3MHVC

Crystal structure of vps4 and vta1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
102
Chain Sequence
GSPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTPCSPGDDGAIEMSPDLTIKDFLKAIKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 4
publication title Structural role of the Vps4-Vta1 interface in ESCRT-III recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 29
structure length 102
sequence length 117
ec nomenclature
pdb deposition date 2010-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3mhvC00
5DYIA 5FTNA 3CF0A 3UK6A 1NVMA 5EP4A 5EP1A 3GLIB 5FTJA 3EIHA 3WHKA 2V6ZM 1IN4A 1S3SA 2R62A 4LJ5A 4QNRA 2RKOA 3KDSE 2V1UA 4JN6A 2C96A 1HT1E 1KSFX 4A3VB 1NY6A 4LRTA 3EIEA 3CF2A 1XXHA 2C99A 1IY2A 4LJ7A 3HU1A 1D2NA 4D80A 1IXSB 1IQPA 1JR3D 3GLGB 5FTKA 4LJ4A 3PXGA 1KYIA 5JI2E 5EXXA 2QP9X 4WW0A 2QBYB 1QVRA 2DHRA 1IN5A 2QZ4A 1IY1A 1IN8A 3H4MA 2ZAMA 1LV7A 1SXJA 4LZZA 2DZNB 1XWIA 4Z8XA 4LJ9A 5C18A 1DO2A 1G41A 4ZPXA 5FTMA 2KRKA 3MHVC 2CHVA 4QOSA 5EXSA 1W5TA 1R6BX 4LGMA 5EQTA 3U60B 2XSZD 4FWHA 4LJ8A 5JI3E 3HWSA 4FWDA 1G4AE 3ZH9B 1L8QA 3KW6A 3HU2A 2CE7A 1SXJC 2CHGA 3GLIA 3GLHA 1IXRC 4FWGA 4EIWA 4LJ6A 3PFIA 1DO0A 3AJIB 1C1KA 1NJFA 2QENA 1NJGA 5EP3A 2VIIA 3GLFB 3R8FA 3K1JA 4QNMA 1HT2E 3GLHB 5EXTA 3GLGA 1HQYE 3M0EA 2Z4SA 4KLNA 1JR3A 4L15A 1FNNA 4QHSA 1IN7A 3SYLA 5DYGA 2ZAOA 2QBYA 4D82A 3M6AA 4I4LA 1E94E 2BJVA 3D8BA 1NY5A 3SYKA 3U5ZB 4LRSA 3SC3A 4L4UA 4LY6A 2X8AA 4FCTA 2C9CA 1OJLA 1IY0A 1XXHB 2C98A 2HCBA 4KODA 2QPAA 5C1BA 2R65A 1IM2A 5FTLA 1HQCA 1QZMA 2CEAA 4L16A 4D81A 1NSFA 2DWZB 4FW9A 1OFIA 1W5SA 4FD2A 3VLFB 2XSZA 2C9OA 3HU3A 4LCBA 1SXJD 2FNAA 3DZDA 2DVWB 3B9PA 1UM8A 1SXJB 1IN6A 1IXZA 4KO8A 3WHLA 1G3IA 5EXPA 1JQJC 4FCVA 2ZANA 1J7KA 3PVSA 1E32A 2Z4RA 4QHTA 2DZOB 5EP2A 3VFDA 4I81A 3U61B 4FCWA 3GLFA 4LJAA 1OFHA 3BOSA 4GITA 1R7RA 1SXJE 2CHQA 1X37A 2BJWA
chains in the Genus database with same CATH superfamily
4MGIE 3TWKA 5FTNA 2CV0A 3L27A 4LF7M 3CF0A 1D0LA 1Q39A 5A2QS 3CTWB 3GLIB 4I8OA 3AV0A 1IN4A 2W82A 4MGZE 3FYDA 3HX3A 3I51A 2DHYA 4R7GA 2L7HA 3U5ZA 2F5OA 3C3DA 4JN6A 2C96A 1HT1E 2V1UA 3U6MA 3KXEC 4DV6M 3EIEA 4LG2A 3BBZA 4NRVA 3K2LA 1MX0A 3HU1A 4D80A 1IXSB 3FUVA 3HHZA 1LTMA 3M7GA 4KT0F 3U6DA 1DGFA 4MGHA 2LWXA 8CATA 1Q3BA 2R4EA 4WW0A 3FUUA 3GRYA 3VK8A 1QVRA 3K9OA 4RF1A 1IBMM 1F4IA 1IY1A 2HWJA 2KNVA 2JWSA 3H4MA 1SXJA 4GRIA 3MJ5A 2DZNB 1Q02A 4DBGB 2LVAA 2XEPA 4DR2M 3B89A 3CGWA 3HHWA 4GEWA 3SHGB 2JP7A 2KRKA 1MN3A 1YUBA 4B7FA 2CHVA 4QOSA 2F5SA 1W5TA 3GPUA 5EQTA 4DV4M 3U6SA 1TH3A 2F5PA 1T6OA 4ITQA 2Y0QA 5E26A 5JI3E 2AHMA 2Z3XA 1G4AE 2CV1A 1L8QA 1ORYB 1WGLA 3KW6A 1VDDA 3J7AS 4FVMA 3J7BA 2DWNA 1SXJC 4G6ZA 4G4QA 4JI7M 5F3WA 1TDZA 1OAIA 2WSCF 4PD2A 1K82A 4EIWA 3A46A 3LVWA 4P16A 4I5SA 1T43A 4IBEA 3AOGA 5ITRA 4X65M 1N77A 5KPZA 1NJFA 3U6CA 4QOZC 1XNQM 4DV2M 4M9XA 2DAEA 2J5YA 3SHFA 5EJCA 5ITXA 4DV5M 4CISA 3TE6A 2MGWA 2HKJA 2A5YB 4G4NA 3GLGA 1PJJA 1MU5A 3FUXA 2EUCA 1JR3A 1GLNA 4AKGA 1FNNA 1Z5AA 2UU9M 2LHGA 1JB0F 3FTDA 3DA1A 2QBYA 2DENA 2I7PA 3C58A 2MH8A 1GO5A 4AKIA 3GLHE 3F92A 1NY5A 3HHYA 4LRSA 1L1ZA 4CIZA 1PM5A 4LF5M 3KS8A 3SASA 2VF7A 4OVZB 1OJLA 2C9CA 3I04M 5C1BA 7CATA 1G59A 3VKHA 4NL4H 1J5EM 4D81A 1QZMA 2CEAA 2XFSA 4B08A 2CV2A 2DWZB 1OKSA 1QANA 2R46A 3GPYA 4FD2A 3ZC7B 1PJTA 3VLFB 2OO9A 2XSZA 4B3SM 1ZQ9A 3W67A 2DZLA 4L8RC 3DOAA 2HHHM 3QAUA 1SXJD 4NSRA 4RKUF 5GKNA 3DZDA 2DAMA 1XMQM 2DVWB 4MH0E 4X66M 4KO8A 1IXZA 3WHLA 4MGKE 2OPFA 5EXPA 1GJSA 2EKFA 5KPTA 1QDTA 3HGIA 4QHTA 2Z4RA 4L78A 4OX9M 4FCWA 2H1RA 2G5GX 4LJAA 3UMMA 1R7RA 1SXJE 1GVNA 1PRBA 2UUBM 5IT9S 3U6QA 3SARA 1T3TA 2JY8A 2D7GA 1N32M 3HJSA 4LFAM 4AQYM 1NVMA 2KHHA 2LVQD 4UN2B 5EP4A 3EIHA 4LJ5A 4MB7A 2R0IA 3IHPA 4RF0A 3KDSE 2KZUA 3A45A 5DNYA 2WZJA 1R2YA 3LQQA 1NY6A 1YLAA 4LRTA 5ITTA 2UUCM 3CF2A 1XXHA 1QUSA 2C99A 1IY2A 4S12A 1FJGM 2VQFM 4NXNM 1A5TA 3SFZA 1JR3D 2EJSA 2Y0TA 1YE9A 1WIVA 3FTCA 3PXGA 1I94M 1KYIA 1OQYA 3I4YA 5JI2E 3ZQJA 3Q8XA 4BLCA 2JY5A 2DKLA 3A42A 3E46A 5ITXE 