3MHVC

Crystal structure of vps4 and vta1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
102
Chain Sequence
b'GSPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTPCSPGDDGAIEMSPDLTIKDFLKAIKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 4
publication title Structural role of the Vps4-Vta1 interface in ESCRT-III recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 29
structure length 102
sequence length 117
ec nomenclature
pdb deposition date 2010-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3mhvC00
5FTNA 1SXJD 1IN5A 4ZPXA 4L4UA 4LJ6A 2R62A 1LV7A 1R6BX 1NY6A 1JR3D 3UK6A 4L15A 1OFHA 2C99A 3M0EA 3GLHB 3DZDA 3GLHA 1J7KA 5C1BA 1KSFX 1IY1A 4I4LA 1G41A 3CF0A 2BJWA 1E94E 4FCTA 4FWHA 4Z8XA 1NSFA 1OJLA 3MHVC 1X37A 3PFIA 2CE7A 4FD2A 1IXZA 4LJ4A 4WW0A 4LY6A 1JQJC 3GLIB 1XXHB 1NJGA 2KRKA 5EQTA 1S3SA 3PXGA 5FTJA 4JN6A 3WHLA 4LJ8A 3B9PA 2FNAA 2ZANA 1IXRC 2V6ZM 3BOSA 4D82A 2Z4SA 2V1UA 3HU1A 1IN8A 2QPAA 1NJFA 3VFDA 3U61B 1NVMA 2XSZA 4KLNA 3SYLA 3CF2A 2CHVA 4QOSA 2QBYB 2QBYA 5JI2E 2CEAA 1DO0A 3U5ZB 1NY5A 3H4MA 1HQCA 3SYKA 3M6AA 2C9OA 5DYGA 3KW6A 1XXHA 2ZAOA 5JI3E 3GLIA 4L16A 1QVRA 4QNMA 3GLGB 1W5SA 1R7RA 5FTMA 1IY0A 5EP4A 5FTLA 4FW9A 1IXSB 2X8AA 3KDSE 4KO8A 1SXJB 4A3VB 3HU3A 5EXSA 2ZAMA 4LJAA 1KYIA 1IN7A 5EXTA 1QZMA 3D8BA 1XWIA 2DZOB 4GITA 4LGMA 4LRSA 4QHTA 3VLFB 2DHRA 3ZH9B 3HWSA 3AJIB 2CHGA 3EIEA 1UM8A 2VIIA 3U60B 1IM2A 1W5TA 5EP2A 3WHKA 4QHSA 3GLFB 3GLFA 4KODA 2C9CA 2DZNB 2C96A 4QNRA 4D80A 2DVWB 5FTKA 2QZ4A 2QP9X 3GLGA 1IN4A 1DO2A 4LJ5A 4D81A 4LRTA 2QENA 1SXJE 5EXPA 1C1KA 1G3IA 1FNNA 1SXJA 4I81A 1L8QA 4FWGA 2RKOA 3R8FA 1JR3A 2XSZD 1HT2E 4FCVA 2BJVA 1G4AE 4LCBA 4LJ7A 2C98A 5EXXA 2DWZB 1HT1E 4FCWA 2Z4RA 4LJ9A 5DYIA 2R65A 1D2NA 2HCBA 3SC3A 1SXJC 5EP1A 1HQYE 3HU2A 4LZZA 1IQPA 5C18A 5EP3A 1IN6A 2CHQA 3K1JA 4FWDA 3EIHA 4EIWA 1E32A 1OFIA 3PVSA 1IY2A
chains in the Genus database with same CATH superfamily
4IBDA 4LFBM 3GPYA 4L4UA 3IG5A 1MX0A 4B7HA 4DV4M 1XC8A 2FH0A 4MGIE 2C99A 3M0EA 2DHYA 1MN3A 1R2ZA 3AOEC 3GLHA 5C1BA 3FYCA 3C3EA 2XZUA 2MH8A 2JP7A 3CF0A 2DXIA 2YFQA 2K47A 3JR4A 3K9PA 1L1TA 1OJLA 3T38A 2XZFA 1OIZA 3TWLA 1GLNA 3GLIB 3KOWE 5KO3A 1S3SA 2QQ8A 2XFSA 3OTOM 1P3QQ 3L27A 4XGIA 4JI3M 1R5LA 4JN6A 2LH0A 3WHLA 2KZUA 2DNAA 1N75A 3SFZA 1TH3A 3B9PA 3U6EA 2ZANA 4D82A 4GH9A 1ZAEA 1K82A 2V1UA 3HHWA 1OIPA 2QPAA 4XK8F 1NJFA 1PRBA 2EKKA 2LXEA 1QAQA 1PM5A 4X62M 2OOBA 3FRHA 3FTDA 2CHVA 4QOSA 3E9SA 2L7IA 2Q2EB 3U5ZB 2APLA 3AKZA 3KP1E 1T6OA 3A46A 1XNRM 2GNOA 5DNYA 3SYKA 4LF9M 1NV8A 1QVRA 4MB7A 2F5QA 2GQFA 1IY0A 5EP4A 2KZSA 2LHGA 3THGA 3SASA 5E6JA 1FJGM 2L2DA 3GPXA 1GJTA 1SXJB 4OVZB 2G3QA 3C3DA 4A3VB 2Y0TA 4REZA 5E26A 2ZAMA 4M0WA 4LJAA 1C7YA 5ITXA 1SG9A 1WR1B 2JY7A 4GITA 2JY6B 2DZOB 1D0KA 2DHRA 2EKFA 3V76A 2KDLA 1PJIA 5ITTA 2LNHC 3I4VA 1IM2A 2OO9A 2EO2A 3T1YM 3GLFB 2JUJA 4M9SA 3FE3A 4RKUF 2C9CA 3NBXX 3FKEA 4QNRA 4DR2M 2CRUA 4KHPM 2BWEA 2WSFF 5FTKA 4G4OA 2XF3A 2DI0A 4NXMM 1TDHA 2F5SA 1V34A 2M5ZA 2VQEM 1GABA 3K9OA 2KEBA 3K2LA 3R9XB 4IBFA 4DUZM 5KQ8A 3ZQJA 1L8QA 4FWGA 3LMMA 3TWMA 4L8RC 2XSZD 2UXCM 3QAUA 4FCVA 1L2CA 3GRVA 3HHZA 5LMUM 3M7GA 4R3DA 4DUYM 2DAGA 3B7QA 4DV2M 1LTMA 1HT1E 3A98B 4FCWA 4FVMA 3QYEA 4PCZA 2JY8A 2V1CA 3KVWA 1NHWC 2RRUA 5DYIA 3GPUA 1D2NA 1HNXM 3SMPA 4NXNM 2OQ4A 2E5LM 1AIPC 1D0MA 3HHYA 1KFVA 2CHQA 1WGNA 4FWDA 5EJCA 3EIHA 4EIWA 4G3OA 3K1JA 2UUCM 2F5PA 2L4EA 5KPRA 1SXJD 1IN5A 1VDLA 3C9PA 4HL4A 2R62A 1LV7A 1OAIA 4TUWA 3U6DA 2RGHA 3LW5F 1NV9A 1OFHA 1OTRA 1JR3E 2JNHA 2CV0A 2YR0A 2R46A 4ITQA 4P17A 4YHHM 1J7KA 4DR1M 4DR3M 8CATA 1IY1A 4PDIA 1G41A 1YLAA 4FCTA 1E94E 5BPVA 2H1RA 2XEPA 3K8ZA 2B3TA 2DZLA 1NO1A 3MHVC 1X37A 2I7PA 1TGUA 2JWSA 1WXQA 4DBGB 1EFUB 1YSYA 2KRKA 5EQTA 4LF4M 1PGYA 2XH9A 4AG5A 2KHHA 4F2LA 5FTJA 4CIZA 2DAMA 3GP1A 1WHCA 1V33A 4LFCM 4CJ6A 4LZJA 2H5XA 2FNAA 3GRRA 1QANA 2FE8A 3DFZA 1HNWM 2ERCA 3SBJA 3HU1A 3B7ZA 3SARA 1NVMA 3U61A 1PJJA 3L29A 3VK7A 1TF0B 2JZ0A 3SAUA 4DV1M 2QBYB 1TH4A 4JXJA 2J7OA 2NQ8C 