4XN3A 3WNZA 1T6NA 4KE9A 1UJ4A 1WKVA 5A88A 1IEWA 3BSFA 2BEWB 3L7JA 3V8MA 1EM8B 4KQWA 1O97C 3SEFA 2P5SA 2JFFA 4MV1A 1C7IA 4U2GA 7ABPA 2WM9B 4DXHA 4DUYB 3ID6C 2OP0A 3FCOA 4YRFA 1YAHA 3ZLVA 4ZHQA 1D6NA 2D7DA 1ECJA 4N8SA 5DEIA 3SYRA 4LXUA 3GK3A 2VEDA 1RWVA 2P67A 4IIFA 1PYOA 2ZGVA 2F4VB 3L4JA 1U3DA 4UZEA 3GRZA 4BRWA 1CUYA 3QYAA 3H1TA 3LC7O 3ET5A 2HUPA 5E4JA 3NETA 1E1NA 1KYQA 2Q3JA 4KKUA 1Z5VA 3PXEA 3PWTA 4R5HA 5EJ2A 3N2GA 4Z3OA 2RGYA 4MRMB 5TQ0A 5IABA 1XN4A 1FYFA 5BQFA 3WL3A 5CX1B 1TJ5A 3BXHA 4M49A 3AEUA 4I36A 1V3VA 4EPYA 5J4KA 3K6SB 3HG7A 3NHLA 4MR7A 3PQ6A 1SH7A 2I6FA 2O1WA 3A6PC 1GRRA 2HKIA 3KZVA 5I4BA 4O1IA 3AR3A 5LD2C 3CF4G 3ZG6A 4N3NA 1ZICA 2AXQA 4EQ6A 1QCDA 3BMNB 4BJ3A 4FFSA 4RY9A 3UZUA 2BYTA 2HT1A 1FQJA 1IXRC 1HNNA 1MU0A 2IGTA 3G8BA 1R6VA 1JU9A 1SCNE 2WTBA 2X8LA 3HVUA 2Q6OA 2JCXA 3DAHA 3PFKA 5CP8A 4DSUA 2A0UA 1VIAA 5AI5A 4PX5A 2NZ2A 2FRDA 5ALLA 4B3HA 3CTAA 1D03A 2HJVA 2UVDA 3CVVA 2I22A 1AC5A 2AH5A 4DLVA 2Z04A 1U3TA 1BFKA 4JKIA 1JB9A 4YJKA 4KW7A 4EUHA 3K92A 4R40A 2PSFA 3A6FA 4WTOA 3BAZA 3A25A 1JTFA 5FIUA 1CUFA 3FIJA 3IVGA 1OXVA 2ZI9A 2OK7A 3Q8KA 3K70B 1WCV1 1X86B 1C7JA 4FWIB 2HA3A 1W85A 4YUWA 1FE8A 1UZAA 3C98A 3RHTA 1OH7A 1BD4A 3I05A 2OAP1 4GS5A 1HDCA 3BIJA 1OAOC 1KDTA 1VQMB 2O2HA 2NVUA 2AZTA 3EVCA 3A6KA 3VPAA 3X44A 3PVZA 4MVJI 4N03A 5IF9A 2GXSA 4ZMBA 3ZR4B 1UC8A 4LI3X 1H8HD 3GRYA 1HVXA 1JHMA 3VA7A 3J81A 1T9ZA 1XJCA 3DZ8A 3DEHA 4K5QA 5IYQA 1P4AA 3LZCA 2EJUA 3DZHA 1E3ZA 2PSEA 4HPWA 1CE8A 4OYRA 4WPGA 1H3NA 3KJGA 5FUMA 4XB6B 2CLOB 1EFUA 1DXQA 1PJCA 2JLRA 1JXQA 3EGOA 3UOGA 4E2WA 2VDLB 1TF5A 3K9FC 3QTTA 2PWYA 2IHUA 1R12A 1G5TA 2F2TA 2ZYRA 2BI7A 4Q12A 2Y4OA 4KPUB 4QFBA 4R9NA 1GUYA 2IHZA 5KQSA 2OZEA 2NZVG 3PUWA 2IPNA 3BJEA 1DV1A 2NPFA 3RC1A 3DKIA 2RGDA 1B15A 1KVSA 2QE7A 1RRVA 3M4YA 2QR3A 3SZRA 4D8VA 4YT5A 2HJ9A 4RLZA 3AY0A 1Z18A 4ZTBA 1L7OA 1VKZA 1D9XA 1COZA 1DHRA 5KNDH 4X60A 4FYKA 1U7ZA 3T5GA 3A1WA 4RTNA 1T29A 2VSOA 4NOKA 3I2FA 4URYR 1Y80A 3NKFA 3BD6A 5JXGA 3H9NA 1FFGA 1V96A 2XNDD 4PLHA 3PKZA 4B85A 1Z2NX 2GO7A 1SEPA 4M7WA 3N39C 2F1RA 4IHAA 2XOKA 4IH4A 1K06A 3M5DA 3ST7A 3WRVA 4CR7A 1G6Q1 4WZLA 1XYYA 1G291 2R66A 2R1ZA 2YY5A 4OJMX 5JWRA 3U44A 1N07A 1XRPA 4Q4HB 2FP3A 1T1RA 1JQBA 2G5PA 7REQB 2QZSA 521PA 3PXDA 5I7HA 1JF8A 3ABZA 1SBYA 3IEIA 3ISTA 3NVKI 4D25A 1SB9A 1T1EA 3JQ6A 2AFIB 2OFFA 5ESXA 2F6RA 3QMPA 4NNPA 1Z7BA 1SIOA 4EB6B 1OF1A 3T7EA 3LDHA 1D5CA 2VUIB 3AVVA 1LW6E 1Q83A 1SOWA 4GOKA 5ED0A 3L8CA 3ZD7A 4JT4A 3HBMA 4D3FA 1I3CA 5C1DA 1ZN9A 3PXAA 2ERXA 2QMHA 4TV8A 3UMVA 1G21A 4IMPA 4HSGA 3TEJA 4Z7NB 4IF4A 1NVGA 2OCBA 2H4ZA 3JU3A 4WL0A 5DXJA 2VRCD 4J2OA 3N2LA 2DCUA 5ECYA 1E1QD 4BQQA 4D4HA 4PYIA 2OM6A 1D0IA 1TVMA 4FWTA 1Y1TA 3QXCA 4C14A 3A1CA 4RKEA 4EFDA 4WINA 3F3YA 1PGPA 1CS0B 2V7EA 2YH2A 1A5SB 2X77A 4FLEA 4D3DA 1S0UA 4HFRA 2Z1NA 5IHXA 3R3ZA 5J5VA 3C8UA 1YRQA 2QIOA 5JRJA 1GAWA 1UEIA 4ASUA 4UHKA 4UU7A 1C3JA 5UKDA 3HXPA 4RA9A 3RVJA 5B2EA 2C3UA 5C5DA 3GVKA 3PDIB 3S1AB 2C2XA 5I9IA 1U0HC 1R6DA 2VUHB 3KZOA 1JDVA 3E1YE 3U7IA 4IH9A 3ZWVA 2CVQA 4YH1A 3J7AC 2FPXA 3OZDA 3FE2A 4DNFA 3BVPA 2IOFK 3I61A 1P5JA 4MGHA 3V42A 2FZGA 1GZVA 3I6QA 3IV9A 3ZJ5A 1LI5A 3GEMA 2BR5A 2NG1A 2NUPB 3P2EA 2M6KA 3R7LA 1CK4A 3CIFA 2JLAA 2JH9A 4YRMA 4KDRA 2GETA 4Q9KA 4GEKA 1SKYB 5IJXA 1F2VA 4M88A 1NBAA 2GM5A 4DJDC 4YAIA 4NCBA 1ACJA 1G8AA 1KQPA 3QI7A 1WSAA 1IWPB 1K9VF 3CPWB 3IP7A 2G1PA 3BMQA 3SBEA 2FN4A 2WHPA 3E22B 1YOVA 