3MHVC

Crystal structure of vps4 and vta1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
102
Chain Sequence
GSPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTPCSPGDDGAIEMSPDLTIKDFLKAIKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural role of the Vps4-Vta1 interface in ESCRT-III recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein 4
total genus 29
structure length 102
sequence length 117
ec nomenclature
pdb deposition date 2010-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3mhvC00
5EP2A 4FWGA 2HCBA 1IXZA 1G41A 2BJVA 2DHRA 1QZMA 4I81A 4LJ4A 1HQCA 2DWZB 4GITA 3B9PA 4FWDA 1SXJB 2DVWB 1C1KA 4FWHA 1G4AE 4FW9A 4LY6A 3CF0A 1E94E 3GLIB 1IY0A 4LGMA 4QNRA 2Z4RA 3BOSA 1R7RA 2C9CA 1IQPA 3HU3A 1L8QA 1IN4A 5FTJA 3PFIA 3HWSA 1NY6A 2VIIA 4LJ5A 5EP1A 3GLFA 2QBYB 1JR3D 4EIWA 3DZDA 4L4UA 5FTNA 3M0EA 1KYIA 2FNAA 1JR3A 4I4LA 3PVSA 2ZANA 2V1UA 4QHTA 3R8FA 3GLHB 1HT2E 4FCTA 4D80A 3U60B 1IN6A 3WHLA 2R65A 4LCBA 1NJGA 3D8BA 4QHSA 1G3IA 1FNNA 1SXJC 2QP9X 1KSFX 2DZOB 4A3VB 3EIHA 5FTKA 1QVRA 5DYGA 2CHGA 5JI3E 2X8AA 1XWIA 4L16A 5C1BA 2XSZA 1J7KA 5EXPA 2CE7A 3GLFB 2QBYA 1OFHA 5DYIA 2CHQA 3AJIB 5EP3A 3M6AA 4D81A 3HU2A 2C96A 5EXXA 1NY5A 3MHVC 1UM8A 3KDSE 3U5ZB 1OFIA 2CHVA 3GLHA 4LRSA 3KW6A 2C98A 1R6BX 2C9OA 4QNMA 5EQTA 5EXSA 3SYLA 2R62A 1IXSB 4FCVA 4KODA 1IN8A 1NVMA 4LRTA 4Z8XA 2RKOA 2KRKA 2QENA 4ZPXA 3UK6A 5JI2E 2ZAMA 4KLNA 3CF2A 1D2NA 3VFDA 3WHKA 1SXJE 5C18A 2QPAA 1XXHA 2DZNB 1DO2A 1JQJC 3SC3A 3GLGB 2ZAOA 2QZ4A 1DO0A 2CEAA 4LJAA 4LJ8A 2BJWA 3PXGA 1IM2A 4QOSA 1IN5A 1HQYE 1X37A 2XSZD 4JN6A 1IXRC 5FTMA 1HT1E 4WW0A 4D82A 5EXTA 1IY1A 3H4MA 4KO8A 1LV7A 1W5SA 4FD2A 1SXJD 1NSFA 3HU1A 1IN7A 4FCWA 1SXJA 4LJ7A 1XXHB 1IY2A 3GLGA 3ZH9B 3K1JA 4LJ6A 3GLIA 3VLFB 1E32A 3EIEA 5FTLA 2V6ZM 1NJFA 4LZZA 1S3SA 3U61B 4LJ9A 5EP4A 3SYKA 1OJLA 4L15A 2Z4SA 2C99A 1W5TA
chains in the Genus database with same CATH superfamily