5BR8M 2DWNA 4NL4H 1NY5A 1R4GA 1N33M 1QAOA 3HJ8A 3TPZA 3KOYE 3SHFA 1BVSA 3GLIE 1DGBA 2C9OA 4CHTB 1XXHA 4R7GA 4AI6A 2RGOA 2LVPC 2WSCF 1W5SA 1R7RA 5FTMA 3KS8A 1DGHB 3AV0A 2KXEA 5IT9S 3KDSE 4KO8A 3IG8A 2XLJA 2ZM6M 2KNAA 1HJPA 1VDDA 2R4EA 4QOZC 3D8LA 3U6LA 2XFTA 4JI7M 2EA0A 1DGGA 2O25A 4JI2M 4AW4A 5EXTA 3I01M 2F5OA 2P5TA 4BLCA 2K0BX 3KSJA 3HWSA 3W0LB 3U60B 2KRUA 1UM8A 4KT0F 5A2QS 2AHMA 2J7NA 4KODA 2M60A 2DZNB 4CISA 2K6BA 4GIPA 1QZEA 2JXNA 3BXWA 3UMMA 1ZQ9A 2CWBA 2LBCA 3LVVA 4D80A 3SAWA 2DVWB 3FUTA 3GLGA 1IN4A 4LJ5A 3A42A 2KNZA 2A5YB 1Z5CA 2VF7A 2Z8YM 1IXSA 1PJTA 1SXJE 2DKLA 4I81A 1T43A 2VQFM 3HY5A 1G8PA 1JR3A 1HT2E 2EUCA 2YNMD 3B89A 2BJVA 1G4AE 2Y20A 3HJQA 4IBIA 4ANRA 2L4FA 1E9SA 5EXXA 3KOXE 2R45A 3W67A 4F1IA 3FTFA 4MGKE 3HKPA 3GLFE 4K0KM 1XB2B 1RU3A 2R65A 3SC3A 2R6FA 4XBOA 1SXJC 3AOEA 1DV0A 5EP1A 3SHGB 5C18A 3IECA 4OU7A 1ZV1A 2O5RA 2I7NA 4WURA 1L2BA 3U6CA 2L09A 1QQWA 3KS4A 4B3TM 1OFIA 3LVWA 3PVSA 1IBLM 2K9DA 2Z3XA 3FTEA 2DAEA 5FSWA 5IZ7D 4ZPXA 3HGIA 3VKHA 4LJ6A 1T3TA 4WP2A 1G71A 2CP8A 1VEGA 4L15A 2Y0QA 3FD9A 3GLHB 1QUSA 3NBIA 1QYRA 4NRVA 3TWKA 3SAVA 1KSFX 2DWMA 2OOAA 4I4LA 3J2PB 3F92A 3RE8A 2R44A 3GRUA 4IIWA 2UXDM 3H4JA 1IFYA 2CUZA 4II7A 2CE7A 4WW0A 1IXZA 4BBAA 1HNZM 4GRIA 4B3MM 1MU5A 1XXHB 2ZBKB 3L28A 1K3XA 1NJGA 1XHBA 4MGHA 4MGZE 4LF5M 4AKGA 2D7EA 1WIVA 3PXGA 3LQQA 1EIJA 4NSOB 1Q39A 4LJ8A 2QHOB 3GRYA 3BOSA 2V6ZM 3QYBA 3I51A 1IN8A 3J27B 2HHHM 2MGWA 1OKSA 2BWBA 1MJGM 3VFDA 3PNYA 2XSZA 3I4YA 3RGPA 4BB9A 4KLNA 3SYLA 3UZUA 3CF2A 1TR8A 1XMOM 2CEAA 3DA1A 4MM3B 3IHPA 4B08A 4RF0A 3U5ZA 1HR0M 1HQCA 4G6ZA 1PJQA 1VEKA 4B7FA 3M6AA 1QUTA 2R18A 1Z59A 2ZAOA 4I5SA 5JI3E 2UXBM 4L16A 4IBGA 4DR6M 1NHGC 3U6QA 1I94M 1JB0F 3GLGB 1OQYA 2BNKA 2HL7A 4AQYM 5FTLA 1GO5A 3CTWB 4FW9A 1IXSB 4CGYB 1CUKA 3GQ3A 3L2AA 1IBKM 1V92A 4B3RM 2G8LA 1VG5A 3HU3A 5ITXE 4GKKM 4UN2B 3HX3A 4M0DA 4Z6YA 3J81S 4DV6M 1QZMA 4JI6M 4LRSA 2Y21A 3HJSA 4LFAM 3VLFB 3ZH9B 3Q8GA 3B7NA 3GO8A 4G4NA 3AJIB 2CHGA 3EIEA 2ZTCA 3MK6A 4Q7JA 3AOGA 3T1HM 4IBJA 2VDBB 5EP2A 1Y8GA 3VDPA 3GLFA 1Q3CA 2L7HA 3VDUA 2HWJA 2KNVA 3GPPA 1L2DA 4NSRA 1IBMM 2CFOA 3E4RA 4NOOB 4OX9M 2QZ4A 4NC6A 2QP9X 3TQSA 2LWXA 4X66M 1QAMA 3U6SA 1QDRA 3L25A 4PD2A 1C1KA 1G3IA 3TL4X 3T6PA 3CF6E 4DV7M 2EJSA 3J7BA 2RKOA 4IBBA 2YQZA 1GKIA 4DV5M 2FS1A 4LCBA 2C98A 4I8OA 4JV5M 1NNUC 2DWZB 3BBZA 3Q8XA 4JI4M 1GJSA 5ITYA 3J80S 1N77A 2HKJA 1J5EM 4OW0A 2DAIA 3CGWA 3DOAA 2DAKA 2LVNC 3JR5A 3B74A 4LJ9A 1ORYB 2CV2A 2F4VM 4DV3M 2HCBA 2WZJA 2FOIC 1D0LA 4GC5A 3T15A 1F4IA 1HQYE 3HU2A 4LZZA 4DR5M 5EP3A 5F3WA 1IN6A 3W0FA 4L78A 3U6PA 4DV0M 1E32A 3FUUA 3FRIA 5H37D 2UUBM 3U6OA 5FLXS 5FTNA 1TDZA 4IBCA 1GL6A 4GC9A 4MGYE 5LMNM 1R6BX 1Z5AA 1NY6A 1JR3D 3UK6A 2MROB 1E9RA 1QDTA 1VQ1A 2W82A 5GKNA 3HZJA 3ZC7B 3KSXA 3ZCBB 4PDGA 3DZDA 3QWLA 4IJEA 1AUAA 5KQDA 2HAKA 1R2YA 4GKJM 4JYAM 2BJWA 2X49A 4FWHA 2X4AA 2N35A 2LTUA 1NSFA 2JZ1A 3E21A 2WSEF 3PFIA 4FD2A 4Z8XA 4LG2A 4LJ4A 4LY6A 4AKIA 2JY5A 1JQJC 4AG6A 2CV1A 2F5NA 3GQ5A 4RNAA 2C5RA 3TE6A 3HHXA 3PNVA 1Q02A 2FFJA 3C58A 1N34M 1VEJA 1TTEA 3VK8A 4RF1A 3FYDA 4GHAA 1IXRC 1WGLA 1N36M 1Z5BA 2Z4SA 4DR7M 2MR9A 1I4WA 3U61B 3GLHE 3KXEC 2OPFA 4IBKA 1DGFA 2DWLA 2QBYA 1ZMWA 7CATA 5JI2E 1DO0A 4DR4M 3I04M 2KW0A 4LF6M 3AL0C 3H4MA 3U6MA 1PJSA 2JA2A 1XXHE 4IJFA 2KA6B 1ZMVA 4S12A 4GHLA 5DYGA 2MJ5B 3KW6A 3SMSA 3GLIA 2R0IA 1G59A 3VKGA 4QNMA 3MMPA 4LGYA 3L26A 4YY3M 5IREB 3KP0E 3ILKA 3UGJA 4JI8M 2QNJA 1DGHA 2X8AA 3FTCA 3GQ4A 4AKHA 3UJNA 1XNQM 3MJ5A 1UFZA 5EXSA 4B3SM 4M9ZA 1KYIA 5ITRA 1IN7A 3D8BA 1XWIA 2VF8A 4LGMA 4QHTA 5ITQA 5KPTA 4G4QA 2UUAM 1GL7A 2L6OA 3NWLA 4AZFA 4JI1M 1N32M 2QSFX 2D7HA 3FUXA 1H6UA 4HLQA 2G5GX 1Q3BA 4NRWA 2VIIA 1GVNA 2XGNA 3U60A 3LCVB 1W5TA 3A45A 3WHKA 1Z6TA 1J09A 3FUVA 4QHSA 4R71A 2UU9M 3SATA 1TH2A 1EE8A 4L6V6 3KFUG 5ITUA 1WJ7A 1XMQM 2C96A 3RFWA 4HEOA 3W68A 4W5WA 4Y28F 1L1ZA 3RGSA 3GLGE 1A5TA 2R4JA 4MH0E 4M9XA 1DO2A 4B7GA 5DFLA 3KOZE 3FUWA 3K92A 4JI0M 4LRTA 2QENA 4D81A 5EXPA 2LVOC 1FNNA 1SXJA 2Z7JA 4OVZA 4PT5A 5KPZA 1ZMUA 5IWAM 3AFHA 3R8FA 3E46A 4JI5M 2LVAA 2D7GA 2DENA 1OAOC 4LJ7A 4GMQA 4P16A 3J7AS 1N78A 4GEWA 1NNJA 4LF7M 3LQRA 1YUBA 2Z4RA 2LHCA 2ZTDA 3JAMS 5L8RF 2LVQD 4X64M 1IQPA 2J5YA 1K3WA 2O01F 2QCUA 4LF8M 1YE9A 4X65M 4G4RA 1IY2A 3LCUA 4IBEA