4CIDA 1AN9A 5FWDA 3A3GA 3PNOA 2OV2A 2JA2A 4GWLA 4AO8A 1H6DA 3A28A 4DUGA 3CPHA 3GUZA 5JATA 3ZZTA 2BC9A 3EISA 4RQBA 1VHDA 2AR9A 2QMYA 3FY4A 4UVDA 4B76A 2GDZA 5TMEA 3AP1A 1P1JA 5BUCA 3SYMA 3ETGA 2CFOA 2WF6A 1UXKA 1VLLA 1AKTA 1NWCA 1C3VA 2G1AA 4QUEA 2I55A 3IEKA 3WKCA 4XGRA 3WAGA 3K94A 2H2DA 4K9OA 3A05A 4D1YA 3LKBA 1SR8A 3QNUA 1IPEA 2Q3FA 4DRXA 2A6PA 4AKTA 1EX9A 2OHFA 4HDMB 1Z8HA 1N2BA 1KYVA 2ZUSA 4NZPA 1LK0A 3GI1A 5EZ5A 2GK7A 1AQNA 2NO6A 3VR2A 2FEPA 3EBPA 4KV9A 4LUCA 4E46A 4ZO7A 3BHMA 5A3VA 4ALJA 3P9IA 1JHRA 1E6UA 1EGMB 1ZC3A 1CJSA 3D7SA 1FLAA 2PX0A 3IHTA 3KQMA 3M82A 4H15A 3CLRC 1Q92A 3VZSA 4RPHA 2J46A 4TKVA 1H2XA 4BVHA 4ZVMA 3VU3A 4JT8A 5LCXA 2A5YB 1OE0A 1BE0A 1JNYA 3BH4A 1TMYA 4IR7A 4P4SB 5AOVA 5ER6A 1NQUA 2GD2A 3R41A 1H8ED 3DHNA 4J0DA 1ZIXA 4CDGA 1NM5A 2BSXA 3E35A 4HUTA 5JADA 4ENWA 4OIMA 4MAFA 1FTWA 1GFSA 1NMXA 3CZMA 4HXFB 1KZGB 3CO5A 4TWRA 5LA6A 4EW2A 5LQJA 2FRXA 3KE8A 3QNMA 3H17A 5G02A 3WGGA 5J2UA 4PZEA 1I2MA 2Q0SA 1XMOB 5AHRA 1KQNA 5SYMA 1W34A 5FOTA 1CDDA 4D82A 2G28A 4K8OA 3CH4B 1M2HA 1NJGA 5ECDA 2ZWAA 3CXRA 1RZUA 4IVQA 1GQFA 4JLJA 5BSFA 2GJKA 3P0JA 1IVYA 1XKXA 4ZOLF 5JI3E 4TKOB 3RSHA 1TX4B 4N0MA 3PJDA 5I8WA 3NKVA 3IUNA 1A8QA 4JYPA 2MINA 4KMSA 4P4GA 4PPGA 5JCZA 5AHWA 1SCUB 2ZQZA 4KG7A 2JFBA 5BVHA 4D81A 2VDPB 1N9KA 1F4PA 1QRRA 2EZ8A 3EF1A 5F7JA 4BATA 5AUOB 4NU0A 3LT4A 2WG1A 2P0AA 2O0LA 2CE2X 1XQ6A 3PVCA 3KJXA 1X87A 2I1WA 4FUTA 1MAHA 4YO7A 3TFQA 3I0NA 2PMKA 2I6QA 3I1FA 4ND8B 1F7VA 4E5UA 2VDUE 3DEIA 2H59A 4LE2A 2ID9A 3B9BA 3LQKA 1OI4A 3O90A 3NB0A 5CVTA 2Z30A 5H4GA 1VHWA 1IATA 2QA5A 1XE1A 2XUAA 1Y98A 2X86A 3CVYA 4PTLA 4WLVA 5ERYA 4F72A 4LWPA 3AK4A 4FYXA 2CV2A 3B8EA 1ZPDA 4DAEA 3PA2A 1ZVJA 3WRWA 4OHUA 1RM3A 1DTWB 4RGBA 3KU4A 1MCZA 3LA6A 1IZ9A 1RJWA 3A0RB 3JALA 4OG2A 2HBRA 3JAKB 4ETIA 3EQ6A 1UMKA 1HWYA 3EAGA 4EG0A 5EERA 8ATCA 1CQIA 3OZUA 4ZTZB 3A36A 3CX4A 5KIAA 4UQOA 3GGOA 4MI1A 3ZXUB 5C51B 3HPRA 1DKPA 4JP8A 4HDRA 3RWOA 2W2XA 2ZRQA 1BC5A 1KZ7B 4LGMA 3BFJA 4XGKA 1XPUA 5A2GA 3EARA 4RHCA 2O5EA 1Y33E 4UNNA 1QUEA 1UT5A 1ZIDA 2ZSUA 3FMPB 3E2PA 1C3EA 5EHIA 3PFBA 1NC1A 3UY4A 4D41A 3EG5A 1ENZA 1G20B 3FPFA 4ZVOA 4H4CA 4B2LA 1MOZA 1NP7A 3FB4A 3CCFA 3FUVA 4RD3A 4DC9A 2B1GA 2NXNA 1VJ5A 3VR6A 2ZYAA 1UPTA 4EPXA 3OE1A 5CCBA 4N6NA 3K0CC 2VHVA 1Z6YA 3TOCA 3UT5A 4M0CA 2A78A 4WFKA 3DULA 2AOTA 4ZIRB 3ZGLA 3EG9B 2G9UA 2H4JA 2J4DA 1AXRA 2PBLA 4UBIA 5TVKA 4AJPA 5M29A 2DUMA 1HFJA 3IOEA 4DR3B 2MSEB 1HDOA 3OLVA 4OSPA 1JHQA 2H5LA 3AO0B 3DOFA 4JELA 2H4YA 3HO1A 4RPDA 4BX8A 1L5SA 3IRUA 3PSHA 3KXDA 4TRJA 4H31A 2FFHA 5HQ3B 2XIQA 3FPAA 4Y6LA 3WBFA 4RK6A 4AMZA 2REBA 4M0EA 1E2BA 2C77A 4CBVA 2JGFA 2FHPA 3WLEA 5HIIA 1WZEA 1FW6A 3PQDA 3AF4A 1XT6A 4REMA 1Z4LA 2O20A 3SZGA 3IPAA 3T1NA 1XHLA 4EEXA 5KSZA 4HN9A 1Y0RA 2VQDA 4M9ZA 4Y2GA 3EUWA 3UMJA 5KYWB 1RRGA 3GA0A 1P33A 3LMKA 1KFJB 1RPTA 1ZAKA 5D87A 5FOXA 4IIGA 4ZODA 3TRIA 2D3TA 4UCQA 1XTVA 5DT2A 5KHOC 3JPYA 1FJHA 4PYOA 4DDWA 1LTHR 3V97A 4N82A 3WFZA 4GR9A 5EJ9A 1W36D 2G1KA 3JATA 2ACVA 5FBVB 3P7MA 1PWYE 3G02A 1Q2XA 1WHSA 4KFTA 1HQCA 4CW7A 5LLSA 1HSZA 1I1NA 3PJEA 3MYRA 4GQAA 1PHPA 5H0IA 1R7RA 2QTFA 3UJ6A 3L0PA 2JFZA 1QC5B 1KEUA 3BBPA 3U4DA 2CLMB 1GHTA 4IYJA 4BFZA 4C1BA 4WZEA 3IKVA 3AVWA 3S8MA 3LH5A 1QJ4A 1UF9A 1B2LA 4MPDA 3VSEA 3F1KA 3OCXA 2BKUA 5J47A 1PX0A 1Z12A 2OBNA 3HYCA 1KP3A 1UEJA 4A0RA 1W5AA 2WZQA 3ZW8A 4HVLA 1YFLA 3ZTYA 4EHKA 4OIFA 3DDHA 5BOSA 3QYJA 2WI8A 5ALWA 