3MHPA

Fnr-recruitment to the thylakoid
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVYTNDAGEVVKGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase, leaf isozyme, chloroplastic
publication title Ferredoxin:NADPH oxidoreductase is recruited to thylakoids by binding to a polyproline type II helix in a pH-dependent manner.
pubmed doi rcsb
source organism Pisum sativum
total genus 96
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3mhpA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 3mhpA02
2X3UA 4TMVA 3W5UA 1BX0A 4F7DA 3WY9A 2PIAA 4ZCLA 2BSAA 1GAWA 4R71A 2OTJB 3WNDA 1ZM2A 4NCNA 1QVFB 2VNKA 1QFZA 2BV3A 4QFMA 5TR9A 3VO1A 3B8HA 3CCUB 1G7CA 3ZBTA 4PGOA 2QTZA 2YWFA 2AHOA 3W2FA 4B4DA 4ZV4A 3ZZUA 3CD6B 4G1VA 3PENA 1D2EA 2RC5A 1G7RA 2VYQA 2BM1A 1K9MD 2E1RA 4M4SA 1Q81D 3OW2B 4M0LA 3JQQA 4NBSA 1YJWB 4IW3B 2BM0A 4B48A 5H59A 2BF4A 1VQ5B 1R5OA 3QFCA 3WYAA 1N0VC 1JNYA 2VNHA 2PLFA 4RD0A 4FK8A 5GV8A 3AVXA 1DDGA 1QUEA 4DQKA 1ZM9A 4YAOA 1BJKA 2DETA 4MYUA 1YHQB 1W34A 1FNBA 4RD2A 1H42A 1XB2A 2HMAA 3LYUA 2BN4A 1B23P 4B43A 1CNFA 1VQOB 4TMXA 1QH0A 5HXBA 4P6VF 5JBQA 1H85A 1W87A 3U6BA 1KJZA 3AGPA 4QHYA 2D74A 3W5HA 2DY1A 4LBVA 3E1YE 1FNDA 1VQ4B 2QEXB 2QDXA 4Y9UA 3P26A 1EP1B 3QFTA 1KK3A 4RD4A 1ZM3A 2BGJA 2R6HA 4TMTA 3OZVA 4RJLA 2EIXA 3VNUA 2BVNA 1N0UA 3G6EB 4ZCMA 4ZGQB 1K73D 3W5VA 4ACBA 3CCLB 3MMPA 2OTLB 1EXMA 1JA1A 2VNJA 1E62A 4FN5A 4TMWA 2HDNB 1E63A 1R5NA 1OGIA 1QFYA 2B7BA 1EWYA 2GQFA 4LBWA 3CW2A 4EH1A 4M1KA 3QFRA 5TY0A 3B78A 1TVCA 4TMZA 3G4SB 3CMAB 1YI2B 1EP3B 1VQMB 3OZWA 4YAWA 1CQXA 2QN6A 1VQPB 3G71B 1OB2A 1XE1A 4YAFA 3P27A 1A8PA 1K8AD 1IJFA 2J7KA 2BGIA 2CRVA 3CCJB 3JQPA 5EMNA 4N3NA 3CCMB 3LVBA 1EFTA 1QVGB 1KQSB 1FRQA 2XEXA 3SJZA 4H9GA 2HCJB 4RCZA 2OK7A 4PC6A 4AF7A 4LC0A 1TUIA 4B47A 3VMFA 1Q86D 4YALA 1M90D 1NJID 4Q7JB 4Y7CA 4YHBA 3FJOA 3AGQA 4AF6A 1QGAA 3WBJA 1FDRA 3A1FA 3AVUA 1S0UA 4C0SA 4C43A 3U6KA 4MYTA 4B3XA 1FNMA 1QX4A 2YWGA 1G7SA 1YJNB 1CNEA 3FPKA 3ZZTA 1F20A 1TTTA 1OB5A 3ZC3A 1VQ8B 1GAQA 1GR1A 3QFSA 1NDHA 1N8RD 3CMEB 1IB0A 1Q82D 2DEUA 3I55B 1Q7YD 1ZM4A 1J9ZA 4PC3A 2ZITA 2B7CA 3LO8A 4RD3A 2PMDA 3CXCB 3CCEB 1VQKB 4HE5A 3CRZA 1SM4A 4M2LA 3V76A 2NPFA 3I1FA 1QG0A 3OJWA 3AVTA 3J81k 1I7PA 1DARA 3U2QA 4B44A 4HE6A 4LBZA 3VNVA 2QA4B 2FX3A 3QE2A 1KRHA 5TV2A 1EP2B 3MHPA 4BPRA 3B82A 2XNCA 4RCYA 4FWTA 1VQNB 3W2EA 1VQ7B 1D8TA 4ZCIA 3CCSB 3W2GA 4RD6A 2OK8A 3CCQB 4TN1A 1S72B 2YWHA 1TLLA 4YAUA 3ZBUA 2BPOA 1AIPA 1KTVA 3WBKA 1WDTA 3WXMA 1W35A 4PC7A 2CNDA 4DQLA 1D1NA 4Y9RA 1FRNA 1G7TA 5H5JA 5KSWB 1KC8D 3WNCA 2DCUA 4J0QA 1EFUA 1UMKA 1U2RA 4M53A 1YITB 4G1BA 1YIJB 1B2RA 4N3GA 5GV7A 1QGYA 4UAJA 3QSYA 2RC6A 3JQRA 1ELOA 1GVHA 1DDIA 1F60A 1E64A 3WNBA 4P3YA 1VQLB 1AMOA 3CPWB 4PC2A 1DG1G 2VNIA 1VQ9B 2YWEA 5DSZA 4WQMA 2XNJA 3CC7B 3VO2A 5FA6A 1KD1D 1GO2A 1QGZA 1KK2A 3CCRB 3LRXA 1W2BB 1BX1A 2BMWA 2VZLA 4G5GA 1IJEA 3W2IA 3AVWA 1HA3A 4PC1A 3MCAA 3OJXA 1GJRA 4K1XA 1FNCA 3CCVB 1R5BA 2QTLA 2C77A 1ZUNB 4ZGNB 3CC4B 1SKQA 2C78A 1EFCA 1JB9A 4U9UA 4AC9A 1JJ2B 2EFGA 5AN9A 3ES9A 1OGJA 3CB4A 2QMUA 4RD1A 1VQ6B 2DERA 1M1KD 3AVYA 3OZUA 1BQEA 1KK0A 1YJ9B 3AVVA 3I56B 4LBYA 2GPJA 1QUFA 3W2HA 1JA0A 2B5OA 4ACAA 3CC2B 1QFJA 1KK1A 3ZZ0A 3E20A 5THXA
chains in the Genus database with same CATH superfamily
1SQGA 4TMVA 4GO1A 4MP6A 3GZTB 1BLIA 3DDCA 3ZNOA 1L7VC 3R6LA 3O5AA 1GT91 2N1MA 1DUIA 1JDBB 1K63A 3DPIA 1SIBE 2ZZQA 4QDUA 1KVRA 4LWPA 2OBYA 4J0GA 2B2XA 3E0XA 3LFHA 4MDHA 2OTJB 3FHLA 4A92A 3MCZA 3PFKA 4OH1A 1P18A 5CLQA 4NCNA 1QVFB 3GCGA 5KEIA 2F55A 2QNIA 1ZXLA 1UAGA 2FSIA 3N28A 5J4LA 1T1JA 2I2BA 2RGNC 1ADFA 3HZHA 2P1RA 2ZJBA 5HDQA 5B7GA 2Z0MA 1W1IA 1G2QA 3R5XA 4Q03A 4KDRA 4XH9B 1LNQA 3LG2A 2XEDA 5AI4A 1VJ1A 2WSMA 4IO0A 1T1IA 1KQ3A 1WUHS 1P39A 3QMMA 1T0JB 1U2SA 4W7SA 5K20A 3W2FA 2P67A 3K71B 1RZVA 4CIAA 2OBMA 5IDVA 3AP3A 4V0NA 1VG8A 3CF4A 5CEJA 1YASA 2G5GX 1MOQA 1OXBB 2H31A 2O7VA 2NT4A 3BWVA 2IYXA 5C8XA 1NBWB 3E84A 3ANMA 1SXIA 1NQOA 4K0KB 3L1KA 1L8AA 4WN9A 2DFDA 1CUWA 2YWXA 2A92A 2TMDA 4CEJA 4BNMA 3LIIA 4ZDIA 3R6GA 1XPJA 3JPYA 4D3ZA 2VG8A 5A6VA 2FB9A 2UXDB 2YNMC 4M4SA 5IYRA 4PHGA 3CLRD 4WLUA 3PQ6A 3MD9A 4B80A 4YQFA 2DWUA 2ADMA 1E9CA 4MW5A 2J6IA 3X3HA 3FPLA 2C9ZA 3H5TA 3GRVA 4O4HB 4TV9F 3CF2A 5AM5A 3H97A 3O73A 4QAJA 3NW9A 5DHUA 2ST1A 3CKYA 3E2IA 3FWKA 3THSA 4YBZA 1F06A 1ZYUA 2V3WA 3QFCA 3EFBA 3IT1A 1WP4A 3MGCA 3BG5A 5CVVA 2YFYA 2PLFA 1WHSA 3OPOA 3OF2A 5IC6A 1WCXA 3TTYA 3CUEF 4HWSA 3WLSA 2CHFA 3BF7A 1DWUA 2IHYA 4RZ2A 5D86A 3PXCX 2VXOA 3C6YA 2XYVA 3PLNA 1PWYE 5DISB 1LXCA 4Z54A 3SHQA 1VYUA 2ZTMA 4BXOB 1OLXA 1QCDA 1W19A 1OX6A 1A9TA 1XCMA 2GN9A 3Q7IA 4GMFA 5FBWB 1ZEJA 1H8ED 1JIQA 1R4AA 5GJCA 5A05A 5FULA 2H54A 1QQAA 2R44A 1SVMA 2YY6A 2Y9PB 4Q9IA 3TUIC 3DO8A 2PMWB 3BF8A 4KVAA 1QVZA 4FHZA 4Q4LA 4PO8A 1SUAA 5NLLA 3RYIB 1FNBA 5I4CA 3ZS8A 1T2FA 5KWJA 2ZQZA 5LMNB 4FUQA 2C29D 5EP4A 1P1HA 1ZVKA 2Q3HA 2XVYA 2D5CA 3DAGA 1RWVA 4WFIA 1VXOA 5SZHB 2I34A 1Y4DE 2HT1A 3C3BA 3MRTA 1H0RA 3ZHSA 4DV1B 4AUEA 2O8EB 3K16A 4ZQIA 2WWHA 3V1UA 3IQGX 1VHEA 4GKAA 1Y6GA 3O8OA 1RLJA 3Q6RA 3ND8A 5JY1A 5I7FA 3V4LA 