chains in the Genus database with same CATH topology
4IBDA 4LFBM 3GPYA 4L4UA 3IG5A 1MX0A 4B7HA 4DV4M 1XC8A 4MGIE 2C99A 3M0EA 1R2ZA 3AOEC 3GLHA 5C1BA 3FYCA 2XZUA 3CF0A 2DXIA 2YFQA 2K47A 3JR4A 1L1TA 1OJLA 3T38A 2XZFA 3TWLA 1GLNA 3GLIB 3KOWE 5KO3A 1S3SA 2XFSA 3OTOM 3L27A 4XGIA 4JI3M 4JN6A 2LH0A 3WHLA 2KZUA 1N75A 3SFZA 1TH3A 3B9PA 3U6EA 2ZANA 4D82A 4GH9A 1ZAEA 1K82A 2V1UA 3HHWA 2QPAA 1NJFA 2LXEA 1PM5A 1QAQA 4X62M 3FTDA 2CHVA 4QOSA 3E9SA 2L7IA 2Q2EB 3U5ZB 3AKZA 3KP1E 1XNRM 3A46A 5DNYA 3SYKA 4LF9M 1QVRA 4MB7A 2F5QA 1IY0A 5EP4A 2KZSA 3THGA 3SASA 1FJGM 5E6JA 3GPXA 1SXJB 4OVZB 4A3VB 2Y0TA 4REZA 5E26A 2ZAMA 4M0WA 4LJAA 5ITXA 4GITA 2DZOB 2DHRA 1PJIA 5ITTA 2LNHC 3I4VA 1IM2A 2EO2A 3T1YM 3GLFB 4M9SA 2C9CA 4DR2M 3FKEA 4QNRA 4KHPM 4G4OA 5FTKA 2XF3A 4NXMM 1TDHA 2F5SA 2M5ZA 2VQEM 2KEBA 3K2LA 3R9XB 4IBFA 4DUZM 5KQ8A 1L8QA 4FWGA 3LMMA 3TWMA 4L8RC 2XSZD 2UXCM 3QAUA 4FCVA 1L2CA 3GRVA 3HHZA 5LMUM 3M7GA 4R3DA 4DUYM 4DV2M 1HT1E 3A98B 4FCWA 4FVMA 4PCZA 2V1CA 3KVWA 1NHWC 5DYIA 3GPUA 1HNXM 1D2NA 3SMPA 4NXNM 2OQ4A 2E5LM 3HHYA 1KFVA 2CHQA 4FWDA 5EJCA 3EIHA 4EIWA 3K1JA 2UUCM 2F5PA 5KPRA 1SXJD 1IN5A 4HL4A 2R62A 1LV7A 4TUWA 3U6DA 2RGHA 1OFHA 4ITQA 2CV0A 2YR0A 2R46A 4YHHM 1J7KA 4DR1M 4DR3M 8CATA 1IY1A 4PDIA 1G41A 4FCTA 5BPVA 1E94E 2H1RA 2XEPA 3K8ZA 3MHVC 1X37A 2I7PA 1TGUA 1WXQA 1YSYA 2KRKA 5EQTA 4LF4M 4AG5A 2XH9A 5FTJA 3GP1A 4LFCM 4LZJA 2FNAA 3GRRA 1QANA 2FE8A 3DFZA 1HNWM 2ERCA 3SBJA 3HU1A 3SARA 1NVMA 3U61A 1PJJA 3L29A 3VK7A 3SAUA 4DV1M 2QBYB 1TH4A 4JXJA 2J7OA 2NQ8C 5BR8M 2DWNA 4NL4H 1NY5A 1N33M 1QAOA 3HJ8A 3TPZA 3KOYE 3SHFA 1DGBA 2C9OA 4CHTB 1XXHA 4R7GA 4AI6A 2RGOA 1W5SA 1R7RA 5FTMA 3KS8A 1DGHB 3AV0A 2KXEA 5IT9S 3KDSE 4KO8A 3IG8A 2XLJA 2ZM6M 1VDDA 2R4EA 4QOZC 3D8LA 3U6LA 2XFTA 4JI7M 2EA0A 1DGGA 4JI2M 4AW4A 5EXTA 2F5OA 2P5TA 4BLCA 3KSJA 3HWSA 3W0LB 3U60B 2KRUA 1UM8A 5A2QS 2AHMA 2J7NA 4KODA 2M60A 2DZNB 4CISA 4GIPA 3UMMA 1ZQ9A 3LVVA 4D80A 3SAWA 2DVWB 3FUTA 3GLGA 1IN4A 4LJ5A 3A42A 2A5YB 1Z5CA 1SXJE 4I81A 2VQFM 1G8PA 1JR3A 1HT2E 2EUCA 2YNMD 2BJVA 1G4AE 2Y20A 3HJQA 4IBIA 1E9SA 5EXXA 3KOXE 2R45A 3FTFA 4MGKE 3HKPA 4K0KM 2R65A 3SC3A 4XBOA 1SXJC 3AOEA 5EP1A 3SHGB 5C18A 4OU7A 2O5RA 2I7NA 4WURA 1L2BA 3U6CA 2L09A 1QQWA 3KS4A 4B3TM 1OFIA 3LVWA 3PVSA 1IBLM 2Z3XA 3FTEA 5FSWA 5IZ7D 4ZPXA 3HGIA 3VKHA 4LJ6A 1T3TA 4L15A 2Y0QA 3FD9A 3GLHB 3NBIA 1QYRA 4NRVA 3TWKA 3SAVA 1KSFX 2DWMA 4I4LA 3J2PB 3RE8A 3GRUA 4IIWA 2UXDM 2CUZA 4II7A 2CE7A 4WW0A 1IXZA 4BBAA 1HNZM 4GRIA 4B3MM 1MU5A 1XXHB 2ZBKB 3L28A 1K3XA 1NJGA 1XHBA 4MGHA 4MGZE 4LF5M 4AKGA 2D7EA 3PXGA 3LQQA 4NSOB 1Q39A 4LJ8A 3GRYA 3BOSA 2V6ZM 3I51A 1IN8A 3J27B 2HHHM 3VFDA 3PNYA 2XSZA 3I4YA 3RGPA 4BB9A 4KLNA 3SYLA 3UZUA 3CF2A 1XMOM 2CEAA 3DA1A 4MM3B 3U5ZA 4B08A 4RF0A 1HR0M 1HQCA 4G6ZA 4B7FA 3M6AA 2R18A 1Z59A 2ZAOA 4I5SA 5JI3E 2UXBM 4L16A 4IBGA 4DR6M 1NHGC 3U6QA 1I94M 3GLGB 2BNKA 2HL7A 4AQYM 5FTLA 3CTWB 4FW9A 1IXSB 4CGYB 3GQ3A 3L2AA 1IBKM 4B3RM 2G8LA 3HU3A 4GKKM 5ITXE 4M0DA 4Z6YA 3J81S 4DV6M 1QZMA 4JI6M 4LRSA 2Y21A 3HJSA 4LFAM 3VLFB 3ZH9B 3GO8A 4G4NA 3AJIB 3EIEA 2CHGA 3MK6A 3T1HM 3AOGA 4IBJA 5EP2A 3VDPA 3GLFA 1Q3CA 2L7HA 3VDUA 1L2DA 3GPPA 1IBMM 4NSRA 2CFOA 3E4RA 4NOOB 4OX9M 2QZ4A 2QP9X 3TQSA 2LWXA 4X66M 1QAMA 3U6SA 3L25A 4PD2A 1C1KA 1G3IA 3TL4X 3CF6E 4DV7M 3J7BA 2RKOA 4IBBA 2YQZA 1GKIA 4DV5M 4LCBA 2C98A 4I8OA 4JV5M 1NNUC 2DWZB 4JI4M 3Q8XA 5ITYA 3J80S 1N77A 2HKJA 1J5EM 4OW0A 3DOAA 3JR5A 4LJ9A 1ORYB 2CV2A 2F4VM 4DV3M 2HCBA 2FOIC 4GC5A 3T15A 1HQYE 3HU2A 4LZZA 4DR5M 5EP3A 5F3WA 1IN6A 3W0FA 4L78A 3U6PA 4DV0M 1E32A 3FUUA 5H37D 2UUBM 3U6OA 5FLXS 5FTNA 1TDZA 4IBCA 1GL6A 4GC9A 4MGYE 5LMNM 1R6BX 1Z5AA 1NY6A 1JR3D 3UK6A 1E9RA 2W82A 5GKNA 3ZC7B 3KSXA 3ZCBB 4PDGA 3DZDA 3QWLA 4IJEA 5KQDA 1R2YA 