3MHVC

Crystal structure of vps4 and vta1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
102
Chain Sequence
GSPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTPCSPGDDGAIEMSPDLTIKDFLKAIKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 4
publication title Structural role of the Vps4-Vta1 interface in ESCRT-III recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 29
structure length 102
sequence length 117
ec nomenclature
pdb deposition date 2010-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3mhvC00
5C18A 1C1KA 2DVWB 4LJ4A 2C9CA 1NJGA 2V6ZM 1L8QA 2BJVA 3CF2A 4LJ6A 3R8FA 5EXTA 3SC3A 2DWZB 1R6BX 4I81A 1IXSB 2RKOA 2DZNB 5DYGA 5EP1A 4LJ5A 5EP2A 1IQPA 3GLFB 3HWSA 2ZAOA 1E32A 4GITA 1IXRC 3GLIA 1DO0A 3U61B 1HT2E 1NVMA 1XXHB 3CF0A 3GLHB 1NJFA 1IN5A 5FTLA 3MHVC 1G4AE 3U60B 1IY2A 2QP9X 2CHQA 3B9PA 1E94E 1SXJE 2HCBA 3WHKA 2QBYB 3DZDA 3EIHA 3SYLA 3M6AA 1IN8A 4L4UA 1OFHA 1OFIA 3PXGA 1IY1A 3HU2A 3H4MA 4JN6A 4L16A 4QHTA 2FNAA 3K1JA 2ZANA 1IY0A 3HU1A 1JQJC 1XWIA 4FCTA 4KLNA 3KDSE 2BJWA 4KO8A 2X8AA 3GLHA 1IN4A 3U5ZB 1HQCA 1KSFX 4LCBA 1D2NA 1SXJC 5JI3E 1SXJB 2XSZD 3EIEA 1R7RA 3VLFB 4FD2A 4D81A 4LJAA 2CHVA 4FCWA 2R62A 4FCVA 1G3IA 4LGMA 3WHLA 3KW6A 1SXJD 4A3VB 4D82A 4LRTA 1QZMA 4QHSA 4LRSA 5EP3A 3PVSA 4FWDA 4L15A 4LJ9A 2KRKA 1UM8A 2C98A 2XSZA 3BOSA 5EXXA 2QENA 2C9OA 3AJIB 5EQTA 3PFIA 3GLFA 2VIIA 5FTKA 2Z4RA 2DZOB 1G41A 1IM2A 4LJ7A 4EIWA 5FTMA 1NSFA 1XXHA 3ZH9B 4Z8XA 1QVRA 1HT1E 1NY5A 1SXJA 2ZAMA 2V1UA 4FWHA 5EP4A 3D8BA 3GLGB 1IN7A 2C96A 4ZPXA 1LV7A 2QBYA 1HQYE 3HU3A 2DHRA 5EXPA 3SYKA 5C1BA 2R65A 4WW0A 5DYIA 5EXSA 1DO2A 4QOSA 1JR3D 1IN6A 4FWGA 1J7KA 1NY6A 5JI2E 3M0EA 2CEAA 1IXZA 4QNRA 1W5SA 1OJLA 1X37A 3UK6A 2C99A 1S3SA 2CHGA 4FW9A 5FTJA 4D80A 2CE7A 4QNMA 2QZ4A 1FNNA 2Z4SA 1W5TA 2QPAA 4LZZA 4LY6A 4I4LA 5FTNA 3VFDA 3GLGA 3GLIB 4LJ8A 1JR3A 4KODA 1KYIA
chains in the Genus database with same CATH superfamily
4FVMA 5C18A 1C1KA 2KZSA 3B89A 3DA1A 4NXNM 3J7AS 2V1CA 2C9CA 1G59A 1Q02A 1GKIA 2V6ZM 3NBIA 3Q8GA 4LJ6A 5DFLA 2CP8A 5KQDA 2H1RA 5DNYA 2JY6B 3AOEA 4I81A 3RGSA 2XF3A 1KFVA 4GHLA 1GO5A 1Z5CA 4XK8F 2CWBA 2HKJA 1Q3BA 2DZNB 3W0LB 5GKNA 2M5ZA 1MU5A 3L27A 1TGUA 5EP2A 1IQPA 1GL6A 1NHGC 3B7ZA 3GLFB 3VKGA 2X4AA 3FUTA 5ITYA 3AKZA 2ZAOA 1E32A 2L7HA 3GLIA 1DO0A 3U6EA 1HT2E 1NVMA 5KPTA 2C5RA 3QAUA 5FTLA 1VEGA 4LFCM 1A5TA 4MH0E 3U60B 1K82A 2QP9X 2CHQA 3A46A 2RGHA 4AW4A 3AOGA 1SXJE 2QBYB 3W68A 3DZDA 1Z5BA 2LHCA 3CGWA 4XBOA 3FYDA 3QYEA 3VK8A 2XFTA 2L4FA 2DHYA 4L4UA 3E4RA 2J7OA 2OOAA 3PXGA 1IY1A 3J7BA 1VDDA 4GC9A 1Q3CA 1ZAEA 3HU2A 4M9ZA 4HL4A 3RFWA 4GIPA 2FNAA 3HU1A 4AKHA 2OO9A 4JI2M 3A42A 1SG9A 2FH0A 4FCTA 4KLNA 4PCZA 2KW0A 2DKLA 2XLJA 2UU9M 3NBXX 1IBKM 4XGIA 2MROB 2QSFX 3BXWA 2F5NA 3SATA 3VKHA 3LQQA 4X64M 2R18A 3U60A 2K0BX 1SXJC 1OAOC 5JI3E 1SXJB 3FTDA 1K3WA 2CV2A 2EKFA 1R7RA 3KOZE 5IREB 2UXBM 4IBEA 1IBLM 4M0WA 3BBZA 4OVZA 4DV4M 3L25A 2K9DA 2XEPA 1JB0F 2LTUA 3GRUA 3AV0A 1N34M 1SXJD 2N35A 2R44A 4LRTA 3U6OA 4LFAM 5EP3A 3I51A 3PVSA 1RU3A 3L29A 3HJQA 3U6DA 2JY8A 2LBCA 4LG2A 2QENA 2C9OA 5EQTA 3AL0C 1N32M 2EKKA 2VIIA 4IJFA 4OU7A 4G4OA 3LVVA 2DZOB 4RNAA 2DXIA 4L78A 5ITUA 4MGKE 1NSFA 1DGHB 2UUAM 4L8RC 1QVRA 1SXJA 1TH3A 2MJ5B 2Z7JA 3SMSA 3VK7A 3CTWB 2E5LM 3D8BA 2R6FA 2YFQA 3C3EA 4X62M 4JI5M 1QZEA 4ZPXA 2EUCA 2OQ4A 1PRBA 1I94M 5KQ8A 4IBJA 2DHRA 1D0LA 3SYKA 4WW0A 1MJGM 3Q8XA 3C58A 1N75A 2M60A 3KSJA 2Y0TA 1IN6A 3HJSA 4FWGA 2ZTDA 1VDLA 1L1ZA 3M0EA 3DFZA 3I4YA 1W5SA 3KSXA 3UK6A 4B7GA 1DGHA 4FW9A 2CUZA 1E9SA 2K6BA 2JP7A 3OTOM 4DR2M 1W5TA 4LZZA 2MH8A 1HJPA 7CATA 4NXMM 3DOAA 1GJSA 1MX0A 1KYIA 1QUTA 4B3RM 3V76A 1BVSA 1UFZA 3MK6A 3GLIE 2L2DA 1T6OA 4GRIA 4CISA 1NJGA 1TF0B 1L8QA 3PNYA 3TPZA 3SASA 4Y28F 5EXTA 3JR4A 3R8FA 2HL7A 4I5SA 4MGIE 2LH0A 4G4QA 1ORYB 5DYGA 2LNHC 3ILKA 1DV0A 2F5PA 4LJ5A 3MMPA 4DV0M 1GJTA 1WXQA 4I8OA 1HNXM 3HWSA 2JY5A 2WSFF 3A98B 1IXRC 3L26A 3GLFE 3KP0E 1XXHB 3W67A 1IN5A 1XHBA 1H6UA 1G4AE 3SFZA 4LF7M 1TR8A 1IY2A 3C9PA 3FUUA 