1LBIA 1J90A 2AI1A 1J5PA 3VPXA 1RAAA 3CIOA 4ZMSA 3WLSA 4TSKA 4YRKA 1E4YA 4UMFA 2W6OA 3E3OA 1VIVA 4FEGA 3TPFA 1IQRA 2JVJA 3CG4A 2HV8A 4F2HA 5BNWA 1R4MB 1U8EA 2HF9A 5FYQA 3TRFA 2HGZA 2WP0A 3RC9A 2CUNA 2IUEA 1VQ8B 2NZ8A 1N6NA 4W9MC 3HDGA 4XDGA 2Z83A 3H84A 1X9IA 1SVNA 5E95A 2V7QD 2B4AA 3PPVA 3WK6A 3SGLA 1U0GA 4JOQA 3HJFA 1JWLA 3TQCA 3LBFA 3VC1A 3G5AA 4GEGA 3SVZA 1GTRA 1LBHA 3ONWA 4O4LF 5LLDA 3H8JA 3U7RA 4QQ8A 1EDZA 3V4FA 4BMXA 5GZ1A 2R7NA 3NJ8A 2COKA 4I50A 2V3WA 4MWTA 3PZBA 3UWKA 2IHKA 1ZO8A 3QELB 4GDMA 3RS7A 1QHEA 3I5AA 5KBYA 3WJAA 4F3YA 2BEJA 2A9KA 1THZA 3QX8A 5G1PA 6PFKA 5CXSA 1YBMA 4EKDA 4XRGA 2DHEA 2VWQA 1M0TA 2PUWA 3TLCA 5KVSA 3HUFA 1QH0A 2W2LA 5GIOE 3M9XA 4JH0A 4D3ZA 2AX3A 2I78A 2PGOA 2KPOA 1EWTA 1Y48E 2XMGA 1KS2A 3NHUA 3QWBA 4QUAA 5E4TA 3UFXB 1CEQA 3WOVA 4BZZA 3QHQA 5CLJA 1N75A 2AW3A 4X92A 4XQGA 5GV7A 1PI3A 2AG0A 4IHJF 4XB1A 1H0SA 2J9ZB 3WKEA 2XE4A 4EPRA 2M9MA 5PGMA 3TNLA 4EKNB 2PG3A 4U0KA 4JOCA 2P5TB 1SG9A 2CNOA 3ZHBA 3EHDA 2D8MA 4WAUA 1WSWA 5AKYA 4TSFD 4CF6A 4Z4UA 1E32A 1KMIY 4LRXA 3TZHA 4L75A 5BVGA 4JSTA 2JATA 4OYYA 2GPSA 3RUDA 3GLIA 1ZX1A 3P9KA 3VR6H 1EWVA 2X22A 4GP6A 1YFZA 1PV4A 1FUYB 1MA3A 1V47A 4MO9A 3ZZNA 4H1WA 1OT5A 1VE1A 2OCIA 1RI5A 4M0KA 4C4OA 4YBZA 4R8SA 3ZQ4A 3I5YA 1UWKA 4GM0A 3WXMA 2ZBGA 1TVKA 3UHPA 2D54A 1YMVA 3ROZA 4L07A 1J56A 1IAVA 4A2WA 3I64A 3ZEAA 3B36A 4QOFA 4TRMA 3QPUA 2VO1A 1U11A 1LDEA 2NQTA 4LYEA 3QVXA 1KEZA 2VJOA 5IULC 3FBWA 2GREA 1H0RA 1YE3A 5BSUA 3TCKA 4J1QA 2A14A 1KIAA 3M7IA 1NB9A 1OGIA 2BISA 2VSXA 2ZSHA 3H5WA 4JJGA 2DM6A 4NC9A 2VBUA 4YXWA 1CKEA 1JDUA 4RVUA 1L4MA 4R8VA 4U7JA 1UBSB 4KQ2A 2OHJA 2WWGA 4PO9A 4RE5A 5CM8B 1J49A 4TMKA 3H3FA 1TZ2A 2QJOA 4QL3A 4WKNA 1P60A 3AG5A 2NZXA 5DI3A 5IZ4A 1GRQA 3BMOB 3B6ZA 3WZMA 5K0ZA 2PSDA 1XTSA 2XYRA 1MW9X 4UNIA 4RABA 5LQMA 2Z2JA 4CRWB 1TTTA 3W4JA 3F9CA 3VNAA 5KJ6A 1Q19A 4TXNA 2MTBA 3LWZA 2DTXA 3HGMA 2ST1A 2J85A 3HU5A 2VDWB 2FGKA 2PE3A 1MB2A 2P1ZA 4HXGA 4RDIA 4PAOA 2JK1A 1WAMA 4JR2A 1EK6A 3AY7A 4F6RB 4KPEC 2Y9MB 3ONDA 4UUQA 1UDRA 3NYWA 1KKMA 5DZSA 1U2GC 1T1JA 1GAEO 1S89A 1XZKA 2C99A 2EIHA 3JQGA 1KC8D 1R5BA 4GSLA 3HM2A 4HMQA 4DB4A 4KV7A 4UE6A 5FP0A 4E5DA 2KVOA 3OKCA 3NATA 3PEEA 4BQNA 1KVRA 5CXXA 1ZRSA 2WYVA 2O2XA 1H93A 4WZKA 1M7BA 1M2JA 1G8HA 1W44A 1K92A 2PT7A 2VYCA 2JCSA 4WY8A 5AOAA 3D6VA 4YAUA 1QSGA 5B6JA 1IHMA 1QR6A 1Z6TA 4GI7A 3ASVA 4PGGA 2HA0A 3SI7A 1VSUA 1DC4A 4IY1A 5J4YA 1VRWA 2GAOA 4H35A 3U5ZB 5H3CA 5CT6A 1HF3A 4GOND 1PL0A 2DERA 1VECA 4COKA 1RI1A 2ASVA 1ZOLA 2UDPA 4LNHA 2VR1A 4DJJA 1Q6YA 3LK6A 3S5UA 3U48A 4D57A 3RWBA 1A9ZA 1KAMA 2DC1A 4CTNA 4Y1FA 4YJGA 2PUCA 3VSAA 1U8CB 4NECA 3WK4A 1OXKB 3NGLA 5CDHA 4Q7JB 2Y99A 1EUCB 3KYCA 3LQQA 1J2UA 1TGVA 3IKTA 3THXA 2QTRA 3IDZA 4BJ5A 4JYAB 4YP6A 4HLUC 1JVNA 4YMWA 4HNVA 4CFZA 2BPOA 4V1CB 4A82A 2YQ4A 3C5HA 3TX2A 3KVNA 1M6WA 4LHWA 3UV3A 3PHGA 5A5DA 2X9VA 3RJMA 3BL5A 4OCZA 1PWXA 4URHA 1U2TA 1XCGB 2Q0QA 2FKAA 1XZPA 3M3HA 3HU3A 4RU1A 3BXEA 5JDIA 1N5KA 1F17A 1EM6A 1J97A 4XD7D 3HC7A 4I1UA 3V8BA 4BV8A 2J4FA 4BFWA 1MC5A 1EE9A 1ONOA 4DBLE 2B7LA 1BAPA 4BDTA 1I9CA 3TM5A 4IQ8A 1E63A 4JT2A 1R18A 5BW6B 1KYYA 2PMDA 1MB3A 3SC2A 1I0IA 3CESA 2C2KA 4LXTA 4D4LA 5C7LO 1JKMA 3GAAA 2G04A 4B35A 4ML3A 4YHBA 4RK7A 1IBMB 1ML4A 2COEA 2GZMA 2QU8A 1FMJA 1JNXX 4NOLA 1ODKA 2IOHA 1YE8A 2V6MA 5IVIA 2DQKA 4NXMB 2BEVB 1A9QA 5EHXA 4QG3A 3M49A 5CJPA 4G25A 3A7DA 3HV2A 1XLWA 3AUTA 3L8EA 5AXCA 5KTYA 4BWFB 