4GKJM 4JYAM 2BJWA 2X49A 4FWHA 2X4AA 4Z8XA 1NSFA 3PFIA 4FD2A 4LG2A 4LJ4A 4LY6A 4AKIA 1JQJC 4AG6A 2CV1A 2F5NA 3GQ5A 4RNAA 2C5RA 3TE6A 3HHXA 3PNVA 2FFJA 3C58A 1N34M 3VK8A 4RF1A 3FYDA 4GHAA 1IXRC 1N36M 1Z5BA 2Z4SA 4DR7M 3U61B 1I4WA 3KXEC 2OPFA 4IBKA 1DGFA 2DWLA 2QBYA 7CATA 5JI2E 1DO0A 4DR4M 2KW0A 4LF6M 3AL0C 3H4MA 3U6MA 2JA2A 4IJFA 2KA6B 4GHLA 4S12A 5DYGA 1G59A 3KW6A 3SMSA 3GLIA 3VKGA 4QNMA 4LGYA 3L26A 4YY3M 5IREB 3KP0E 3ILKA 3UGJA 4JI8M 2X8AA 1DGHA 3FTCA 3GQ4A 4AKHA 3UJNA 1XNQM 3MJ5A 5EXSA 4B3SM 4M9ZA 1KYIA 5ITRA 1IN7A 3D8BA 1XWIA 4LGMA 4QHTA 5ITQA 5KPTA 4G4QA 2UUAM 1GL7A 2L6OA 3NWLA 4AZFA 4JI1M 1N32M 2D7HA 3FUXA 1H6UA 4HLQA 2G5GX 1Q3BA 4NRWA 2VIIA 1GVNA 2XGNA 3U60A 1W5TA 3A45A 3WHKA 1Z6TA 1J09A 3FUVA 4QHSA 2UU9M 3SATA 1TH2A 1EE8A 3KFUG 5ITUA 1XMQM 2C96A 3RFWA 4W5WA 1L1ZA 3RGSA 2R4JA 4MH0E 4M9XA 1DO2A 4B7GA 3KOZE 3FUWA 3K92A 4JI0M 4LRTA 2QENA 4D81A 5EXPA 1FNNA 1SXJA 2Z7JA 4OVZA 4PT5A 5KPZA 5IWAM 3AFHA 3R8FA 4JI5M 2D7GA 4LJ7A 4GMQA 4P16A 3J7AS 1N78A 1NNJA 4LF7M 3LQRA 1YUBA 2Z4RA 3JAMS 4X64M 1IQPA 1K3WA 2QCUA 4LF8M 1YE9A 4X65M 4G4RA 1IY2A 4IBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FTN A;  1SXJ D;  1IN5 A;  4ZPX A;  4L4U A;  4LJ6 A;  2R62 A;  1LV7 A;  1R6B X;  1NY6 A;  1JR3 D;  3UK6 A;  4L15 A;  1OFH A;  2C99 A;  3M0E A;  3GLH B;  3DZD A;  3GLH A;  1J7K A;  5C1B A;  1KSF X;  1IY1 A;  4I4L A;  1G41 A;  3CF0 A;  2BJW A;  1E94 E;  4FCT A;  4FWH A;  4Z8X A;  1NSF A;  1OJL A;  3MHV C;  1X37 A;  3PFI A;  2CE7 A;  4FD2 A;  1IXZ A;  4LJ4 A;  4WW0 A;  4LY6 A;  1JQJ C;  3GLI B;  1XXH B;  1NJG A;  2KRK A;  5EQT A;  1S3S A;  3PXG A;  5FTJ A;  4JN6 A;  3WHL A;  4LJ8 A;  3B9P A;  2FNA A;  2ZAN A;  1IXR C;  2V6Z M;  3BOS A;  4D82 A;  2Z4S A;  2V1U A;  3HU1 A;  1IN8 A;  2QPA A;  1NJF A;  3VFD A;  3U61 B;  1NVM A;  2XSZ A;  4KLN A;  3SYL A;  3CF2 A;  2CHV A;  4QOS A;  2QBY B;  2QBY A;  5JI2 E;  2CEA A;  1DO0 A;  3U5Z B;  1NY5 A;  3H4M A;  1HQC A;  3SYK A;  3M6A A;  2C9O A;  5DYG A;  3KW6 A;  1XXH A;  2ZAO A;  5JI3 E;  3GLI A;  4L16 A;  1QVR A;  4QNM A;  3GLG B;  1W5S A;  1R7R A;  5FTM A;  1IY0 A;  5EP4 A;  5FTL A;  4FW9 A;  1IXS B;  2X8A A;  3KDS E;  4KO8 A;  1SXJ B;  4A3V B;  3HU3 A;  5EXS A;  2ZAM A;  4LJA A;  1KYI A;  1IN7 A;  5EXT A;  1QZM A;  3D8B A;  1XWI A;  2DZO B;  4GIT A;  4LGM A;  4LRS A;  4QHT A;  3VLF B;  2DHR A;  3ZH9 B;  3HWS A;  3AJI B;  2CHG A;  3EIE A;  1UM8 A;  2VII A;  3U60 B;  1IM2 A;  1W5T A;  5EP2 A;  3WHK A;  4QHS A;  3GLF B;  3GLF A;  4KOD A;  2C9C A;  2DZN B;  2C96 A;  4QNR A;  4D80 A;  2DVW B;  5FTK A;  2QZ4 A;  2QP9 X;  3GLG A;  1IN4 A;  1DO2 A;  4LJ5 A;  4D81 A;  4LRT A;  2QEN A;  1SXJ E;  5EXP A;  1C1K A;  1G3I A;  1FNN A;  1SXJ A;  4I81 A;  1L8Q A;  4FWG A;  2RKO A;  3R8F A;  1JR3 A;  2XSZ D;  1HT2 E;  4FCV A;  2BJV A;  1G4A E;  4LCB A;  4LJ7 A;  2C98 A;  5EXX A;  2DWZ B;  1HT1 E;  4FCW A;  2Z4R A;  4LJ9 A;  5DYI A;  2R65 A;  1D2N A;  2HCB A;  3SC3 A;  1SXJ C;  5EP1 A;  1HQY E;  3HU2 A;  4LZZ A;  1IQP A;  5C18 A;  5EP3 A;  1IN6 A;  2CHQ A;  3K1J A;  4FWD A;  3EIH A;  4EIW A;  1E32 A;  1OFI A;  3PVS A;  1IY2 A; 
#chains in the Genus database with same CATH topology
 4IBD A;  4LFB M;  3GPY A;  4L4U A;  3IG5 A;  1MX0 A;  4B7H A;  4DV4 M;  1XC8 A;  2FH0 A;  4MGI E;  2C99 A;  3M0E A;  2DHY A;  1MN3 A;  1R2Z A;  3AOE C;  3GLH A;  5C1B A;  3FYC A;  3C3E A;  2XZU A;  2MH8 A;  2JP7 A;  3CF0 A;  2DXI A;  2YFQ A;  2K47 A;  3JR4 A;  3K9P A;  1L1T A;  1OJL A;  3T38 A;  2XZF A;  1OIZ A;  3TWL A;  1GLN A;  3GLI B;  3KOW E;  5KO3 A;  1S3S A;  2QQ8 A;  2XFS A;  3OTO M;  1P3Q Q;  3L27 A;  4XGI A;  4JI3 M;  1R5L A;  4JN6 A;  2LH0 A;  3WHL A;  2KZU A;  2DNA A;  1N75 A;  3SFZ A;  1TH3 A;  3B9P A;  3U6E A;  2ZAN A;  4D82 A;  4GH9 A;  1ZAE A;  1K82 A;  2V1U A;  3HHW A;  1OIP A;  2QPA A;  4XK8 F;  1NJF A;  1PRB A;  2EKK A;  2LXE A;  1QAQ A;  1PM5 A;  4X62 M;  2OOB A;  3FRH A;  3FTD A;  2CHV A;  4QOS A;  3E9S