2F4VM 2BWEA 1OAIA 4DR6M 1MN3A 1QYRA 2B3TA 2ERCA 2FOIC 2BWBA 1VEJA 3EIHA 3HHXA 3M6AA 1OFHA 3FRHA 2J5YA 1PJSA 3IECA 1J5EM 4LF8M 4ANRA 4LGYA 3FD9A 4AG6A 4PDIA 5LMNM 4NSRA 3THGA 4P16A 1IY0A 2JZ0A 2JXNA 3KS4A 2J7NA 1QDRA 3KDSE 2BJWA 4X66M 1PJQA 1XB2B 1Q39A 4B3TM 1VG5A 3U5ZB 2JY7A 2ZM6M 1L2BA 1NNUC 3KVWA 4BLCA 4B3MM 2LVAA 2QQ8A 3EIEA 1E9RA 3VLFB 3C3DA 1XMQM 1PGYA 1QAQA 4KT0F 3T38A 4FCWA 5E26A 2YQZA 4A3VB 1PJTA 1QZMA 4QHSA 3T6PA 2G5GX 4LRSA 1VQ1A 5F3WA 2XFSA 2DAEA 2KRKA 2KEBA 1UM8A 2C98A 4IBCA 3HGIA 3SAVA 5ITQA 2KXEA 3GLFA 4IBDA 5FTKA 2O01F 2Q2EB 1G41A 2DAKA 1Z59A 4DV1M 4GMQA 2JZ1A 3IHPA 3FTFA 5KPZA 5FTMA 1NY5A 3E46A 3W0FA 3LVWA 2O5RA 3HY5A 5FLXS 2F5OA 4AQYM 2EO2A 3SARA 4TUWA 2QBYA 4Z6YA 1HQYE 2F5QA 3K8ZA 4AKIA 5IT9S 4R3DA 1YSYA 2R65A 2ZTCA 5IWAM 3GPYA 1IBMM 3FUVA 4QOSA 4F2LA 3U6LA 1V34A 4AKGA 1TH4A 3F92A 2LVPC 1XNRM 3T15A 4OX9M 1YUBA 3CF6E 1YE9A 1J7KA 3GRRA 4BBAA 1PM5A 1NY6A 5JI2E 1TDHA 2DAIA 4II7A 4RF1A 1S3SA 2CHGA 2XGNA 4G4NA 3PNVA 3HKPA 4GH9A 4LZJA 1FNNA 4QNMA 3ZQJA 2QPAA 3GQ3A 5LMUM 4LF6M 4I4LA 3GPUA 2JWSA 4YY3M 2KRUA 2WSCF 4KODA 4NRVA 1C7YA 4BB9A 4KHPM 3I01M 1QDTA 3CF2A 3KXEC 4IBKA 1TDZA 3SC3A 2DWZB 3T1HM 1PJIA 1IXSB 1ZMVA 2DWLA 1QUSA 3SHGB 2RKOA 5E6JA 2GQFA 2YNMD 1N77A 2CV0A 2MGWA 4UN2B 2VF8A 2DWMA 2Y20A 2DAMA 3KFUG 4GITA 4GC5A 5BR8M 2L7IA 3U61B 1OIZA 1Z5AA 3M7GA 3GLHB 3MHVC 2LHGA 4S12A 2F5SA 4IBBA 3B9PA 1XXHE 2FFJA 3WHKA 2HCBA 4G6ZA 5EJCA 1XMOM 3UZUA 1I4WA 2HHHM 3J80S 3SYLA 3TWLA 1IN8A 2VF7A 3GPPA 2VQEM 1OFIA 2FS1A 1ZQ9A 3GRYA 1F4IA 2LVQD 3SHFA 4JN6A 3H4MA 1NV8A 1N36M 1N33M 1OIPA 1ZMUA 1V33A 4QHTA 4NRWA 4WP2A 2P5TA 2WZJA 4IBIA 4NL4H 3GP1A 2L4EA 1XC8A 3ZCBB 1JQJC 3J2PB 1HR0M 2JA2A 3QYBA 4MGYE 4PT5A 4KO8A 4HEOA 2H5XA 4B08A 3UJNA 3GLHA 1IN4A 3JAMS 4DUYM 2L09A 2KA6B 2XZFA 1HQCA 3SMPA 1KSFX 4LCBA 1D2NA 1XNQM 3TWMA 2APLA 4JV5M 4FD2A 4IBGA 2EA0A 3GRVA 2CHVA 2R62A 2O25A 1L2DA 1G3IA 2CRUA 4LGMA 3AOEC 2JNHA 2R0IA 3LCVB 4D82A 2D7GA 4LF5M 5KPRA 2DZLA 4JXJA 3BOSA 2I7NA 3AJIB 3PFIA 3U6QA 4M0DA 1WJ7A 4DV5M 1WHCA 4JI1M 3A45A 1G71A 1XXHA 2D7HA 3ZH9B 3KS8A 2XZUA 1ZMWA 2DENA 2MR9A 2EJSA 4K0KM 1D0MA 3I04M 2C96A 4YHHM 1LV7A 4IIWA 2WSEF 2KNZA 1OQYA 1QAOA 3HU3A 4Q7JA 4RF0A 4DV3M 5C1BA 5KO3A 3HX3A 1R2ZA 1DO2A 2QHOB 2ZBKB 4GEWA 1D0KA 3FYCA 3L28A 4CHTB 4AG5A 3HHYA 3RE8A 1CUKA 3KOWE 4NOOB 1PJJA 1IXZA 1OJLA 2VDBB 2Y0QA 1OTRA 1J09A 3R9XB 1OKSA 4R7GA 2C99A 4D80A 2HWJA 2X49A 2HAKA 2CE7A 2OOBA 5FTJA 4DR1M 2QZ4A 3U5ZA 4ITQA 4L6V6 2LXEA 4LY6A 4W5WA 3VFDA 3KOYE 5FTNA 2CV1A 4LJ8A 3GQ4A 1GVNA 3MJ5A 1HNZM 2DVWB 4LF9M 1IFYA 4LJ4A 3AFHA 4IJEA 3VDPA 3K9PA 3LQRA 2BJVA 3TQSA 4R71A 4OVZB 3UGJA 1HNWM 1TH2A 1FJGM 3SAWA 1R6BX 2I7PA 2Y21A 2G3QA 3VDUA 3GQ5A 3K2LA 1T3TA 1NV9A 4MM3B 2L6OA 4AI6A 4CJ6A 5EP1A 1R4GA 4DV2M 4DV7M 2A5YB 2UUCM 3U6SA 3J27B 3FKEA 1WGLA 2XH9A 3NWLA 4JI3M 4LF4M 5BPVA 8CATA 2R46A 2KHHA 4M9SA 5ITXE 1ZV1A 3L2AA 4B7HA 2R4EA 4GKKM 1VEKA 3U6PA 2NQ8C 3CF0A 4CGYB 1NJFA 2RGOA 1QQWA 3B7NA 1YLAA 4IBFA 4G3OA 4DV6M 3T1YM 4GKJM 4PD2A 1E94E 3FTEA 3D8LA 3GLHE 4HLQA 4P17A 3TL4X 2VQFM 3ZC7B 2DWNA 1NNJA 1G8PA 2BNKA 3B74A 4MGZE 1N78A 3HZJA 4CIZA 4X65M 1WIVA 4GHAA 2LWXA 4OW0A 4QOZC 2R45A 4L16A 1L2CA 3IG5A 3I4VA 3LCUA 4REZA 1DGGA 1P3QQ 1Y8GA 3K1JA 2ZANA 4DR7M 2DI0A 1DGFA 2KDLA 2KZUA 1L1TA 3E9SA 1XWIA 1R2YA 5IZ7D 2X8AA 1DGBA 1GLNA 4G4RA 4JI8M 2XSZD 1AUAA 3J81S 3FE3A 3E21A 4D81A 1Z6TA 3HHWA 4MGHA 3QWLA 4LJAA 1EIJA 4JYAM 3SAUA 3FRIA 4WURA 1GL7A 3GLGE 1R5LA 5H37D 3HHZA 4JI4M 1JR3E 4FCVA 1EFUB 2QCUA 4JI0M 3H4JA 3JR5A 3WHLA 2DAGA 4B3SM 3KW6A 4M9XA 1IXSA 4JI7M 2UXDM 4PDGA 1AIPC 2LVNC 3KP1E 4FWDA 4L15A 1NO1A 2D7EA 2LVOC 2W82A 4LJ9A 2XSZA 5EXXA 5ITXA 4NSOB 5ITRA 5ITTA 4JI6M 3FTCA 2QNJA 2Z4RA 3U6MA 1IM2A 4LJ7A 4MB7A 4EIWA 3U61A 4DR5M 3LMMA 2OPFA 4DUZM 2R4JA 4Z8XA 2ZAMA 1HT1E 2KNVA 2V1UA 4FWHA 3GPXA 5EP4A 4LFBM 1WGNA 3GLGB 1IN7A 2Z3XA 2K47A 3FUXA 3KOXE 5FSWA 2Z8YM 1NHWC 3LW5F 1V92A 5EXPA 5A2QS 2UUBM 2G8LA 2FE8A 5DYIA 2AHMA 3HJ8A 4B7FA 5EXSA 3TWKA 5L8RF 3GO8A 4DR3M 2RRUA 1K3XA 3IG8A 1JR3D 2YR0A 2GNOA 1GABA 4F1IA 3FUWA 1EE8A 3K92A 4AZFA 1WR1B 3SBJA 2UXCM 2CEAA 4DBGB 4QNRA 4NC6A 3UMMA 1X37A 3B7QA 4DR4M 1QANA 4RKUF 1LTMA 1T43A 2Z4SA 3TE6A 2JUJA 1QAMA 2CFOA 3RGPA 3GLGA 3K9OA 1TTEA 2DNAA 2KNAA 3GLIB 1JR3A 3U6CA