1L5WA 2FG5A 4IG4A 3IJEB 2GWRA 3GFTA 2BFOA 2W2KB 4IWNA 1OLUA 3ZYZA 4KQFA 5F4ZA 4E2XA 4L2IB 3B1JA 4G8DA 4HNQA 3QEBZ 2VBGA 1GPDG 1AKRA 1CJVC 2B8TA 1SHUX 2XI4A 2ZZKA 4NCJA 2ZIFA 3UH0A 1YTLA 3O95A 4G5FA 1B23P 1IM8A 3L0YA 4KXMA 1DJMA 4D9EA 3QX9A 3K16A 3ZE0B 2VLBA 1YQTA 3IOMA 1H1DA 5CRIA 4YAKA 2Y05A 3QLEA 5K8VA 3TLXA 3SS8A 5CFMA 3B20A 2FN3A 4HY3A 4RCZA 4I81A 1BXGA 2XYQA 3P0HA 1P1RA 2WVHA 3CZ4A 4RK0A 4AICA 5L7WA 2DWUA 3AKYA 3QGMA 1E3JA 4OSEA 2NO5A 1GXSA 1W6UA 2IYVA 3M6UA 3L7BA 4FQ5A 4UREA 4D0RA 5HW0A 1HPLA 5FOUA 4URVR 3UB3A 1T8SA 5IYZF 3R0JA 4BCBA 1OREA 3ASQA 2YZ2A 1Q1AA 3COVA 4G0NA 4G6ZA 3SLKA 1PFWA 4WFQA 1HE5A 9GPBA 4ZJZA 1CP3A 4RTOA 3LWBA 1T0UA 4C3OB 3W5DA 4XM3A 3NNSA 1RWBA 4DQLA 1CFJA 3VJLA 3QE3A 3U4QA 2XUZA 1NYQA 3OC6A 3UAVA 3CVOA 3P32A 4GUAA 4TUYF 3K9BA 2IV3A 1O58A 1WMDA 2FR8A 2WDPA 1KHHA 1CQPA 1C14A 2G0NA 4GG1A 3MW8A 4JA2A 2GR9A 3WSVA 5ICGA 1CYEA 2EGUA 5HJEA 1CJBA 2P27A 3G2JA 4FOSA 4RBNA 3C7KA 4TV9F 2F9MA 1V1RA 1TCUA 1ZUNB 1FS5A 1N6PA 3P9XA 1E2IA 1FLVA 1SULA 3T52A 2WF7A 2IOQA 2GJPA 3DTVA 3TNDA 2WD7A 3ZWXA 3W5IA 3FHTA 2O23A 4DQUA 2D4HA 1PQ4A 1PW5A 3BH0A 5FTMA 1YDEA 5I7EA 3L1KA 1B3RA 1TIBA 4FN5A 4BNYA 3H94A 2YMQA 4BJ6A 4G7XA 2F3QA 1X1DA 3LCCA 3S40A 5EIFA 5JJIA 2FUCA 3INNA 3H4TA 2AZMA 2LIPA 1II8A 1QHSA 2IZ5A 3L0DA 4DCCA 5JARA 3CCCA 1KWKA 4GLBA 3IPLA 2CNWD 5FUBA 2CXQA 4RK4A 1O54A 2C97A 1WUTA 2NYRA 1P7PA 4IQ4A 1JA0A 5I5EA 4AT1A 3BL8A 5CA1B 4TL6A 2XQGA 5FADA 3T1YB 1RBZA 1IVNA 2OP1A 2NV4A 1RXUA 1VPDA 1FFWA 1UMDA 3C3MA 2PL5A 3M6FA 3ZNOA 1EK5A 4CU5A 2QVXX 5A4JA 1Y3HA 2YYAA 5MGNA 4JY7A 4DZTA 3FOFC 1IZ7A 1PL7A 1ZYUA 3Q8LA 4KN5A 1KAOA 3GLUA 3QVGB 2ATEA 1DAEA 4L15A 3E9ZA 2RI6A 1LSSA 3Q9SA 4N49A 1EBFA 3ZHRA 1U1GA 4K6KA 1C1YA 5LUAA 1Q7TA 1N2ZA 3WWEA 3QVOA 2DUNA 4OOSA 4MV6A 4NJEA 1SWWA 2XWJI 5K6AC 2VDVE 5JPIA 4KRYA 1BGVA 5TQ2A 1PIWA 1L4LA 4KSBA 4GXNA 4RMGA 3GYBA 3UAXA 1G4UR 1FF9A 1ZMBA 2EJTA 2M6RA 4QQRA 1G8MA 3T5CA 4KKSA 1H5NA 4J0CA 3UMSA 1I8TA 2IFTA 1UD6A 2FPPB 3HYNA 1H05A 1L7AA 2XXAA 2D5AA 1DAMA 2ODPA 2JGMA 3I45A 2D9RA 3BFVA 4FHDA 2BR3A 4FZVA 4JDPA 3GA7A 5F1PA 5HCIA 4MWGA 2YHBA 4ITRC 13PKA 2JAQA 3OIVA 3KYDB 3B89A 3OT1A 2E4WA 3G1WA 4GWGA 1VL6A 1P44A 3TTVA 2LXNA 3MEQA 3ZYCA 5F4OA 1WUIS 1Q22A 3EFEA 3RY8A 5KOHB 2B1QA 1SB8A 3UB2A 5B1YA 2IK8A 3NTRA 4G9GA 4O6VA 1RXWA 2A92A 2CB9A 4RORA 2XF8A 2IOYA 1MLDA 4LRSB 2FN8A 4RSMA 1VG0B 3CG0A 4JWKA 3TLGB 1D6MA 2CHVA 4ZHSA 2YV2A 3VJKA 3CBQA 1LKZA 1I1HA 5JW6A 2OGWA 3BQNB 4P58A 1AZSC 1X14A 3F5QA 1KVQA 5BNFA 1EG7A 3HPQA 5A04A 3AFOA 2EDAA 1UM9A 1XA3A 3E0XA 4OUDB 4ER5A 3EXEB 1QX3A 1RMQA 1NW8A 4OFBA 4X8LA 5EWJB 2MSNA 3H75A 4AZ3B 4CE6A 1ILWA 3VKFA 2XWBF 5HFJA 3M2PA 4JMPA 2I8AA 2ZAIA 3OM1A 4N0DA 3JD2A 3MFYA 4DIEA 5KTNA 2E6UX 2RJNA 4FMDB 1Y8CA 3HSSA 3BK1A 1XZ8A 2JGNA 3C6QA 5CH8A 5E3IA 4YPVA 2OCPA 4DR6B 1C0LA 3I28A 1RWKA 1DG9A 1SBIA 5K0JA 2JFVA 1FFXB 4MYUA 2AWNA 2HCTA 1V5EA 2D0PB 1UBHS 1QIFA 1ZLXA 1GNRA 3BKXA 3CH5A 3CZCA 2JIZA 4ZV4A 3PHBE 3PXBA 3Q9UA 4B1FA 3BD7A 5ALDA 2XJ9A 3I8SA 1G19A 4P3NA 4UUBA 1AMUA 3I9OA 4JJ8A 4Z4FA 1Z13A 3HTXA 4GL2A 4B4DA 1U2ZA 3KU1A 4BBPA 3K0BA 3IURA 4KYUA 5LQRA 2SKDA 1KY4A 1ZL0A 4ZDWA 4NYMR 4YO8A 3WTBA 3U80A 1MAVA 2EP5A 5ALRA 5AVZA 1PLKA 2WNSA 4TKZA 4YRZA 3RVLA 4LVUA 1UJNA 4BNUA 4O0LA 4AKSA 5I7WA 1CHNA 3S4YA 2A57A 2C7QA 2QNRA 5JZSA 2YNMA 4IQGA 1LDMA 1OW3B 2IDJA 1BMFA 1LPBB 4I3FA 1AHIA 4JASB 2ZLBA 4JQOA 4N0EA 4Q48A 4QUBA 4UEKA 3WFIA 1Z3IX 