3TVTA 1T0PA 3VOBA 4FMDF 1G20E 2Q5IA 4K2AA 3TRDA 4CIYA 2PBZA 1DOZA 3VR5H 4BWYA 3E1YE 2PDAA 2WUEA 1V41E 1OYVA 2PZKA 2BRUC 1IEVA 4K46A 4XLCA 4NZNA 4C29A 2ZRHA 1PGPA 2BMVA 4NV0A 2EP5A 4BNVA 1UQRA 5J40A 2AR9A 1OZAA 4EY8A 1YC5A 1JJVA 4RVUA 2Q0SA 4C0BA 1EVJA 5CU7A 1DRWA 1MMFB 3ILHA 3QUTA 4L2IA 4QRIA 3SM3A 3WSTA 2K7FA 2C7RA 1OYWA 3W1VA 1ZQ1A 2R6HA 1A27A 3P0HA 4TMTA 1PLJA 2DSTA 4RSRA 4X7EA 1E61A 2L19A 1P5HA 5BV2P 3ZD7A 1T5TA 4FFRA 5H02A 3NWEA 3DAFA 3W79A 1GL6A 5EXXA 3G6EB 1QQ6A 3DZDA 4B6JA 1Y5LA 4XLFA 1NNSA 3NRJA 1HZZC 1DINA 2P41A 3MYYA 5DGXA 5JAOA 5FLEX 3ORRA 1SGWA 1IC6A 1X7DA 4L8LA 1XQXA 3MCWA 3GEIA 4RFSA 5ALOA 5EESA 5HCIA 1W44A 3HUFA 2P7IA 1ZI8A 1WVMA 4CCYA 3OWXA 4LXXA 1Q9SA 2AK3A 3RUAA 3SX0A 4IPTA 4P3KA 4RPJA 1R9GA 4RTMA 2FQWA 3K5HA 2P68A 1JECA 1UDAA 4YGXB 1FE8A 3ZPXA 3ZZNA 1EQ2A 1UL1X 4CMGA 3WQZA 4F3CA 4HNUA 2F48A 3V33A 4XM3A 4CEIB 4MARA 3S2GA 1IMOA 4DK0A 2HF2A 3IQZA 3D8UA 4H17A 1FQOA 4GF5A 3NAQA 4D3DA 4N7BA 4D82A 3SN6A 4KJXA 4Y2QA 4KXLA 2Y1WA 4A82A 5KUTA 2JG3A 4KYTA 4XR9A 1G9SA 4J76A 4KIWA 2HWYA 3OESA 3U44B 2PLNA 2BI4A 3K32A 5CDFE 1OYOA 1QKJA 4BO4A 3EXEA 1F2UB 3T5GA 1ISSA 4F38A 1XXHA 3WQRA 3VYRB 1LNSA 2FPRA 4PN7A 4GVLA 1NVKA 4RKEA 4INZA 1TQ4A 2JKZA 4MV1A 4KFSA 4NU6A 1YI2B 5EIWA 3ZI7A 2BBSA 5KDDA 1VL6A 4RM2A 4AUKA 1IFXA 4LE0A 1W47A 3Q6IA 4NBKA 3WYGA 1WY7A 1ZA1A 3W2TA 3H2BA 4P2GA 3U1BA 1CE8A 3SBXA 1XG5A 2HA6A 1YQGA 1J1ZA 2J0UA 3B53X 3GH3A 4JCOA 4KXUA 4FFDA 2Q2NA 4G2TA 4DCMA 1BRTA 4F6LA 5L51A 1HRKA 3UFBA 1CZNA 1EFRD 4YJGA 2ATIA 1JN0A 1W5EA 2A5DA 5HQJA 3HO6A 3LP6A 2VA8A 3VH4A 3JQCA 4BUJA 2CHUA 4M3NA 1RM5A 2D5LA 1Q7EA 1B14A 2ZIWB 3PC3A 1G21B 2IBSA 4GKBA 4CKYA 2XLBA 3CCJB 2A0XA 3QPWA 2Z1MA 1LWNA 4CLXA 1GIAA 1E3WA 2HN9A 1SBIA 1P7YA 3IIIA 4PSDA 4WBXC 1OJ7A 3HGTA 5LDGA 3NKLA 4L02A 3UQYS 3IQXA 1PT8A 2P30A 3IAXA 2VUUA 1FDWA 3C6BA 3ISTA 2I3AA 4I36A 3PQEA 4TRRA 3E9YA 3TQSA 3UJ3X 4CU2A 4WBNF 3M5DA 2RJ3A 2VSYA 3NUZA 1TQ8A 5JCOC 2COUA 2Q9CA 4EAQA 4IOJA 3WLRA 2AN3A 1TKCA 3EPHA 3A3GA 4H9GA 2Z4SA 4ND8A 4EMTA 4WASA 1LI4A 1ZEMA 4UUNA 4HHEA 3BEOA 3L0SA 4RNCA 5ALKA 1ZM7A 3KWLA 3OM9A 1VPEA 2XV1A 4YBRA 3UAWA 2JFXA 3GJXC 4MNTA 4IGIA 2ORYA 1YU9A 3OE5A 1LCIA 1TKBA 2LCIA 4LRYA 2H4ZA 3HZZA 3AJ8A 3IO5A 1Y1QA 2XOKD 4Y7CA 3QM1A 1DC8A 4U02A 2X0EA 2FEOA 1W4ZA 1YD7A 3TLBA 1SOAA 2G09A 1V6AA 4AY6A 3QENA 4WJZA 3T1NA 4BX0A 1JH9A 2DBRA 3B13B 4E33A 1DXOA 3CRVA 1DNPA 3I3OA 3HBNA 3AVUA 3O31A 3GLFB 4BWVA 3UMVA 2DULA 5HJ5A 2JIRA 3AUXA 4Z9FA 3SE7A 5B1SA 1E6CA 5LPNA 3SYRA 4PSAA 3EDYA 4ZEVA 1U5CA 4JDPA 1EFRA 3BNWA 4KWIA 1KU0A 2AWOA 1YCHA 3KU1A 2YWGA 1TM3E 3IA7A 5CVDA 1DO2A 2ZJ2A 2C84A 4D92A 4CZ2A 3DFUA 5K3OA 2CVZA 4M22A 2B7LA 2QTAA 4YAEA 1TTTA 5CT5A 4QOGA 5IVKA 2DUJA 1M5RA 3AFNA 4P33A 3OM8A 2J59A 5T8KA 3QEOA 4JJ8A 1HDCA 2ZBEA 2R48A 4P4GA 4WWHA 4J75A 1XPOA 2XHZA 1VZ3A 2QS9A 5A7HA 1U3TA 2AK2A 3UEOA 1NBHA 1P7PA 3OHMA 4AO8A 2G04A 5IT0A 2PXHA 4E1AA 2HBQA 3PC8C 3TS1A 1G66A 3B38A 1FYEA 4PX5A 4MRMA 4R4JA 1GPYA 2BHRA 5CGZA 3NBAA 1ADGA 2OBSA 3EEBA 4X92A 4B8WA 1GA4A 5AH0A 5JECA 1RPJA 3ZVRA 1FBNA 4WLVA 4CF7A 2OKCA 4KHZA 3EMDA 3DVSX 5ER6A 2BKEA 2FFHA 2IZ1A 2Q4OA 4JC8A 2RHDA 2GN4A 4M2LA 3V76A 2WLTA 4JYMA 4UNNA 5CURA 4BVGA 4DLRA 3P20A 4UQPA 1YZLA 4JB0A 2CL5A 1WO8A 3IVAA 4NQRA 3PUIA 4JI3B 3B7WA 2JBAB 5C3UA 2HZBA 2XKBA 2AR7A 1GQRA 5I7HA 2ZYUX 3VA7A 1XRSB 3IA2A 5I4BA 5E7MA 4U63A 5T3YA 2GTIA 3JVDA 2Q9AA 4HE6A 2J4CA 4UQLA 4D45A 3LDAA 5M7EA 5E1OA 3A1CA 4I4CA 3W77A 2HLDD 1VB5A 1WP9A 1C3LA 3N0WA 1OYYA 3OPYA 1XD2B 4O29A 2X8LA 4BIMA 2Z2YA 4EFMA 2HHJA 1RRKA 2ZFUA 3GFVA 2RG1A 3CEPB 5CNJA 3KALA 1WOMA 3MHPA 1C29B 1GSHA 1ZK2A 3A4YA 3IPCA 5CFQA 1FOEB 5A4AA 4Q7EA 3LQKA 4I99A 4OLFA 4HI0E 4YJ3F 1WB6A 5I8ZA 3TM5A 3DB1A 3AVOA 2B69A 4QPNA 1LSUA 1VQNB 2BEUA 3PVZA 1JDUA 4K6OA 1AHHA 2WOOA 2ORIA 5AP9A 5ECGC 3I61A 1UBUS 2LZ0A 2G1AA 3GVPA 1L3BA 2IVZA 2WC1A 1NLYA 3ASVA 4C6SA 1Z0FA 5ALTA 1ZSVA 1BVHA 1ZITA 5IM4F 4HDSB 3DMDA 4CQNA 1M6VA 1UBOS 4P7GA 5AW7A 1LRLA 3E1GA 5IVPA 4LZAA 2B1RA 4RGVA 4EI7A 1CY1A 3FCCA 4QRDA 5IZCC 4Y6PA 5F1KA 1QE5A 3KELA 1WSWA 1GU1A 1AQNA 1QKKA 2GLXA 3ZJUA 1GTG1 2VK1A 4LJ4A 1JR2A 1T8PA 5DCWA 3ACDA 1WDTA 3TEFA 4ZYYA 1H6DA 2GQ0A 3CXRA 1GDDA 3IVMA 4PU0A 4L16A 4MQLA 3TR0A 5IWCA 2B4RO 5HS4A 1FSSA 3KR0A 5U4QA 4BFZA 1Z6TA 3KWJA 4TUYB 3KEGA 5H5JA 3H8JA 3WNCA 2V4MA 1PEYA 1YZKA 1Z6XA 4DCUA 3CXUA 5TS2A 5IUKC 2X6XA 1P4MA 1B2RA 3QX9A 1ZN2A 3V34A 2HLDA 2O3TA 3DR5A 4ZAZA 5HP4A 2AN5A 1JE0A 1C41A 3K1AB 3JQRA 2GBGA 4QATA 3S4YA 4UXJA 2O2HA 3GJZA 3OWOA 5SZIA 1ZUD1 4NEQA 5K3AA 1GVHA 1EINA 4HN9A 3VRHA 3B2NA 2DJIA 4YQZA 5LZ5A 4YDRA 1MG5A 2HJSA 2XQKA 4P2NA 3EUFA 3N05A 2HF8A 4QT4A 3T54A 1P7ZA 3IAHA 5B1YA 4ZALA 4W5QA 3JY6A 1A9SA 4P5PA 1U3UA 1PZFA 4HNRA 4YDSA 2XODA 1AMOA 1I5RA 3WMEA 4HATA 3C3KA 3FOBA 5CXUA 2Z04A 4LXIA 3MCUA 4AJHA 3U7HB 5J63A 5JQWA 3TB6A 1UBTS 4OSEA 3ROKA 1Y1SA 2XGSA 4JLSA 3CC7B 2H1RA 2XXAA 4WAUA 3VO2A 2CDCA 3JWPA 4II3A 4EDHA 1KD1D 4Q15A 1JE1A 3DOIA 4N65A 4E3ZA 2QTFA 3LZ6A 2AKEA 1KYZA 5HF6A 2H18A 4B5KA 1PR3A 3FWZA 1P2FA 4QAQA 4OSPA 5AK6A 4WKGA 2P40A 1V4BA 2H1FA 4MV4A 1ZAYA 4DDKA 4B3FX 1KBOA 2DLDA 2FZWA 3M0EA 