4JV5M 2DHRA 2DAIA 2HAKA 3E21A 4MGYE 4IBGA 2QZ4A 3K9PA 4DV0M 2ZM6M 3L29A 4M9ZA 3GLGE 4JI0M 2GQFA 1LV7A 4K0KM 2KA6B 3D8LA 4LJ9A 4R3DA 1DO2A 1G41A 4CJ6A 5C18A 2Y21A 3FUTA 1CUKA 3I4VA 3MHVC 3LCUA 2I7NA 2DAGA 1R6BX 4LGMA 5IZ7D 1MJGM 2JXNA 2XSZD 3LCVB 4FWHA 2R6FA 2F5NA 2UXBM 2DWMA 1QAMA 3DFZA 3UZUA 1N36M 3HU2A 2VQEM 4JI1M 2CP8A 2FH0A 2H5XA 1TR8A 1WR1B 2DWLA 2OQ4A 2KEBA 1TDHA 4Z6YA 3J2PB 1HJPA 1DO0A 2LBCA 1C1KA 2QENA 3W68A 1EFUB 1OTRA 2VIIA 4PDGA 3MK6A 3SAVA 3R8FA 3K1JA 4B3TM 1UFZA 2L7IA 3B7NA 2FE8A 3GLHB 1TTEA 5EXTA 2FS1A 4YY3M 5ITUA 1N34M 3SAUA 1QUTA 1Z59A 3SAWA 3V76A 3M0EA 1L2BA 3PNYA 1YSYA 4KLNA 4L15A 4Y28F 3RE8A 1NHWC 1TH4A 3FTEA 2ERCA 4IBBA 3KFUG 2ZAOA 4NSOB 3M6AA 3K8ZA 4I4LA 4BBAA 1K3XA 3U5ZB 3SYKA 4G3OA 4IIWA 2APLA 1Q3CA 4DR4M 1OAOC 4L4UA 4LF9M 2X8AA 3NBIA 2XFTA 4IJEA 1OIZA 2KNAA 1IY0A 4GIPA 2HCBA 2KDLA 2Y20A 1VDLA 4DR3M 3C3EA 5FTLA 3U60A 2WSEF 2EA0A 3UJNA 3IG5A 4JI4M 1NSFA 1J09A 2JY6B 2LVPC 3VDUA 2QCUA 1OIPA 1W5SA 4XGIA 1IBLM 1XXHE 4AI6A 3HKPA 1GKIA 4GHLA 3FRHA 2FNAA 4OW0A 3SBJA 2X4AA 1SXJB 2X49A 3KP1E 4RNAA 2MROB 1NO1A 3R9XB 3JR4A 1JQJC 3KP0E 3L28A 1EIJA 1G71A 1J7KA 2QNJA 2ZANA 3PVSA 3KVWA 4II7A 3TPZA 3VFDA 4I81A 3KOYE 3J81S 2J7OA 2R44A 3QYBA 3GLFA 1OFHA 3AOEA 5LMNM 4JI8M 4PT5A 3KSXA 2K6BA 2CHQA 2G3QA 3J80S 1N75A 2XH9A 2F4VM 1AIPC 1DGHA 2UXCM 2YNMD 2LVOC 4G4OA 1GL7A 5EP1A 1E9RA 4HLQA 4IJFA 5FTJA 4IBJA 2BWBA 2QQ8A 3WHKA 3GP1A 2V6ZM 2DXIA 2XF3A 4LF8M 3FRIA 4GKJM 1WGNA 2O01F 2RKOA 3AOEC 3SMPA 1NNJA 3VKGA 1DV0A 1ZMUA 1D0KA 2L2DA 1Z6TA 2R18A 1KSFX 2JZ1A 2M5ZA 4A3VB 1N78A 5FLXS 1G8PA 2C5RA 1XB2B 1IQPA 2XZUA 3GLGB 4LJ4A 2K0BX 3C9PA 3AKZA 3CF6E 4JYAM 3IECA 3VDPA 4B7HA 3W0FA 4GC5A 2QBYB 3THGA 5L8RF 1VEGA 4F1IA 1R2ZA 2UUAM 4JI6M 2O5RA 4Z8XA 4ZPXA 1WJ7A 5ITQA 5FTMA 4IBIA 1NV9A 5EXSA 3U61A 3L2AA 3VK7A 2HL7A 3T1YM 4KHPM 4LJ8A 4X62M 4FWDA 1R4GA 3J27B 1N33M 4PDIA 1K3WA 3KS4A 3IG8A 3W0LB 2CE7A 2L09A 3GLIA 3GLHA 3B7QA 1DGGA 3KOWE 2KXEA 4MM3B 5KO3A 3GQ3A 3U6LA 3FTFA 4AG6A 1ZMWA 2QHOB 2XZFA 3B74A 3NWLA 3PFIA 2J7NA 3Q8GA 4NRWA 2G8LA 4DR7M 4XK8F 5BR8M 1VG5A 3GRRA 1H6UA 2DAKA 4IBCA 5FSWA 2LHCA 1JR3E 1HT2E 3FYCA 1QYRA 1IXSA 4DV7M 1ZV1A 3QYEA 1IFYA 1TGUA 5KQDA 4DV3M 2CUZA 1SG9A 1PGYA 3FKEA 3KOZE 4DUYM 2KRUA 4QHSA 1IN7A 2RGHA 3SYLA 1TH2A 3JR5A 5DYGA 4D82A 4M0WA 1HR0M 1E94E 2BJVA 3D8BA 4NOOB 3L26A 1QZEA 4NXMM 3TQSA 4NC6A 1XC8A 3TL4X 2FOIC 3FD9A 3KOXE 5KPRA 2FFJA 4DR1M 3NBXX 1V92A 2DI0A 4CGYB 1XXHB 2JA2A 4KODA 1QDRA 4JI2M 2UXDM 1QAQA 3KSJA 4G4RA 2R65A 4DUZM 1EE8A 4CHTB 4L16A 2R45A 4P17A 1OFIA 3T15A 3L25A 3T38A 3ZCBB 1VEJA 2EKKA 2EO2A 1XNRM 3HU3A 3BXWA 4LZJA 3LQRA 4M0DA 2OOBA 3B9PA 1UM8A 1DGBA 1IN6A 5LMUM 1G3IA 3AL0C 5BPVA 4GH9A 2BNKA 4FCVA 1E32A 2BWEA 1AUAA 2DZOB 1PJQA 2JY7A 2L4EA 4GHAA 3T6PA 2LTUA 4GITA 4B3RM 4DV1M 3TWLA 5DYIA 5IREB 4ANRA 1RU3A 2L4FA 3K92A 3UK6A 2JZ0A 2ZTDA 4REZA 4GC9A 2JUJA 4GKKM 5H37D 2ZBKB 3I01M 5E6JA 1S3SA 2R62A 2V1CA 4GMQA 1QAOA 3B7ZA 3FUWA 3HY5A 4IBKA 4QNRA 3FE3A 4YHHM 2DNAA 3E9SA 1XMOM 3GO8A 4IBDA 1C7YA 3PNVA 4OVZA 1L2DA 4LF6M 1NHGC 3GLIE 2Z8YM 4LJ7A 2VDBB 1V33A 1D2NA 4F2LA 2RGOA 5ITYA 1IBKM 4WURA 3MMPA 5FTKA 1WHCA 3QWLA 2E5LM 5EXXA 2QP9X 3GPXA 1GABA 2O25A 1V34A 3RGSA 4LF4M 3HJQA 4LGYA 3U6OA 1L2CA 1IN5A 3GRVA 2CRUA 2VF8A 4M9SA 4XBOA 1IN8A 4LFCM 2ZAMA 2NQ8C 4LZZA 4Q7JA 4LFBM 1XWIA 3TWMA 3H4JA 3JAMS 4PCZA 1QQWA 3HZJA 4WP2A 4OU7A 2YQZA 3U60B 2D7EA 2WSFF 3A98B 1BVSA 4AW4A 2KZSA 3HWSA 3ILKA 3ZH9B 1E9SA 4AKHA 1L1TA 5KQ8A 3U6PA 1HNWM 4HL4A 2CHGA 1XHBA 1GJTA 1NV8A 1IXRC 4FWGA 4JI3M 4LJ6A 4HEOA 2LNHC 4TUWA 3T1HM 2F5QA 1NNUC 2N35A 3AJIB 2K47A 1NJGA 5EP3A 3GLFB 1Z5BA 3HHXA 4QNMA 4AG5A 1VEKA 1R5LA 1TF0B 1WXQA 2YFQA 2YR0A 1ZAEA 1HQYE 2KW0A 1DGHB 1GL6A 2CWBA 4X64M 3OTOM 2K9DA 1PJIA 2KNZA 1I4WA 2Z4SA 1HNZM 4DR6M 2JNHA 3LW5F 4AZFA 2ZTCA 1ZMVA 2LH0A 2RRUA 3SC3A 2XLJA 1PJSA 2L6OA 4LY6A 4B7GA 1HNXM 4FCTA 3GQ4A 2Q2EB 3E4RA 2XGNA 2C98A 3RFWA 2Z7JA 2QPAA 1IM2A 1HQCA 1Y8GA 2QSFX 3SMSA 4FW9A 4L6V6 4DR5M 2D7HA 3U6EA 4JXJA 2B3TA 2C9OA 3RGPA 4LCBA 3UGJA 3AFHA 3LMMA 3GQ5A 2CFOA 3GPPA 4BB9A 4W5WA 1D0MA 3GRUA 3GLFE 4R71A 4JI5M 2GNOA 2LXEA 1VQ1A 2MR9A 5EP2A 5IWAM 2MJ5B 2LVNC 3U61B 4IBFA 2R4JA 1KFVA 1P3QQ 1Z5CA 2P5TA 2M60A 3BOSA 4B3MM 2OOAA 3SATA 5DFLA 1X37A 2BJWA 3HJ8A 3LVVA