chains in the Genus database with same CATH topology
4FVMA 5C18A 1C1KA 2KZSA 3DA1A 4NXNM 3J7AS 2V1CA 2C9CA 1G59A 2V6ZM 1GKIA 4LJ6A 3NBIA 5KQDA 2H1RA 5DNYA 3AOEA 4I81A 3RGSA 2XF3A 1KFVA 4GHLA 1Z5CA 2HKJA 1Q3BA 2DZNB 3W0LB 5GKNA 2M5ZA 1MU5A 3L27A 1TGUA 5EP2A 1IQPA 1GL6A 1NHGC 3GLFB 3VKGA 2X4AA 3FUTA 5ITYA 3AKZA 2ZAOA 1E32A 2L7HA 3GLIA 1DO0A 3U6EA 1HT2E 1NVMA 5KPTA 2C5RA 3QAUA 5FTLA 4LFCM 4MH0E 3U60B 1K82A 2QP9X 2CHQA 3A46A 2RGHA 4AW4A 3AOGA 1SXJE 2QBYB 3DZDA 1Z5BA 4XBOA 3VK8A 3FYDA 2XFTA 4L4UA 3E4RA 2J7OA 3PXGA 1IY1A 3J7BA 1VDDA 4GC9A 1Q3CA 1ZAEA 3HU2A 4M9ZA 4HL4A 3RFWA 4GIPA 2FNAA 3HU1A 4AKHA 4JI2M 3A42A 4FCTA 4KLNA 4PCZA 2KW0A 2XLJA 2UU9M 1IBKM 4XGIA 2F5NA 3SATA 3VKHA 3LQQA 4X64M 2R18A 3U60A 1SXJC 5JI3E 1K3WA 1SXJB 3FTDA 2CV2A 1R7RA 3KOZE 5IREB 2UXBM 4IBEA 1IBLM 4M0WA 4DV4M 4OVZA 3L25A 2XEPA 3GRUA 3AV0A 1N34M 1SXJD 4LRTA 3U6OA 4LFAM 5EP3A 3I51A 3PVSA 3L29A 3HJQA 3U6DA 4LG2A 2QENA 2C9OA 5EQTA 3AL0C 1N32M 2VIIA 4IJFA 4OU7A 4G4OA 3LVVA 2DZOB 4RNAA 2DXIA 4L78A 5ITUA 4MGKE 1NSFA 1DGHB 2UUAM 4L8RC 1QVRA 1SXJA 1TH3A 2Z7JA 3SMSA 3VK7A 3CTWB 2E5LM 3D8BA 2YFQA 4X62M 4JI5M 4ZPXA 2EUCA 2OQ4A 1I94M 5KQ8A 4IBJA 2DHRA 3SYKA 4WW0A 3Q8XA 3C58A 1N75A 2M60A 3KSJA 2Y0TA 1IN6A 3HJSA 4FWGA 1L1ZA 3M0EA 3DFZA 3I4YA 1W5SA 3KSXA 3UK6A 4B7GA 1DGHA 4FW9A 2CUZA 1E9SA 3OTOM 4DR2M 1W5TA 4LZZA 7CATA 4NXMM 3DOAA 1MX0A 1KYIA 4B3RM 3MK6A 4CISA 4GRIA 1NJGA 3PNYA 1L8QA 3TPZA 3SASA 3R8FA 5EXTA 3JR4A 2HL7A 4I5SA 4MGIE 2LH0A 4G4QA 1ORYB 5DYGA 2LNHC 3ILKA 2F5PA 4LJ5A 4DV0M 1WXQA 1HNXM 3HWSA 3A98B 1IXRC 3L26A 3KP0E 1XXHB 1IN5A 1XHBA 1H6UA 1G4AE 3SFZA 4LF7M 2F4VM 1IY2A 3FUUA 4DR6M 1QYRA 2ERCA 2FOIC 3EIHA 3HHXA 3M6AA 1OFHA 1J5EM 4LF8M 4LGYA 3FD9A 4AG6A 4PDIA 5LMNM 4NSRA 3THGA 4P16A 1IY0A 3KS4A 2J7NA 3KDSE 2BJWA 4X66M 4B3TM 1Q39A 3U5ZB 2ZM6M 1L2BA 1NNUC 3KVWA 4BLCA 4B3MM 3EIEA 1E9RA 3VLFB 1XMQM 1QAQA 3T38A 4FCWA 5E26A 2YQZA 4A3VB 1QZMA 4QHSA 2G5GX 4LRSA 5F3WA 2XFSA 2KRKA 2KEBA 1UM8A 2C98A 4IBCA 3HGIA 3SAVA 5ITQA 2KXEA 3GLFA 4IBDA 5FTKA 2Q2EB 1G41A 1Z59A 4DV1M 4GMQA 3FTFA 5KPZA 5FTMA 1NY5A 3W0FA 3LVWA 2O5RA 5FLXS 2F5OA 4AQYM 2EO2A 3SARA 4TUWA 2QBYA 4Z6YA 1HQYE 2F5QA 3K8ZA 4AKIA 5IT9S 4R3DA 1YSYA 2R65A 5IWAM 3GPYA 1IBMM 3FUVA 4QOSA 3U6LA 4AKGA 1TH4A 1XNRM 3T15A 4OX9M 1YUBA 3CF6E 1YE9A 1J7KA 3GRRA 4BBAA 1PM5A 1NY6A 5JI2E 1TDHA 4II7A 4RF1A 1S3SA 2CHGA 2XGNA 4G4NA 3PNVA 3HKPA 4GH9A 4LZJA 1FNNA 4QNMA 3GQ3A 2QPAA 4LF6M 5LMUM 4I4LA 3GPUA 4YY3M 2KRUA 4KODA 4NRVA 4BB9A 4KHPM 3CF2A 3KXEC 4IBKA 1TDZA 3SC3A 2DWZB 3T1HM 1PJIA 1IXSB 2DWLA 3SHGB 2RKOA 5E6JA 2YNMD 1N77A 2CV0A 2DWMA 2Y20A 3KFUG 4GITA 4GC5A 5BR8M 2L7IA 3U61B 1Z5AA 3M7GA 3GLHB 3MHVC 4S12A 2F5SA 4IBBA 3B9PA 2FFJA 3WHKA 2HCBA 4G6ZA 5EJCA 1XMOM 3UZUA 1I4WA 2HHHM 3J80S 3SYLA 3TWLA 1IN8A 3GPPA 2VQEM 1OFIA 1ZQ9A 3GRYA 3SHFA 4JN6A 3H4MA 1N36M 1N33M 4QHTA 4NRWA 2P5TA 4IBIA 4NL4H 3GP1A 1XC8A 3ZCBB 1JQJC 3J2PB 1HR0M 2JA2A 4MGYE 4PT5A 4KO8A 4B08A 3UJNA 3GLHA 1IN4A 3JAMS 4DUYM 2L09A 2KA6B 2XZFA 1HQCA 3SMPA 1KSFX 4LCBA 1D2NA 1XNQM 3TWMA 4JV5M 4FD2A 4IBGA 2EA0A 3GRVA 2CHVA 2R62A 1L2DA 1G3IA 4LGMA 3AOEC 4D82A 2D7GA 4LF5M 5KPRA 4JXJA 3BOSA 2I7NA 3AJIB 3PFIA 3U6QA 4M0DA 4DV5M 4JI1M 3A45A 1XXHA 2D7HA 3ZH9B 3KS8A 2XZUA 4K0KM 2C96A 4YHHM 1LV7A 4IIWA 4RF0A 1QAOA 3HU3A 4DV3M 5C1BA 5KO3A 1R2ZA 1DO2A 2ZBKB 3FYCA 3L28A 4CHTB 4AG5A 3HHYA 3RE8A 3KOWE 4NOOB 1PJJA 1IXZA 1OJLA 2Y0QA 1J09A 3R9XB 4R7GA 2C99A 4D80A 2X49A 5FTJA 2CE7A 4DR1M 3U5ZA 2QZ4A 4ITQA 2LXEA 4LY6A 4W5WA 3VFDA 3KOYE 5FTNA 2CV1A 4LJ8A 3GQ4A 1GVNA 3MJ5A 1HNZM 2DVWB 4LF9M 4LJ4A 3AFHA 4IJEA 3VDPA 1HNWM 3LQRA 2BJVA 3TQSA 4OVZB 3UGJA 1TH2A 1FJGM 3SAWA 1R6BX 2I7PA 2Y21A 3VDUA 3GQ5A 3K2LA 1T3TA 4MM3B 2L6OA 4AI6A 5EP1A 4DV2M 4DV7M 2A5YB 