2BWEA 1Z5CA 3L27A 5FLXS 4LF7M 4MGHA 2UUCM 4DV0M 4LJ4A 5LMUM 3A98B 2O01F 3B9PA 1YUBA 1R5LA 2KA6B 3NBXX 4OU7A 1SXJB 3KP0E 3KSJA 3CTWB 3B7QA 1V92A 2FOIC 1XC8A 2CUZA 1IY0A 1ZQ9A 4JV5M 2DHYA 3E21A 2DAGA 8CATA 3L26A 1R7RA 3SBJA 4LF5M 3PNVA 3TWKA 4LF4M 2L7IA 1IFYA 5KPTA 4IBFA 4JI3M 3TPZA 1XMOM 3L25A 2EKKA 2DAIA 2OOAA 4L78A 4IBDA 1WGLA 1OTRA 3HHYA 3I4VA 4AKIA 4UN2B 3B7NA 2DWNA 2UUBM 2XFSA 2YNMD 1PJTA 3M0EA 2H1RA 2FNAA 1JR3A 3DA1A 1PGYA 1Q02A 1QAMA 3TWLA 3GLHE 3UGJA 5ITRA 3R8FA 2VQEM 1R2YA 1Z5BA 3FRIA 3WHLA 1L2CA 4QOZC 4LCBA 4QHSA 3D8BA 4CISA 3U6LA 3E4RA 4JI1M 2DZOB 3B7ZA 1NHWC 4AQYM 2DAMA 3EIHA 5IZ7D 1HJPA 3KFUG 5DYGA 1R2ZA 5JI3E 2G3QA 2MGWA 2V1CA 2X8AA 3FYCA 1L2DA 2R0IA 3A45A 2XSZA 1J7KA 3QYEA 1JB0F 2VDBB 3HHWA 3M6AA 2Y20A 4CJ6A 4D81A 2C96A 3KOXE 3MJ5A 2L09A 2DAKA 1UM8A 3KDSE 2APLA 1LTMA 1OFIA 2DWMA 3KW6A 2MH8A 2C98A 2C9OA 2LVQD 3SYLA 4JI4M 2R62A 2M60A 1AIPC 4YHHM 4GMQA 1IN8A 1ORYB 1PJSA 2KRKA 3K8ZA 1GJSA 1JR3E 2J7NA 2LBCA 2C5RA 3B89A 4IBKA 2D7EA 1N32M 4L6V6 2D7GA 4Z6YA 1GL7A 3FUUA 3VFDA 1MU5A 2EUCA 3E46A 3OTOM 3VKHA 4IIWA 1SXJE 3HGIA 3ZQJA 1XXHA 3T38A 2R44A 4PD2A 3T1HM 1Z6TA 3GLGB 1IBMM 4MGZE 2JY8A 5IT9S 3C3DA 3AOEC 1HQYE 3GRUA 4S12A 1XNRM 1G71A 2JNHA 3LCUA 2KZUA 4NRVA 2R6FA 3LQRA 3W67A 3J27B 4B3TM 4WW0A 1KFVA 2R18A 3UZUA 4AG5A 2O5RA 1GLNA 4M0WA 4AG6A 4AW4A 1SXJD 2CP8A 5IREB 3A46A 3HJ8A 2XZFA 2WSEF 5LMNM 1YLAA 4MM3B 4LF6M 1QANA 2XZUA 3F92A 1E9RA 2MR9A 2LVOC 2OO9A 4JI8M 1RU3A 5KQDA 3FYDA 3GLGA 4LJ6A 4NC6A 1IBKM 5ITXE 3K9OA 3ZC7B 5L8RF 4GIPA 1TTEA 5BR8M 3L2AA 1Q3BA 1S3SA 4LZZA 3R9XB 2XH9A 2F5PA 1XXHE 1GO5A 1N33M 1PJIA 4ITQA 1NO1A 3RGSA 2QNJA 1TH4A 4L15A 2Z4SA 2DWLA 2C99A 2JZ0A 1TGUA 4PCZA 4FWGA 3MK6A 2JA2A 1PRBA 2DHRA 5KO3A 1Z59A 5H37D 3ILKA 4DV1M 2VF8A 3GQ5A 3W0LB 3HJQA 4FWDA 3U6CA 2EJSA 4FWHA 4LF9M 2KDLA 1XMQM 1VEGA 1QUSA 2DI0A 3C9PA 2LHGA 3I51A 3A42A 1HNWM 1D0MA 1DV0A 2ZTCA 4X65M 3HHZA 1SG9A 4IBBA 3U61A 2UUAM 3HWSA 1Q3CA 1CUKA 3HHXA 