chains in the Genus database with same CATH topology
4MGIE 3TWKA 5FTNA 2CV0A 3L27A 4LF7M 3CF0A 1Q39A 5A2QS 3CTWB 3GLIB 4I8OA 3AV0A 1IN4A 2W82A 4MGZE 3FYDA 3I51A 2F5OA 4R7GA 2L7HA 3U5ZA 2V1UA 4JN6A 2C96A 1HT1E 3U6MA 3KXEC 4DV6M 3EIEA 4LG2A 4NRVA 3K2LA 1MX0A 3HU1A 4D80A 1IXSB 3FUVA 3HHZA 3M7GA 3U6DA 1DGFA 4MGHA 2LWXA 8CATA 1Q3BA 2R4EA 4WW0A 3FUUA 3GRYA 3VK8A 1QVRA 4RF1A 1IY1A 3H4MA 1SXJA 4GRIA 3MJ5A 2DZNB 2XEPA 4DR2M 3HHWA 3SHGB 2KRKA 1YUBA 4B7FA 2CHVA 4QOSA 2F5SA 1W5TA 3GPUA 5EQTA 4DV4M 3U6SA 1TH3A 2F5PA 4ITQA 3VKGA 2Y0QA 5E26A 5JI3E 2AHMA 2Z3XA 1G4AE 2CV1A 1L8QA 1ORYB 3KW6A 3J7AS 1VDDA 4FVMA 3J7BA 2DWNA 1SXJC 4G6ZA 4G4QA 4JI7M 5F3WA 1TDZA 4PD2A 1K82A 4EIWA 3A46A 3LVWA 4P16A 4I5SA 4IBEA 3AOGA 5ITRA 4X65M 1N77A 5KPZA 1NJFA 3U6CA 4QOZC 1XNQM 4DV2M 4M9XA 3SHFA 5EJCA 5ITXA 4DV5M 4CISA 3TE6A 2BJWA 2HKJA 2A5YB 4G4NA 3GLGA 1PJJA 1MU5A 3FUXA 2EUCA 1JR3A 1GLNA 4AKGA 1FNNA 1Z5AA 2UU9M 3FTDA 3DA1A 2QBYA 2I7PA 3C58A 4AKIA 1NY5A 3HHYA 4LRSA 1L1ZA 1PM5A 4LF5M 3KS8A 3SASA 4OVZB 1OJLA 2C9CA 5C1BA 7CATA 1G59A 3VKHA 4NL4H 1J5EM 4D81A 1QZMA 2CEAA 2XFSA 4B08A 2CV2A 2DWZB 1QANA 2R46A 3GPYA 4FD2A 3ZC7B 3VLFB 4B3SM 2XSZA 1ZQ9A 4L8RC 3DOAA 2HHHM 3QAUA 1SXJD 4NSRA 5GKNA 3DZDA 1XMQM 2DVWB 4MH0E 4X66M 4KO8A 1IXZA 3WHLA 4MGKE 2OPFA 5EXPA 5KPTA 3HGIA 4QHTA 2Z4RA 4L78A 4OX9M 4FCWA 2H1RA 2G5GX 4LJAA 3UMMA 1R7RA 1SXJE 1GVNA 2UUBM 5IT9S 3U6QA 3SARA 1T3TA 2D7GA 1N32M 3HJSA 4LFAM 4AQYM 1NVMA 5EP4A 3EIHA 4LJ5A 4MB7A 4RF0A 3KDSE 2KZUA 3A45A 5DNYA 1R2YA 3LQQA 1NY6A 4LRTA 5ITTA 2UUCM 3CF2A 1XXHA 4S12A 2C99A 1IY2A 1FJGM 2VQFM 4NXNM 3SFZA 1JR3D 2Y0TA 1YE9A 3FTCA 3PXGA 1I94M 1KYIA 3I4YA 5JI2E 3Q8XA 4BLCA 3A42A 5ITXE 4JV5M 2DHRA 4MGYE 4DV0M 4IBGA 2QZ4A 2ZM6M 3L29A 4M9ZA 4JI0M 1LV7A 4K0KM 2KA6B 3D8LA 4LJ9A 4R3DA 1DO2A 1G41A 5C18A 2Y21A 3FUTA 3I4VA 3MHVC 2I7NA 1R6BX 4LGMA 5IZ7D 2XSZD 4FWHA 2F5NA 2UXBM 2DWMA 1QAMA 3DFZA 3UZUA 1N36M 3HU2A 2VQEM 4JI1M 2DWLA 2OQ4A 2KEBA 1TDHA 4Z6YA 3J2PB 1DO0A 1C1KA 2QENA 2VIIA 4PDGA 3MK6A 3SAVA 3R8FA 3K1JA 4B3TM 2L7IA 2FE8A 3GLHB 5EXTA 4YY3M 1N34M 3SAUA 1Z59A 3SAWA 3M0EA 1L2BA 3PNYA 1YSYA 4KLNA 4L15A 3RE8A 1NHWC 1TH4A 3FTEA 2ERCA 4IBBA 3KFUG 2ZAOA 4NSOB 3M6AA 3K8ZA 4I4LA 4BBAA 1K3XA 3U5ZB 3SYKA 4IIWA 4DR4M 1Q3CA 4L4UA 4LF9M 2X8AA 3NBIA 2XFTA 4IJEA 1IY0A 4GIPA 2HCBA 2Y20A 4DR3M 5FTLA 3U60A 2EA0A 3UJNA 3IG5A 4JI4M 1NSFA 1J09A 3VDUA 2QCUA 1W5SA 4XGIA 1IBLM 4AI6A 3HKPA 1GKIA 4GHLA 2FNAA 4OW0A 3SBJA 2X4AA 1SXJB 2X49A 3KP1E 4RNAA 3R9XB 3JR4A 1JQJC 3KP0E 3L28A 2ZANA 1J7KA 3PVSA 4II7A 3VFDA 3KVWA 3TPZA 3GO8A 1IBMM 4I81A 3KOYE 3J81S 2J7OA 3GLFA 5LMNM 1OFHA 3AOEA 4JI8M 4PT5A 3KSXA 2CHQA 3J80S 1N75A 2XH9A 2F4VM 1DGHA 2UXCM 2YNMD 4G4OA 1GL7A 5EP1A 1E9RA 4HLQA 4IJFA 5FTJA 4IBJA 3WHKA 3GP1A 2V6ZM 2DXIA 2XF3A 4LF8M 4GKJM 2RKOA 3AOEC 3SMPA 1NNJA 1Z6TA 2R18A 1KSFX 2M5ZA 4A3VB 1N78A 5FLXS 1G8PA 2C5RA 1IQPA 2XZUA 3GLGB 4LJ4A 3AKZA 3CF6E 4JYAM 3VDPA 4B7HA 3W0FA 4GC5A 2QBYB 3THGA 4JI6M 1R2ZA 2UUAM 2O5RA 4Z8XA 4ZPXA 5ITQA 5FTMA 4IBIA 5EXSA 3U61A 3L2AA 3VK7A 2HL7A 3T1YM 4KHPM 4LJ8A 4X62M 4FWDA 3J27B 1N33M 4PDIA 1K3WA 3KS4A 3IG8A 3W0LB 2CE7A 2L09A 3GLIA 1DGGA 3KOWE 2KXEA 4MM3B 5KO3A 3GQ3A 3U6LA 3FTFA 4AG6A 2XZFA 3NWLA 3PFIA 2J7NA 4NRWA 2G8LA 4DR7M 5BR8M 3GRRA 1H6UA 4IBCA 5FSWA 1HT2E 3FYCA 1QYRA 4DV7M 1TGUA 5KQDA 4DV3M 2CUZA 3KOZE 3FKEA 4DUYM 2KRUA 4QHSA 1IN7A 2RGHA 3SYLA 1TH2A 3JR5A 5DYGA 4D82A 4M0WA 1HR0M 1E94E 2BJVA 3D8BA 4NOOB 3L26A 4NXMM 1XC8A 3TL4X 2FOIC 3FD9A 3KOXE 5KPRA 2FFJA 4DR1M 4CGYB 1XXHB 2JA2A 4KODA 2UXDM 4JI2M 1QAQA 3KSJA 4G4RA 2R65A 4DUZM 1EE8A 4CHTB 4L16A 2R45A 1OFIA 3T15A 3L25A 3T38A 3ZCBB 2EO2A 1XNRM 3HU3A 4LZJA 3LQRA 4M0DA 3B9PA 1UM8A 1DGBA 1IN6A 5LMUM 1G3IA 3AL0C 5BPVA 4GH9A 2BNKA 4FCVA 