5E7IA 1IJEA 1XTPA 3Q1KA 3OZIA 4EA6A 3LX8A 2XQVA 3FYDA 3OCZA 4ME6A 1AQIA 4LNHA 1XT6A 4KFTA 3FUVA 4XMYA 3IR7A 421PA 4K1XA 4JQOA 3Q12A 2Z6BD 5DCLA 1VLQA 1WXEA 1NXQA 3C1UA 5GONB 2ORVA 5CLIA 1Y7HA 4KH0A 5FQNA 3WI7A 1Y82A 1MN6A 1UBGA 1ZONA 1BD3A 2OAEA 3OBIA 3W34A 5JXJA 1TQ2A 3KJHA 2J3KA 3U62A 2O5CA 3QPBA 4YECA 5H70A 4N0PA 3MOSA 5D5HA 1W4LA 1O6GA 3TCXB 4HZIA 4EG6A 1BAPA 2BFFA 2ZYGA 2Z3ZA 3D8HA 3KVNA 521PA 4E4YA 4JBHA 3VR0A 4CGZA 3ZDQA 1DBRA 4DSAA 3JATA 5KSOA 2DERA 2VDVE 3T56B 4YRTA 4LZLA 1TFUA 3SQXA 1X38A 3BE4A 1UEXC 4JQSA 4HGPA 5LB4A 4D81A 4TSFD 5KTNA 1M2OB 4WLNA 2LKDA 1TD9A 2Q2QA 3PWSA 2NTYC 5JWRA 1O6FA 5AKHA 3ZY5A 3GCDA 5DFAA 1JPVA 3D81A 2WOJA 3KK0A 1JEOA 3RTBA 4GOXA 4GYWA 2DPGA 1W4AA 3PGJA 4NAHA 1DMSA 1WU7A 4MW4A 5J5CA 4PGHA 2BFCA 2H57A 4M37A 5GM2A 1NKSA 5E6RB 3UN1A 5CD1A 2DHCA 1EG2A 1RRFA 3I9V1 4MIYA 3CC2B 1Z3IX 1EMDA 4MW6A 4P80A 1BXGB 1DO0A 3TLJA 5AM3A 2HK7A 2I78A 1GCOA 5ALZA 3QFHA 4P5DA 1OIVA 2FPPB 1UPXA 1BCSA 1L7NA 1M75A 1ZOOA 2ZIUB 4AZTA 3UHPA 3B5EA 3MAGA 4J7AA 3NT4A 1PWXA 1PX0A 2G9RA 3OKPA 1DRVA 3FR8A 3ZLUA 1ADYA 1JSCA 4N3BA 1V7ZA 1L5GB 2FN7A 1CQPA 5C53B 4M7OA 2PT5A 1KYXA 2YOFA 5DF1A 2DLNA 4MW1A 2O0KA 3A58B 4UFPA 1UBNA 3WWEA 3I9KA 2O3RA 1VTKA 2R1VB 4PNEA 2WD7A 4MGIR 2IEAA 3A7EA 2JD0A 4PX2A 1CZLA 3TTTA 4IO1A 1U8TA 4XGQA 4O08A 4AMYA 5T6BA 1RBYA 5BN5A 1QOZA 1CUVA 3R7BA 3R8CA 1TO1E 1LDMA 2XTJA 3QH4A 2O7NA 1YQXA 4NNOA 4CV3A 4D1YA 5JAUA 1P4AA 4G81A 2XZDA 3AQIA 1I3LA 1DRJA 3MSCA 4DQ0A 2XGOA 4MW9A 3S7TA 2JC3A 4C76A 3KCQA 4Q34A 2XDWA 1GZSA 4TLAA 1L5HA 1XMOB 3CD6B 4OXYA 2XTNA 3N8GA 1CR0A 1UK8A 3LQ2A 4C0LA 1G7RA 2O06A 3PFWO 4RELA 4V0SA 1VDZA 2N3ZA 4OQPA 3DV0A 1N2BA 2V9CA 1G64A 2XWPA 3HJHA 3PUZA 4YREA 3TQQA 4DRXB 4RV4A 4XPZA 1X1DA 4K40A 3HKBB 5ALPA 5EP2A 2ERXA 3HDVA 2V5VA 4LCJA 3T41A 4JYAB 3KHSA 3BWYA 3OIDA 3ONFA 5G4LA 5J2UB 4CF3A 4OMDA 4ZOLF 1YH3A 2W6JD 3T3OA 2OQ2A 4GPZA 4WESB 1BYUA 3CF4G 4WUTA 2YMMA 4DGQA 1A2OA 3LY5A 5E4JA 4KUHA 2OBTA 1O87A 3AY6A 4HAZA 4D6XA 2ZRAA 4TRMA 1O94C 2IXGA 2BGLA 1IAVA 3VOTA 1JU3A 3F6YA 3EIFA 3WBBA 5HVNA 1G18A 2BDUA 2D3LA 1JJBA 5I51A 4EPXA 2PLWA 3TVYA 1E3IA 4HEHA 4Q7LA 3D7KA 3OVMA 5JNVA 4ZQGA 2J87A 1Y8AA 1BJKA 1ZXBA 4NPAA 2DETA 2WIDA 4UCFA 4Y67A 5G0UA 4MYUA 3VDQA 1YHQB 1QWSA 4UHFA 3BH4A 1W34A 2OCLA 4B5LA 4ZYZA 3VSAA 3SS8A 2P8JA 4F3YA 1Q1AA 1XMSA 3PFGA 4JXJA 4V0RA 4KQXA 3L04A 5FBKA 2QP3A 1MVOA 2RAFA 3FOZA 1QO0D 3OA2A 3IAEA 4E6PA 3H2HA 2IYRA 3QF4B 5HA5A 2CXOA 3KU4A 1USIA 1MC1A 3VPAA 2OV8A 4Q1DA 3W3AH 4DG9A 5BNWA 5B53A 3OX4A 2C7PA 3RRXA 5F4MA 3GRPA 1U1DA 3UICA 1E3DA 2EP7A 1JAHA 3LXUX 4QE3A 4AQ7A 1BNCA 2ZQ5A 2W22A 3RLFA 2PUDA 2RHMA 2FZ5A 1Z45A 3CRMA 4Q7KA 4HQOA 3QELA 1KJIA 2JARA 4FKZA 4PPGA 1EM6A 5D6OA 1RKBA 4D9FA 5EP3A 3BGVA 1GZ5A 1SC6A 1Z36A 3CSDA 4ZO7A 2NM0A 3V8PA 2CNWD 4MINA 3A2LA 1PBTA 1QIFA 4C6RA 3IAAA 3A9VA 5C8DA 4FCWA 1D2CA 3LBHA 5ALLA 2W6OA 1CUSA 4IXDA 4A3SA 3CZ5A 3RGWS 2H9IA 3L77A 3U31A 1M8FA 1V6CA 4KQKA 1KI8A 4CIDA 1KY3A 1LVHA 1VLZA 2CUTA 3K8ZA 1CVIA 5IKMA 2B99A 1VLYA 4BGVA 3TGPA 4XNFA 1NU6A 1OH6A 1JIIA 1UJ6A 1JT2A 1RRMA 1T36A 2CJYA 2QQFA 4ZTBA 2BY4A 1AC5A 1M34E 4HN4B 4R54A 3O8QB 3PV0A 3FCXA 3SXUA 2OTLB 3C16C 621PA 3UGJA 1MXHA 3ZHZA 4HVLA 5JJKA 3L0YA 2E7ZA 3VPHA 3C3MA 3GZJA 4YT2A 1EUCB 4IUDS 1QO0A 3NBKA 4OAQA 4FNAA 1QR2A 1ZLXA 3TW6A 1TYDE 2PKYX 1K7CA 2RB4A 3FE2A 1E6MA 3BSFA 2VJDA 5DBFA 2HBYA 1NBAA 1P4JA 1OA1A 1VGVA 3DCJA 3HNPA 2B7BA 3WL4A 4RORA 1ODFA 4BKOA 2JCSA 2D6FA 1TM4E 4BS9A 1IQRA 3LHDA 1IUOA 1CQIA 3E3AA 2ZIXB 3K4QA 2NLOA 3WGYA 3DL0A 5K99A 1SQ6A 3M70A 4DBZA 1PJQA 2VTKA 4U3JB 2QG4A 1HUQA 4GD3Q 3KQKA 4FQ7A 1SHUX 2X5OA 4H77A 3L4SO 4NY1A 1QK5A 2ET6A 1IHOA 4GGOA 3ZHCA 4ZHQF 1KWKA 1IOVA 2ES4A 2QMHA 4HAIA 1Z17A 4RSGA 5B6PA 1GUAA 2CNWA 1AK1A 3LZCA 4IDAA 4LHVA 1RKXA 1RI2A 3GYGA 4I6JA 3WLMA 4BC0A 5K0JA 2HF7A 4IDDA 4QXRA 4DV0B 4DL9A 5I7WA 2DH6A 1SB8A 3FKSD 2J3HA 1PJ5A 4WKCA 1L7PA 4COKA 4QBHA 1Q74A 2IYZA 2XKJE 2XR1A 4JIMA 2GBLC 1KY2A 1PHPA 2A67A 1QAOA 2ICAA 2RK6A 2QI9F 4LYYA 4F9FA 1G6KA 1DEXA 4NOKA 4G2NA 1CRWG 3DD1A 1NF9A 2V8BA 5AVKA 3WKEA 2DPXA 3CX7A 1J90A 4RVDA 1U63A 2H1CA 5GGXA 3OUTA 1DDOA 4RWEA 4CM7A 4L4ZA 2OFFA 1HFWA 3WWYA 5B1DA 1FEZA 1EHCA 3NAGA 4KXYA 5KX5B 3ONDA 2CL6X 1T35A 3IJPA 1SA0B 5ECYA 4G41A 3ROTA 3QJ5A 4F46A 2M98A 5CEEA 1U28C 2PUCA 2JI6A 3LLSA 4WK0B 5GZ6A 4YV1A 2WZDA 4TYNA 1SQSA 2ILVA 2YHIA 1EZ1A 1L4YA 4ETIA 1JV2B 4QJ5A 3LCRA 4UTXA 3C7TA 3HKDB 3GDFA 4XJTA 3PCRB 1P74A 1ECCA 3HG7A 2GVNA 1J9EA 3I01A 5EJEA 4NFSA 5ITZB 3A1UA 2HD4A 3Q0TA 4GXTA 4D4JA 3UJDA 3R8XA 1DADA 1X9GA 5CB4A 2B82A 3AG6A 3GC6A 4DA6A 1O9HA 4Z7QB 5F3WB 1U0TA 2XCQA 1DKPA 1IULA 4ZCQA 1RI1A 3HGMA 2IIPA 3JQGA 3WLFA 4RTLA 1ZIOA 3FKSA 2FW0A 2Z8ZA 3HWRA 1P19A 2ZJ0A 3Q5EA 2YFHA 1WMBA 1BKDR 2LGJA 3AEUB 1PQPA 1PZMA 2E55A 1V95A 1GQYA 2G0TA 4I6EA 5E4YA 4DG8A 3P9KA 2X6YA 4NVRA 3D5QA 2EGGA 3ZLTA 2ID8A 1CK4A 3R0ZA 1WV0A 5DKFA 5ALVA 3RFFA 3RF6A 2I8LA 4RXUA 4PPFA 2VJIA 4PZ9A 3IQIX 3TDMA 1AXGA 1VHJA 4JOQA 3OY7A 4IQGA 3ZNQA 4EHJA 3FDFA 1D03A 4PCVA 1L5NA 4H3KB 3NTRA 2QVCA 3VSBA 4KQIA 2OBFA 1M76A 1N6KA 2WINI 3LF1A 1QPGA 4NESA 4PZZA 4QTZA 4CR7A 