1HNZM 4GRIA 1PJJA 5EP1A 4DV7M 2YFQA 4EIWA 2HHHM 3DZDA 1ZMVA 4KHPM 4JI6M 3CGWA 1HNXM 4B7GA 1KYIA 3BBZA 4PDIA 3U5ZA 3GLHB 2CV2A 3K2LA 4FCTA 1IN6A 1VDDA 2KEBA 2R65A 3KP1E 1G59A 1YE9A 2QP9X 1SXJC 3D8LA 3IG8A 1A5TA 4DV4M 1D0KA 4IBGA 2CHGA 4M0DA 3UMMA 3I01M 1XWIA 1NNUC 4MB7A 5EXPA 2R4JA 2F5NA 1OFHA 2LWXA 5DYIA 1QAOA 5E6JA 3PNYA 4RKUF 1P3QQ 3KOYE 4NSOB 4HLQA 5EXXA 4B3MM 2LVNC 3MHVC 1WIVA 5EJCA 3SHGB 3GPYA 1T43A 1N34M 3Q8GA 4LF8M 1TR8A 2DENA 3U6PA 3GLHA 4X62M 4AKGA 4B3RM 3W0FA 4G4RA 1QZEA 2WZJA 4II7A 1TDZA 4QNMA 3GQ3A 1J5EM 4DBGB 4FCVA 1XHBA 1GABA 3E9SA 4LRTA 3GPUA 4JXJA 3GLIE 1T3TA 1Z5AA 2L4FA 4XK8F 4I8OA 2F5QA 2EO2A 1NV8A 4DV5M 1H6UA 2DZNB 4R3DA 2ZAOA 3VK7A 4MH0E 2B3TA 1G8PA 2CEAA 3BXWA 3V76A 5ITQA 3UJNA 4MGYE 4P16A 1IM2A 1GL6A 2HL7A 2RRUA 3TQSA 4JN6A 2ZBKB 4DR4M 1QQWA 4G3OA 4D82A 1IY1A 3U6QA 3LQQA 1LV7A 1MN3A 3J7BA 4GKJM 4DV6M 1DGGA 2OOBA 2LTUA 1DGHA 4IBIA 2XLJA 1SXJA 3FRHA 1XXHB 3U6OA 2HWJA 4G4OA 2GNOA 1IY2A 4B7HA 3FD9A 3VDPA 3IECA 2KXEA 2QCUA 2I7PA 3LCVB 4FVMA 5KPZA 3GLIA 4GH9A 2HKJA 1QDTA 3EIEA 1J09A 1DGFA 1NJFA 2V6ZM 5E26A 2OQ4A 3FTEA 3U61B 2LNHC 4B7FA 3C3EA 1ZV1A 3SMSA 2WSFF 3SAUA 1TH2A 2QZ4A 2JXNA 4IJEA 5EP2A 2DZLA 4DR6M 1EFUB 4ANRA 2MJ5B 3MMPA 2LVPC 1G41A 2K9DA 2ZTDA 1QZMA 4I81A 4GHAA 4NSRA 2DWZB 4GITA 2KNZA 1OIPA 3T15A 3SFZA 1K82A 3B74A 3U6DA 4RF0A 4GHLA 4F2LA 2KHHA 2Z7JA 3VKGA 3GQ4A 2FS1A 5ITUA 4MGKE 4JI5M 4LGMA 4QNRA 2LVAA 2Z4RA 5ITXA 2L6OA 3BOSA 1VEJA 2C9CA 2RGOA 3HKPA 4LG2A 1WJ7A 2MROB 1L8QA 1FJGM 3PFIA 3GRVA 1NY6A 4IBJA 2VIIA 3I4YA 4LJ5A 3K9PA 2EKFA 3KSXA 3GLFA 2QBYB 4YY3M 1N36M 2J5YA 2UXBM 4HEOA 3FTCA 4G4NA 4JI2M 2W82A 3IG5A 3AV0A 2L7HA 3JR5A 2BNKA 4JYAM 1ZMWA 2ZANA 2K0BX 1HT2E 2L4EA 4RF1A 4D80A 2OPFA 4TUWA 3CF6E 2LH0A 1QDRA 1N75A 1N77A 1FNNA 4DR2M 3ZCBB 1KSFX 4A3VB 3GRYA 1OAOC 2UXDM 2JY7A 2R45A 3QYBA 3J81S 1OKSA 5C1BA 2BWBA 2CE7A 3GLFB 2QBYA 3LVVA 2CWBA 3TL4X 1QYRA 2VQFM 2G8LA 3HY5A 3HU2A 3AOEA 1NY5A 