A;  2L7I A;  2Q2E B;  3U5Z B;  2APL A;  3AKZ A;  3KP1 E;  1T6O A;  3A46 A;  1XNR M;  2GNO A;  5DNY A;  3SYK A;  4LF9 M;  1NV8 A;  1QVR A;  4MB7 A;  2F5Q A;  2GQF A;  1IY0 A;  5EP4 A;  2KZS A;  2LHG A;  3THG A;  3SAS A;  5E6J A;  1FJG M;  2L2D A;  3GPX A;  1GJT A;  1SXJ B;  4OVZ B;  2G3Q A;  3C3D A;  4A3V B;  2Y0T A;  4REZ A;  5E26 A;  2ZAM A;  4M0W A;  4LJA A;  1C7Y A;  5ITX A;  1SG9 A;  1WR1 B;  2JY7 A;  4GIT A;  2JY6 B;  2DZO B;  1D0K A;  2DHR A;  2EKF A;  3V76 A;  2KDL A;  1PJI A;  5ITT A;  2LNH C;  3I4V A;  1IM2 A;  2OO9 A;  2EO2 A;  3T1Y M;  3GLF B;  2JUJ A;  4M9S A;  3FE3 A;  4RKU F;  2C9C A;  3NBX X;  3FKE A;  4QNR A;  4DR2 M;  2CRU A;  4KHP M;  2BWE A;  2WSF F;  5FTK A;  4G4O A;  2XF3 A;  2DI0 A;  4NXM M;  1TDH A;  2F5S A;  1V34 A;  2M5Z A;  2VQE M;  1GAB A;  3K9O A;  2KEB A;  3K2L A;  3R9X B;  4IBF A;  4DUZ M;  5KQ8 A;  3ZQJ A;  1L8Q A;  4FWG A;  3LMM A;  3TWM A;  4L8R C;  2XSZ D;  2UXC M;  3QAU A;  4FCV A;  1L2C A;  3GRV A;  3HHZ A;  5LMU M;  3M7G A;  4R3D A;  4DUY M;  2DAG A;  3B7Q A;  4DV2 M;  1LTM A;  1HT1 E;  3A98 B;  4FCW A;  4FVM A;  3QYE A;  4PCZ A;  2JY8 A;  2V1C A;  3KVW A;  1NHW C;  2RRU A;  5DYI A;  3GPU A;  1D2N A;  1HNX M;  3SMP A;  4NXN M;  2OQ4 A;  2E5L M;  1AIP C;  1D0M A;  3HHY A;  1KFV A;  2CHQ A;  1WGN A;  4FWD A;  5EJC A;  3EIH A;  4EIW A;  4G3O A;  3K1J A;  2UUC M;  2F5P A;  2L4E A;  5KPR A;  1SXJ D;  1IN5 A;  1VDL A;  3C9P A;  4HL4 A;  2R62 A;  1LV7 A;  1OAI A;  4TUW A;  3U6D A;  2RGH A;  3LW5 F;  1NV9 A;  1OFH A;  1OTR A;  1JR3 E;  2JNH A;  2CV0 A;  2YR0 A;  2R46 A;  4ITQ A;  4P17 A;  4YHH M;  1J7K A;  4DR1 M;  4DR3 M;  8CAT A;  1IY1 A;  4PDI A;  1G41 A;  1YLA A;  4FCT A;  1E94 E;  5BPV A;  2H1R A;  2XEP A;  3K8Z A;  2B3T A;  2DZL A;  1NO1 A;  3MHV C;  1X37 A;  2I7P A;  1TGU A;  2JWS A;  1WXQ A;  4DBG B;  1EFU B;  1YSY A;  2KRK A;  5EQT A;  4LF4 M;  1PGY A;  2XH9 A;  4AG5 A;  2KHH A;  4F2L A;  5FTJ A;  4CIZ A;  2DAM A;  3GP1 A;  1WHC A;  1V33 A;  4LFC M;  4CJ6 A;  4LZJ A;  2H5X A;  2FNA A;  3GRR A;  1QAN A;  2FE8 A;  3DFZ A;  1HNW M;  2ERC A;  3SBJ A;  3HU1 A;  3B7Z A;  3SAR A;  1NVM A;  3U61 A;  1PJJ A;  3L29 A;  3VK7 A;  1TF0 B;  2JZ0 A;  3SAU A;  4DV1 M;  2QBY B;  1TH4 A;  4JXJ A;  2J7O A;  2NQ8 C;  5BR8 M;  2DWN A;  4NL4 H;  1NY5 A;  1R4G A;  1N33 M;  1QAO A;  3HJ8 A;  3TPZ A;  3KOY E;  3SHF A;  1BVS A;  3GLI E;  1DGB A;  2C9O A;  4CHT B;  1XXH A;  4R7G A;  4AI6 A;  2RGO A;  2LVP C;  2WSC F;  1W5S A;  1R7R A;  5FTM A;  3KS8 A;  1DGH B;  3AV0 A;  2KXE A;  5IT9 S;  3KDS E;  4KO8 A;  3IG8 A;  2XLJ A;  2ZM6 M;  2KNA A;  1HJP A;  1VDD A;  2R4E A;  4QOZ C;  3D8L A;  3U6L A;  2XFT A;  4JI7 M;  2EA0 A;  1DGG A;  2O25 A;  4JI2 M;  4AW4 A;  5EXT A;  3I01 M;  2F5O A;  2P5T A;  4BLC A;  2K0B X;  3KSJ A;  3HWS A;  3W0L B;  3U60 B;  2KRU A;  1UM8 A;  4KT0 F;  5A2Q S;  2AHM A;  2J7N A;  4KOD A;  2M60 A;  2DZN B;  4CIS A;  2K6B A;  4GIP A;  1QZE A;  2JXN A;  3BXW A;  3UMM A;  1ZQ9 A;  2CWB A;  2LBC A;  3LVV A;  4D80 A;  3SAW A;  2DVW B;  3FUT A;  3GLG A;  1IN4 A;  4LJ5 A;  3A42 A;  2KNZ A;  2A5Y B;  1Z5C A;  2VF7 A;  2Z8Y M;  1IXS A;  1PJT A;  1SXJ E;  2DKL A;  4I81 A;  1T43 A;  2VQF M;  3HY5 A;  1G8P A;  1JR3 A;  1HT2 E;  2EUC A;  2YNM D;  3B89 A;  2BJV A;  1G4A E;  2Y20 A;  3HJQ A;  4IBI A;  4ANR A;  2L4F A;  1E9S A;  5EXX A;  3KOX E;  2R45 A;  3W67 A;  4F1I A;  3FTF A;  4MGK E;  3HKP A;  3GLF E;  4K0K M;  1XB2 B;  1RU3 A;  2R65 A;  3SC3 A;  2R6F A;  4XBO A;  1SXJ C;  3AOE A;  1DV0 A;  5EP1 A;  3SHG B;  5C18 A;  3IEC A;  4OU7 A;  1ZV1 A;  2O5R A;  2I7N A;  4WUR A;  1L2B A;  3U6C A;  2L09 A;  1QQW A;  3KS4 A;  4B3T M;  1OFI A;  3LVW A;  3PVS A;  1IBL M;  2K9D A;  2Z3X A;  3FTE A;  2DAE A;  5FSW A;  5IZ7 D;  4ZPX A;  3HGI A;  3VKH A;  4LJ6 A;  1T3T A;  4WP2 A;  1G71 A;  2CP8 A;  1VEG A;  4L15 A;  2Y0Q A;  3FD9 A;  3GLH B;  1QUS A;  3NBI A;  1QYR A;  4NRV A;  3TWK A;  3SAV A;  1KSF X;  2DWM