4QUHA 3T3IA 4C07A 3ILXA 3R6LA 3ASSA 3ZNNA 4EP1A 4PW0A 3HCRA 3AHJA 3NTVA 1GPUA 4TT3D 1M7GA 1FS6A 5FTKA 2QXTA 1FDVA 1DAPA 5AJZA 1UBMS 3L07A 3HM9A 4NWIA 1RP7A 3L8MA 4P36A 2B94A 4X3CA 5DASA 3IHWA 4DM4A 5JD5A 1EX1A 1CY4A 2VRBA 4L9AA 4YMSA 3GEPA 3KQPA 1SEVA 4HATA 1I6LA 5B12A 3DDYA 4L16A 4HR7A 3TIGA 3HXKA 4MW5A 1Z4NA 3DM9B 2ZB3A 2SNIE 3GPDG 2AJDA 3AHHA 2I03A 3MINB 3ZH9B 2EZTA 1M2VB 2N3ZA 1U80A 1OXBB 1S2IA 2HUNA 3GZJA 3M6IA 3R7SA 4RD2A 3OW7A 2H0AA 3BXPA 3HR4A 3BXOA 1DKOA 4JXKA 4ZVTA 2W6QA 2DOGA 1FTGA 1X3LA 3JQDA 4IMRA 3OHSX 4ZU1X 3TXXA 3JAWB 2H1WA 2H57A 3KOWA 2P1RA 5JAMA 2BCGY 2OBTA 1X42A 1IHXA 1C7ZA 4E5YA 3QVTA 4IYRA 4NG4A 2GKSA 4OK3A 5J58A 5JS1A 1YVRA 4QJBA 2OBFA 3D6AA 3CX7A 1M5RA 1FLNA 2HNAA 2PKQO 4XLEA 2XUGA 1FVHA 3C1TA 3NAGA 1J8VA 2JANA 3DS8A 1OU0A 3CLRD 1TNDA 1WF6A 3KCNA 3OIGA 3PI7A 5AK4A 5K3FA 1YFKA 1O9GA 3DF9A 3LHDA 2ZAMA 5ALHA 1XEWY 3S0JA 4EB8A 2R6FA 4YJHB 4C0QC 3O8CA 2GFQA 3GLFE 2HCRA 5C1OA 4GPIB 2UXDB 1B0PA 1QF9A 1LJUA 4IP0A 4GX2A 5KTMA 2ZDQA 4YIKA 3U9TA 3ED1A 4C1NA 1RJFA 3BC1A 4C30A 3PLNA 3RYHB 5LMUB 2ZIWB 4J29A 1NW3A 1OZ0A 4OQ4A 4BLWA 1XQBA 3GD5A 4PABA 5LU9A 1HSOA 4IJ6A 3IPRA 1L7QA 1MN6A 4FTWA 1YZUA 2XUFA 2XR1A 3WKAA 4L28A 3UJ7A 4DLAA 2UZIR 3S7TA 4Z4EA 5J2TF 3CEJA 4C3UA 1IU9A 1U2PA 1VGRA 3GU3A 1O6GA 3EPKA 3W5VA 1A9TA 1EDBA 3FUXA 2I2AA 1OWNA 1TAGA 2AOWA 5KQGA 3HHPA 2XGSA 1CU1A 2CL5A 2OQIA 2YY7A 1KR5A 1U5AA 5IYNA 3PNQA 5CVUA 3H2YA 3TG8A 4MUKA 4PVCA 3MWKA 3CLKA 2D62A 4G85A 3ZW9A 1A7KA 2BFCA 2H4HA 5EKTA 3EY9A 4R3WA 1VRCA 4A91A 3WLQA 2ZB2A 4QXMA 5A0FA 4AUMA 1Z75A 1EDEA 3WGUA 3FTNA 4GU5A 4L4YA 4UU8A 3H5TA 1Q17A 3L5OA 3L4SO 3V1KA 5I7VA 5KPJA 1N9ZA 3CMAB 3CN9A 4LYJA 4NJOA 4X1YA 5I8PA 2OZVA 3QE4A 4PG4A 4JLBA 5ALUA 4CEHB 4LK2A 4CR6A 4JR1A 2DIEA 2R8YA 1FY2A 4HEQA 1C0EA 2P1DA 1M1UA 4QICA 1KSJA 5K3DA 2D8AA 4XKJA 1BFDA 4ACBA 3EC7A 4DW8A 3FOZA 1JPUA 3TBFA 4LOKA 5A9RA 1MO5A 2FZEA 4JV5B 1EFRA 1V8BA 2FQWA 1DP4A 3I9JA 1KNXA 3FPJA 2BBWA 2ZIZA 3N53A 4YHHB 4Y0VA 1RXSA 1DXYA 1MH9A 2ECOA 2W6MA 4DIBA 3VYUB 5JHHB 4M9CA 3T5PA 3L4BA 1DIRA 2XKJE 4BEBA 4A5SA 2H48A 5H68A 4C6RA 2GNOA 3ZQKA 4RK1A 4QPNA 4QVAA 4GYJA 4MTLA 5CJ2A 4ZYWA 3ZV7A 1KH3A 3SZUA 1P1CA 3M6VA 1SK8A 3JD3A 1QYRA 5GVRA 4BBAA 4DLYA 3UJ3X 2O7NA 4TKUB 4HUQB 4CM6A 4UAVA 1W9MA 3LX8A 3U4AA 1TO1E 3U16A 1XZMA 4R16A 2WFLA 3H8VA 1BU5A 1JSRA 4B3TB 4M0LA 3ESBA 1W1WA 3RRXA 3Q85A 1ZG3A 2W2PA 1XNJA 1WSRA 3RYFA 1W4RA 2YOFA 4BO7A 2NSYA 2HRQA 2N75A 3H2GA 3PEVA 4LHEA 3VR3D 3RVKA 3ZWDA 2Y71A 2VNAA 3MJCA 2JPDA 3LCRA 2GARA 1IQ0A 1UZNA 4ALIA 3IBTA 4IKPA 1ZH6A 3D6NB 4DABA 4YRJA 2VHCA 4ZGNB 1USKA 1D1QA 1SJ9A 3WLJA 3W3AD 4BX2A 1Z39A 4CTOA 1B26A 4U6NA 2BFFA 1B8UA 3ONFA 2HDHA 2J6CA 3KPUA 1VE7A 3JYPA 4YRIA 3O03A 2WA2A 4H7KA 4OHWA 5E2IA 1PV2A 4ZD6A 3RIEA 1MABB 4OPOA 3V34A 4DT1A 4MS3A 2E4ZA 4JOSA 1DS6A 3CNOA 2X8BA 5KX5A 2C54A 5A5FA 3GDHA 4HN4B 2G07A 2H51A 1RM0A 2GA8A 3M2TA 3OEYA 1NKSA 3QMMA 1JRLA 3PEFA 1F7UA 1CYDA 1PUXA 3L01A 3DL2A 4MWEA 3MRVA 3X43A 4BP3A 1ZJYA 5BYKA 4NBSA 1KQGA 4JJFA 4IZIA 4KH1A 2A2ZA 3MWDB 4B3CA 1NFQA 2AG8A 3BWMA 1DJOA 1JSXA 1G63A 2Q8QA 1AB5A 2B3DA 4JI2B 1L8LA 1R15A 1NRKA 1QLJA 1FA9A 2HPHA 2ILTA 3I6IA 1AF4A 2GJSA 3OLWA 3T7SA 3TZQA 4G1CA 5K05A 1XTRA 5K8LA 4DV6B 1OZAA 1EWQA 1U04A 4PY2A 5B36A 2ZR8A 1F9EA 4NCAA 5JBQA 1PGOA 1B6TA 3X2EA 2C07A 1R0LA 2I1VB 1Y3FE 3ELBA 3NHAA 1G6HA 1WMEA 1IQUA 1ZFNA 4IIEA 4QRDA 4TWJA 4BVEA 4D9KA 4UATA 4IFTA 4V39A 4RDLA 