1E32A 2DZOB 4GHAA 4GITA 4B3RM 4DV1M 3TWLA 5DYIA 5IREB 3K92A 3UK6A 4REZA 4GC9A 4GKKM 5H37D 2ZBKB 5E6JA 1S3SA 2R62A 2V1CA 4GMQA 1QAOA 3FUWA 4IBKA 4QNRA 3TQSA 5ITUA 4YHHM 3E9SA 1XMOM 4IBDA 3PNVA 4OVZA 1L2DA 4LF6M 1NHGC 4LJ7A 1D2NA 2RGOA 5ITYA 1IBKM 4WURA 5FTKA 3QWLA 2E5LM 5EXXA 2QP9X 3GPXA 3RGSA 4LF4M 3HJQA 4LGYA 3U6OA 1L2CA 1IN5A 3GRVA 4LFCM 4M9SA 4XBOA 1IN8A 2ZAMA 2NQ8C 4LZZA 4LFBM 1XWIA 3TWMA 3JAMS 4PCZA 1QQWA 4OU7A 2YQZA 3U60B 2D7EA 3A98B 4AW4A 2KZSA 3HWSA 3ILKA 3ZH9B 1E9SA 4AKHA 1L1TA 5KQ8A 3U6PA 1HNWM 4HL4A 2CHGA 1XHBA 1IXRC 4FWGA 4JI3M 4LJ6A 2LNHC 4TUWA 3T1HM 2F5QA 1NNUC 3AJIB 2K47A 1NJGA 5EP3A 3GLFB 1Z5BA 3HHXA 4QNMA 4AG5A 1WXQA 2YFQA 2YR0A 1ZAEA 1HQYE 2KW0A 1DGHB 1GL6A 1PJIA 4X64M 3OTOM 1HNZM 4DR6M 1I4WA 2Z4SA 4AZFA 2LH0A 3SC3A 2XLJA 2L6OA 4LY6A 4B7GA 1HNXM 4FCTA 3GQ4A 2Q2EB 3E4RA 2XGNA 2C98A 3RFWA 2Z7JA 2QPAA 1IM2A 1HQCA 3SMSA 4FW9A 4DR5M 2D7HA 3U6EA 4JXJA 2C9OA 3RGPA 4LCBA 3UGJA 3AFHA 3LMMA 3GQ5A 2CFOA 3GPPA 4BB9A 4W5WA 3GRUA 4JI5M 2LXEA 5EP2A 5IWAM 3U61B 4IBFA 2R4JA 1KFVA 1Z5CA 2P5TA 2M60A 3BOSA 4B3MM 3SATA 1X37A 3GLHA 3HJ8A 3LVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYI A;  5FTN A;  3CF0 A;  3UK6 A;  1NVM A;  5EP4 A;  5EP1 A;  3GLI B;  5FTJ A;  3EIH A;  3WHK A;  2V6Z M;  1IN4 A;  1S3S A;  2R62 A;  4LJ5 A;  4QNR A;  2RKO A;  3KDS E;  2V1U A;  4JN6 A;  2C96 A;  1HT1 E;  1KSF X;  4A3V B;  1NY6 A;  4LRT A;  3EIE A;  3CF2 A;  1XXH A;  2C99 A;  1IY2 A;  4LJ7 A;  3HU1 A;  1D2N A;  4D80 A;  1IXS B;  1IQP A;  1JR3 D;  3GLG B;  5FTK A;  4LJ4 A;  3PXG A;  1KYI A;  5JI2 E;  5EXX A;  2QP9 X;  4WW0 A;  2QBY B;  1QVR A;  2DHR A;  1IN5 A;  2QZ4 A;  1IY1 A;  1IN8 A;  3H4M A;  2ZAM A;  1LV7 A;  1SXJ A;  4LZZ A;  2DZN B;  1XWI A;  4Z8X A;  4LJ9 A;  5C18 A;  1DO2 A;  1G41 A;  4ZPX A;  5FTM A;  2KRK A;  3MHV C;  2CHV A;  4QOS A;  5EXS A;  1W5T A;  1R6B X;  4LGM A;  5EQT A;  3U60 B;  2XSZ D;  4FWH A;  4LJ8 A;  5JI3 E;  3HWS A;  4FWD A;  1G4A E;  3ZH9 B;  1L8Q A;  3KW6 A;  3HU2 A;  2CE7 A;  1SXJ C;  2CHG A;  3GLI A;  3GLH A;  1IXR C;  4FWG A;  4EIW A;  4LJ6 A;  3PFI A;  1DO0 A;  3AJI B;  1C1K A;  1NJF A;  2QEN A;  1NJG A;  5EP3 A;  2VII A;  3GLF B;  3R8F A;  3K1J A;  4QNM A;  1HT2 E;  3GLH B;  5EXT A;  3GLG A;  1HQY E;  3M0E A;  2Z4S A;  4KLN A;  1JR3 A;  4L15 A;  1FNN A;  4QHS A;  1IN7 A;  3SYL A;  5DYG A;  2ZAO A;  2QBY A;  4D82 A;  3M6A A;  4I4L A;  1E94 E;  2BJV A;  3D8B A;  1NY5 A;  3SYK A;  3U5Z B;  4LRS A;  3SC3 A;  4L4U A;  4LY6 A;  2X8A A;  4FCT A;  2C9C A;  1OJL A;  1IY0 A;  1XXH B;  2C98 A;  2HCB A;  4KOD A;  2QPA A;  5C1B A;  2R65 A;  1IM2 A;  5FTL A;  1HQC A;  1QZM A;  2CEA A;  4L16 A;  4D81 A;  1NSF A;  2DWZ B;  4FW9 A;  1OFI A;  1W5S A;  4FD2 A;  3VLF B;  2XSZ A;  2C9O A;  3HU3 A;  4LCB A;  1SXJ D;  2FNA A;  3DZD A;  2DVW B;  3B9P A;  1UM8 A;  1SXJ B;  1IN6 A;  1IXZ A;  4KO8 A;  3WHL A;  1G3I A;  5EXP A;  1JQJ C;  4FCV A;  2ZAN A;  1J7K A;  3PVS A;  1E32 A;  2Z4R A;  4QHT A;  2DZO B;  5EP2 A;  3VFD A;  4I81 A;  3U61 B;  4FCW A;  3GLF A;  4LJA A;  1OFH A;  3BOS A;  4GIT A;  1R7R A;  1SXJ E;  2CHQ A;  1X37 A;  2BJW A; 
#chains in the Genus database with same CATH topology
 4MGI E;  3TWK A;  5FTN A;  2CV0 A;  3L27 A;  4LF7 M;  3CF0 A;  1D0L A;  1Q39 A;  5A2Q S;  3CTW B;  3GLI B;  4I8O A;  3AV0 A;  1IN4 A;  2W82 A;  4MGZ E;  3FYD A;  3HX3 A;  3I51 A;  2DHY A;  4R7G A;  2L7H A;  3U5Z A;  2F5O A;  3C3D A;  4JN6 A;  2C96 A;  1HT1 E;  2V1U A;  3U6M A;  3KXE C;  4DV6 M;  3EIE A;  4LG2 A;  3BBZ A;  4NRV A;  3K2L A;  1MX0 A;  3HU1 A;  4D80 A;  1IXS B;  3FUV A;  3HHZ A;  1LTM A;  3M7G A;  4KT0 F;  3U6D A;  1DGF A;  4MGH A;  2LWX A;  8CAT A;  1Q3B A;  2R4E A;  4WW0 A;  3FUU A;  3GRY A;  3VK8 A;  1QVR A;  3K9O A;  4RF1 A;  1IBM M;  1F4I A;  1IY1 A;  2HWJ A;  2KNV A;  2JWS A;  3H4M A;  1SXJ A;  4GRI A;  3MJ5 A;  2DZN B;  1Q02 A;  4DBG B;  2LVA A;  2XEP A;  4DR2 M;  3B89 A;  3CGW A;  3HHW A;  4GEW A;  3SHG B;  