4P17A 4DV2M 3JR4A 3AL0C 2ZM6M 4AKHA 2P5TA 2CHVA 2H5XA 3LW5F 2LHCA 3J7AS 3GLFE 1OQYA 1R6BX 1PJQA 5EQTA 4CGYB 4JI7M 5KQ8A 4KODA 1NVMA 3FTDA 2RKOA 2QENA 4ZPXA 1MX0A 3IHPA 1Q39A 1NNJA 3CF2A 1D2NA 2Q2EB 1I94M 1NHGC 4LZJA 2FFJA 2RGHA 2E5LM 2O25A 2QHOB 3FUXA 3M7GA 1DO2A 1JQJC 3SC3A 3GPXA 1ZMUA 1D0LA 2M5ZA 2G5GX 3FKEA 1WR1B 2BJWA 5F3WA 3KXEC 4G6ZA 5DNYA 3QWLA 2XSZD 4KT0F 1IXRC 5FTMA 4DR7M 4AZFA 1VDLA 2I7NA 5EXTA 3KS8A 3FUTA 3T1YM 1W5SA 1WHCA 2VF7A 4DR1M 1NSFA 3U6MA 2YR0A 2ERCA 3GRRA 4OVZB 1OAIA 4X64M 4FCWA 1PM5A 1GKIA 2XF3A 3Q8XA 3K92A 3NBIA 2X4AA 4LJ7A 2DXIA 3VK8A 1DGHB 4GKKM 3SAVA 3ZH9B 3K1JA 1E9SA 1NV9A 3QAUA 3SMPA 1F4IA 2UXCM 5EP4A 3KVWA 1L1ZA 1Y8GA 2HAKA 2DAEA 3FUWA 4IBCA 2Y0QA 4WURA 2Z3XA 4DUZM 4PDGA 1W5TA 3JAMS 3KS4A 2HCBA 2D7HA 3FUVA 3W68A 1IXZA 2BJVA 3DFZA 1HQCA 4OVZA 2DVWB 1C1KA 3SASA 1G4AE 2R46A 4FW9A 4LY6A 1XNQM 2NQ8C 4R7GA 2DNAA 3CF0A 4B3SM 1QAQA 4AI6A 1E94E 3GLIB 3TWMA 4CIZA 2YQZA 1VG5A 3GPPA 1IQPA 1WXQA 3HU3A 4BB9A 1IN4A 5FTJA 4LFCM 2Y21A 1UFZA 1JR3D 2CRUA 2KW0A 4L4UA 5FTNA 2CV0A 3AKZA 3RE8A 2KZSA 4MGIE 3C58A 1K3WA 2QQ8A 1QUTA 3SARA 2KNAA 4IBEA 3J2PB 4I4LA 3PVSA 3L28A 2V1UA 4QHTA 3HX3A 1V33A 3J80S 3U6EA 4PT5A 3LMMA 2L2DA 3U60B 1GVNA 4M9SA 4LFAM 1NJGA 1IXSA 3HJSA 4F1IA 1G3IA 3RGPA 5KPRA 1V34A 1MJGM 1GJTA 5FTKA 1HR0M 1QVRA 3LVWA 2J7OA 3TE6A 2GQFA 2JUJA 4OX9M 4IJFA 4L16A 3HZJA 1I4WA 1TDHA 4DR5M 4K0KM 2CHQA 3AJIB 5EP3A 5A2QS 2EA0A 5DFLA 1DGBA 2X49A 2JY6B 4G4QA 3KOWE 1ZAEA 1L1TA 3U5ZB 3DOAA 3GP1A 2F4VM 4R71A 4LRSA 1EIJA 3U60A 5EXSA 3SAWA 2XGNA 2JZ1A 1IXSB 3I04M 2FH0A 4JI0M 4NXMM 4Z8XA 2CFOA 3UK6A 4NL4H 2K6BA 2XFTA 5JI2E 4DV3M 1EE8A 1TH3A 2ZAMA 4KLNA 4M9ZA 4Q7JA 2JWSA 2KNVA 3T6PA 3THGA 2Y0TA 1BVSA 4X66M 3WHKA 2FE8A 1IBLM 3GO8A 5C18A 2QPAA 4LFBM 4BBAA 4BLCA 3GLGE 4DR3M 4WP2A 2JY5A 4XBOA 1XB2B 4LGYA 1DO0A 3RFWA 4W5WA 4GC5A 4NOOB 4LJAA 4LJ8A 3PXGA 5ITYA 4QOSA 3FTFA 1IN5A 4HL4A 4NXNM 3SATA 4M9XA 2XEPA 1X37A 5ITTA 4NRWA 4RNAA 1L2BA 4Y28F 5FSWA 4GC9A 1HT1E 4I5SA 4OW0A 3SHFA 2R4EA 3KOZE 2QSFX 3H4MA 3H4JA 4KO8A 3L29A 4FD2A 3VDUA 5IWAM 2F5SA 2LXEA 3HU1A 4B08A 1IN7A 1T6OA 2CV1A 3AOGA 1VQ1A 1AUAA 1YSYA 5GKNA 7CATA 1N78A 1VEKA 1TF0B 2A5YB 2N35A 2WSCF 2AHMA 3VLFB 4L8RC 1E32A 2K47A 1WGNA 2Z8YM 1R4GA 4GEWA 4DUYM 5FTLA 4CHTB 1OIZA 2KRUA 3AFHA 4REZA 2JP7A 4LJ9A 5BPVA 3NWLA 1C7YA 2DKLA 3SYKA 1OJLA 4XGIA 3FE3A 2F5OA 1K3XA 3U6SA 2UU9M
chains in the Genus database with same CATH topology
1Z5CA 3L27A 5FLXS 4LF7M 4MGHA 2UUCM 4DV0M 4LJ4A 5LMUM 3A98B 3B9PA 1YUBA 2KA6B 4OU7A 1SXJB 3KP0E 3KSJA 3CTWB 2FOIC 1XC8A 2CUZA 1IY0A 1ZQ9A 4JV5M 8CATA 3L26A 1R7RA 3SBJA 4LF5M 3PNVA 3TWKA 4LF4M 2L7IA 5KPTA 4IBFA 4JI3M 3TPZA 1XMOM 3L25A 4L78A 4IBDA 3HHYA 3I4VA 4AKIA 2DWNA 2UUBM 2XFSA 2YNMD 3M0EA 2H1RA 2FNAA 1JR3A 3DA1A 1QAMA 3TWLA 3UGJA 5ITRA 3R8FA 2VQEM 1R2YA 1Z5BA 3WHLA 1L2CA 4QOZC 4LCBA 4QHSA 3D8BA 4CISA 3U6LA 3E4RA 4JI1M 2DZOB 1NHWC 4AQYM 3EIHA 5IZ7D 3KFUG 5DYGA 1R2ZA 5JI3E 2V1CA 2X8AA 3FYCA 1L2DA 3A45A 2XSZA 1J7KA 3HHWA 3M6AA 2Y20A 4D81A 2C96A 3KOXE 3MJ5A 2L09A 1UM8A 3KDSE 1OFIA 2DWMA 3KW6A 2C98A 2C9OA 3SYLA 4JI4M 2R62A 2M60A 4YHHM 4GMQA 1IN8A 1ORYB 2KRKA 3K8ZA 2J7NA 2C5RA 4IBKA 2D7EA 1N32M 2D7GA 4Z6YA 1GL7A 3FUUA 3VFDA 1MU5A 2EUCA 3OTOM 3VKHA 4IIWA 1SXJE 3HGIA 1XXHA 3T38A 4PD2A 3T1HM 1Z6TA 3GLGB 1IBMM 4MGZE 5IT9S 3GRUA 3AOEC 1HQYE 4S12A 1XNRM 2KZUA 4NRVA 3LQRA 3J27B 4B3TM 4WW0A 1KFVA 2R18A 3UZUA 4AG5A 2O5RA 1GLNA 4M0WA 4AG6A 4AW4A 1SXJD 5IREB 3A46A 3HJ8A 2XZFA 5LMNM 4LF6M 4MM3B 1QANA 2XZUA 1E9RA 4JI8M 5KQDA 3FYDA 3GLGA 4LJ6A 1IBKM 5ITXE 3ZC7B 4GIPA 5BR8M 3L2AA 1Q3BA 1S3SA 4LZZA 3R9XB 2XH9A 2F5PA 1N33M 1PJIA 4ITQA 3RGSA 1TH4A 4L15A 2Z4SA 2DWLA 2C99A 1TGUA 4PCZA 4FWGA 3MK6A 2JA2A 2DHRA 5KO3A 1Z59A 5H37D 3ILKA 4DV1M 3GQ5A 3W0LB 3HJQA 4FWDA 3U6CA 4FWHA 4LF9M 1XMQM 3I51A 3A42A 1HNWM 4X65M 3HHZA 4IBBA 3U61A 2UUAM 3HWSA 1Q3CA 3HHXA 1HNZM 4GRIA 1PJJA 5EP1A 4DV7M 