A;  2OOA A;  4I4L A;  3J2P B;  3F92 A;  3RE8 A;  2R44 A;  3GRU A;  4IIW A;  2UXD M;  3H4J A;  1IFY A;  2CUZ A;  4II7 A;  2CE7 A;  4WW0 A;  1IXZ A;  4BBA A;  1HNZ M;  4GRI A;  4B3M M;  1MU5 A;  1XXH B;  2ZBK B;  3L28 A;  1K3X A;  1NJG A;  1XHB A;  4MGH A;  4MGZ E;  4LF5 M;  4AKG A;  2D7E A;  1WIV A;  3PXG A;  3LQQ A;  1EIJ A;  4NSO B;  1Q39 A;  4LJ8 A;  2QHO B;  3GRY A;  3BOS A;  2V6Z M;  3QYB A;  3I51 A;  1IN8 A;  3J27 B;  2HHH M;  2MGW A;  1OKS A;  2BWB A;  1MJG M;  3VFD A;  3PNY A;  2XSZ A;  3I4Y A;  3RGP A;  4BB9 A;  4KLN A;  3SYL A;  3UZU A;  3CF2 A;  1TR8 A;  1XMO M;  2CEA A;  3DA1 A;  4MM3 B;  3IHP A;  4B08 A;  4RF0 A;  3U5Z A;  1HR0 M;  1HQC A;  4G6Z A;  1PJQ A;  1VEK A;  4B7F A;  3M6A A;  1QUT A;  2R18 A;  1Z59 A;  2ZAO A;  4I5S A;  5JI3 E;  2UXB M;  4L16 A;  4IBG A;  4DR6 M;  1NHG C;  3U6Q A;  1I94 M;  1JB0 F;  3GLG B;  1OQY A;  2BNK A;  2HL7 A;  4AQY M;  5FTL A;  1GO5 A;  3CTW B;  4FW9 A;  1IXS B;  4CGY B;  1CUK A;  3GQ3 A;  3L2A A;  1IBK M;  1V92 A;  4B3R M;  2G8L A;  1VG5 A;  3HU3 A;  5ITX E;  4GKK M;  4UN2 B;  3HX3 A;  4M0D A;  4Z6Y A;  3J81 S;  4DV6 M;  1QZM A;  4JI6 M;  4LRS A;  2Y21 A;  3HJS A;  4LFA M;  3VLF B;  3ZH9 B;  3Q8G A;  3B7N A;  3GO8 A;  4G4N A;  3AJI B;  2CHG A;  3EIE A;  2ZTC A;  3MK6 A;  4Q7J A;  3AOG A;  3T1H M;  4IBJ A;  2VDB B;  5EP2 A;  1Y8G A;  3VDP A;  3GLF A;  1Q3C A;  2L7H A;  3VDU A;  2HWJ A;  2KNV A;  3GPP A;  1L2D A;  4NSR A;  1IBM M;  2CFO A;  3E4R A;  4NOO B;  4OX9 M;  2QZ4 A;  4NC6 A;  2QP9 X;  3TQS A;  2LWX A;  4X66 M;  1QAM A;  3U6S A;  1QDR A;  3L25 A;  4PD2 A;  1C1K A;  1G3I A;  3TL4 X;  3T6P A;  3CF6 E;  4DV7 M;  2EJS A;  3J7B A;  2RKO A;  4IBB A;  2YQZ A;  1GKI A;  4DV5 M;  2FS1 A;  4LCB A;  2C98 A;  4I8O A;  4JV5 M;  1NNU C;  2DWZ B;  3BBZ A;  3Q8X A;  4JI4 M;  1GJS A;  5ITY A;  3J80 S;  1N77 A;  2HKJ A;  1J5E M;  4OW0 A;  2DAI A;  3CGW A;  3DOA A;  2DAK A;  2LVN C;  3JR5 A;  3B74 A;  4LJ9 A;  1ORY B;  2CV2 A;  2F4V M;  4DV3 M;  2HCB A;  2WZJ A;  2FOI C;  1D0L A;  4GC5 A;  3T15 A;  1F4I A;  1HQY E;  3HU2 A;  4LZZ A;  4DR5 M;  5EP3 A;  5F3W A;  1IN6 A;  3W0F A;  4L78 A;  3U6P A;  4DV0 M;  1E32 A;  3FUU A;  3FRI A;  5H37 D;  2UUB M;  3U6O A;  5FLX S;  5FTN A;  1TDZ A;  4IBC A;  1GL6 A;  4GC9 A;  4MGY E;  5LMN M;  1R6B X;  1Z5A A;  1NY6 A;  1JR3 D;  3UK6 A;  2MRO B;  1E9R A;  1QDT A;  1VQ1 A;  2W82 A;  5GKN A;  3HZJ A;  3ZC7 B;  3KSX A;  3ZCB B;  4PDG A;  3DZD A;  3QWL A;  4IJE A;  1AUA A;  5KQD A;  2HAK A;  1R2Y A;  4GKJ M;  4JYA M;  2BJW A;  2X49 A;  4FWH A;  2X4A A;  2N35 A;  2LTU A;  1NSF A;  2JZ1 A;  3E21 A;  2WSE F;  3PFI A;  4FD2 A;  4Z8X A;  4LG2 A;  4LJ4 A;  4LY6 A;  4AKI A;  2JY5 A;  1JQJ C;  4AG6 A;  2CV1 A;  2F5N A;  3GQ5 A;  4RNA A;  2C5R A;  3TE6 A;  3HHX A;  3PNV A;  1Q02 A;  2FFJ A;  3C58 A;  1N34 M;  1VEJ A;  1TTE A;  3VK8 A;  4RF1 A;  3FYD A;  4GHA A;  1IXR C;  1WGL A;  1N36 M;  1Z5B A;  2Z4S A;  4DR7 M;  2MR9 A;  1I4W A;  3U61 B;  3GLH E;  3KXE C;  2OPF A;  4IBK A;  1DGF A;  2DWL A;  2QBY A;  1ZMW A;  7CAT A;  5JI2 E;  1DO0 A;  4DR4 M;  3I04 M;  2KW0 A;  4LF6 M;  3AL0 C;  3H4M A;  3U6M A;  1PJS A;  2JA2 A;  1XXH E;  4IJF A;  2KA6 B;  1ZMV A;  4S12 A;  4GHL A;  5DYG A;  2MJ5 B;  3KW6 A;  3SMS A;  3GLI A;  2R0I A;  1G59 A;  3VKG A;  4QNM A;  3MMP A;  4LGY A;  3L26 A;  4YY3 M;  5IRE B;  3KP0 E;  3ILK A;  3UGJ A;  4JI8 M;  2QNJ A;  1DGH A;  2X8A A;  3FTC A;  3GQ4 A;  4AKH A;  3UJN A;  1XNQ M;  3MJ5 A;  1UFZ A;  5EXS A;  4B3S M;  4M9Z A;  1KYI A;  5ITR A;  1IN7 A;  3D8B A;  1XWI A;  2VF8 A;  4LGM A;  4QHT A;  5ITQ A;  5KPT A;  4G4Q A;  2UUA M;  1GL7 A;  2L6O A;  3NWL A;  4AZF A;  4JI1 M;  1N32 M;  2QSF X;  2D7H A;  3FUX A;  1H6U A;  4HLQ A;  2G5G X;  1Q3B A;  4NRW A;  2VII A;  1GVN A;  2XGN A;  3U60 A;  3LCV B;  1W5T A;  3A45 A;  3WHK A;  1Z6T A;  1J09 A;  3FUV A;  4QHS A;  4R71 A;  2UU9 M;  3SAT A;  1TH2 A;  1EE8 A;  4L6V 6;  3KFU G;  5ITU A;  