2UUCM 3U6SA 3J27B 3FKEA 2XH9A 3NWLA 4JI3M 4LF4M 5BPVA 8CATA 2R46A 4M9SA 5ITXE 4GKKM 3L2AA 4B7HA 2R4EA 3U6PA 2NQ8C 3CF0A 4CGYB 1NJFA 2RGOA 1QQWA 4IBFA 4DV6M 3T1YM 4GKJM 4PD2A 1E94E 3FTEA 3D8LA 4HLQA 3TL4X 2VQFM 3ZC7B 2DWNA 1NNJA 1G8PA 2BNKA 4MGZE 1N78A 4X65M 4GHAA 4QOZC 2LWXA 4OW0A 2R45A 4L16A 1L2CA 3IG5A 3I4VA 4REZA 1DGGA 4DR7M 3K1JA 2ZANA 1DGFA 2KZUA 1L1TA 3E9SA 1XWIA 1R2YA 5IZ7D 2X8AA 1DGBA 1GLNA 4G4RA 4JI8M 2XSZD 3J81S 4D81A 1Z6TA 3HHWA 4MGHA 3QWLA 4LJAA 4JYAM 3SAUA 4WURA 1GL7A 3HHZA 4JI4M 5H37D 4FCVA 2QCUA 4JI0M 3JR5A 3WHLA 4B3SM 3KW6A 4M9XA 2UXDM 4JI7M 4PDGA 3KP1E 4FWDA 4L15A 2D7EA 2W82A 4LJ9A 5ITXA 2XSZA 5EXXA 4NSOB 5ITRA 5ITTA 4JI6M 3FTCA 2Z4RA 3U6MA 1IM2A 4LJ7A 4MB7A 4EIWA 3U61A 4DR5M 3LMMA 2OPFA 4DUZM 2R4JA 4Z8XA 2ZAMA 1HT1E 2V1UA 4FWHA 3GPXA 5EP4A 4LFBM 3GLGB 1IN7A 2Z3XA 2K47A 3FUXA 3KOXE 5FSWA 1NHWC 5EXPA 5A2QS 2UUBM 2G8LA 2FE8A 5DYIA 2AHMA 3HJ8A 4B7FA 5EXSA 3TWKA 3GO8A 4DR3M 1K3XA 3IG8A 1JR3D 2YR0A 3FUWA 1EE8A 3K92A 4AZFA 3SBJA 2UXCM 2CEAA 4QNRA 3UMMA 1X37A 4DR4M 1QANA 3TE6A 2Z4SA 1QAMA 2CFOA 3RGPA 3GLGA 3GLIB 4I8OA 1JR3A 3U6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C18 A;  1C1K A;  2DVW B;  4LJ4 A;  2C9C A;  1NJG A;  2V6Z M;  1L8Q A;  2BJV A;  3CF2 A;  4LJ6 A;  3R8F A;  5EXT A;  3SC3 A;  2DWZ B;  1R6B X;  4I81 A;  1IXS B;  2RKO A;  2DZN B;  5DYG A;  5EP1 A;  4LJ5 A;  5EP2 A;  1IQP A;  3GLF B;  3HWS A;  2ZAO A;  1E32 A;  4GIT A;  1IXR C;  3GLI A;  1DO0 A;  3U61 B;  1HT2 E;  1NVM A;  1XXH B;  3CF0 A;  3GLH B;  1NJF A;  1IN5 A;  5FTL A;  3MHV C;  1G4A E;  3U60 B;  1IY2 A;  2QP9 X;  2CHQ A;  3B9P A;  1E94 E;  1SXJ E;  2HCB A;  3WHK A;  2QBY B;  3DZD A;  3EIH A;  3SYL A;  3M6A A;  1IN8 A;  4L4U A;  1OFH A;  1OFI A;  3PXG A;  1IY1 A;  3HU2 A;  3H4M A;  4JN6 A;  4L16 A;  4QHT A;  2FNA A;  3K1J A;  2ZAN A;  1IY0 A;  3HU1 A;  1JQJ C;  1XWI A;  4FCT A;  4KLN A;  3KDS E;  2BJW A;  4KO8 A;  2X8A A;  3GLH A;  1IN4 A;  3U5Z B;  1HQC A;  1KSF X;  4LCB A;  1D2N A;  1SXJ C;  5JI3 E;  1SXJ B;  2XSZ D;  3EIE A;  1R7R A;  3VLF B;  4FD2 A;  4D81 A;  4LJA A;  2CHV A;  4FCW A;  2R62 A;  4FCV A;  1G3I A;  4LGM A;  3WHL A;  3KW6 A;  1SXJ D;  4A3V B;  4D82 A;  4LRT A;  1QZM A;  4QHS A;  4LRS A;  5EP3 A;  3PVS A;  4FWD A;  4L15 A;  4LJ9 A;  2KRK A;  1UM8 A;  2C98 A;  2XSZ A;  3BOS A;  5EXX A;  2QEN A;  2C9O A;  3AJI B;  5EQT A;  3PFI A;  3GLF A;  2VII A;  5FTK A;  2Z4R A;  2DZO B;  1G41 A;  1IM2 A;  4LJ7 A;  4EIW A;  5FTM A;  1NSF A;  1XXH A;  3ZH9 B;  4Z8X A;  1QVR A;  1HT1 E;  1NY5 A;  1SXJ A;  2ZAM A;  2V1U A;  4FWH A;  5EP4 A;  3D8B A;  3GLG B;  1IN7 A;  2C96 A;  4ZPX A;  1LV7 A;  2QBY A;  1HQY E;  3HU3 A;  2DHR A;  5EXP A;  3SYK A;  5C1B A;  2R65 A;  4WW0 A;  5DYI A;  5EXS A;  1DO2 A;  4QOS A;  1JR3 D;  1IN6 A;  4FWG A;  1J7K A;  1NY6 A;  5JI2 E;  3M0E A;  2CEA A;  1IXZ A;  4QNR A;  1W5S A;  1OJL A;  1X37 A;  3UK6 A;  2C99 A;  1S3S A;  2CHG A;  4FW9 A;  5FTJ A;  4D80 A;  2CE7 A;  4QNM A;  2QZ4 A;  1FNN A;  2Z4S A;  1W5T A;  2QPA A;  4LZZ A;  4LY6 A;  4I4L A;  5FTN A;  3VFD A;  3GLG A;  3GLI B;  4LJ8 A;  1JR3 A;  4KOD A;  1KYI A; 
#chains in the Genus database with same CATH topology
 4FVM A;  5C18 A;  1C1K A;  2KZS A;  3B89 A;  3DA1 A;  4NXN M;  3J7A S;  2V1C A;  2C9C A;  1G59 A;  1Q02 A;  1GKI A;  2V6Z M;  3NBI A;  3Q8G A;  4LJ6 A;  5DFL A;  2CP8 A;  5KQD A;  2H1R A;  5DNY A;  2JY6 B;  3AOE A;  4I81 A;  3RGS A;  2XF3 A;  1KFV A;  4GHL A;  1GO5 A;  1Z5C A;  4XK8 F;  2CWB A;  2HKJ A;  1Q3B A;  2DZN B;  3W0L B;  5GKN A;  2M5Z A;  1MU5 A;  3L27 A;  1TGU A;  5EP2 A;  1IQP A;  1GL6 A;  1NHG C;  3B7Z A;  3GLF B;  3VKG A;  2X4A A;  3FUT A;  5ITY A;  3AKZ A;  2ZAO A;  1E32 A;  2L7H A;  3GLI A;  1DO0 A;  3U6E A;  1HT2 E;  1NVM A;  5KPT A;  2C5R A;  3QAU A;  5FTL A;  1VEG A;  4LFC M;  1A5T A;  4MH0 E;  3U60 B;  1K82 A;  2QP9 X;  2CHQ A;  3A46 A;  2RGH A;  4AW4 A;  3AOG A;  1SXJ E;  2QBY B;  3W68 A;  3DZD A;  1Z5B A;  