4EEXA 4F5EA 5LU8A 4C2UA 4MWDA 3SC6A 2VQDA 2ZUVA 3TINA 2R4QA 4NMHA 3PSAA 1HLDA 2VC2B 3D7RA 3QFSA 1DQYA 1QRAA 4QEDA 1FB5A 5FBQB 4IRMA 2HCBA 1LD3A 1NW9B 3HSKA 3BXEA 3HYRA 2A0WA 4NYJR 3O8LA 3WRYA 3QMWA 2FKNA 4ZICA 3KCNA 1EGAA 1Q14A 1RQRA 2Z8YM 4OXKA 4B71A 1JHVA 5HQTA 1UBCA 1D09A 1EXVA 2NU7A 2B7CA 3CXCB 5KVQA 2P4SA 2DHRA 3I58A 2OB1A 3RRNA 1LS6A 2CZQA 2VWPA 4WOJA 3K53A 4B2PA 4I1SA 3HEAA 1V48A 2VHCA 1P7VA 5KVAA 4D8VA 1ENYA 3GNTA 5LZ4A 4LXUA 5CA0A 2FPMA 3ZW7A 3NVKI 1N36B 2NP6A 3AVTA 4Y9SA 1K97A 3UJHA 3P45A 4U2DA 5FFMA 3LJKA 2I7CA 4RXTA 1G8HA 5E6TA 1M0SA 3LCMA 1Y6JA 4FE3A 1AGNA 3U7QB 2YZMA 4FLFA 4HNHA 4TTVA 1KQNA 6ABPA 2VH2A 3G2PA 4GRAA 4O4JA 5HS6A 5MDHA 3EC1A 3O92A 5TPZA 1OUMA 2GN1A 5JU6A 1YR1A 3GLGA 1XKXA 4GL4A 4J0FA 2YTZA 2V4ZA 3CX3A 1YR3A 4WBNA 1L4LA 2ZLBA 1QE0A 2YJ4A 1HLPA 4IIJB 1CHDA 2HMVA 2XNCA 1ZGGA 2LCFA 2Z3VA 4IVNA 5IKOA 2YV4A 5FWAA 1ZGCA 2PHZA 4YWHA 1X39A 1UD3A 5DEOA 1PR5A 4PYJA 6CHYA 5TT0A 1A4XA 4OQLA 5L40A 4N47A 4DCCA 4UE3S 3QYFA 3FZNA 3NIGB 4OJYA 4YJHB 3GQVA 4HQNA 1X14A 3ZTWA 1DAPA 1AGYA 1Z0AA 2C1EA 3FTCA 4MB0A 1H1TA 2G76A 2WHXA 3EPPA 4ZT5A 3PEVA 2WJIA 2GPNA 1U8UA 2YBDA 2IPMA 3C1AA 4OM8A 2EC5A 4DZZA 4BJ1A 3IQDB 4IYJA 3HLYA 2RDMA 4RPCA 1LTHR 2Q27A 2HEGA 2M1ZA 1EFKA 2W0SA 4EKNB 2PUVA 5JS6A 4RK1A 4KBFA 1LBQA 1URPA 1HE2A 1POWA 4PC7A 4IQ8A 5FD8A 3WGOA 1HEIA 1LDYA 3EEFA 3TOXA 1VZ2A 2XMSA 4JITA 3TMKA 1AK2A 1HDGO 1Y4ZA 4IHKA 2YUTA 5JJIA 2W4MA 4UZFA 4TV8F 1GTJ1 3RBZA 1U2RA 4RF3A 1YL6A 1KQPA 2CF6A 3IKTA 1QR6A 2NZUG 2Z09A 4E5YA 1NXXA 1G0NA 3DE5X 4R16A 1RRPA 2BR3A 4P53A 2RBEA 2VEOA 1NRJB 1TZBA 1DG3A 1E5QA 1GQQA 4FYVA 1VLOA 1BHQ1 1DX9A 4C3VA 5IWAB 3K5PA 5HEKA 1P17A 4FZ5A 4QQNA 4BNXA 1BVRA 1QS0A 2DQKA 3KEFA 4W63A 4BMCA 2E21A 4L50A 1D6SA 5KOJA 1R0CA 3FTFA 2X19A 2H5EA 3T9EA 2FF7A 1K6XA 5H1YA 4TZ0A 3VVCA 3Q72A 1NY5A 4L78A 3SBDA 3Q39A 4RTSA 4GI2A 2QGFA 3WYEA 2H6EA 2RIPA 1ADBA 1DV1A 5CCEA 2O48X 4E03A 1EIWA 3GQBA 1FJ2A 1G8YA 2YXPX 4K26A 3F8TA 3B70A 3KYCB 4BQOA 2EWMA 1C9JA 2VCYA 4WWVA 3FOCA 3GNQA 1I4OA 4WCFC 3ZQKA 2Q0XA 4TKVB 3IDZA 2GWHA 2GREA 1XNGA 2C96A 5D5QA 4COOA 5F2KA 3S2FA 4MICA 1YRHA 4JB3A 3RR2A 2OORA 1WCWA 4DLYA 2ZGVA 4M9ZA 5FHRA 4EVQA 3QLUC 3STYA 3BHJA 3F67A 4QXMA 3EGDA 5JATA 5IUJC 3OQPA 3L2OB 4QYIA 5DGIA 5TJ9A 2IFTA 2ZI4A 1T1EA 2BOVA 3RSZA 3MCAA 1YSCA 3UK7A 3AKZA 2Q7OE 1SJ9A 1KDZA 1JFSA 4JN6B 3LTEA 1SFRA 3LQYA 1JQKA 4LVCA 3IOBA 3ZKAA 3AW8A 1AT1A 4G01B 1QTRA 4Z4ZA 3EOBI 3NVAA 5EIBD 2WI8A 2H2WA 2W8BA 3BWDD 3CSUA 1CERA 1XP8A 2O7RA 5L3VA 1JWLA 5IVHA 1DCFA 3A3YA 3PEUA 5CB6A 5KNCH 2I3GA 1RE1A 4KQ6A 1JHDA 2XB9A 2MWMA 5DE3A 1K6JA 1IJKA 1UOEA 2AZ4A 4YO8A 4NJEA 3OE7D 1NJGA 5A3RA 4P0PB 1C7FA 2PM8A 4X7DA 3A31A 4G56A 4XQEA 4AC9A 3S1AB 5FFFA 2IS2A 3GOQA 6NULA 2C20A 1KEZA 3CO0S 4MTLA 2R11A 1GUYA 4YS6A 2O8BA 1ODKA 3EUAA 2OE2A 4TSRA 1OLSA 5EC8A 3ETJA 4PN3A 2BISA 4L0QA 5IX8A 3BXFA 2GHIA 4ZXPA 1TIKA 3UA4A 3BMNA 1VG1A 1OZGA 2A5YB 2PL1A 3TYXA 1PGJA 5KYXB 4Q1EA 4OX9Y 4GWKA 3UVEA 3WJ2A 3S55A 4OMUA 3IP5A 1YI1A 3NIDB 2ASEA 2O4UX 1CUYA 2HA5A 3QTTA 4FSHA 1YS2X 1C0KA 1MLDA 2HMTA 3EQ7A 4BJ6A 2Q5HA 5FO1A 3L7MA 4TXLA 4J03A 1I4WA 2RIRA 3KQWA 2SNIE 2KYRA 4I2NA 4KQEA 4L07A 3OZTA 1L5QA 4Q9HA 3ZDYB 4CTMA 1R8YA 4L4SA 2XQFA 1TRHA 1NVFA 1Y5IA 1FU8A 3SC2B 2QMQA 4WZAE 2AZTA 5CLJA 1KOGA 2ZCJA 4YMSA 3FMPB 2HLNA 1XZLA 3QXCA 4MGEA 4RK0A 5HRCA 3GGOA 3OJ0A 2VO1A 3UT5A 3GFFA 5B36A 3O3OB 1SY7A 3BEDA 3GMIA 4IKEA 3AUUA 1QZTA 4GFDA 2HYIC 4WY5A 1SD2A 4MMZB 5A4KA 3R44A 4LXGA 2OZPA 3A8IA 3HB7A 4ANFA 1RJ9A 4EJSC 4L9WA 2IP4A 5CNMA 5A06A 2FQYA 3GO4A 3WGMA 4KP7A 3W5CA 2NU9B 5AW2A 1QONA 3JAKA 4UEWA 5EJ4A 1IZYA 4XDZA 1ZM2A 4FILA 3UBMA 1QRUA 5WRFA 4N3CA 1X9IA 3T5DA 5TF4A 4AULA 2BMEA 2WNHA 3U37A 3V1KA 4AX4A 4BQFA 1BS9A 1J7KA 1SKBA 2VJOA 4ZP1A 5JDIA 1NJ1A 2C9OA 1QVAA 2TECE 1G1AA 3VO1A 1HETA 3ETGA 2A1UB 2DTEA 3CCUB 5HGJA 3NJ8A 5IC5A 3VR6H 1ZH8A 3W4KA 3WO1A 2C5LA 2AOUA 2O6HA 4ISBA 2QBYB 3A3NA 4WNCA 4UTPA 3GJQA 1ZAKA 4M9SA 4DV4B 2I1QA 3BCDA 1HL7A 3GVXA 2AN1A 1QKIA 2B1JA 3RBXA 1KQFA 1F17A 4MO2A 4EI2A 4V24A 1F8XA 3LHIA 4RTPA 4IP0A 2WIAA 1CVLA 3CZCA 4MV0A 1JG4A 4DLKA 1IOWA 3PF8A 2X9LA 2GBIA 5CT8A 1XTUA 5AIAA 4CTKA 2DZDA 1N4DA 2IGTA 3DDZX 1ZJZA 4X3CA 3VHXA 4UVEA 1R9MA 2A9OA 1NBMD 4P8RA 3CN7A 1EZ4A 2V6MA 3N2LA 1KP3A 2ZXEA 3OZSA 1ND6A 1XD9A 1JEQB 2YJNA 4R1TA 3RIMA 3T5AA 3W9UA 821PA 3OW2B 3DEIA 4E6EA 3FHCB 2FZGA 1U31A 4JOSA 4M55A 3OJFA 2IA5A 3CUWA 1RWNA 5HRAA 2XY4A 5CBPA 5AJWA 1EUDB 1OWMA 1VI6A 2X22A 2X2EA 1XEWX 4UD2A 2HADA 4P6YA 3KZ1E 2FKAA 1I6MA 1MF7A 2FI1A 2WNIA 4LHYA 4CDGA 5HOQA 3AIOA 3CUUA 4PANA 3TNJA 1IH8A 1P1KA 1N0VC 2XUDA 3TLMA 1XZMA 3ZG6A 4B3JA 1B3BA 1H2AS 1RXUA 3BXHA 4Y1EA 1T3SA 1E58A 4XSHA 2PMEA 3G9UA 2P3LA 1AU9A 1IRXA 1GZ3A 3UJCA 1JU9A 4GGPA 1EUYA 2UU9B 4E5VA 1JXQA 1Q21A 4YUYA 3RSHA 4I9HA 2WWIA 1FLDA 3ZVKA 2GD2A 2ZUCA 1UJ2A 3KYJB 3F7TA 4RVNA 5BO5A 2CMFA 3DWFA 4NZYA 3P9XA 2Y0CA 4KV7A 3EIOA 1RQNA 1M54A 2A30A 3BMCA 3OG9A 4C78A 4PYNA 3OLYA 5E2AA 2A5LA 5FBRB 1UEIA 4FYXA 3DOJA 3I6ZA 4NV1A 3N7AA 1HLFA 3FMOB 2YJZA 4Y9TA 4A6XA 2LRHA 1THZA 1GL9B 2VJMB 4W8GA 3NEYA 4WCFB 1QH0A 3GP8A 4I4TA 1NBMA 1VRCA 