1WJ7 A;  1XMQ M;  2C96 A;  3RFW A;  4HEO A;  3W68 A;  4W5W A;  4Y28 F;  1L1Z A;  3RGS A;  3GLG E;  1A5T A;  2R4J A;  4MH0 E;  4M9X A;  1DO2 A;  4B7G A;  5DFL A;  3KOZ E;  3FUW A;  3K92 A;  4JI0 M;  4LRT A;  2QEN A;  4D81 A;  5EXP A;  2LVO C;  1FNN A;  1SXJ A;  2Z7J A;  4OVZ A;  4PT5 A;  5KPZ A;  1ZMU A;  5IWA M;  3AFH A;  3R8F A;  3E46 A;  4JI5 M;  2LVA A;  2D7G A;  2DEN A;  1OAO C;  4LJ7 A;  4GMQ A;  4P16 A;  3J7A S;  1N78 A;  4GEW A;  1NNJ A;  4LF7 M;  3LQR A;  1YUB A;  2Z4R A;  2LHC A;  2ZTD A;  3JAM S;  5L8R F;  2LVQ D;  4X64 M;  1IQP A;  2J5Y A;  1K3W A;  2O01 F;  2QCU A;  4LF8 M;  1YE9 A;  4X65 M;  4G4R A;  1IY2 A;  3LCU A;  4IBE A; 
#chains in the Genus database with same CATH homology
 4IBD A;  4LFB M;  3GPY A;  4L4U A;  3IG5 A;  1MX0 A;  4B7H A;  4DV4 M;  1XC8 A;  4MGI E;  2C99 A;  3M0E A;  1R2Z A;  3AOE C;  3GLH A;  5C1B A;  3FYC A;  2XZU A;  3CF0 A;  2DXI A;  2YFQ A;  2K47 A;  3JR4 A;  1L1T A;  1OJL A;  3T38 A;  2XZF A;  3TWL A;  1GLN A;  3GLI B;  3KOW E;  5KO3 A;  1S3S A;  2XFS A;  3OTO M;  3L27 A;  4XGI A;  4JI3 M;  4JN6 A;  2LH0 A;  3WHL A;  2KZU A;  1N75 A;  3SFZ A;  1TH3 A;  3B9P A;  3U6E A;  2ZAN A;  4D82 A;  4GH9 A;  1ZAE A;  1K82 A;  2V1U A;  3HHW A;  2QPA A;  1NJF A;  2LXE A;  1PM5 A;  1QAQ A;  4X62 M;  3FTD A;  2CHV A;  4QOS A;  3E9S A;  2L7I A;  2Q2E B;  3U5Z B;  3AKZ A;  3KP1 E;  1XNR M;  3A46 A;  5DNY A;  3SYK A;  4LF9 M;  1QVR A;  4MB7 A;  2F5Q A;  1IY0 A;  5EP4 A;  2KZS A;  3THG A;  3SAS A;  1FJG M;  5E6J A;  3GPX A;  1SXJ B;  4OVZ B;  4A3V B;  2Y0T A;  4REZ A;  5E26 A;  2ZAM A;  4M0W A;  4LJA A;  5ITX A;  4GIT A;  2DZO B;  2DHR A;  1PJI A;  5ITT A;  2LNH C;  3I4V A;  1IM2 A;  2EO2 A;  3T1Y M;  3GLF B;  4M9S A;  2C9C A;  4DR2 M;  3FKE A;  4QNR A;  4KHP M;  4G4O A;  5FTK A;  2XF3 A;  4NXM M;  1TDH A;  2F5S A;  2M5Z A;  2VQE M;  2KEB A;  3K2L A;  3R9X B;  4IBF A;  4DUZ M;  5KQ8 A;  1L8Q A;  4FWG A;  3LMM A;  3TWM A;  4L8R C;  2XSZ D;  2UXC M;  3QAU A;  4FCV A;  1L2C A;  3GRV A;  3HHZ A;  5LMU M;  3M7G A;  4R3D A;  4DUY M;  4DV2 M;  1HT1 E;  3A98 B;  4FCW A;  4FVM A;  4PCZ A;  2V1C A;  3KVW A;  1NHW C;  5DYI A;  3GPU A;  1HNX M;  1D2N A;  3SMP A;  4NXN M;  2OQ4 A;  2E5L M;  3HHY A;  1KFV A;  2CHQ A;  4FWD A;  5EJC A;  3EIH A;  4EIW A;  3K1J A;  2UUC M;  2F5P A;  5KPR A;  1SXJ D;  1IN5 A;  4HL4 A;  2R62 A;  1LV7 A;  4TUW A;  3U6D A;  2RGH A;  1OFH A;  4ITQ A;  2CV0 A;  2YR0 A;  2R46 A;  4YHH M;  1J7K A;  4DR1 M;  4DR3 M;  8CAT A;  1IY1 A;  4PDI A;  1G41 A;  4FCT A;  5BPV A;  1E94 E;  2H1R A;  2XEP A;  3K8Z A;  3MHV C;  1X37 A;  2I7P A;  1TGU A;  1WXQ A;  1YSY A;  2KRK A;  5EQT A;  4LF4 M;  4AG5 A;  2XH9 A;  5FTJ A;  3GP1 A;  4LFC M;  4LZJ A;  2FNA A;  3GRR A;  1QAN A;  2FE8 A;  3DFZ A;  1HNW M;  2ERC A;  3SBJ A;  3HU1 A;  3SAR A;  1NVM A;  3U61 A;  1PJJ A;  3L29 A;  3VK7 A;  3SAU A;  4DV1 M;  2QBY B;  1TH4 A;  4JXJ A;  2J7O A;  2NQ8 C;  5BR8 M;  2DWN A;  4NL4 H;  1NY5 A;  1N33 M;  1QAO A;  3HJ8 A;  3TPZ A;  3KOY E;  3SHF A;  1DGB A;  2C9O A;  4CHT B;  1XXH A;  4R7G A;  4AI6 A;  2RGO A;  1W5S A;  1R7R A;  5FTM A;  3KS8 A;  1DGH B;  3AV0 A;  2KXE A;  5IT9 S;  3KDS E;  4KO8 A;  3IG8 A;  2XLJ A;  2ZM6 M;  1VDD A;  2R4E A;  4QOZ C;  3D8L A;  3U6L A;  2XFT A;  4JI7 M;  2EA0 A;  1DGG A;  4JI2 M;  4AW4 A;  5EXT A;  2F5O A;  2P5T A;  4BLC A;  3KSJ A;  3HWS A;  3W0L B;  3U60 B;  2KRU A;  1UM8 A;  5A2Q S;  2AHM A;  2J7N A;  4KOD A;  2M60 A;  2DZN B;  4CIS A;  4GIP A;  3UMM A;  1ZQ9 A;  3LVV A;  4D80 A;  3SAW A;  2DVW B;  3FUT A;  3GLG A;  1IN4 A;  4LJ5 A;  3A42 A;  2A5Y B;  1Z5C A;  1SXJ E;  4I81 A;  2VQF M;  1G8P A;  1JR3 A;  1HT2 E;  2EUC A;  2YNM D;  2BJV A;  1G4A E;  2Y20 A;  3HJQ A;  4IBI A;  1E9S A;  5EXX A;  3KOX E;  2R45 A;  3FTF A;  4MGK E;  3HKP A;  4K0K M;  2R65 A;  3SC3 A;  4XBO A;  1SXJ C;  3AOE A;  5EP1 A;  3SHG B;  5C18 A;  4OU7 A;  2O5R A;  2I7N A;  4WUR A;  1L2B A;  3U6C A;  2L09 A;  