2LHC A;  3CGW A;  4XBO A;  3FYD A;  3QYE A;  3VK8 A;  2XFT A;  2L4F A;  2DHY A;  4L4U A;  3E4R A;  2J7O A;  2OOA A;  3PXG A;  1IY1 A;  3J7B A;  1VDD A;  4GC9 A;  1Q3C A;  1ZAE A;  3HU2 A;  4M9Z A;  4HL4 A;  3RFW A;  4GIP A;  2FNA A;  3HU1 A;  4AKH A;  2OO9 A;  4JI2 M;  3A42 A;  1SG9 A;  2FH0 A;  4FCT A;  4KLN A;  4PCZ A;  2KW0 A;  2DKL A;  2XLJ A;  2UU9 M;  3NBX X;  1IBK M;  4XGI A;  2MRO B;  2QSF X;  3BXW A;  2F5N A;  3SAT A;  3VKH A;  3LQQ A;  4X64 M;  2R18 A;  3U60 A;  2K0B X;  1SXJ C;  1OAO C;  5JI3 E;  1SXJ B;  3FTD A;  1K3W A;  2CV2 A;  2EKF A;  1R7R A;  3KOZ E;  5IRE B;  2UXB M;  4IBE A;  1IBL M;  4M0W A;  3BBZ A;  4OVZ A;  4DV4 M;  3L25 A;  2K9D A;  2XEP A;  1JB0 F;  2LTU A;  3GRU A;  3AV0 A;  1N34 M;  1SXJ D;  2N35 A;  2R44 A;  4LRT A;  3U6O A;  4LFA M;  5EP3 A;  3I51 A;  3PVS A;  1RU3 A;  3L29 A;  3HJQ A;  3U6D A;  2JY8 A;  2LBC A;  4LG2 A;  2QEN A;  2C9O A;  5EQT A;  3AL0 C;  1N32 M;  2EKK A;  2VII A;  4IJF A;  4OU7 A;  4G4O A;  3LVV A;  2DZO B;  4RNA A;  2DXI A;  4L78 A;  5ITU A;  4MGK E;  1NSF A;  1DGH B;  2UUA M;  4L8R C;  1QVR A;  1SXJ A;  1TH3 A;  2MJ5 B;  2Z7J A;  3SMS A;  3VK7 A;  3CTW B;  2E5L M;  3D8B A;  2R6F A;  2YFQ A;  3C3E A;  4X62 M;  4JI5 M;  1QZE A;  4ZPX A;  2EUC A;  2OQ4 A;  1PRB A;  1I94 M;  5KQ8 A;  4IBJ A;  2DHR A;  1D0L A;  3SYK A;  4WW0 A;  1MJG M;  3Q8X A;  3C58 A;  1N75 A;  2M60 A;  3KSJ A;  2Y0T A;  1IN6 A;  3HJS A;  4FWG A;  2ZTD A;  1VDL A;  1L1Z A;  3M0E A;  3DFZ A;  3I4Y A;  1W5S A;  3KSX A;  3UK6 A;  4B7G A;  1DGH A;  4FW9 A;  2CUZ A;  1E9S A;  2K6B A;  2JP7 A;  3OTO M;  4DR2 M;  1W5T A;  4LZZ A;  2MH8 A;  1HJP A;  7CAT A;  4NXM M;  3DOA A;  1GJS A;  1MX0 A;  1KYI A;  1QUT A;  4B3R M;  3V76 A;  1BVS A;  1UFZ A;  3MK6 A;  3GLI E;  2L2D A;  1T6O A;  4GRI A;  4CIS A;  1NJG A;  1TF0 B;  1L8Q A;  3PNY A;  3TPZ A;  3SAS A;  4Y28 F;  5EXT A;  3JR4 A;  3R8F A;  2HL7 A;  4I5S A;  4MGI E;  2LH0 A;  4G4Q A;  1ORY B;  5DYG A;  2LNH C;  3ILK A;  1DV0 A;  2F5P A;  4LJ5 A;  3MMP A;  4DV0 M;  1GJT A;  1WXQ A;  4I8O A;  1HNX M;  3HWS A;  2JY5 A;  2WSF F;  3A98 B;  1IXR C;  3L26 A;  3GLF E;  3KP0 E;  1XXH B;  3W67 A;  1IN5 A;  1XHB A;  1H6U A;  1G4A E;  3SFZ A;  4LF7 M;  1TR8 A;  1IY2 A;  3C9P A;  3FUU A;  2F4V M;  2BWE A;  1OAI A;  4DR6 M;  1MN3 A;  1QYR A;  2B3T A;  2ERC A;  2FOI C;  2BWB A;  1VEJ A;  3EIH A;  3HHX A;  3M6A A;  1OFH A;  3FRH A;  2J5Y A;  1PJS A;  3IEC A;  1J5E M;  4LF8 M;  4ANR A;  4LGY A;  3FD9 A;  4AG6 A;  4PDI A;  5LMN M;  4NSR A;  3THG A;  4P16 A;  1IY0 A;  2JZ0 A;  2JXN A;  3KS4 A;  2J7N A;  1QDR A;  3KDS E;  2BJW A;  4X66 M;  1PJQ A;  1XB2 B;  1Q39 A;  4B3T M;  1VG5 A;  3U5Z B;  2JY7 A;  2ZM6 M;  1L2B A;  1NNU C;  3KVW A;  4BLC A;  4B3M M;  2LVA A;  2QQ8 A;  3EIE A;  1E9R A;  3VLF B;  3C3D A;  1XMQ M;  1PGY A;  1QAQ A;  4KT0 F;  3T38 A;  4FCW A;  5E26 A;  2YQZ A;  4A3V B;  1PJT A;  1QZM A;  4QHS A;  3T6P A;  2G5G X;  4LRS A;  1VQ1 A;  5F3W A;  2XFS A;  2DAE A;  2KRK A;  2KEB A;  1UM8 A;  2C98 A;  4IBC A;  3HGI A;  3SAV A;  5ITQ A;  2KXE A;  3GLF A;  4IBD A;  5FTK A;  2O01 F;  2Q2E B;  1G41 A;  2DAK A;  1Z59 A;  4DV1 M;  4GMQ A;  2JZ1 A;  3IHP A;  3FTF A;  5KPZ A;  5FTM A;  1NY5 A;  3E46 A;  3W0F A;  3LVW A;  2O5R A;  3HY5 A;  5FLX S;  2F5O A;  4AQY M;  2EO2 A;  3SAR A;  4TUW A;  2QBY A;  4Z6Y A;  1HQY E;  2F5Q A;  3K8Z A;  4AKI A;  5IT9 S;  4R3D A;  1YSY A;  2R65 A;  2ZTC A;  5IWA M;  3GPY A;  1IBM M;  3FUV A;  4QOS A;  4F2L A;  3U6L A;  1V34 A;  4AKG A;  1TH4 A;  3F92 A;  2LVP C;  1XNR M;  3T15 A;  4OX9 M;  1YUB A;  3CF6 E;  1YE9 A;  1J7K A;  3GRR A;  4BBA A;  1PM5 A;  1NY6 A;  5JI2 E;  1TDH A;  2DAI A;  4II7 A;  4RF1 A;  1S3S A;  2CHG A;  2XGN A;  4G4N A;  3PNV A;  3HKP A;  4GH9 A;  4LZJ A;  1FNN A;  4QNM A;  3ZQJ A;  2QPA A;  3GQ3 A;  5LMU M;  4LF6 M;  4I4L A;  3GPU A;  2JWS A;  4YY3 M;  2KRU A;  2WSC F;  4KOD A;  4NRV A;  1C7Y A;  4BB9 A;  4KHP M;  3I01 