2LBPA 4IF4A 2XHEA 3G49A 3JQ9C 2PS0A 4FR5A 4PGFA 3ZTTA 4JAVC 4DXDA 4LQLA 9LDTA 4Y98A 1T6NA 5JDCA 5DXAA 4E14A 3G7NA 4B7XA 2C7OA 4UHJA 3E3OA 3AB7A 2XVAA 2GOYA 1Y8CA 2O1XA 2QD1A 2ZZKA 4BNDA 3TTUA 1TAGA 4IFTA 4YJ2A 4CR6A 1M8JA 2DUMA 3C8DA 5CXQA 2XF2A 4HAVA 1JHYA 3DCNA 3G59A 4KIFA 4C0XA 1GKYA 2D8MA 4EVSA 2W2NA 5EJIA 4BBPA 3F3MA 2FEMA 3T5TA 1NQVA 2F43B 4MUFA 3U13A 5GWXA 4YWJA 2Q3CA 3IUSA 4ENVA 2RHWA 2GZRA 5FPYA 3KKNA 2I3BA 1XRPA 4HDRA 2JEYA 3DL2A 2O8FB 5AKLA 2B36A 2BGJA 1IOZA 1N2JA 2V9PA 2Z98A 3KYBA 3PYLA 2WAOA 3E9EA 3QUBA 1NASA 4QELA 5E9WA 4BNLA 5KINB 2D3WA 3W7VA 5EKXA 1HDIA 5ADUS 4TYWA 1YQDA 2XTMA 3QBJA 4REQB 3I30X 1DXYA 1BDHA 1M1UA 4ZCMA 2RFLA 3ML1A 3P4YA 5EWJA 3AM3A 3D3EA 5AW6A 5J4HA 4MIKA 1CZKA 1FYVA 3BD7A 2XI4A 1CDEA 3NPMA 4RF5A 3CCLB 3NQ41 2FWRA 1KEEB 4NECA 3R9IA 3R8FA 5AJXA 3CSSA 4FFOA 5CYFA 2IP2A 3UC9A 3PFHA 2EWWA 1VE3A 2F64A 1MQAA 4YELA 1DKOA 5AW8A 1WSBA 3OPNA 1EVEA 5I47A 1V5FA 2VF8A 4GBJA 4OKIA 1SOVA 2XNDD 3K15A 3DWGA 4GDMA 4WFJA 3VI4B 1N2CE 2WPDD 2ZVDA 5IDXA 2WYIA 4IIUA 2PD3A 4IWNA 3ZEIA 1EK5A 4BBJA 4OFZA 3M1YA 1CNMA 1N7HA 2GFHA 2OHXA 2NIPA 4A15A 4J91A 3EQ8A 1V5WA 3LYLA 2VF2A 4QRHA 1BQ4A 3K6KA 1Z5NA 1T5OA 1X8XA 2ODTX 4IHQA 1PYGA 3GGSA 1MV5A 2UUPA 4CL0A 4DSTA 4G1FA 1NN5A 5TY0A 4XW2A 4XDGA 5KNBH 1Z5GA 1IG0A 4WFQA 5GZ1A 4MJXA 3F6CA 4E2XA 1IQ0A 2VWHA 3UGKA 2BEJA 4ZFNA 2HK9A 1UJNA 4EJSB 2X40A 4KQCA 2PCLA 1T9GS 4B6EA 4XA8A 2OB2A 1USWA 2Y1KA 1IXZA 1DTEA 1U0LA 3ITKA 4JR1A 4MV7A 4XCQA 4DCTA 1PQWA 2CW5A 1JQJC 2DP4E 4IOKA 1P9RA 1D1QA 1Z2OX 2IHUA 3KJNA 3PHJA 1KZHA 2EOAA 4BATA 3ZLJA 2BHTA 2WK1A 2X6TA 3OHPA 2CFIA 2BSXA 1RQLA 4HGOA 1B8UA 1KI6A 1XE1A 1N2XA 2CB9A 3NASA 5G1OA 5C32A 3OE1A 3WRYC 2J9RA 3DYIA 4G86A 5ERGB 1EK1A 2GNPA 4MKRA 2NSJA 3Q6QA 3GFQA 4I2VA 4S1VA 2FPWA 2P5UA 5E1DA 1GXSA 4NTZA 3S28A 3DKPA 4OP2A 2H2GA 4KITB 4RKRA 1JKIA 3A36A 3WXBA 4O0MA 1T6XA 1VHOA 4HB0A 1K27A 4NOMA 5J4YA 4N3NA 5IAAA 1JSXA 3OA0A 1CDDA 3MN1A 3BWXA 3KL4A 2Z1NA 2WPDA 1R4NA 3DD5A 5I48A 3CW8X 2D2FA 1FRQA 1QYDA 2PRJA 1ZU5A 4MI9A 1C2TA 3SJZA 3NP7A 3D7NA 2HXYA 3ZU4A 4GM4A 3TIIA 1M74A 3MT8A 4XAQA 1CUXA 4HZUB 2W6NA 3NIWA 5D1NA 1M73E 4HXFB 3PGMA 4QPPA 4G0WA 3VTZA 2PKXA 2PE3A 4ERXA 1XZDA 1OBHA 1Y1KE 2FZKA 2NPOA 3LUAA 1EM8A 4BMYA 3IDOA 3ZU2A 4Z6KA 2W2QA 3K70D 1XX6A 3AGQA 4N6NA 3L7BA 3WGIA 2ZJ4A 2RKOA 1XKTA 1LV8A 1H0SA 3D4IA 3W05A 2YOHA 2B9VA 1G42A 2DU8A 3HVJA 1YZHA 1H65A 1NE2A 1E0SA 1XU9A 2AFVA 4E5NA 3GIRA 3JYNA 4JP5A 2FMHA 3OPXA 1PS0A 3QPUA 3OC6A 4YVFA 1Z26A 4Y0AA 2XGJA 3H6GA 5KYYB 2YWJA 4C07A 4DJDC 3ZZTA 4GMHA 4XIYA 1F20A 3KJFA 1HYBA 4HV4A 2VBVA 5ESXA 3HVUA 1NUAA 4D99A 2OYSA 1FMFA 1I1NA 4RMIA 1ND5A 1PNRA 2O3JA 3CS3A 4PAAA 2D2EA 1JEYB 4WXEA 1T5EA 5EJ5A 2AMYA 3L05A 4ND4A 5EINA 1E3MA 5KYUA 1X8JA 4ZT6A 2KX7A 2ZJ8A 4F84A 1V1MB 1J9ZA 5JS2A 3PUNA 1L4KA 1N3YA 3OQIA 1EJ2A 3QVVA 4P98A 4EK9A 3C39A 2QRVB 2YFKA 3L6OO 1JL3A 2NZXA 4FC6A 5F1OA 1HY3A 4RD3A 4KSCA 1VSQA 1TI7A 1SO8A 1Z5VA 1EPUA 1R0RE 4UE6A 5I7OA 1GQSA 4GMKA 3Q3VA 3QJYA 2H1LA 3VU8A 3C85A 4P38A 3M3PA 1U11A 3A8JA 1T2VA 1XRLA 1YUMA 2C3UA 2PX8A 3IJRA 3VH2A 2WRZA 5IH3A 5IJZA 3C7CB 1DCMA 1KAGA 2X0KA 2AD1A 2YDYA 3IURA 2O59A 2VSXA 4GPAA 1WW8A 4K9MA 4MA0A 4KYIB 4K9QA 2UYGA 1NBEA 1IMJA 1ZK1A 4MRNA 4BX8A 1I4LD 3SZLA 1U6JA 4B44A 2RGBA 2VT6A 2BH9A 2H1WA 3I9NA 1H4VB 2VJNA 3VZBA 4ZQEA 2MYTA 4DEYA 5ADVA 5B3JC 1U99A 5EJFA 1YS7A 4YQEA 5CA1B 3RRYA 2P3SA 2PVSA 3U1VA 4K81B 1KRHA 2VDWA 1UKZA 2HJGA 2XDAA 1V8OA 5HUJA 3WGJA 4Q1CA 5IJWA 4K9OA 1NVMB 1G19A 2GLTA 3EVAA 2J3JA 1PJSA 4IV8A 2OORC 3MAAC 4LG1A 5ENVA 3T6KA 3VYTB 2UVPB 3LV8A 1QANA 2CDBA 2QTMA 2QTBA 3T7IA 4QGFA 4RZXA 5TXGA 1UMDB 3N86A 4LSMA 1E2FA 3V00A 1CG6A 2ZI9A 5KJ1A 1E66A 4AO6A 1DIGA 1NHGA 1Z4QA 4AN1A 4D4LA 3R5SA 1YJ8A 4XM1A 4TN1A 3DDOA 4O1HA 4MCIA 5LWQA 5L3ZA 4OHCA 2DUUA 1GKLA 2C4WA 3CC8A 4OA5A 5CAEA 5DRYA 2SCUA 4CKWA 2DGDA 4QNMA 5FUMA 1JRLA 5JSZA 2HW8A 4QFBA 4YAUA 3ASPA 1ZR2A 2P6MA 1JYFA 4R1QA 2VTBB 1V8ZA 1CRQA 3RU7A 3P0FA 4Z9YA 3L06A 4RHEA 2GAIA 4R8VA 2Z9DA 3FLAA 5DHSA 3TMYA 1GNSA 4RMGA 1ZISA 3FPBA 5EKSA 1BCRA 2J31A 1TAUA 3AL3A 5CH3A 2B37A 4ZIRB 3OLZA 2G83A 1MEEA 2C98A 3M9WA 4KI7A 1HORA 1PK9A 2VP5A 3TNFA 2MINA 1QSGA 1KEWA 1HZJA 5FJIA 4IZIA 2APJA 1KC8D 4DZTA 1GZDA 3KR1A 1IWOA 4JC0A 1EWTA 3JZIA 1FFGA 4TLDA 2RAUA 1XYGA 1G3MA 2YYYA 2VK2A 1CSEE 3OE4A 3SM9A 4AJ9A 5K05A 2ZZEA 3P9YA 4GYYA 1WOYA 3CYFA 3QSYA 3MWEB 4J0DA 3R0XA 4BJHB 4U8GA 4NPHA 1QNFA 5LUAA 2EWVA 3FFTA 3QKTA 2BGTA 4NFLA 1R2QA 3QW2A 5TC4A 3WB0A 2C3OA 3ZWNA 1CEEA 1M2VB 3A3PA 3VR4A 2EDAA 1BU8A 5HKKA 4X1IA 1KVUA 4C06A 3G2MA 1U98A 4RLHA 4WGFA 1BDIA 1NWHA 2GZ2A 2KI5A 2PCJA 1UFKA 4NZOA 1EEXB 2ZJ3A 4BMOB 3H0EA 1K6EA 2JCVA 2CVQA 3HMQA 2PRKA 4FJ0A 3VDMA 2H0AA 2L69A 3FGZA 4UNQA 1PK8A 3CPJB 4O2AA 1HSZA 1C3EA 4EF6A 2D06A 1UXKA 4DEVA 2QN1A 2VPZA 4LKOA 4UMFA 4P26A 4FFVA 1GA1A 4PGMA 3LC0A 4L4XA 4W7HA 2J30A 5CXXA 1Z8HA 1P75A 4EI9A 1SPXA 2EZ8A 3ANYB 5CVJA 3RW9A 2AVDA 2V55B 3ELUA 1OVMA 3N3BC 3ITEA 4A9AA 5FWXB 4TWBA 4RTRA 2LIPA 1HA3A 5CFZA 3FNFA 5JLAA 2JGFA 3BRWA 4KOEC 5AVUA 3E2PA 3N0TA 5JDIC 2Q4BA 2YW9A 4MUEA 3IOCA 3AF5A 2ILTA 3IVRA 4ILEA 2VDKB 