2JP7 A;  2KRK A;  1MN3 A;  1YUB A;  4B7F A;  2CHV A;  4QOS A;  2F5S A;  1W5T A;  3GPU A;  5EQT A;  4DV4 M;  3U6S A;  1TH3 A;  2F5P A;  1T6O A;  4ITQ A;  2Y0Q A;  5E26 A;  5JI3 E;  2AHM A;  2Z3X A;  1G4A E;  2CV1 A;  1L8Q A;  1ORY B;  1WGL A;  3KW6 A;  1VDD A;  3J7A S;  4FVM A;  3J7B A;  2DWN A;  1SXJ C;  4G6Z A;  4G4Q A;  4JI7 M;  5F3W A;  1TDZ A;  1OAI A;  2WSC F;  4PD2 A;  1K82 A;  4EIW A;  3A46 A;  3LVW A;  4P16 A;  4I5S A;  1T43 A;  4IBE A;  3AOG A;  5ITR A;  4X65 M;  1N77 A;  5KPZ A;  1NJF A;  3U6C A;  4QOZ C;  1XNQ M;  4DV2 M;  4M9X A;  2DAE A;  2J5Y A;  3SHF A;  5EJC A;  5ITX A;  4DV5 M;  4CIS A;  3TE6 A;  2MGW A;  2HKJ A;  2A5Y B;  4G4N A;  3GLG A;  1PJJ A;  1MU5 A;  3FUX A;  2EUC A;  1JR3 A;  1GLN A;  4AKG A;  1FNN A;  1Z5A A;  2UU9 M;  2LHG A;  1JB0 F;  3FTD A;  3DA1 A;  2QBY A;  2DEN A;  2I7P A;  3C58 A;  2MH8 A;  1GO5 A;  4AKI A;  3GLH E;  3F92 A;  1NY5 A;  3HHY A;  4LRS A;  1L1Z A;  4CIZ A;  1PM5 A;  4LF5 M;  3KS8 A;  3SAS A;  2VF7 A;  4OVZ B;  1OJL A;  2C9C A;  3I04 M;  5C1B A;  7CAT A;  1G59 A;  3VKH A;  4NL4 H;  1J5E M;  4D81 A;  1QZM A;  2CEA A;  2XFS A;  4B08 A;  2CV2 A;  2DWZ B;  1OKS A;  1QAN A;  2R46 A;  3GPY A;  4FD2 A;  3ZC7 B;  1PJT A;  3VLF B;  2OO9 A;  2XSZ A;  4B3S M;  1ZQ9 A;  3W67 A;  2DZL A;  4L8R C;  3DOA A;  2HHH M;  3QAU A;  1SXJ D;  4NSR A;  4RKU F;  5GKN A;  3DZD A;  2DAM A;  1XMQ M;  2DVW B;  4MH0 E;  4X66 M;  4KO8 A;  1IXZ A;  3WHL A;  4MGK E;  2OPF A;  5EXP A;  1GJS A;  2EKF A;  5KPT A;  1QDT A;  3HGI A;  4QHT A;  2Z4R A;  4L78 A;  4OX9 M;  4FCW A;  2H1R A;  2G5G X;  4LJA A;  3UMM A;  1R7R A;  1SXJ E;  1GVN A;  1PRB A;  2UUB M;  5IT9 S;  3U6Q A;  3SAR A;  1T3T A;  2JY8 A;  2D7G A;  1N32 M;  3HJS A;  4LFA M;  4AQY M;  1NVM A;  2KHH A;  2LVQ D;  4UN2 B;  5EP4 A;  3EIH A;  4LJ5 A;  4MB7 A;  2R0I A;  3IHP A;  4RF0 A;  3KDS E;  2KZU A;  3A45 A;  5DNY A;  2WZJ A;  1R2Y A;  3LQQ A;  1NY6 A;  1YLA A;  4LRT A;  5ITT A;  2UUC M;  3CF2 A;  1XXH A;  1QUS A;  2C99 A;  1IY2 A;  4S12 A;  1FJG M;  2VQF M;  4NXN M;  1A5T A;  3SFZ A;  1JR3 D;  2EJS A;  2Y0T A;  1YE9 A;  1WIV A;  3FTC A;  3PXG A;  1I94 M;  1KYI A;  1OQY A;  3I4Y A;  5JI2 E;  3ZQJ A;  3Q8X A;  4BLC A;  2JY5 A;  2DKL A;  3A42 A;  3E46 A;  5ITX E;  4JV5 M;  2DHR A;  2DAI A;  2HAK A;  3E21 A;  4MGY E;  4IBG A;  2QZ4 A;  3K9P A;  4DV0 M;  2ZM6 M;  3L29 A;  4M9Z A;  3GLG E;  4JI0 M;  2GQF A;  1LV7 A;  4K0K M;  2KA6 B;  3D8L A;  4LJ9 A;  4R3D A;  1DO2 A;  1G41 A;  4CJ6 A;  5C18 A;  2Y21 A;  3FUT A;  1CUK A;  3I4V A;  3MHV C;  3LCU A;  2I7N A;  2DAG A;  1R6B X;  4LGM A;  5IZ7 D;  1MJG M;  2JXN A;  2XSZ D;  3LCV B;  4FWH A;  2R6F A;  2F5N A;  2UXB M;  2DWM A;  1QAM A;  3DFZ A;  3UZU A;  1N36 M;  3HU2 A;  2VQE M;  4JI1 M;  2CP8 A;  2FH0 A;  2H5X A;  1TR8 A;  1WR1 B;  2DWL A;  2OQ4 A;  2KEB A;  1TDH A;  4Z6Y A;  3J2P B;  1HJP A;  1DO0 A;  2LBC A;  1C1K A;  2QEN A;  3W68 A;  1EFU B;  1OTR A;  2VII A;  4PDG A;  3MK6 A;  3SAV A;  3R8F A;  3K1J A;  4B3T M;  1UFZ A;  2L7I A;  3B7N A;  2FE8 A;  3GLH B;  1TTE A;  5EXT A;  2FS1 A;  4YY3 M;  5ITU A;  1N34 M;  3SAU A;  1QUT A;  1Z59 A;  3SAW A;  3V76 A;  3M0E A;  1L2B A;  3PNY A;  1YSY A;  4KLN A;  4L15 A;  4Y28 F;  3RE8 A;  1NHW C;  1TH4 A;  3FTE A;  2ERC A;  4IBB A;  3KFU G;  2ZAO A;  4NSO B;  3M6A A;  3K8Z A;  4I4L A;  4BBA A;  1K3X A;  3U5Z B;  3SYK A;  4G3O A;  4IIW A;  2APL A;  1Q3C A;  4DR4 M;  1OAO C;  4L4U A;  4LF9 M;  2X8A A;  3NBI A;  2XFT A;  4IJE A;  1OIZ A;  2KNA A;  1IY0 A;  4GIP A;  2HCB A;  2KDL A;  2Y20 A;  1VDL A;  4DR3 M;  3C3E A;  5FTL A;  3U60 A;  2WSE F;  2EA0 A;  3UJN A;  3IG5 A;  4JI4 M;  1NSF A;  1J09 A;  2JY6 B;  2LVP C;  3VDU A;  2QCU A;  1OIP A;  1W5S A;  4XGI A;  1IBL M;  1XXH E;  4AI6 A;  3HKP A;  1GKI A;  4GHL A;  3FRH A;  2FNA A;  4OW0 A;  3SBJ A;  2X4A A;  1SXJ B;  2X49 A;  3KP1 E;  4RNA A;  2MRO B;  1NO1 A;  3R9X B;  3JR4 A;  1JQJ C;  3KP0 E;  3L28 A;  1EIJ A;  1G71 A;  1J7K A;  2QNJ A;  2ZAN A;  3PVS A;  3KVW A;  4II7 A;  3TPZ A;  3VFD A;  4I81 A;  3KOY E;  3J81 S;  2J7O A;  2R44 A;  3QYB A;  3GLF A;  1OFH A;  3AOE A;  5LMN M;  4JI8 M;  4PT5 A;  3KSX A;  2K6B A;  2CHQ A;  2G3Q A;  3J80 S;  1N75 A;  2XH9 A;  2F4V M;  1AIP C;  1DGH A;  2UXC M;  2YNM D;  2LVO C;  4G4O A;  1GL7 A;  5EP1 A;  1E9R A;  4HLQ A;  4IJF A;  5FTJ A;  4IBJ A;  2BWB A;  2QQ8 A;  3WHK A;  3GP1 A;  2V6Z M;  2DXI A;  2XF3 A;  4LF8 M;  3FRI A;  4GKJ M;  1WGN A;  2O01 F;  2RKO A;  3AOE C;  3SMP A;  1NNJ A;  3VKG A;  1DV0 A;  1ZMU A;  1D0K A;  2L2D A;  1Z6T A;  2R18 A;  1KSF X;  2JZ1 A;  2M5Z A;  4A3V B;  1N78 A;  5FLX S;  1G8P A;  2C5R A;  1XB2 B;  1IQP A;  2XZU A;  3GLG B;  4LJ4 A;  2K0B X;  3C9P A;  3AKZ A;  3CF6 E;  4JYA M;  3IEC A;  3VDP A;  4B7H A;  3W0F A;  4GC5 A;  2QBY B;  3THG A;  5L8R F;  1VEG A;  4F1I A;  1R2Z A;  2UUA M;  4JI6 M;  2O5R A;  4Z8X A;  4ZPX A;  1WJ7 A;  5ITQ A;  5FTM A;  4IBI A;  1NV9 A;  5EXS A;  3U61 A;  3L2A A;  3VK7 A;  2HL7 A;  3T1Y M;  4KHP M;  4LJ8 A;  4X62 M;  4FWD A;  1R4G A;  3J27 B;  1N33 M;  4PDI A;  1K3W A;  3KS4 A;  3IG8 A;  3W0L B;  2CE7 A;  2L09 A;  3GLI A;  3GLH A;  3B7Q A;  1DGG A;  3KOW E;  2KXE A;  4MM3 B;  5KO3 A;  3GQ3 A;  3U6L A;  3FTF A;  4AG6 A;  1ZMW A;  2QHO B;  2XZF A;  3B74 A;  3NWL A;  3PFI A;  2J7N A;  3Q8G A;  4NRW A;  2G8L A;  4DR7 M;  4XK8 F;  5BR8 M;  1VG5 A;  3GRR A;  1H6U A;  2DAK A;  4IBC A;  5FSW A;  2LHC A;  1JR3 E;  1HT2 E;  3FYC A;  1QYR A;  1IXS A;  4DV7 M;  1ZV1 A;  3QYE A;  1IFY A;  1TGU A;  5KQD A;  4DV3 M;  2CUZ A;  1SG9 A;  1PGY A;  3FKE A;  3KOZ E;  4DUY M;  2KRU A;  4QHS A;  1IN7 A;  2RGH A;  3SYL A;  1TH2 A;  3JR5 A;  5DYG A;  4D82 A;  4M0W A;  1HR0 M;  1E94 E;  2BJV A;  3D8B A;  4NOO B;  3L26 A;  1QZE A;  4NXM M;  3TQS A;  4NC6 A;  1XC8 A;  3TL4 X;  2FOI C;  3FD9 A;  3KOX E;  5KPR A;  2FFJ A;  4DR1 M;  3NBX X;  1V92 A;  2DI0 A;  4CGY B;  1XXH B;  2JA2 A;  4KOD A;  1QDR A;  4JI2 M;  2UXD M;  1QAQ A;  3KSJ A;  4G4R A;  2R65 A;  4DUZ M;  1EE8 A;  4CHT B;  4L16 A;  2R45 A;  4P17 A;  1OFI A;  3T15 A;  3L25 A;  3T38 A;  3ZCB B;  1VEJ A;  2EKK A;  2EO2 A;  1XNR M;  3HU3 A;  3BXW A;  4LZJ A;  3LQR A;  4M0D A;  2OOB A;  3B9P A;  1UM8 A;  1DGB A;  1IN6 A;  5LMU M;  1G3I A;  3AL0 C;  5BPV A;  4GH9 A;  2BNK A;  4FCV A;  1E32 A;  2BWE A;  1AUA A;  2DZO B;  1PJQ A;  2JY7 A;  2L4E A;  4GHA A;  3T6P A;  2LTU A;  4GIT A;  4B3R M;  4DV1 M;  3TWL A;  5DYI A;  5IRE B;  4ANR A;  1RU3 A;  2L4F A;  3K92 A;  3UK6 A;  2JZ0 A;  2ZTD A;  4REZ A;  4GC9 A;  2JUJ A;  4GKK M;  5H37 D;  2ZBK B;  3I01 M;  5E6J A;  1S3S A;  2R62 A;  2V1C A;  4GMQ A;  1QAO A;  3B7Z A;  3FUW A;  3HY5 A;  4IBK A;  4QNR A;  3FE3 A;  4YHH M;  2DNA A;  3E9S A;  1XMO M;  3GO8 A;  4IBD A;  1C7Y A;  3PNV A;  4OVZ A;  1L2D A;  4LF6 M;  1NHG C;  3GLI E;  2Z8Y M;  4LJ7 A;  2VDB B;  1V33 A;  1D2N A;  4F2L A;  2RGO A;  5ITY A;  1IBK M;  4WUR A;  3MMP A;  5FTK A;  1WHC A;  3QWL A;  2E5L M;  5EXX A;  2QP9 X;  3GPX A;  1GAB A;  2O25 A;  1V34 A;  3RGS A;  4LF4 M;  3HJQ A;  4LGY A;  3U6O A;  1L2C A;  1IN5 A;  3GRV A;  2CRU A;  2VF8 A;  4M9S A;  4XBO A;  1IN8 A;  4LFC M;  2ZAM A;  2NQ8 C;  4LZZ A;  4Q7J A;  4LFB M;  1XWI A;  3TWM A;  3H4J A;  3JAM S;  4PCZ A;  1QQW A;  3HZJ A;  4WP2 A;  4OU7 A;  2YQZ A;  3U60 B;  2D7E A;  2WSF F;  3A98 B;  1BVS A;  4AW4 A;  2KZS A;  3HWS A;  3ILK A;  3ZH9 B;  1E9S A;  4AKH A;  1L1T A;  5KQ8 A;  3U6P A;  1HNW M;  4HL4 A;  2CHG A;  1XHB A;  1GJT A;  1NV8 A;  1IXR C;  4FWG A;  4JI3 M;  4LJ6 A;  4HEO A;  2LNH C;  4TUW A;  3T1H M;  2F5Q A;  1NNU C;  2N35 A;  3AJI B;  2K47 A;  1NJG A;  5EP3 A;  3GLF B;  1Z5B A;  3HHX A;  4QNM A;  4AG5 A;  1VEK A;  1R5L A;  1TF0 B;  1WXQ A;  2YFQ A;  2YR0 A;  1ZAE A;  1HQY E;  2KW0 A;  1DGH B;  1GL6 A;  2CWB A;  4X64 M;  3OTO M;  2K9D A;  1PJI A;  2KNZ A;  1I4W A;  2Z4S A;  1HNZ M;  4DR6 M;  2JNH A;  3LW5 F;  4AZF A;  2ZTC A;  1ZMV