M;  1QDT A;  3CF2 A;  3KXE C;  4IBK A;  1TDZ A;  3SC3 A;  2DWZ B;  3T1H M;  1PJI A;  1IXS B;  1ZMV A;  2DWL A;  1QUS A;  3SHG B;  2RKO A;  5E6J A;  2GQF A;  2YNM D;  1N77 A;  2CV0 A;  2MGW A;  4UN2 B;  2VF8 A;  2DWM A;  2Y20 A;  2DAM A;  3KFU G;  4GIT A;  4GC5 A;  5BR8 M;  2L7I A;  3U61 B;  1OIZ A;  1Z5A A;  3M7G A;  3GLH B;  3MHV C;  2LHG A;  4S12 A;  2F5S A;  4IBB A;  3B9P A;  1XXH E;  2FFJ A;  3WHK A;  2HCB A;  4G6Z A;  5EJC A;  1XMO M;  3UZU A;  1I4W A;  2HHH M;  3J80 S;  3SYL A;  3TWL A;  1IN8 A;  2VF7 A;  3GPP A;  2VQE M;  1OFI A;  2FS1 A;  1ZQ9 A;  3GRY A;  1F4I A;  2LVQ D;  3SHF A;  4JN6 A;  3H4M A;  1NV8 A;  1N36 M;  1N33 M;  1OIP A;  1ZMU A;  1V33 A;  4QHT A;  4NRW A;  4WP2 A;  2P5T A;  2WZJ A;  4IBI A;  4NL4 H;  3GP1 A;  2L4E A;  1XC8 A;  3ZCB B;  1JQJ C;  3J2P B;  1HR0 M;  2JA2 A;  3QYB A;  4MGY E;  4PT5 A;  4KO8 A;  4HEO A;  2H5X A;  4B08 A;  3UJN A;  3GLH A;  1IN4 A;  3JAM S;  4DUY M;  2L09 A;  2KA6 B;  2XZF A;  1HQC A;  3SMP A;  1KSF X;  4LCB A;  1D2N A;  1XNQ M;  3TWM A;  2APL A;  4JV5 M;  4FD2 A;  4IBG A;  2EA0 A;  3GRV A;  2CHV A;  2R62 A;  2O25 A;  1L2D A;  1G3I A;  2CRU A;  4LGM A;  3AOE C;  2JNH A;  2R0I A;  3LCV B;  4D82 A;  2D7G A;  4LF5 M;  5KPR A;  2DZL A;  4JXJ A;  3BOS A;  2I7N A;  3AJI B;  3PFI A;  3U6Q A;  4M0D A;  1WJ7 A;  4DV5 M;  1WHC A;  4JI1 M;  3A45 A;  1G71 A;  1XXH A;  2D7H A;  3ZH9 B;  3KS8 A;  2XZU A;  1ZMW A;  2DEN A;  2MR9 A;  2EJS A;  4K0K M;  1D0M A;  3I04 M;  2C96 A;  4YHH M;  1LV7 A;  4IIW A;  2WSE F;  2KNZ A;  1OQY A;  1QAO A;  3HU3 A;  4Q7J A;  4RF0 A;  4DV3 M;  5C1B A;  5KO3 A;  3HX3 A;  1R2Z A;  1DO2 A;  2QHO B;  2ZBK B;  4GEW A;  1D0K A;  3FYC A;  3L28 A;  4CHT B;  4AG5 A;  3HHY A;  3RE8 A;  1CUK A;  3KOW E;  4NOO B;  1PJJ A;  1IXZ A;  1OJL A;  2VDB B;  2Y0Q A;  1OTR A;  1J09 A;  3R9X B;  1OKS A;  4R7G A;  2C99 A;  4D80 A;  2HWJ A;  2X49 A;  2HAK A;  2CE7 A;  2OOB A;  5FTJ A;  4DR1 M;  2QZ4 A;  3U5Z A;  4ITQ A;  4L6V 6;  2LXE A;  4LY6 A;  4W5W A;  3VFD A;  3KOY E;  5FTN A;  2CV1 A;  4LJ8 A;  3GQ4 A;  1GVN A;  3MJ5 A;  1HNZ M;  2DVW B;  4LF9 M;  1IFY A;  4LJ4 A;  3AFH A;  4IJE A;  3VDP A;  3K9P A;  3LQR A;  2BJV A;  3TQS A;  4R71 A;  4OVZ B;  3UGJ A;  1HNW M;  1TH2 A;  1FJG M;  3SAW A;  1R6B X;  2I7P A;  2Y21 A;  2G3Q A;  3VDU A;  3GQ5 A;  3K2L A;  1T3T A;  1NV9 A;  4MM3 B;  2L6O A;  4AI6 A;  4CJ6 A;  5EP1 A;  1R4G A;  4DV2 M;  4DV7 M;  2A5Y B;  2UUC M;  3U6S A;  3J27 B;  3FKE A;  1WGL A;  2XH9 A;  3NWL A;  4JI3 M;  4LF4 M;  5BPV A;  8CAT A;  2R46 A;  2KHH A;  4M9S A;  5ITX E;  1ZV1 A;  3L2A A;  4B7H A;  2R4E A;  4GKK M;  1VEK A;  3U6P A;  2NQ8 C;  3CF0 A;  4CGY B;  1NJF A;  2RGO A;  1QQW A;  3B7N A;  1YLA A;  4IBF A;  4G3O A;  4DV6 M;  3T1Y M;  4GKJ M;  4PD2 A;  1E94 E;  3FTE A;  3D8L A;  3GLH E;  4HLQ A;  4P17 A;  3TL4 X;  2VQF M;  3ZC7 B;  2DWN A;  1NNJ A;  1G8P A;  2BNK A;  3B74 A;  4MGZ E;  1N78 A;  3HZJ A;  4CIZ A;  4X65 M;  1WIV A;  4GHA A;  2LWX A;  4OW0 A;  4QOZ C;  2R45 A;  4L16 A;  1L2C A;  3IG5 A;  3I4V A;  3LCU A;  4REZ A;  1DGG A;  1P3Q Q;  1Y8G A;  3K1J A;  2ZAN A;  4DR7 M;  2DI0 A;  1DGF A;  2KDL A;  2KZU A;  1L1T A;  3E9S A;  1XWI A;  1R2Y A;  5IZ7 D;  2X8A A;  1DGB A;  1GLN A;  4G4R A;  4JI8 M;  2XSZ D;  1AUA A;  3J81 S;  3FE3 A;  3E21 A;  4D81 A;  1Z6T A;  3HHW A;  4MGH A;  3QWL A;  4LJA A;  1EIJ A;  4JYA M;  3SAU A;  3FRI A;  4WUR A;  1GL7 A;  3GLG E;  1R5L A;  5H37 D;  3HHZ A;  4JI4 M;  1JR3 E;  4FCV A;  1EFU B;  2QCU A;  4JI0 M;  3H4J A;  3JR5 A;  3WHL A;  2DAG A;  4B3S M;  3KW6 A;  4M9X A;  1IXS A;  4JI7 M;  2UXD M;  4PDG A;  1AIP C;  2LVN C;  3KP1 E;  4FWD A;  4L15 A;  1NO1 A;  2D7E A;  2LVO C;  2W82 A;  4LJ9 A;  2XSZ A;  5EXX A;  5ITX A;  4NSO B;  5ITR A;  5ITT A;  4JI6 M;  3FTC A;  2QNJ A;  2Z4R A;  3U6M A;  1IM2 A;  4LJ7 A;  4MB7 A;  4EIW A;  3U61 A;  4DR5 M;  3LMM A;  2OPF A;  4DUZ M;  2R4J A;  4Z8X A;  2ZAM A;  1HT1 E;  2KNV A;  