4WLOA 3HABA 3IUJA 3R0IA 1ZGJA 3NTUA 1E5LA 1KAMA 2WVHA 1X7GA 2ZRKA 5LOVA 5K2MA 3OQMA 1JBEA 2NACA 3B2QA 3TLZA 4ZGNB 1CZOA 3FF4A 4W1SA 1CF4A 1FQJA 2Q0QA 3UCXA 4MVJD 1FRZA 3MFQA 4JMQA 4BNFA 1P5FA 4BE9A 2VDOB 4GLFA 3HA5A 3BTSA 1G8PA 5JPIA 3E22A 2Y99A 3EASA 2VDRB 5F2NA 1IHXA 4B32A 1VCHA 4MPTA 2ZYRA 3NYRA 1WDMA 1CUAA 1BWRA 1PTJA 4RPKA 2C0QA 4AG6A 3FIJA 3QYJA 5LLTA 2HAEA 2I3DA 4G8DA 2EKBA 3KLMX 2WJPA 4ALKA 3NC1C 4BO6A 4YJKA 4B6PA 1BU5A 1H5QA 3ZWCA 4ARZA 4CMKA 1UZLA 2C4MA 2WQZA 2R85A 4PSKA 2R7AA 4ON9A 4X45A 2CXSA 2KM1A 3LUGA 5I7SA 1Q16A 3AVVA 2OCXA 3BH6A 3HQ4O 3ND5A 5L7WA 4EHHA 5PGMA 3SSOA 1WTAA 5FEUA 2WICA 1K5GA 1VBKA 2DAPA 3I05A 5DI9A 5FLKA 3RS3A 1KFBB 4H60A 4QGAA 3ZOZA 4A03A 3H4TA 2F1JA 3VOSA 2FZEA 4B1FA 5HQ3A 5IEJA 4L7QA 1N9ZA 2RHRA 1CB0A 1DAHA 3KS9A 4HMQA 4IX1A 4URZR 5CLLA 3A26A 4JBXA 5LBTA 1YNOA 2XMCA 3SQOA 4D98A 3VISA 1E6UA 4CFZA 2NNLD 3W04A 4DNXA 3M2PA 4QLBA 1BGWA 2X3UA 1YZVA 3BRCA 3P9RA 3KTAB 2I66A 4C7BA 2DM6A 3F49S 1SVUA 4F7DA 3QTBA 3LT2A 4FXUA 4ZVMA 1ABBA 4WZZA 2ZJ7A 4WRRA 4O4IB 1Q0QA 4AG5A 2C2YA 2XH8A 4ZC8A 4IOLA 1H93A 4JOBA 4MVJA 4H0NA 2NUAB 1T9AA 1QC5A 4RS4A 2XBUA 1KC3A 2X13A 1ZH6A 1VJDA 4RH3A 1GCIA 2IZ6A 5KKAA 3PK0A 3OZBA 5EPOA 2CYAA 3BWMA 3BL6A 4G4SO 3LI2A 2RHLA 2VJKA 4GOND 4RANA 3V7AA 2R25B 3SE0A 4PGOA 4BEBA 4HWKA 2GJRA 2ZTVA 5KVVA 3GK3A 3FWNA 4N7JA 3JARA 4JNCA 2QVZX 2ZUSA 4JLWA 2W11A 4MYRA 3OH8A 4NYIR 2VSOA 1JKMA 2PD4A 3PRKE 3V2UA 1W581 4BLSA 4U7TB 1SG0A 5CLGA 3K9BA 4QD3A 5ESWA 4YCDA 2HSJA 5E1MA 2VYQA 1NURA 1O89A 2ZEJA 3JQAB 4X41A 4F60A 1YIDA 1XQ1A 2QXUA 4V0ME 4KZKA 3I32A 3I83A 4OHOA 1GTVA 3OEYA 2PIDA 2ESRA 3VDNB 4AS2A 5FAXA 2ZSIA 4DDHA 1E5XA 4CHTA 1II0A 2F62A 3KOZA 1XRJA 3WQHA 4Y0VA 1SXGA 4R1LA 3EX7C 3WWCA 3L8FA 1IY2A 3DOOA 3K9WA 5KTMA 5AVQA 3HU1A 5DYTA 2ECQA 2DY0A 2AUMA 3K4PA 3MYRA 2VJCA 4BRZA 3LVFO 2CB0A 4EJMA 3O7WA 4ZZ2A 2KE5A 1R6TA 4IJ5A 2FWNA 2C03A 4WLFA 3RARA 1S8NA 3QLVA 4RVOA 5BQXA 1E3EA 3OJOA 1RPZA 2QY6A 4TN5A 1IN8A 3M33A 3K5IA 5ALGA 2I4TA 3ZXXA 4MEBA 5CX1B 3EC2A 4P92A 5CFRA 2Q1TA 3L5KA 4CM6A 3KEQA 2QZZA 4V1CB 4EUHA 2DBQA 4Z99A 5JD6A 4XRRA 4AWBA 3EMVA 5JRJA 3FDZB 2DX7A 4WY8A 2AJ8A 4O8ZA 1QHYA 4M1QA 2BEKA 3U4QB 3HYTA 3GJ0A 2IHVA 3D59A 4OXIA 2EKQA 1CY6A 4ZO4A 2V9ZA 2VUSA 3NDBB 1RT9A 3WLTA 4QPCA 2G82A 1F8YA 2GCOA 2EW8A 2UYOA 3K7EA 2Q0HA 4O4LB 2CDNA 3DB2A 2JH9A 3HCAA 1CJTC 3R3VA 4UTNA 3KFXA 4NMWA 2BBOA 2XMGA 4BV2A 1OXUA 5HIMA 4LA4A 2JJYA 1YFJA 1YVUA 5JD4A 2J6CA 2H07A 4Z4IA 2B6HA 2AFHA 3RFUA 1KJZA 3EUWA 3PITA 3TF5A 2GSWA 3F78A 1XVVA 4ARUA 4KGDA 2DHQA 3V7NA 1ZIDA 4FEGA 1DBQA 3WLIA 3M81A 3ZWBA 4DPMA 5IFKA 3DVLA 2DIEA 3EZNA 3JRXA 5IJ9B 2LD4A 1X6VA 4EO7A 4B7UA 1GGJA 1ULTA 1V9CA 3NUQA 1BFKA 4HDKB 4I50A 3BHNA 3EWSA 4E4RA 5SYMA 1CHNA 2GEFA 1SBYA 4TKUB 4BZXA 1VA5A 2B21A 3QKSA 2SKEA 3VPFA 2XUPA 3MTEA 1W52X 3BICA 4BNTA 3ELBA 1E43A 3EZ2A 3QKWA 4KIGA 2ZUEA 5T67A 1FP7A 1FSGA 1PBNA 2EF0A 2D8AA 4FDVA 3ZW9A 1UOQA 2I3ZA 2J46A 4PSCA 5EJAA 4UUAA 3S40A 2Q3LA 4JBLA 5FYDA 4DM7A 1B16A 1V9SA 1AV6A 3SKXA 2VPIA 3P0EA 2W83A 2KBFA 3PTLA 4BU1A 4OMCA 2RKWA 2VZ8A 4EFKA 1OLUA 1YB2A 1K73D 2G4CA 3NMUF 3GVCA 4CM4A 2H85A 4D02A 1N6RA 4J1SA 3AIIA 2P4QA 3BERA 4JUFA 2X2OA 2GPBA 3OP1A 3JPWA 3GEPA 4QECA 4EG4A 1WLSA 3K94A 5ALDA 1I2BA 3G89A 1XDZA 3OIVA 1U8ZA 3KAQA 4QOEA 4R8LA 1SKMA 4BP8A 2CE2X 2O8VA 4TMWA 5D00A 4N8SA 1NE7A 4V38A 4DNFA 4DC0A 5M04A 4NL4H 5A0VA 2ARKA 1ZNYA 4F8JA 2IBTA 2Q5CA 5EHZA 1ZD2P 1KR2A 4BECA 3LXMA 2JIMA 5LBIA 5EYPB 1FF9A 4M7WA 5JANA 1EWYA 3RSCA 3VSDA 1MZPA 2X5KO 2I54A 1S9HA 2J5KA 2RH9B 4LBWA 1OTYA 3GEEA 3HDTA 3LYAA 3QBTA 4YYZA 4AY2A 3D9QX 4MUHA 2VT7A 3IH5A 5C0OE 4KKSA 2BDTA 4NCXA 2XRMA 2YINC 5CJPA 5JMOA 2NSYA 2YYZA 1F6WA 1KXZA 1UM9A 3LXRA 3PJRA 1FJHA 4FYWA 3P2IA 4Z4HA 4QVAA 4LIPD 2CVPA 4O33A 4RACA 5D8DA 5F2OA 3WK7A 3GJ5A 2OGZA 1MRZA 3NT5A 2N0SA 4WZBE 1ITZA 2QYTA 1OKKD 3V7YA 3I72A 3K0BA 1RVDA 2P78A 1VQMB 3AP1A 2HA4A 3R40A 4BDTA 1OAAA 3IKVA 1U0EA 3KPWA 3L7JA 5J5VA 3U3ZA 4BGEA 1JHQA 3PUJA 4OI1A 2QN6A 3R7DA 3DLIA 4HUJA 3RSFA 4MQFB 4RJTA 4FMBB 1N5KA 2ACKA 1KDPA 2XB6A 3FRIA 3N76A 3TSOA 2VLIA 3T53B 2FR8A 1L4MA 2CWDA 1VBFA 2DQSA 3E7PA 1Q77A 4H1TA 4M38A 5IXYA 2I4NA 2Z2IA 2Z43A 3DXZA 3W1EA 4AMVA 4CLOB 4MPDA 2H5LA 3B6ZA 5F1PA 4CKCA 1I18A 1OAOC 3C8MA 4OLJA 1RXVA 4L3WA 1SC1A 2PV7A 1QP7A 3RJ5A 3GPDG 4B7ZA 1NUTA 4GBGA 5FOQA 2GETA 1KIFA 2WTEA 4QU0A 4WT7A 3K70C 1ISPA 3BXOA 4DLAA 5BWMA 1KQSB 3F4LA 1R6XA 1QLWA 3T4XA 4U6NA 1JTEA 3KE8A 1G3UA 1T1RA 1X7XB 3MZ0A 3UWKA 1NYLA 1S2GA 3GT3A 1EFAA 1KEVA 3PCTA 4PC6A 3V1NA 4C0JA 5ILOA 4LC0A 1C0LA 1J25A 4OG2A 4CU5A 2JKYA 4II2A 1FUEA 1NSTA 5ALMA 3VMFA 4TXNA 3QE4A 3DPSA 3AFIA 4RXMA 1M90D 1CS0A 3DV2A 1NJID 1GQFA 1E2KA 4L85A 2FU5C 4P9SA 2VATA 3K2EA 3DO6A 5EOVA 3RK0A 1R16A 4YHBA 1K7FB 1RMQA 3FI0A 7MHTA 2DHEA 4Q39A 5AKIA 1HYQA 2HHLA 3UV3A 3PGLA 1WRBA 3RRJA 2G0NA 5BN4B 4XEUA 5EZ5A 4MLZA 1O96B 3K1JA 4PLPA 4TT8A 5DW0A 4GMGA 2RH5A 4AK9A 3TLAA 4BQEA 4UOZA 3THWA 1KNQA 2NV0A 3P4UA 4C0SA 3TTXA 4F2GA 1XTQA 2GZAA 2ZTHA 1FP1D 4PO1A 5AVJA 5K01A 3BILA 1P29A 4H7EA 3WRWA 4LS3A 6YASA 1F38A 5EJMA 1CJMA 3FCSB 5ADWA 1U7OA 3AHEA 3G0OA 