1QQW A;  3KS4 A;  4B3T M;  1OFI A;  3LVW A;  3PVS A;  1IBL M;  2Z3X A;  3FTE A;  5FSW A;  5IZ7 D;  4ZPX A;  3HGI A;  3VKH A;  4LJ6 A;  1T3T A;  4L15 A;  2Y0Q A;  3FD9 A;  3GLH B;  3NBI A;  1QYR A;  4NRV A;  3TWK A;  3SAV A;  1KSF X;  2DWM A;  4I4L A;  3J2P B;  3RE8 A;  3GRU A;  4IIW A;  2UXD M;  2CUZ A;  4II7 A;  2CE7 A;  4WW0 A;  1IXZ A;  4BBA A;  1HNZ M;  4GRI A;  4B3M M;  1MU5 A;  1XXH B;  2ZBK B;  3L28 A;  1K3X A;  1NJG A;  1XHB A;  4MGH A;  4MGZ E;  4LF5 M;  4AKG A;  2D7E A;  3PXG A;  3LQQ A;  4NSO B;  1Q39 A;  4LJ8 A;  3GRY A;  3BOS A;  2V6Z M;  3I51 A;  1IN8 A;  3J27 B;  2HHH M;  3VFD A;  3PNY A;  2XSZ A;  3I4Y A;  3RGP A;  4BB9 A;  4KLN A;  3SYL A;  3UZU A;  3CF2 A;  1XMO M;  2CEA A;  3DA1 A;  4MM3 B;  3U5Z A;  4B08 A;  4RF0 A;  1HR0 M;  1HQC A;  4G6Z A;  4B7F A;  3M6A A;  2R18 A;  1Z59 A;  2ZAO A;  4I5S A;  5JI3 E;  2UXB M;  4L16 A;  4IBG A;  4DR6 M;  1NHG C;  3U6Q A;  1I94 M;  3GLG B;  2BNK A;  2HL7 A;  4AQY M;  5FTL A;  3CTW B;  4FW9 A;  1IXS B;  4CGY B;  3GQ3 A;  3L2A A;  1IBK M;  4B3R M;  2G8L A;  3HU3 A;  4GKK M;  5ITX E;  4M0D A;  4Z6Y A;  3J81 S;  4DV6 M;  1QZM A;  4JI6 M;  4LRS A;  2Y21 A;  3HJS A;  4LFA M;  3VLF B;  3ZH9 B;  3GO8 A;  4G4N A;  3AJI B;  3EIE A;  2CHG A;  3MK6 A;  3T1H M;  3AOG A;  4IBJ A;  5EP2 A;  3VDP A;  3GLF A;  1Q3C A;  2L7H A;  3VDU A;  1L2D A;  3GPP A;  1IBM M;  4NSR A;  2CFO A;  3E4R A;  4NOO B;  4OX9 M;  2QZ4 A;  2QP9 X;  3TQS A;  2LWX A;  4X66 M;  1QAM A;  3U6S A;  3L25 A;  4PD2 A;  1C1K A;  1G3I A;  3TL4 X;  3CF6 E;  4DV7 M;  3J7B A;  2RKO A;  4IBB A;  2YQZ A;  1GKI A;  4DV5 M;  4LCB A;  2C98 A;  4I8O A;  4JV5 M;  1NNU C;  2DWZ B;  4JI4 M;  3Q8X A;  5ITY A;  3J80 S;  1N77 A;  2HKJ A;  1J5E M;  4OW0 A;  3DOA A;  3JR5 A;  4LJ9 A;  1ORY B;  2CV2 A;  2F4V M;  4DV3 M;  2HCB A;  2FOI C;  4GC5 A;  3T15 A;  1HQY E;  3HU2 A;  4LZZ A;  4DR5 M;  5EP3 A;  5F3W A;  1IN6 A;  3W0F A;  4L78 A;  3U6P A;  4DV0 M;  1E32 A;  3FUU A;  5H37 D;  2UUB M;  3U6O A;  5FLX S;  5FTN A;  1TDZ A;  4IBC A;  1GL6 A;  4GC9 A;  4MGY E;  5LMN M;  1R6B X;  1Z5A A;  1NY6 A;  1JR3 D;  3UK6 A;  1E9R A;  2W82 A;  5GKN A;  3ZC7 B;  3KSX A;  3ZCB B;  4PDG A;  3DZD A;  3QWL A;  4IJE A;  5KQD A;  1R2Y A;  4GKJ M;  4JYA M;  2BJW A;  2X49 A;  4FWH A;  2X4A A;  4Z8X A;  1NSF A;  3PFI A;  4FD2 A;  4LG2 A;  4LJ4 A;  4LY6 A;  4AKI A;  1JQJ C;  4AG6 A;  2CV1 A;  2F5N A;  3GQ5 A;  4RNA A;  2C5R A;  3TE6 A;  3HHX A;  3PNV A;  2FFJ A;  3C58 A;  1N34 M;  3VK8 A;  4RF1 A;  3FYD A;  4GHA A;  1IXR C;  1N36 M;  1Z5B A;  2Z4S A;  4DR7 M;  3U61 B;  1I4W A;  3KXE C;  2OPF A;  4IBK A;  1DGF A;  2DWL A;  2QBY A;  7CAT A;  5JI2 E;  1DO0 A;  4DR4 M;  2KW0 A;  4LF6 M;  3AL0 C;  3H4M A;  3U6M A;  2JA2 A;  4IJF A;  2KA6 B;  4GHL A;  4S12 A;  5DYG A;  1G59 A;  3KW6 A;  3SMS A;  3GLI A;  3VKG A;  4QNM A;  4LGY A;  3L26 A;  4YY3 M;  5IRE B;  3KP0 E;  3ILK A;  3UGJ A;  4JI8 M;  2X8A A;  1DGH A;  3FTC A;  3GQ4 A;  4AKH A;  3UJN A;  1XNQ M;  3MJ5 A;  5EXS A;  4B3S M;  4M9Z A;  1KYI A;  5ITR A;  1IN7 A;  3D8B A;  1XWI A;  4LGM A;  4QHT A;  5ITQ A;  5KPT A;  4G4Q A;  2UUA M;  1GL7 A;  2L6O A;  3NWL A;  4AZF A;  4JI1 M;  1N32 M;  2D7H A;  3FUX A;  1H6U A;  4HLQ A;  2G5G X;  1Q3B A;  4NRW A;  2VII A;  1GVN A;  2XGN A;  3U60 A;  1W5T A;  3A45 A;  3WHK A;  1Z6T A;  1J09 A;  3FUV A;  4QHS A;  2UU9 M;  3SAT A;  1TH2 A;  1EE8 A;  3KFU G;  5ITU A;  1XMQ M;  2C96 A;  3RFW A;  4W5W A;  1L1Z A;  3RGS A;  2R4J A;  4MH0 E;  4M9X A;  1DO2 A;  4B7G A;  3KOZ E;  3FUW A;  3K92 A;  4JI0 M;  4LRT A;  2QEN A;  4D81 A;  5EXP A;  1FNN A;  1SXJ A;  2Z7J A;  4OVZ A;  4PT5 A;  5KPZ A;  5IWA M;  3AFH A;  3R8F A;  4JI5 M;  2D7G A;  4LJ7 A;  4GMQ A;  4P16 A;  3J7A S;  1N78 A;  1NNJ A;  4LF7 M;  3LQR A;  1YUB A;  2Z4R A;  3JAM S;  4X64 M;  1IQP A;  1K3W A;  2QCU A;  4LF8 M;  1YE9 A;  4X65 M;  4G4R A;  1IY2 A;  4IBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...