2V1U A;  4FWH A;  3GPX A;  5EP4 A;  4LFB M;  1WGN A;  3GLG B;  1IN7 A;  2Z3X A;  2K47 A;  3FUX A;  3KOX E;  5FSW A;  2Z8Y M;  1NHW C;  3LW5 F;  1V92 A;  5EXP A;  5A2Q S;  2UUB M;  2G8L A;  2FE8 A;  5DYI A;  2AHM A;  3HJ8 A;  4B7F A;  5EXS A;  3TWK A;  5L8R F;  3GO8 A;  4DR3 M;  2RRU A;  1K3X A;  3IG8 A;  1JR3 D;  2YR0 A;  2GNO A;  1GAB A;  4F1I A;  3FUW A;  1EE8 A;  3K92 A;  4AZF A;  1WR1 B;  3SBJ A;  2UXC M;  2CEA A;  4DBG B;  4QNR A;  4NC6 A;  3UMM A;  1X37 A;  3B7Q A;  4DR4 M;  1QAN A;  4RKU F;  1LTM A;  1T43 A;  2Z4S A;  3TE6 A;  2JUJ A;  1QAM A;  2CFO A;  3RGP A;  3GLG A;  3K9O A;  1TTE A;  2DNA A;  2KNA A;  3GLI B;  1JR3 A;  3U6C A; 
#chains in the Genus database with same CATH homology
 4FVM A;  5C18 A;  1C1K A;  2KZS A;  3DA1 A;  4NXN M;  3J7A S;  2V1C A;  2C9C A;  1G59 A;  2V6Z M;  1GKI A;  4LJ6 A;  3NBI A;  5KQD A;  2H1R A;  5DNY A;  3AOE A;  4I81 A;  3RGS A;  2XF3 A;  1KFV A;  4GHL A;  1Z5C A;  2HKJ A;  1Q3B A;  2DZN B;  3W0L B;  5GKN A;  2M5Z A;  1MU5 A;  3L27 A;  1TGU A;  5EP2 A;  1IQP A;  1GL6 A;  1NHG C;  3GLF B;  3VKG A;  2X4A A;  3FUT A;  5ITY A;  3AKZ A;  2ZAO A;  1E32 A;  2L7H A;  3GLI A;  1DO0 A;  3U6E A;  1HT2 E;  1NVM A;  5KPT A;  2C5R A;  3QAU A;  5FTL A;  4LFC M;  4MH0 E;  3U60 B;  1K82 A;  2QP9 X;  2CHQ A;  3A46 A;  2RGH A;  4AW4 A;  3AOG A;  1SXJ E;  2QBY B;  3DZD A;  1Z5B A;  4XBO A;  3VK8 A;  3FYD A;  2XFT A;  4L4U A;  3E4R A;  2J7O A;  3PXG A;  1IY1 A;  3J7B A;  1VDD A;  4GC9 A;  1Q3C A;  1ZAE A;  3HU2 A;  4M9Z A;  4HL4 A;  3RFW A;  4GIP A;  2FNA A;  3HU1 A;  4AKH A;  4JI2 M;  3A42 A;  4FCT A;  4KLN A;  4PCZ A;  2KW0 A;  2XLJ A;  2UU9 M;  1IBK M;  4XGI A;  2F5N A;  3SAT A;  3VKH A;  3LQQ A;  4X64 M;  2R18 A;  3U60 A;  1SXJ C;  5JI3 E;  1K3W A;  1SXJ B;  3FTD A;  2CV2 A;  1R7R A;  3KOZ E;  5IRE B;  2UXB M;  4IBE A;  1IBL M;  4M0W A;  4DV4 M;  4OVZ A;  3L25 A;  2XEP A;  3GRU A;  3AV0 A;  1N34 M;  1SXJ D;  4LRT A;  3U6O A;  4LFA M;  5EP3 A;  3I51 A;  3PVS A;  3L29 A;  3HJQ A;  3U6D A;  4LG2 A;  2QEN A;  2C9O A;  5EQT A;  3AL0 C;  1N32 M;  2VII A;  4IJF A;  4OU7 A;  4G4O A;  3LVV A;  2DZO B;  4RNA A;  2DXI A;  4L78 A;  5ITU A;  4MGK E;  1NSF A;  1DGH B;  2UUA M;  4L8R C;  1QVR A;  1SXJ A;  1TH3 A;  2Z7J A;  3SMS A;  3VK7 A;  3CTW B;  2E5L M;  3D8B A;  2YFQ A;  4X62 M;  4JI5 M;  4ZPX A;  2EUC A;  2OQ4 A;  1I94 M;  5KQ8 A;  4IBJ A;  2DHR A;  3SYK A;  4WW0 A;  3Q8X A;  3C58 A;  1N75 A;  2M60 A;  3KSJ A;  2Y0T A;  1IN6 A;  3HJS A;  4FWG A;  1L1Z A;  3M0E A;  3DFZ A;  3I4Y A;  1W5S A;  3KSX A;  3UK6 A;  4B7G A;  1DGH A;  4FW9 A;  2CUZ A;  1E9S A;  3OTO M;  4DR2 M;  1W5T A;  4LZZ A;  7CAT A;  4NXM M;  3DOA A;  1MX0 A;  1KYI A;  4B3R M;  3MK6 A;  4CIS A;  4GRI A;  1NJG A;  3PNY A;  1L8Q A;  3TPZ A;  3SAS A;  3R8F A;  5EXT A;  3JR4 A;  2HL7 A;  4I5S A;  4MGI E;  2LH0 A;  4G4Q A;  1ORY B;  5DYG A;  2LNH C;  3ILK A;  2F5P A;  4LJ5 A;  4DV0 M;  1WXQ A;  1HNX M;  3HWS A;  3A98 B;  1IXR C;  3L26 A;  3KP0 E;  1XXH B;  1IN5 A;  1XHB A;  1H6U A;  1G4A E;  3SFZ A;  4LF7 M;  2F4V M;  1IY2 A;  3FUU A;  4DR6 M;  1QYR A;  2ERC A;  2FOI C;  3EIH A;  3HHX A;  3M6A A;  1OFH A;  1J5E M;  4LF8 M;  4LGY A;  3FD9 A;  4AG6 A;  4PDI A;  5LMN M;  4NSR A;  3THG A;  4P16 A;  1IY0 A;  3KS4 A;  2J7N A;  3KDS E;  2BJW A;  4X66 M;  4B3T M;  1Q39 A;  3U5Z B;  2ZM6 M;  1L2B A;  1NNU C;  3KVW A;  4BLC A;  4B3M M;  3EIE A;  1E9R A;  3VLF B;  1XMQ M;  1QAQ A;  3T38 A;  4FCW A;  5E26 A;  2YQZ A;  4A3V B;  1QZM A;  4QHS A;  2G5G X;  4LRS A;  5F3W A;  2XFS A;  2KRK A;  2KEB A;  1UM8 A;  2C98 A;  4IBC A;  3HGI A;  3SAV A;  5ITQ A;  2KXE A;  3GLF A;  4IBD A;  5FTK A;  2Q2E B;  1G41 A;  1Z59 A;  4DV1 M;  4GMQ A;  3FTF A;  5KPZ A;  5FTM A;  1NY5 A;  3W0F A;  3LVW A;  2O5R A;  5FLX S;  2F5O A;  4AQY M;  2EO2 A;  3SAR A;  4TUW A;  2QBY A;  4Z6Y A;  1HQY E;  2F5Q A;  3K8Z A;  4AKI A;  5IT9 S;  4R3D A;  1YSY A;  2R65 A;  5IWA M;  3GPY A;  