4N0QA 4CV0A 2AFIB 3COWA 3KVYA 4UM9B 4ZHSA 1FLAA 4OREX 4Y2YA 1V35A 2PMKA 1RR6A 1SZDA 1T5IA 4I4LA 4R7ZA 4RAOA 4UHEA 3NFYA 3NHLA 1YZFA 4MYCA 3TK1A 5KQMA 5CB4F 5G0VA 3PEYA 3BMXA 2BM8A 2PGLA 3R7AA 1U0BB 2D5AA 4OAPA 1KJQA 3PEFA 1RLMA 1PJ7A 1TT5B 4K9SA 4JKOA 1A72A 1XTBA 4KZPA 5CGQB 2WIJA 5D01A 3EULA 2G7ZA 2YXLA 2OYNA 3QVGB 4R9SA 3LL7A 1ZHFA 1K8ZB 1JYSA 2OZLB 1ONSA 5TGZA 5C46F 5AVYA 4I6GA 1EJBA 3NONA 5FKJA 1HF3A 2VHYA 3SJUA 3RUPA 4FT4A 1V25A 2FW6A 3BGSA 3DMPA 4KX5A 3RAEC 1V8FA 3P32A 2QMZA 2ZK7A 3BK2A 2Z83A 2P91A 1J07A 2PSFA 4GWGA 2P6RA 2OVFA 4MAMA 1T0HB 3CVVA 5K0LA 3ZGLA 3TO5A 3UBTA 1NG9A 1Z6ZA 3BJIC 4P4TA 3WE7A 3WHIA 2NPFA 1P6XA 3I1FA 1E8NA 1KAHA 3NM4A 4YXWA 1QZZA 4KAFA 3DHVA 3NEJA 2XE8A 5TT1A 2J0VA 3CG0A 3MVEA 1QIGA 4HNSA 3MGGA 1WAMA 3RSSA 1DARA 1HYHA 3OW7A 1AHNA 3ZQUA 2ONKA 4DARA 3DZHA 5DHQA 4UARA 3FH0A 4EATA 2HI0A 3SZMA 1F4PA 2Z5FA 5BSYA 2FNAA 2JCYA 2Q07A 3BSWA 4EPVA 4BX2A 4IV0A 4EBFA 3LLUA 4KXQA 3UUGA 2QE7D 2VKTA 2O20A 5AT1A 5FNVB 1L1QA 1SWWA 4WXRA 2BH2A 3PQ2A 1CP2A 1T3GA 2P2NA 2X6RA 1Q5PA 3ZK7A 5JASA 2UZ0A 1V71A 3I92A 2X9QA 3NVDA 3Q40A 2BSQA 3G0HA 1V3UA 2WF9A 4LJAA 1WPRA 2QVYX 3AKEA 1JKJB 3W2EA 4BCBA 3FCOA 2WE8A 4IJVA 4PTYA 5CA0F 1V16B 2O3QA 3ETNA 5GZ3A 1ZGBA 3DQPA 4KGZA 1WB4A 1JHAA 2FSUA 2IEYA 1NYTA 4I9GA 4UJ3A 3RVQA 3SS7X 5KYGA 1EEHA 3UW3A 5D84A 1IUNA 3QWIA 4W9RA 4Y2PA 3RFVA 4AW9A 5A03A 4EA8A 4XWKA 1G0OA 3BFXA 3N07A 1TJNA 3M5CA 4HGYA 2EATA 4O4JF 5JD3A 3ET4A 3PXDA 3SXPA 5KOHA 3X1DA 1VL5A 5KTOA 4Z4YA 5FPKA 3GLIB 3GJRA 4UXHA 3HXTA 1JFRA 2AG0A 2X15A 4NBUA 5DBOA 3CVXA 1UM8A 3ZU3A 3EW7A 2IF0A 3EXFB 3HM2A 4YP1A 5IM5A 3R76A 1SBCA 1UF9A 2IPAB 4CQLA 3L6BA 1Q6YA 1FVHA 3I2FA 2ZRPA 2F9MA 4KR0A 3S99A 4PO9A 2NPIA 5JFOA 2NTJA 1K8YB 4L9RA 4MX8A 5BN1A 1P9NA 2R7KA 1ABEA 4BN5A 3EODA 3MTAA 4ARBA 1PTJC 2QAGA 3PUMA 1GA6A 1Z7GA 1EFUA 3IEKA 3KTDA 4KU4A 3FOFC 1EA7A 2CVFA 3I2YX 3HB1A 4RC9A 5TGDA 1QGYA 3D4PA 3L40A 3N6RA 3LMKA 2R9VA 2QE7A 1TQ6A 3QKRA 1UD2A 2JGKA 3FZEA 4QDTA 2DTXA 2ODEA 1RYEA 3AKCA 3GMSA 3K72B 4TMYA 4XD7D 4BZWA 4BYGA 4MR7A 4U7GA 1T2EA 1V45E 3SLDA 1SK9A 4K88A 5HR5A 3KV3O 3A1TA 1RHQA 3IESA 3PQDA 4AMZA 1GEEA 5BSVA 2V0GA 4QTYA 3ZE7A 2XDQA 3G0CA 3AF1A 3QSGA 3N2YA 3RVMA 5A4JA 1XPUA 1Q7RA 3IEUA 4EEZA 2O2DA 5FTJA 3RU3A 1JIUA 1NRKA 3K70B 1GDHA 4KBYA 5CTAA 1PGQA 2AYZA 4B87A 4Z7NB 1U0JA 5LSAA 3BTUA 4O2LA 4X00A 4WZTA 2YWEA 2ZTSA 3IAM6 3JASA 5C3MA 2OXCA 1DP4A 4AJIA 1IB6A 4QGBA 5JQGA 1NMSA 3IQFA 5M29A 1FW6A 1OWPA 3EH1A 3MD0A 3CUKA 3M3HA 5AESA 4MKGA 4KBGA 2PSHA 3HDGA 8ABPA 3AG5A 3NO4A 1G38A 1MH9A 1CUCA 3WGKA 2OP0A 1OFUA 4JUDX 5DNDA 5LQDA 4I0WB 1TM7E 2A4KA 1E5TA 2IZZA 1CJKC 2XB4A 1NC3A 2XMQA 3I34X 3OKAA 2R4TA 2YXBA 2FZVA 5B1IA 1PWEA 4PC1A 3HUDA 3HKCA 1EI9A 4G6ZA 3RI3A 5C18A 4KVZA 4M7RA 1HURA 4C6TB 4GUAA 3GFSA 2WMOB 3OUZA 2AR0A 4PBRA 5AK5A 3VU9A 4HSEA 5A4DA 1IPHA 5AVWA 3CEMA 3ZDEA 3OCJA 3HXPA 1D2HA 2HNBA 5FOTA 2OCPA 3IAUA 1EVLA 1C9EA 2M1XA 2WWXA 3ZWQA 4CQMB 2C78A 3EGIA 1BA2A 1BWSA 1RLOA 1YQEA 2FEKA 4HX9A 4ZOCA 2OCDA 3IVGA 2ZI6A 1G59A 2HH9A 3BHIA 5FH9A 2DFNA 1SN7A 4HZGA 3T0FA 4WKOA 1WU8A 4HGZA 4X63A 5EGSA 5IYNA 1FCJA 4ARAA 4X07A 5AN9A 1T8RA 2DWPA 1L5WA 4R5MA 2IUUA 2HM7A 1RLIA 2HSZA 2YN0A 4WXMA 1F48A 2Q46A 3KXDA 4W82A 1TOAA 3RG8A 1E4EB 5AWFC 4K3VA 1OAKA 2FPIB 2OFPA 4DMCA 3UPTA 3PWTA 3RC3A 4AP6A 3COSA 3NIBA 1II8B 1E1LA 5CT9A 2V4DA 2O5EA 2C3MA 1RFGE 1Z4OA 3P2KA 4JT2A 4RYLA 1MDBA 2RI1A 1BDJA 1SCQA 4IDNA 3UK1A 4B85A 4C4ZA 4URFA 1H2BA 3C3JA 3WBFA 5B12A 1FLVA 5E6UB 5LXTB 3G0DA 4B8YA 1R66A 1DAEA 1KS2A 1DWQA 4EY4A 3NZEA 1ZN7A 4MI6A 3D3QA 3F6SA 3LT4A 4AJEA 5EQFA 4FLMA 1ZN9A 1NI3A 3BQMB 3PDUA 4W6QA 4UVIA 4F8EA 3GVHA 4O0LA 1D7OA 2ZL7A 1KK1A 3E20A 1S02A 2FZCA 2J3EA 3ZE9A 2EGHA 3MAJA 3O8DA 1M2JA 4U7WA 2FR1A 1XRNA 4PPQA 2Z4RA 4KK4A 1AZSC 1BEZA 1FDOA 3ERCA 3ZHRA 2AIRA 3JD0A 2V74B 3H18A 1CUDA 2DWCA 2GX6A 4LHXA 3JSAA 2VWGA 1QFSA 1T3TA 1YR7A 1LQUA 2IV3A 2WM8A 3I6QA 4A73A 1ZL0A 1CUUA 2H9AA 2O3SA 2JAUA 3HB4X 3FY4A 4LXTA 4M54A 3WK9A 3PQ7A 1MB9A 3N9IA 2BEWA 4DMLA 3BIWA 4HR7A 1PJLA 2GJAA 4RY8A 4NI5A 4YP9A 5LQKA 1O5OA 2OAQ1 1CULC 4LX8A 3EGXB 4JLKA 3QWFA 3RADC 3MLBA 3S27A 1K6IA 4K6FA 2ZE8A 4H7HA 4CG3A 5JH7A 4H0CA 1FFEA 3LC7O 1VFPA 5K09A 1BWQA 4BAUA 3T06B 2AUNA 3ZWWA 3A6LA 3RABA 2XT0A 1B15A 1KMMA 4CLEA 5JTUA 1AKEA 1KSFX 1M1NB 1EBBA 2D1TA 3SVTA 5DI3B 5EN4A 4ARIA 1NDUA 1UKBA 4P54A 4MVJG 3UZUA 3D4OA 2X0DA 3WHLA 1E98A 1EBUA 3DF7A 3OOYA 2IH2A 5BVHA 4EG5A 2CJWB 1LFDB 2WWRA 5BYKA 3ZDAA 1HMPA 1JMYA 2BD0A 3FPSA 3H7IA 3MTIA 4G5RA 4QVGA 1O08A 4BLUA 3Q10A 3F9IA 1OY1A 1T2NA 2PR2A 3IMGA 4WH0A 4ENWA 1Q81D 2PSEA 2YS6A 3CWQA 4DLUA 1HDYA 2PJRA 2BZGA 4AN0A 4IM7A 1MC4A 2W2LA 4A2QA 5ISMA 1ZI6A 4J3FA 4WEOA 1NVWQ 4KRXA 5AKJA 4BU0A 4YRZA 2ZYAA 1YJWB 2QORA 4K0RA 4DR7B 2JDID 3VJMA 2NZJA 4ETWA 4IAOA 2ZUTA 4X8LA 1T13A 1JVSA 4RIIA 5BR8B 3FNHA 1HG1A 4EVIA 2AJLI 4JWTA 1ZR4A 3PPXA 1X74A 3ASYA 4LQCA 1VQ5B 1R5OA 3I52A 5D7BA 3UHAA 2BTQB 4M89A 1I7DA 2VNHA 1SVSA 3L7DA 2AV6A 2XUHA 1ZNWA 2IKSA 3DBIA 3JTEA 1MOSA 2H08A 4G07A 5FWYB 1TYZA 4QO7A 2FSVC 3HU5A 1UCFA 1A2QA 2Q5QA 4TKLA 5EIAA 1PSWA 1SHTX 1VYHA 4X7RA 1TCBA 4XSVA 