1DXHA 1GSAA 2V6IA 3L0CA 4FC7A 4ARZB 1RXIA 3HUDA 1TUGA 2WYOA 2CVZA 1RCTE 1NJ2A 3PGA1 2OLEA 3EUAA 4ZGBA 1LPSA 1NX9A 3Q0EA 4M7PA 4CG0A 4PEVA 2VJJA 3W7VA 2GQFA 4L8FA 2NIPA 4NE7A 2PS0A 2Y1FA 1CBUA 2ETXA 3W6ZA 4KVZA 4Z7OB 2I66A 4INOA 5AOBA 3NONA 3O1LA 1ZD9A 3MB5A 2EFYA 4RJIA 4J0KA 1YB6A 5EGSA 5ED4A 3R9WA 4EYKA 3RR2A 1J8YF 3AF1A 2BDUA 3K70D 5DNUA 4O3FA 5BRJA 1NLZA 5EZYA 1S3FA 3G68A 1T0JB 3DXFA 5AK5A 1MO2A 2GM4A 1Q0UA 1EVEA 2ROQA 4JJAA 4TLLB 1VYUA 1XKQA 3ESXA 5CLIA 1PEAA 3LI2A 3NHWA 2WMNB 3GJZA 1UJBA 2OCAA 3LWDA 3MCUA 1NW9B 2QRJA 1TO6A 2H9IA 1SCKA 4E22A 4CCAA 4C5BA 1AK9A 1G3IA 1PQPA 1SXIA 1Z5UA 1GGFA 2JBAB 1EFKA 1YH3A 2Q5HA 2CXOA 5AMXA 3W9SA 4EYOA 2B21A 3FOCA 3RK4A 2QN6A 4WLNA 1C9YA 4YRPA 2BH2A 1E3XA 2FW8A 4Q4JB 1CDZA 1KPGA 5IXYA 4I4NA 1GFWA 3KAQA 3DJFA 3QLTA 4PQFA 1TU3A 2ARKA 3N5CA 1XXHE 1CY0A 3PCRB 4OI2A 3SU8A 3R40A 5J3JA 3VM6A 1NWHA 2HJGA 1TKCA 4ZI7A 1N33B 2I2WA 3QRWA 4LV6A 1WDLA 1DEOA 3IO5A 2HIGA 5EYPB 1X3SA 3RS8A 1YU9A 4OBWA 1FEZA 2K87A 3B6IA 5EZ6B 3AI1A 3CCEB 3KOXA 4A2PA 1Y89A 4B5KA 1R5JA 5C8XA 4KZKA 5LOVF 3OE7D 5LL6P 2DSTA 1SU8A 2P9CA 3ZCTA 4JP3A 3QWAA 5J4VA 3WJ7A 2VHEA 5CAEA 5ALFA 4XJSA 2OSBA 4GKVA 3U5TA 1IXYA 2QAJA 2SBTA 3PICA 4KQ1A 2KJQA 5AQ1A 3QIAA 5EINA 1IPHA 4TLDA 3AI7A 1L3BA 1ZXXA 2D5LA 3NCTA 2G6BA 5HE8A 5JCJD 2J67A 4KN8A 1WY7A 1HNZB 3HB7A 3QE9Y 1RMYA 4P7GA 1U7XA 2HO4A 3BH6A 3M9LA 3A70A 1KO8A 5A4FS 2NNWB 2ZRHA 2CT8A 5HPYB 2FUNB 3GJSA 2HMVA 4MKXA 3ZWQA 3AFHA 1ZM7A 4UU1A 5CU7A 2Q9UA 3UQZA 3WWYA 2AIRA 4DG9A 3AL0C 4AP6A 1XAIA 3NDBB 2OHIA 4C03A 4L4ZA 1PJ2A 1ZIYA 2A58A 4HWKA 4HIZA 2VC2B 5JMOA 4E13A 3JQQA 1Q0ZA 3VI4B 4E5KA 4EI8A 3PRYA 3F2IA 3TI7A 4PQRA 2X0EA 5AI9A 5AJHA 1M10A 2QRPA 1XYGA 1TUIA 3B6EA 5FR2A 3RRJA 4AROA 4XUGB 5AW9A 3G2HA 1VMEA 3OIWA 5KPDA 4GBED 4B0PA 5K0CA 4ACAA 2Z6VA 3IAUA 1AQ6A 2RG7A 2F48A 3O8QA 5A7HA 3ITEA 5EXEA 1M83A 1OWMA 1M0SA 2QYOA 2WF5A 4ZCPA 3V7FA 1Q1EA 3BFXA 4RPCA 4TQGA 4XOTA 4U2CA 3GNQA 1TA0A 1T36A 4RZ3A 1WD5A 2YZ7A 4HXYA 4L1KA 4LJAA 4PSKA 2VAPA 4MV5A 4AZWA 3W79A 1NF2A 4MYSA 1XZGA 4RVOA 5CK5A 1IY8A 3EXAA 4JI7B 1G6KA 2DE0X 1FZQA 4B7CA 4UBOA 2BM8A 1H85A 1XD8A 3FHJA 5EE9A 2V0GA 3R6KA 1XXLA 3QY0A 1P1BA 3PHHA 4K87A 5BV8A 1K9SA 1MJGA 1LNZA 1US8B 4UTPA 3MGCA 5T4EA 1DDGA 1HORA 5B53A 1K4MA 3I6ZA 3DEFA 3DD5A 3BY2A 1OA0A 1S2NA 1C9MA 2VTKA 3KDPA 4FUQA 1XTQA 4DY6A 2BR4A 2VFAA 3G79A 1BMTA 3EZFA 5AI8A 2BE7A 2FWAA 2VN8A 3F6YA 4JZKA 2N9UA 3Q3CA 2VTVA 4MP6A 5IG2A 3LQRA 4L50A 4MWSA 3VV2A 4OQEA 5TMBA 3VR5D 3ZHXA 5IJ9A 4F4IA 3H1EA 3LVRE 2H2IA 1AKYA 1KMNA 1UZUA 3GUYA 3HRKA 3G6EB 4HTFA 4LCJA 1QFSA 3KL9A 4P7FA 1QFZA 3WMXA 4AN4A 1X7DA 3GJYA 4GWKA 3ANMA 3UWOA 3ABOB 4NBRA 1K7XB 3QX3A 1ZA1A 3K9NA 1KF0A 3QEMB 4OQDA 2WWYA 4N5MA 1TEVA 3R5TA 3I2GA 2CUKA 4RUKA 2NW6A 5DX1A 2VVTA 2VBIA 4Y67A 3TW6A 4ER7A 4D7AA 2VTBB 2JJ2A 1TD9A 4CLOA 1V16B 4CT5A 1QVRA 4K8RB 4B3XA 4N12A 4HBZA 1NYRA 2D1RA 4C0AC 3QH4A 4NEQA 3JD4A 1SKQA 4GECA 4FWBA 1YZVA 2E49A 2G1UA 4LDJA 4WXEA 3DL7A 4KQJA 4E03A 2CVFA 3TXYA 4HGYA 3GVJA 3DC7A 1PR9A 2AFHA 3EGWA 3SM9A 5BMVB 2CYBA 3NUZA 3GVXA 1K3FA 1WL8A 3HUEA 3RLFA 1T9AA 4ZV9A 3ZWOA 1GYRA 3BE4A 3UK0A 3ODPA 5FYDA 4D6XA 2IL1A 3PC6A 5I48A 2QOEA 1ONNA 4IVNA 3SY8A 3VGPA 1N6OA 1OIWA 4WIAA 3HYRA 4WNYA 2HA5A 3O1JC 1W93A 2G4CA 5ERGB 5TS3A 1N7IA 2P6RA 4UAUA 3AVOA 2CLSA 3FSRA 4A8PA 2PS1A 3AIOA 2V5UA 4NICA 5GOTA 3T7IA 4TVSA 1O6CA 5HX7A 1NJFA 3BDAA 5C5IA 3IAS6 2ATCA 1U3GA 4JBIA 2JFGA 