1IBM M;  3FUV A;  4QOS A;  3U6L A;  4AKG A;  1TH4 A;  1XNR M;  3T15 A;  4OX9 M;  1YUB A;  3CF6 E;  1YE9 A;  1J7K A;  3GRR A;  4BBA A;  1PM5 A;  1NY6 A;  5JI2 E;  1TDH A;  4II7 A;  4RF1 A;  1S3S A;  2CHG A;  2XGN A;  4G4N A;  3PNV A;  3HKP A;  4GH9 A;  4LZJ A;  1FNN A;  4QNM A;  3GQ3 A;  2QPA A;  4LF6 M;  5LMU M;  4I4L A;  3GPU A;  4YY3 M;  2KRU A;  4KOD A;  4NRV A;  4BB9 A;  4KHP M;  3CF2 A;  3KXE C;  4IBK A;  1TDZ A;  3SC3 A;  2DWZ B;  3T1H M;  1PJI A;  1IXS B;  2DWL A;  3SHG B;  2RKO A;  5E6J A;  2YNM D;  1N77 A;  2CV0 A;  2DWM A;  2Y20 A;  3KFU G;  4GIT A;  4GC5 A;  5BR8 M;  2L7I A;  3U61 B;  1Z5A A;  3M7G A;  3GLH B;  3MHV C;  4S12 A;  2F5S A;  4IBB A;  3B9P A;  2FFJ A;  3WHK A;  2HCB A;  4G6Z A;  5EJC A;  1XMO M;  3UZU A;  1I4W A;  2HHH M;  3J80 S;  3SYL A;  3TWL A;  1IN8 A;  3GPP A;  2VQE M;  1OFI A;  1ZQ9 A;  3GRY A;  3SHF A;  4JN6 A;  3H4M A;  1N36 M;  1N33 M;  4QHT A;  4NRW A;  2P5T A;  4IBI A;  4NL4 H;  3GP1 A;  1XC8 A;  3ZCB B;  1JQJ C;  3J2P B;  1HR0 M;  2JA2 A;  4MGY E;  4PT5 A;  4KO8 A;  4B08 A;  3UJN A;  3GLH A;  1IN4 A;  3JAM S;  4DUY M;  2L09 A;  2KA6 B;  2XZF A;  1HQC A;  3SMP A;  1KSF X;  4LCB A;  1D2N A;  1XNQ M;  3TWM A;  4JV5 M;  4FD2 A;  4IBG A;  2EA0 A;  3GRV A;  2CHV A;  2R62 A;  1L2D A;  1G3I A;  4LGM A;  3AOE C;  4D82 A;  2D7G A;  4LF5 M;  5KPR A;  4JXJ A;  3BOS A;  2I7N A;  3AJI B;  3PFI A;  3U6Q A;  4M0D A;  4DV5 M;  4JI1 M;  3A45 A;  1XXH A;  2D7H A;  3ZH9 B;  3KS8 A;  2XZU A;  4K0K M;  2C96 A;  4YHH M;  1LV7 A;  4IIW A;  4RF0 A;  1QAO A;  3HU3 A;  4DV3 M;  5C1B A;  5KO3 A;  1R2Z A;  1DO2 A;  2ZBK B;  3FYC A;  3L28 A;  4CHT B;  4AG5 A;  3HHY A;  3RE8 A;  3KOW E;  4NOO B;  1PJJ A;  1IXZ A;  1OJL A;  2Y0Q A;  1J09 A;  3R9X B;  4R7G A;  2C99 A;  4D80 A;  2X49 A;  5FTJ A;  2CE7 A;  4DR1 M;  3U5Z A;  2QZ4 A;  4ITQ A;  2LXE A;  4LY6 A;  4W5W A;  3VFD A;  3KOY E;  5FTN A;  2CV1 A;  4LJ8 A;  3GQ4 A;  1GVN A;  3MJ5 A;  1HNZ M;  2DVW B;  4LF9 M;  4LJ4 A;  3AFH A;  4IJE A;  3VDP A;  1HNW M;  3LQR A;  2BJV A;  3TQS A;  4OVZ B;  3UGJ A;  1TH2 A;  1FJG M;  3SAW A;  1R6B X;  2I7P A;  2Y21 A;  3VDU A;  3GQ5 A;  3K2L A;  1T3T A;  4MM3 B;  2L6O A;  4AI6 A;  5EP1 A;  4DV2 M;  4DV7 M;  2A5Y B;  2UUC M;  3U6S A;  3J27 B;  3FKE A;  2XH9 A;  3NWL A;  4JI3 M;  4LF4 M;  5BPV A;  8CAT A;  2R46 A;  4M9S A;  5ITX E;  4GKK M;  3L2A A;  4B7H A;  2R4E A;  3U6P A;  2NQ8 C;  3CF0 A;  4CGY B;  1NJF A;  2RGO A;  1QQW A;  4IBF A;  4DV6 M;  3T1Y M;  4GKJ M;  4PD2 A;  1E94 E;  3FTE A;  3D8L A;  4HLQ A;  3TL4 X;  2VQF M;  3ZC7 B;  2DWN A;  1NNJ A;  1G8P A;  2BNK A;  4MGZ E;  1N78 A;  4X65 M;  4GHA A;  4QOZ C;  2LWX A;  4OW0 A;  2R45 A;  4L16 A;  1L2C A;  3IG5 A;  3I4V A;  4REZ A;  1DGG A;  4DR7 M;  3K1J A;  2ZAN A;  1DGF A;  2KZU A;  1L1T A;  3E9S A;  1XWI A;  1R2Y A;  5IZ7 D;  2X8A A;  1DGB A;  1GLN A;  4G4R A;  4JI8 M;  2XSZ D;  3J81 S;  4D81 A;  1Z6T A;  3HHW A;  4MGH A;  3QWL A;  4LJA A;  4JYA M;  3SAU A;  4WUR A;  1GL7 A;  3HHZ A;  4JI4 M;  5H37 D;  4FCV A;  2QCU A;  4JI0 M;  3JR5 A;  3WHL A;  4B3S M;  3KW6 A;  4M9X A;  2UXD M;  4JI7 M;  4PDG A;  3KP1 E;  4FWD A;  4L15 A;  2D7E A;  2W82 A;  4LJ9 A;  5ITX A;  2XSZ A;  5EXX A;  4NSO B;  5ITR A;  5ITT A;  4JI6 M;  3FTC A;  2Z4R A;  3U6M A;  1IM2 A;  4LJ7 A;  4MB7 A;  4EIW A;  3U61 A;  4DR5 M;  3LMM A;  2OPF A;  4DUZ M;  2R4J A;  4Z8X A;  2ZAM A;  1HT1 E;  2V1U A;  4FWH A;  3GPX A;  5EP4 A;  4LFB M;  3GLG B;  1IN7 A;  2Z3X A;  2K47 A;  3FUX A;  3KOX E;  5FSW A;  1NHW C;  5EXP A;  5A2Q S;  2UUB M;  2G8L A;  2FE8 A;  5DYI A;  2AHM A;  3HJ8 A;  4B7F A;  5EXS A;  3TWK A;  3GO8 A;  4DR3 M;  1K3X A;  3IG8 A;  1JR3 D;  2YR0 A;  3FUW A;  1EE8 A;  3K92 A;  4AZF A;  3SBJ A;  2UXC M;  2CEA A;  4QNR A;  3UMM A;  1X37 A;  4DR4 M;  1QAN A;  3TE6 A;  2Z4S A;  1QAM A;  2CFO A;  3RGP A;  3GLG A;  3GLI B;  4I8O A;  1JR3 A;  3U6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...