A;  2LH0 A;  2RRU A;  3SC3 A;  2XLJ A;  1PJS A;  2L6O A;  4LY6 A;  4B7G A;  1HNX M;  4FCT A;  3GQ4 A;  2Q2E B;  3E4R A;  2XGN A;  2C98 A;  3RFW A;  2Z7J A;  2QPA A;  1IM2 A;  1HQC A;  1Y8G A;  2QSF X;  3SMS A;  4FW9 A;  4L6V 6;  4DR5 M;  2D7H A;  3U6E A;  4JXJ A;  2B3T A;  2C9O A;  3RGP A;  4LCB A;  3UGJ A;  3AFH A;  3LMM A;  3GQ5 A;  2CFO A;  3GPP A;  4BB9 A;  4W5W A;  1D0M A;  3GRU A;  3GLF E;  4R71 A;  4JI5 M;  2GNO A;  2LXE A;  1VQ1 A;  2MR9 A;  5EP2 A;  5IWA M;  2MJ5 B;  2LVN C;  3U61 B;  4IBF A;  2R4J A;  1KFV A;  1P3Q Q;  1Z5C A;  2P5T A;  2M60 A;  3BOS A;  4B3M M;  2OOA A;  3SAT A;  5DFL A;  1X37 A;  2BJW A;  3HJ8 A;  3LVV A; 
#chains in the Genus database with same CATH homology
 4MGI E;  3TWK A;  5FTN A;  2CV0 A;  3L27 A;  4LF7 M;  3CF0 A;  1Q39 A;  5A2Q S;  3CTW B;  3GLI B;  4I8O A;  3AV0 A;  1IN4 A;  2W82 A;  4MGZ E;  3FYD A;  3I51 A;  2F5O A;  4R7G A;  2L7H A;  3U5Z A;  2V1U A;  4JN6 A;  2C96 A;  1HT1 E;  3U6M A;  3KXE C;  4DV6 M;  3EIE A;  4LG2 A;  4NRV A;  3K2L A;  1MX0 A;  3HU1 A;  4D80 A;  1IXS B;  3FUV A;  3HHZ A;  3M7G A;  3U6D A;  1DGF A;  4MGH A;  2LWX A;  8CAT A;  1Q3B A;  2R4E A;  4WW0 A;  3FUU A;  3GRY A;  3VK8 A;  1QVR A;  4RF1 A;  1IY1 A;  3H4M A;  1SXJ A;  4GRI A;  3MJ5 A;  2DZN B;  2XEP A;  4DR2 M;  3HHW A;  3SHG B;  2KRK A;  1YUB A;  4B7F A;  2CHV A;  4QOS A;  2F5S A;  1W5T A;  3GPU A;  5EQT A;  4DV4 M;  3U6S A;  1TH3 A;  2F5P A;  4ITQ A;  3VKG A;  2Y0Q A;  5E26 A;  5JI3 E;  2AHM A;  2Z3X A;  1G4A E;  2CV1 A;  1L8Q A;  1ORY B;  3KW6 A;  3J7A S;  1VDD A;  4FVM A;  3J7B A;  2DWN A;  1SXJ C;  4G6Z A;  4G4Q A;  4JI7 M;  5F3W A;  1TDZ A;  4PD2 A;  1K82 A;  4EIW A;  3A46 A;  3LVW A;  4P16 A;  4I5S A;  4IBE A;  3AOG A;  5ITR A;  4X65 M;  1N77 A;  5KPZ A;  1NJF A;  3U6C A;  4QOZ C;  1XNQ M;  4DV2 M;  4M9X A;  3SHF A;  5EJC A;  5ITX A;  4DV5 M;  4CIS A;  3TE6 A;  2BJW A;  2HKJ A;  2A5Y B;  4G4N A;  3GLG A;  1PJJ A;  1MU5 A;  3FUX A;  2EUC A;  1JR3 A;  1GLN A;  4AKG A;  1FNN A;  1Z5A A;  2UU9 M;  3FTD A;  3DA1 A;  2QBY A;  2I7P A;  3C58 A;  4AKI A;  1NY5 A;  3HHY A;  4LRS A;  1L1Z A;  1PM5 A;  4LF5 M;  3KS8 A;  3SAS A;  4OVZ B;  1OJL A;  2C9C A;  5C1B A;  7CAT A;  1G59 A;  3VKH A;  4NL4 H;  1J5E M;  4D81 A;  1QZM A;  2CEA A;  2XFS A;  4B08 A;  2CV2 A;  2DWZ B;  1QAN A;  2R46 A;  3GPY A;  4FD2 A;  3ZC7 B;  3VLF B;  4B3S M;  2XSZ A;  1ZQ9 A;  4L8R C;  3DOA A;  2HHH M;  3QAU A;  1SXJ D;  4NSR A;  5GKN A;  3DZD A;  1XMQ M;  2DVW B;  4MH0 E;  4X66 M;  4KO8 A;  1IXZ A;  3WHL A;  4MGK E;  2OPF A;  5EXP A;  5KPT A;  3HGI A;  4QHT A;  2Z4R A;  4L78 A;  4OX9 M;  4FCW A;  2H1R A;  2G5G X;  4LJA A;  3UMM A;  1R7R A;  1SXJ E;  1GVN A;  2UUB M;  5IT9 S;  3U6Q A;  3SAR A;  1T3T A;  2D7G A;  1N32 M;  3HJS A;  4LFA M;  4AQY M;  1NVM A;  5EP4 A;  3EIH A;  4LJ5 A;  4MB7 A;  4RF0 A;  3KDS E;  2KZU A;  3A45 A;  5DNY A;  1R2Y A;  3LQQ A;  1NY6 A;  4LRT A;  5ITT A;  2UUC M;  3CF2 A;  1XXH A;  4S12 A;  2C99 A;  1IY2 A;  1FJG M;  2VQF M;  4NXN M;  3SFZ A;  1JR3 D;  2Y0T A;  1YE9 A;  3FTC A;  3PXG A;  1I94 M;  1KYI A;  3I4Y A;  5JI2 E;  3Q8X A;  4BLC A;  3A42 A;  5ITX E;  4JV5 M;  2DHR A;  4MGY E;  4DV0 M;  4IBG A;  2QZ4 A;  2ZM6 M;  3L29 A;  4M9Z A;  4JI0 M;  1LV7 A;  4K0K M;  2KA6 B;  3D8L A;  4LJ9 A;  4R3D A;  1DO2 A;  1G41 A;  5C18 A;  2Y21 A;  3FUT A;  3I4V A;  3MHV C;  2I7N A;  1R6B X;  4LGM A;  5IZ7 D;  2XSZ D;  4FWH A;  2F5N A;  2UXB M;  2DWM A;  1QAM A;  3DFZ A;  3UZU A;  1N36 M;  3HU2 A;  2VQE M;  4JI1 M;  2DWL A;  2OQ4 A;  2KEB A;  1TDH A;  4Z6Y A;  3J2P B;  1DO0 A;  1C1K A;  2QEN A;  2VII A;  4PDG A;  3MK6 A;  3SAV A;  3R8F A;  3K1J A;  4B3T M;  2L7I A;  2FE8 A;  3GLH B;  5EXT A;  4YY3 M;  1N34 M;  3SAU A;  1Z59 A;  3SAW A;  3M0E A;  1L2B A;  3PNY A;  1YSY A;  4KLN A;  4L15 A;  3RE8 A;  1NHW C;  1TH4 A;  3FTE A;  2ERC A;  4IBB A;  3KFU G;  2ZAO A;  4NSO B;  3M6A A;  3K8Z A;  4I4L A;  4BBA A;  1K3X A;  