1WA5A 3LD9A 1UL1X 3NORA 4IJWA 4R3UC 1KJYA 5E6RA 1DUIA 1G1AA 4AUEA 1A9OA 2GLXA 4PG6A 2GVDC 4S2UA 4XX1A 1WS6A 4QBIA 4EGJA 2K4MA 5IVHA 3VDXA 3LLVA 1CJTC 1D2MA 3GIRA 4MVCA 1ZJJA 5A7GA 3ISXA 3IULA 3ZXIA 4I8IA 2J9FA 3S1LA 5FI0B 3AXTA 4MMZB 5EEHA 4AFNA 4JLKA 4HB4A 5L9AA 3T5AA 1ODIA 1DBIA 1PTJC 3V4OA 2ZIXB 5E6SA 2QLMA 4K81B 1MOSA 1WKBA 4DHWA 1ZCJA 4NCHA 5DBIA 4F2GA 2YDXA 4HQNA 1RWOA 3QA3E 4G5YA 2ZXUA 1PS8A 3JASB 4PRKA 4ARIA 4PNPA 5TNXA 1N8RD 4GKKB 1AH2A 4LISA 4NJMA 3WBBA 3K30A 5GMOA 5IAKA 5KUTA 4HNTA 2FQ1A 2FK8A 3L0IB 3D0QA 3U37A 4L02A 4PC3A 4BNDA 3PC8C 4HX5A 4TTVA 3RBXA 3TYXA 3CP2A 2CXNA 1KPIA 4CL3A 1SVOA 3ROTA 5DDIP 1Q1NA 2R7KA 4BKQA 2WB4A 2ZBFA 1O9HA 2G0TA 3C3DA 4UCFA 4I9FA 2ID4A 5E38A 1QIKA 1XTBA 4P83A 1IK4A 3GUHA 3IODA 4BFVA 3GLRA 5DCWA 2HK6A 5JFGA 1KEEA 3SD7A 2JH3A 4JC5A 4Y0AA 3A2MA 3EXFB 2JAWA 4WZBA 3ZE6A 1VHOA 3K8YA 3LXMA 2HQSA 5FV4A 3GL9A 2PRYA 4QO8A 2R8BA 3D3EA 1U0EA 3LECA 3W2TA 5D5QA 3Q9LA 1XX6A 5G41A 3AQ4A 2UXBB 2ZI3A 1Z8NA 1Y4SA 2HRZA 2ZJ0A 4Q3KA 4UULA 3TD6A 1VFPA 2GN9A 4AY5A 2XSZD 4DG5A 1SO8A 1U6JA 3GFRA 4S3MA 3GLHE 4QBHA 1TJ3A 5DBGA 4IJVA 5F12A 1SBZA 3H97A 4XEHA 1QJCA 2BCEA 1Z7GA 4M1TA 1VCIA 2VP0A 4LOLA 3SMQA 3HJTA 4FDAA 3GMDA 4AZVA 5HKKA 4DWOA 4DJEC 1H2BA 4V38A 3TEFA 4QGGA 2YWJA 3AG6A 3B9QA 3CWCA 5G1NA 3DL0A 4JSYA 3D8RA 1QP0A 5A7FA 1RYEA 3MA0A 5FFFA 2AHOA 1NUTA 4BCCA 1JX6A 2D1QA 2HEIA 1CQZA 2VH5R 2XXBA 4NBNA 2XUHA 3DE0X 2VHTA 8ADHA 4LCEA 3RKRA 3UUWA 2C7PA 4HWPA 4X1IA 3F73A 1M2OB 5CDUA 3AEUB 3B60A 3BORA 3LCMA 3KR1A 4MUYA 4EJSB 5KYYA 1D4OA 1U9CA 1CXZA 3KQHA 1SU6A 1GTL1 3HDVA 1IOVA 1C0KA 1KTIA 1P62B 2EEPA 3EPLA 3P71T 1BVUA 4EQ6B 1U4OA 2FPMA 5T4FA 4AN1A 4QVKA 3STHA 1EB8A 4K05A 3JV7A 3ND6A 1ZP6A 4MR8B 1QFMA 2RC6A 4U63A 1H2EA 2B37A 3CF4A 3HCAA 3QFFA 1OXXK 2G80A 3HO8A 2FK7A 4K3VA 3OY7A 3UW3A 1JKJA 2YJGA 3ABIA 4ENRA 2VSFA 1QQBA 5A5GA 4U0JA 1VL0A 3R3YA 5AJUA 3I52A 1J42A 3QNWA 4CFYA 5CIYA 1BDHA 2ZSEA 4TVBA 3USCS 3UJ8A 4B6QA 4IHJA 1E96A 3U3JA 3MBOA 4OHMA 4CMHA 2JFXA 2RMKA 2PZJA 4FD3A 4J1TC 3JTMA 4WZBE 4OI1A 3ROEA 1DEKA 4CHGA 1Z7WA 4OJNA 4LCBA 2VWPA 2V5VA 2FVGA 3BIXA 5EXTA 1NYLA 4F9GA 2CB0A 2QLTA 2PPVA 4A92A 1R10A 2DWQA 4DN6A 3O2SB 2P30A 1PRYA 1SPBS 1OPXA 1Z0DA 2XTZA 3GJ4A 2APJA 1J06A 2NTNA 4LWOA 4HWTA 2X58A 3G6WA 5FBKA 5F9FA 3LUBA 3ZHYA 4JYBA 2EFEB 1PEDA 3KSZO 4R8KA 4UD2A 3B1KA 4LECA 1HH4A 4KXNA 3DVAA 4ILKA 1JDBB 1A4XA 3HFJA 5TE9A 1X1EA 4Z3KA 1LCIA 2ZJ8A 2IC5A 5CA0F 4EZBA 1A2OA 3L9WA 5ALSA 3RIYA 1I10A 3U4IA 3TO5A 2I3BA 2ZJ2A 1ZDMA 2P9YA 2NPOA 2DFLA 3CSDA 3IVXA 3KWJA 4KMMA 5CB8A 2CF6A 4IINA 4WOKA 1E5DA 4DEXA 1EDDA 3KVRA 1ID8A 1DKRA 2E5FA 3ZCXA 5FXMA 4DIUA 4U6SA 2IVZA 3HKEA 1NFFA 2XMDA 5ECWA 3C2QA 4IDAA 4EWLA 1I4TD 1MQ9A 2B9EA 1E8DA 3CEHA 3IRVA 1ATIA 1KBOA 3EGEA 4R1MA 2JBWA 1TB4A 4F93B 2ZYSA 2N0SA 2PU7A 2H54A 2JGLA 2YN4A 3PFFA 3QLVC 3KSDO 3G5TA 1JEQA 2ZS9A 4YDHB 1L4EA 4EFNA 2MYPA 1C8LA 1G3QA 2ZVPX 4H1VA 1GNLA 2XH8A 4Q9NA 3RVBA 3K20A 4FHEA 4PAQA 3GFBA 4FQ8A 5DB4A 3D6HA 3STVA 4EG3A 2AYZA 3Q7IA 1ODSA 2YHIA 4D4MA 3O84A 2OWEA 4OQQA 4XDYA 3P2KA 5BWMA 1THTA 5LZ7A 2JLWA 4OBBA 1ECCA 1G60A 2JFQA 4M1WA 1C7EA 3S3TA 3TMKA 1ELOA 1C30B 3EPRA 5IDQA 2TECE 5IJWA 1XPOA 1WG8A 2NT3A 5MF6A 2GPWA 4PGMA 1EZZA 3IIKA 3SHOA 3OC0A 3R3JA 3B1YA 4RVHA 5ES4B 1PGJA 1XROA 3U13A 4E4TA 4ZARA 1RKQA 4MWZA 3GNTA 2C3OA 2NYUA 3UC9A 4AMGA 5ITVA 3QOFA 4Z53A 3BMCB 1WU7A 4Q6BA 3V8PA 1L5QA 2QP9X 2P3MA 1JMYA 2VPQA 2C7RA 