4GKKB 1Z4PX 1T43A 1VLLA 3Q2KA 4IFEA 4ZU3A 3SR0A 5FX2A 3V4RA 4MCJA 1NP3A 1SUSA 4U2GA 2ACWA 3M5PA 4C4RA 5JO0A 3AF0A 3VO8A 1ZVVA 2Q8QA 1E1KA 5KO2A 4N41A 2I4MA 4QNRA 3RWMB 1XZKA 2DRIA 3MQ4A 3V2GA 3HC7A 1SU4A 1XQ9A 2ZSKA 4CG1A 1HFJA 1KAQA 1D5WA 2DWQA 3P97A 4DCGA 1BXRB 4QBGB 5HF5A 1Z16A 2I2XB 1I2ZA 1MOPA 2I71A 3IUMA 1I30A 3F97A 4B46A 2ZRLA 4WW0A 1DC6A 2VPPA 3C3YA 4E46A 1LDBA 1CNFA 1DQZA 3PQ3A 4LZJA 2C8VA 2Q1UA 4AY5A 3CT6A 2CY0A 1A8SA 1P81A 2NG1A 1Y6RA 2G1UA 4FFMA 4KN9S 4MS4A 4C4AA 4OQEA 2RGWA 3KEOA 5IT4A 1OH8A 1X1TA 3D6VA 2F17A 4IRUB 1QCYA 3EXAA 5AM4A 4DT1B 1I7SB 3DT8A 2EKPA 1MO5A 3OZ7A 4OAOA 1ZOSA 1EK0A 1N0IA 2X76A 4C22A 1YR2A 2JDIA 1X80A 1V7PC 4JVLA 4PG8A 4JT9A 3BGIA 4PEVA 4QM6A 1Z68A 3P26A 3DZFA 1TLFA 4PQRA 1B1AA 2P2YA 2P2ZA 3DZGA 3M6VA 1OH7A 4F4IA 1W85A 4FFNA 4PRLA 2CYCA 3KUCA 1VKNA 3EG5A 3P2EA 5CT6A 1QGDA 1XL0A 1MT0A 2H63A 3H11A 2ZI5A 1J4AA 3B7GA 3FTEA 3AIKA 2QNBA 2Z95A 1KAOA 2GM9A 4RJLA 1YFKA 3E8SA 4I4TF 2B4KA 5EKUA 3VNUA 3WNZA 3N75A 4XJVA 2EX1A 2XOXA 3HU2A 1OFTA 2O57A 3MTJA 3QEMB 4PXYA 4AXXA 4B33A 3NHZA 2OGWA 5JS7A 4WDRA 3RGGA 4OQXA 4HJXA 3E1KA 2X3FA 4DK1A 4FB4A 2E48A 2PTGA 2LXNA 3FPHA 1NVAA 4YJ2F 3MMPA 3KUXA 4JEMA 4WV3A 4Y6SA 2JJ2D 1QVVA 1RIFA 4MQ4A 5G0TA 4CJXA 5B4VA 5JPDA 1NULA 2E85A 1K06A 3KUUA 5LU9A 4FN5A 1FUYB 3AHFA 4P4SB 2WG2A 4X90A 2XWQA 4HTAA 4Q4AA 3HN6A 4OMFG 4I5GA 3I8OA 2HMYB 1X8LA 1L8OA 5C1OA 1K0FA 3KQQA 3HSSA 1QGUA 3AR6A 1L7BA 4OBXA 1W2GA 3AI7A 3AF2A 3GD5A 2O0JA 3IIMA 1QRDA 4CM9D 3CGGA 1M2NA 1E2DA 1FP4A 1NVXQ 1SHLA 2QTCA 4MB6A 3THRA 3MWFA 3VPGA 5JSHA 3GA7A 3K0HA 1Z4LA 1G5RA 2VBIA 3AR9A 3O2NA 1TMOA 3F5MA 4IXMA 1Z7YA 1XQBA 1OJLA 5E9QA 4LJ7A 4EH1A 2P5SA 3R3HA 5J1SB 1JB1A 5FL3A 1EA5A 2H29A 3SLGA 1RQXA 4LGMA 5A71A 1SG9A 1AUVA 1TF2A 1G3QA 1NVTA 3TSWA 4YX9A 2BYTA 3KG2A 3P5BA 1LX7A 2QM8A 3IBFA 3I5AA 3TPCA 3FF1A 2ZB4A 1P2VA 4ENTA 3OFVA 5ICCA 1REQA 1AKRA 1OVGA 1D2RA 3GLHE 1J00A 1WNFA 1XLUA 5B7NA 2DFKB 4R3UC 2OXFA 4IZ6A 1CUEA 4KPUA 4BO5A 1WQ4A 1X42A 3EAQA 3ZHBA 1YVPA 1TZJA 4L4RA 1SG6A 1ECPA 3I3SR 4Q9LA 1YR6A 3KD2A 2NYAA 4EHFA 1NGSA 6REQB 3DLBA 1NR5A 5IFLA 5JYBA 4OXXA 1PNVA 1YB1A 2WZQA 4FJ2A 4DBLC 1CUBA 1FFXA 2QTTA 1FY2A 4ZYLA 3L8ZA 4OIFA 5EZYA 1EGQA 4FDMA 4TWIA 4XN0A 1ACJA 4HYTA 4JYCA 2UZ4A 1HKHA 1BFDA 3N2NA 1CY8A 4LJRA 3E9DA 1SXJC 3H5RA 4GC9A 4IQFA 4AD8A 1YT5A 3NPAA 2UVQA 4MDEA 1XZQA 2M6RA 5K0CA 3CCMB 4AP9A 4XCVA 1ISJA 3U4AA 2W4QA 2PRZA 2GRAA 2B0CA 2B1GA 1XALA 1YRYE 3PICA 4KH1A 5DGHA 2R6CA 1P3Y1 1R12A 5HIIA 1DFHA 1OWOA 1R0WA 3Q3GE 4GP6A 1FUUA 4EF5A 3DHWC 3L5OA 5MN6A 4TYMA 1E3LA 2GPYA 2OK7A 3FTDA 3D2BA 3ME5A 4OI2A 3STVA 2F8LA 4PLCA 5TDHA 3HVKA 3T1VA 5C8VA 1T4BA 1XZJA 4KNWA 3WFIA 4YT8A 3SDBA 4IINA 2WYOA 4RMHA 1OU0A 1W0CA 2E5WA 4I5FA 4R98A 4IL5A 3VV2A 4X7CA 1E79D 4GKVA 5CVTA 4M88A 4FMCF 4PYOA 1OXKB 1RJGA 1D9ZA 3BULA 3I5MA 3K6JA 2PKRA 2M6KA 5L4SA 4EB3A 3E81A 2B4AA 3NHSA 4BMXA 5HYVA 1UT5A 5IASA 5BNZA 3ND6A 5CDUA 4NLLA 4MUNA 5AO9A 3IP7A 5AJVB 3UCFA 4F1WA 4EWLA 5B7QA 1V8BA 4V3BA 4AJLA 3D8BA 1ODSA 3KQHA 1GTL1 4CWAA 4EABA 1B41A 2DQYA 1L5MA 3PPYA 1KC1A 1LPPA 2B92A 2RAVA 3R6DA 5DM1A 4F4UA 1MB0A 2FP4B 5JNSA 3U4IA 1L4EA 1N2OA 1HYGA 1XMXA 1YZQA 3BIOA 2WDPA 4I3GA 3V4PB 1V39A 3EEYA 5KWSA 1MX3A 1UXOA 4RTJA 1G7SA 3T12A 3K0SA 4AL4A 5DSTA 2Q62A 2F8SA 2H8KA 3B9QA 3WRXC 2RHGB 3KTOA 2XCOA 4BGUA 1FL9A 2L82A 2FSPA 4BBAA 3DVQX 4UHDA 5EMKA 5I6DA 3RFXA 3F4BA 1MNAA 2VT2A 1YS6A 2VH1A 4PLHA 3EEQA 4OP3A 2BP7B 1NDHA 1VCOA 3NOQA 5AHOA 4PABA 3IAS1 2ZIZA 3SQMA 3HDQA 3PR3A 1XFDA 2WE7A 5HIKA 4QICA 3UMMA 3FBTA 1QIJA 3ASQA 1P4GA 1A9RA 4RU1A 4PTLA 2WIKA 1E79A 3JYPA 2A1TS 2G4LA 4RPBA 1XRQA 4HRAA 1GILA 4JVSB 1EWQA 3H75A 1MJGM 2FWPA 2ZU0C 4Y2HA 2XLCA 3CRZA 1JHMA 3JZAA 1AKWA 2NVUB 3N5KA 3T15A 5TEVA 4QHSA 3TNDA 4WSOA 4MB2A 4XX0B 1YBAA 3N8KA 4JSRA 5D1HA 3OJWA 4K05A 2VDJA 1Y3DE 1JHXA 3AJEA 2B98A 3R4CA 5EHIA 3MWDB 5HFJA 4PZCA 2HTFA 3NHPA 3U1TA 2IV2X 4OB6A 2NUBA 3ETEA 1KVSA 2ODAA 3AY0A 3U4DA 2D2IA 1YB4A 4F5YA 1E1YA 1ZUIA 3EA5A 3UFXA 1NI4B 2UV8A 2DE0X 3QVXA 3E4CA 4RCVA 1NU8A 3EJWA 1KGDA 1JEEA 1RI4A 2IIVA 2QRHA 1RLTA 1HT2E 1OASA 3PIRA 4R9NA 5F73A 5TQ0B 1HO3A 2X8BA 4OTZA 5HJ7A 5LXTA 3R5JA 5G2OA 5E9JA 5G1PA 4LFBB 5A9SB 1NT4A 3ROQA 1W48A 3OQJA 1XELA 4ZAFA 2JNWA 2PX6A 3HYNA 1AUOA 2QWXA 1UWLA 3MTQA 3EZXA 3HSYA 1Q7BA 3W4IA 4MMXB 3LY9A 2ZIVB 4S05A 2W2KA 2YRWA 1SBHA 3D1JA 1IHPA 3CURA 3JCZA 4G9GA 3UK6A 3F73A 2PUEA 4K6KA 5ESDA 1TNDA 4N76A 1G3RA 2BPOA 1SQ5A 2AC4A 3GAMA 1PR4A 3QJGA 5FOUA 3RVNA 4DFDA 2AG8A 3GDHA 3HMKA 5B1HA 4ZARA 1U8XX 1Z39A 4MV6A 4B83A 5B30A 3RAFC 1BPLA 1V5GA 5AJUA 3IPAA 1KSGA 2ODQA 3ONVA 4G1CA 2NZWA 4LOLA 2CXXA 3B89A 1LLDA 4LF5B 1R8SA 1BC5A 5LYJA 1H8HA 1QPBA 4OPSA 2O2YA 4Z4SA 1BW9A 3L84A 1YQWA 1UMKA 3HDJA 2NU6A 1F5SA 3OQ1A 1YIJB 1E1DA 1TKRA 4LWOA 4BRUA 4D79A 4XWWA 5KIAA 2Y6VA 1M72A 3ISXA 5KYVA 2G1PA 2DG2A 1UBFA 2VJJA 1YNSA 2CLIB 4JP3A 5T64A 3OTQA 2AB0A 1RYNA 4A0GA 1WHTA 2PMBA 1BD4A 3AK4A 2AEMA 2F3UA 1Q2XA 2EW2A 4FEAA 4BX3A 1ISMA 1UOPA 2MSWA 4ZVRA 3TOZA 1XJ5A 1SXJB 1U2DC 5GVRA 4ZAYA 1XTTA 1ULUA 4HGNA 1LW6E 1F2TB 1UBRS 3S44A 2UZAA 2J9FA 2QM3A 3ZPNA 2C92A 2XQGA </