3U5Z B;  3SYK A;  4IIW A;  4DR4 M;  1Q3C A;  4L4U A;  4LF9 M;  2X8A A;  3NBI A;  2XFT A;  4IJE A;  1IY0 A;  4GIP A;  2HCB A;  2Y20 A;  4DR3 M;  5FTL A;  3U60 A;  2EA0 A;  3UJN A;  3IG5 A;  4JI4 M;  1NSF A;  1J09 A;  3VDU A;  2QCU A;  1W5S A;  4XGI A;  1IBL M;  4AI6 A;  3HKP A;  1GKI A;  4GHL A;  2FNA A;  4OW0 A;  3SBJ A;  2X4A A;  1SXJ B;  2X49 A;  3KP1 E;  4RNA A;  3R9X B;  3JR4 A;  1JQJ C;  3KP0 E;  3L28 A;  2ZAN A;  1J7K A;  3PVS A;  4II7 A;  3VFD A;  3KVW A;  3TPZ A;  3GO8 A;  1IBM M;  4I81 A;  3KOY E;  3J81 S;  2J7O A;  3GLF A;  5LMN M;  1OFH A;  3AOE A;  4JI8 M;  4PT5 A;  3KSX A;  2CHQ A;  3J80 S;  1N75 A;  2XH9 A;  2F4V M;  1DGH A;  2UXC M;  2YNM D;  4G4O A;  1GL7 A;  5EP1 A;  1E9R A;  4HLQ A;  4IJF A;  5FTJ A;  4IBJ A;  3WHK A;  3GP1 A;  2V6Z M;  2DXI A;  2XF3 A;  4LF8 M;  4GKJ M;  2RKO A;  3AOE C;  3SMP A;  1NNJ A;  1Z6T A;  2R18 A;  1KSF X;  2M5Z A;  4A3V B;  1N78 A;  5FLX S;  1G8P A;  2C5R A;  1IQP A;  2XZU A;  3GLG B;  4LJ4 A;  3AKZ A;  3CF6 E;  4JYA M;  3VDP A;  4B7H A;  3W0F A;  4GC5 A;  2QBY B;  3THG A;  4JI6 M;  1R2Z A;  2UUA M;  2O5R A;  4Z8X A;  4ZPX A;  5ITQ A;  5FTM A;  4IBI A;  5EXS A;  3U61 A;  3L2A A;  3VK7 A;  2HL7 A;  3T1Y M;  4KHP M;  4LJ8 A;  4X62 M;  4FWD A;  3J27 B;  1N33 M;  4PDI A;  1K3W A;  3KS4 A;  3IG8 A;  3W0L B;  2CE7 A;  2L09 A;  3GLI A;  1DGG A;  3KOW E;  2KXE A;  4MM3 B;  5KO3 A;  3GQ3 A;  3U6L A;  3FTF A;  4AG6 A;  2XZF A;  3NWL A;  3PFI A;  2J7N A;  4NRW A;  2G8L A;  4DR7 M;  5BR8 M;  3GRR A;  1H6U A;  4IBC A;  5FSW A;  1HT2 E;  3FYC A;  1QYR A;  4DV7 M;  1TGU A;  5KQD A;  4DV3 M;  2CUZ A;  3KOZ E;  3FKE A;  4DUY M;  2KRU A;  4QHS A;  1IN7 A;  2RGH A;  3SYL A;  1TH2 A;  3JR5 A;  5DYG A;  4D82 A;  4M0W A;  1HR0 M;  1E94 E;  2BJV A;  3D8B A;  4NOO B;  3L26 A;  4NXM M;  1XC8 A;  3TL4 X;  2FOI C;  3FD9 A;  3KOX E;  5KPR A;  2FFJ A;  4DR1 M;  4CGY B;  1XXH B;  2JA2 A;  4KOD A;  2UXD M;  4JI2 M;  1QAQ A;  3KSJ A;  4G4R A;  2R65 A;  4DUZ M;  1EE8 A;  4CHT B;  4L16 A;  2R45 A;  1OFI A;  3T15 A;  3L25 A;  3T38 A;  3ZCB B;  2EO2 A;  1XNR M;  3HU3 A;  4LZJ A;  3LQR A;  4M0D A;  3B9P A;  1UM8 A;  1DGB A;  1IN6 A;  5LMU M;  1G3I A;  3AL0 C;  5BPV A;  4GH9 A;  2BNK A;  4FCV A;  1E32 A;  2DZO B;  4GHA A;  4GIT A;  4B3R M;  4DV1 M;  3TWL A;  5DYI A;  5IRE B;  3K92 A;  3UK6 A;  4REZ A;  4GC9 A;  4GKK M;  5H37 D;  2ZBK B;  5E6J A;  1S3S A;  2R62 A;  2V1C A;  4GMQ A;  1QAO A;  3FUW A;  4IBK A;  4QNR A;  3TQS A;  5ITU A;  4YHH M;  3E9S A;  1XMO M;  4IBD A;  3PNV A;  4OVZ A;  1L2D A;  4LF6 M;  1NHG C;  4LJ7 A;  1D2N A;  2RGO A;  5ITY A;  1IBK M;  4WUR A;  5FTK A;  3QWL A;  2E5L M;  5EXX A;  2QP9 X;  3GPX A;  3RGS A;  4LF4 M;  3HJQ A;  4LGY A;  3U6O A;  1L2C A;  1IN5 A;  3GRV A;  4LFC M;  4M9S A;  4XBO A;  1IN8 A;  2ZAM A;  2NQ8 C;  4LZZ A;  4LFB M;  1XWI A;  3TWM A;  3JAM S;  4PCZ A;  1QQW A;  4OU7 A;  2YQZ A;  3U60 B;  2D7E A;  3A98 B;  4AW4 A;  2KZS A;  3HWS A;  3ILK A;  3ZH9 B;  1E9S A;  4AKH A;  1L1T A;  5KQ8 A;  3U6P A;  1HNW M;  4HL4 A;  2CHG A;  1XHB A;  1IXR C;  4FWG A;  4JI3 M;  4LJ6 A;  2LNH C;  4TUW A;  3T1H M;  2F5Q A;  1NNU C;  3AJI B;  2K47 A;  1NJG A;  5EP3 A;  3GLF B;  1Z5B A;  3HHX A;  4QNM A;  4AG5 A;  1WXQ A;  2YFQ A;  2YR0 A;  1ZAE A;  1HQY E;  2KW0 A;  1DGH B;  1GL6 A;  1PJI A;  4X64 M;  3OTO M;  1HNZ M;  4DR6 M;  1I4W A;  2Z4S A;  4AZF A;  2LH0 A;  3SC3 A;  2XLJ A;  2L6O A;  4LY6 A;  4B7G A;  1HNX M;  4FCT A;  3GQ4 A;  2Q2E B;  3E4R A;  2XGN A;  2C98 A;  3RFW A;  2Z7J A;  2QPA A;  1IM2 A;  1HQC A;  3SMS A;  4FW9 A;  4DR5 M;  2D7H A;  3U6E A;  4JXJ A;  2C9O A;  3RGP A;  4LCB A;  3UGJ A;  3AFH A;  3LMM A;  3GQ5 A;  2CFO A;  3GPP A;  4BB9 A;  4W5W A;  3GRU A;  4JI5 M;  2LXE A;  5EP2 A;  5IWA M;  3U61 B;  4IBF A;  2R4J A;  1KFV A;  1Z5C A;  2P5T A;  2M60 A;  3BOS A;  4B3M M;  3SAT A;  1X37 A;  3GLH A;  3HJ8 A;  3LVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...