2CEKA 2CDRA 2OR3A 2PS3A 3GHYA 4N3GA 2CYAA 2DR0A 4Q9JA 2IVFA 2BMEA 4X24A 1ODJA 1SCJA 1EFDN 1LF5A 2V7XA 4BAGA 4N9QA 1KP9A 1GTVA 2OXTA 7MDHA 4TX1A 1O94A 4RHEA 2EFCB 4D3YA 1F8UA 3EXG2 1N8NA 1P17A 1P4MA 2NAFA 2XYPA 3GNLA 3UG7A 2CL7X 2XPCA 3O8OA 1N4AA 2VK1A 4GW3A 3RABA 2I7TA 3L8GA 3IUSA 5EC8A 2J0VA 3DTNA 1ECBA 1Y4DE 4PRLA 5FUVA 5I9NA 4OMFG 3OEED 1QOZA 1N0WA 2HTEA 2QN7A 3D6TB 3L7CA 1KI9A 3FNFA 2P90A 3RIXA 4U02A 5IVKA 3HCPA 3GV0A 3VO8A 1OILA 4Z0NA 1TOAA 2XA1A 1TM1E 1EP3B 1KMQA 1PEYA 1Q3KA 2ZXFA 3COSA 4PHFA 5DNVA 3A1NA 1B8OA 2QJFA 3T7RA 1SVMA 3BRQA 2V65A 3R3SA 3JARB 3PNLA 1ENPA 1C9DB 1HE4A 1MO3A 3JYLA 3R0XA 2FN7A 4QX6A 4S1PA 3WQSB 4CWAA 4QLBA 2W2NA 3LKDA 1L1RA 2R751 3PCTA 3SC3A 3SR4A 4RMNA 5IAAA 4PZ0A 3LQYA 2R6CA 3HDQA 2IYPA 3KTDA 1GKKA 3L93A 1W9XA 3UCFA 1J2TA 3AZPA 5K3EA 3R6TA 5F3WB 3DMPA 3LUPA 2X5KO 1CJUC 3GH3A 5C8ZA 3TGLA 3VKGA 4PGAA 3WDMA 2D2IA 2Q1WA 5JVDA 4O59O 3RRNA 2Q4DA 3K2BA 4O08A 5LR6A 1CQXA 4P22A 2CSUA 1NF3A 2VEOA 1VA5A 2VNHA 3H86A 5EJGA 4QIHA 1FU4A 2IZ1A 4JWTA 5TMDA 1D0VA 3NP7A 3QU9A 1FZTA 1UP7A 4JKOA 4YTEA 4EGAA 1XCPA 3ZWNA 3WGLA 4C6SA 3QBDA 3PUZA 3D43A 3KZNA 1RBQA 2VRWA 4E88A 1UD8A 4QG7A 4ED9A 4XVRA 4XGIA 5L3SB 1OC4A 3ENVA 1GRVA 2KBFA 5HSGA 2FZKA 2PA3A 3KT8A 3OMLA 5JXJA 2WUWE 4KXVA 1RXEA 2GI4A 3A1UA 5EWMA 1O03A 3GFSA 3R7BA 5B2FA 2F00A 1UPBA 2ZAYA 4D4IA 3QFHA 4F60A 4UHFA 3NI2A 1NTRA 3L6OO 1B6SA 1ULUA 3C1UA 4W8GA 5F33A 5JYDA 1XK6A 1M73E 1JHDA 1FC0A 2EKPA 5L45A 3VBCA 1MG5A 2VHZA 1ANKA 4RVSA 1NLMA 4MW4A 1N0UA 1X74A 1D8TA 2X3YA 3L46A 3Q88A 3H65A 1LX7A 3QLUC 4X6LA 4PCVA 4F45A 1UP6A 4HCJA 1J6UA 4KXFB 4PZUA 4G81A 1A8HA 3BB1A 1G66A 4N41A 1NW6A 1S8AA 1OXMA 3ASYA 3IR7A 5E2AA 2VQFB 1OI7A 3E1GA 1PL8A 2DTEA 4RH0A 4Q9HA 4DA8A 2PUTA 4GR4A 3W6OA 3RF7A 4FKMA 1P6QA 2W2QA 3EUFA 4KQXA 2QE6A 4F4JA 1UBRS 1HDYA 3BTOA 3DLBA 4QRHA 4YNBA 3VBEA 1JI0A 4UNQA 5HYVA 2PBRA 3IC5A 4GPAA 4HC4A 2JDIA 4LJLA 5LA6B 1SBQA 1LJLA 1S3SA 2GESA 3RT7A 2ZUUA 1R2QA 2UV8A 4H59A 4DOMA 1KPHA 1U8AA 3TEMA 2IY7A 5F7ZA 4NMXB 4BQIA 4B4OA 1N5RA 1I6MA 1P0PA 1RYMA 3AB3A 5K4HA 1NDHA 1QBKC 1RCFA 2B9VA 4W1QA 3ZTTA 2UU9B 1CF4A 3P2MA 3D7LA 6CHYA 3LRPA 3IILA 4N3BA 3BWYA 4KRFA 3HKDB 4JNCA 5FPTA 3LY7A 3TL6A 3VNUA 1SC1A 2Y0EA 5LP6F 3RUCA 2MINB 1DG1G 1BD3A 1YDMA 3GP3A 2BMVA 2I6TA 3AEYA 3HEBA 3QI2A 4GVPA 4WK6A 4PS1A 3CC2B 3WLNA 4MUJA 1CRQA 1T43A 5LFAA 2WJ4A 3PD0A 5DISB 1NE2A 2OG2A 3VRHA 1SIBE 1FX1A 3G88A 1KZ1A 5DNEA 3PQ5A 4WLFA 2B7CA 1YS9A 3OT5A 4IJQA 5T3UA 3UMMA 1D6JA 4OLFA 1JT9A 1P3Y1 2IDMA 3LBYA 3HKCA 1DWPA 4Q37A 3COZA 4JLOA 4MW1A 2VBCA 3SHTA 4F9TA 4V0ME 4M9SA 4GP7A 1DRUA 2QR2A 4HNSA 1ZKMA 3FWYA 8MHTA 4IDQA 4BXOA 1VHEA 4QTUB 3GN2A 3AUJB 1T2NA 1TYDE 5LKAA 5DE3A 4CT0A 1XMVA 2G9RA 2WFMA 2NADA 1HO3A 3Q6NA 2HOQA 3WAJA 4X66B 2R4UA 2X19A 3E9DA 5EOVA 1J25A 1JDJA 1CQIB 4OFXA 1WWKA 4L85A 4W5WA 3MJVA 3T3HA 1ESMA 4NHEA 3OLYA 1VA4A 1X1TA 2FGJA 2Q3BA 3OEHA 3PUNA 2QMOA 1ZGJA 3PPIA 2ZR7A 4MQBA 3UCEA 4AUNA 2Q62A 2H4WA 2WJIA 4AAYA 4CLEA 3KJNA 1U2DC 4DCMA 2WJPA 2O8BB 2C2GA 4XQ9A 3TSAA 2NXCA 2QAIA 3GCWA 2ZM6B 2GCPA 2ZRFA 3OFSA 2DUUA 2GYVA 1KDVA 5IBRA 1E2EA 3AB8A 2O8EA 5TLSA 1XCJA 3PV0A 4RW0A 4TUYB 2DR3A 1HUQA 2I7DA 4XFDA 4M9XA 4D9NA 2XADA 2XVMA 3VR4D 2B0CA 3HV0A 3ZWWA 2OCYC 2RFLA 4IRMA 4TV9B 2OHGA 3JZMA 2G40A 1DKMA 1QRDA 1JR3A 2F3TA 1VCHA 4CKZA 4M76B 4C7OB 1F0YA 5EGNA 2PD4A 2UZ0A 2RJ3A 3MRTA 3O9VA 4L4XA 3WSWA 1UD3A 1HKHA 2BFPA 1B6RA 4OMDA 4G5SA 2OOKA 3WH