2YFQA 4EIWA 2HHHM 3DZDA 4KHPM 4JI6M 1HNXM 4B7GA 1KYIA 4PDIA 3U5ZA 3GLHB 2CV2A 3K2LA 4FCTA 1IN6A 1VDDA 2KEBA 2R65A 3KP1E 1G59A 1YE9A 2QP9X 1SXJC 3D8LA 3IG8A 4DV4M 4IBGA 2CHGA 4M0DA 3UMMA 1XWIA 1NNUC 4MB7A 5EXPA 2R4JA 2F5NA 1OFHA 2LWXA 5DYIA 1QAOA 5E6JA 3PNYA 3KOYE 4NSOB 4HLQA 5EXXA 4B3MM 3MHVC 5EJCA 3SHGB 3GPYA 4LF8M 1N34M 3U6PA 3GLHA 4X62M 4AKGA 4B3RM 3W0FA 4G4RA 4II7A 1TDZA 4QNMA 3GQ3A 1J5EM 4FCVA 1XHBA 3E9SA 4LRTA 3GPUA 4JXJA 1T3TA 1Z5AA 4I8OA 2F5QA 2EO2A 4DV5M 1H6UA 2DZNB 4R3DA 2ZAOA 3VK7A 4MH0E 2CEAA 1G8PA 5ITQA 3UJNA 4MGYE 4P16A 1IM2A 1GL6A 2HL7A 3TQSA 4JN6A 2ZBKB 4DR4M 1QQWA 4D82A 1IY1A 3U6QA 3LQQA 1LV7A 3J7BA 4GKJM 4DV6M 1DGGA 1DGHA 4IBIA 2XLJA 1SXJA 1XXHB 3U6OA 4G4OA 1IY2A 4B7HA 3FD9A 3VDPA 2KXEA 2QCUA 2I7PA 4FVMA 5KPZA 3GLIA 4GH9A 2HKJA 3EIEA 1J09A 1DGFA 1NJFA 2V6ZM 5E26A 2OQ4A 3FTEA 3U61B 2LNHC 4B7FA 3SMSA 3SAUA 1TH2A 2QZ4A 4IJEA 5EP2A 4DR6M 1G41A 1QZMA 4I81A 4GHAA 4NSRA 2DWZB 4GITA 3T15A 3SFZA 1K82A 3U6DA 4RF0A 4GHLA 2Z7JA 3VKGA 3GQ4A 5ITUA 4MGKE 4JI5M 4LGMA 4QNRA 2Z4RA 5ITXA 2L6OA 3BOSA 3HKPA 2C9CA 2RGOA 4LG2A 1FJGM 1L8QA 3PFIA 3GRVA 1NY6A 4IBJA 2VIIA 3I4YA 4LJ5A 3KSXA 3GLFA 2QBYB 4YY3M 1N36M 2UXBM 3FTCA 4G4NA 4JI2M 2W82A 3IG5A 3AV0A 2L7HA 3JR5A 2BNKA 4JYAM 2ZANA 1HT2E 4RF1A 4D80A 2OPFA 4TUWA 3CF6E 2LH0A 1N75A 1N77A 1FNNA 4DR2M 3ZCBB 1KSFX 4A3VB 3GRYA 2UXDM 2R45A 3J81S 5C1BA 2CE7A 3GLFB 2QBYA 3LVVA 3TL4X 1QYRA 2VQFM 2G8LA 3HU2A 3AOEA 1NY5A 4DV2M 3JR4A 3AL0C 2ZM6M 4AKHA 2P5TA 2CHVA 3J7AS 1R6BX 5EQTA 4CGYB 4JI7M 5KQ8A 4KODA 1NVMA 3FTDA 2RKOA 2QENA 4ZPXA 1MX0A 1NNJA 1Q39A 3CF2A 1D2NA 2Q2EB 1I94M 1NHGC 4LZJA 2FFJA 2RGHA 2E5LM 3FUXA 3M7GA 1DO2A 1JQJC 3SC3A 3GPXA 2M5ZA 3FKEA 2G5GX 2BJWA 5F3WA 3KXEC 4G6ZA 5DNYA 3QWLA 2XSZD 1IXRC 5FTMA 4DR7M 4AZFA 2I7NA 5EXTA 3KS8A 3FUTA 3T1YM 1W5SA 4DR1M 1NSFA 3U6MA 2YR0A 2ERCA 3GRRA 4OVZB 4X64M 1PM5A 4FCWA 1GKIA 2XF3A 3Q8XA 3K92A 3NBIA 2X4AA 4LJ7A 2DXIA 3VK8A 1DGHB 4GKKM 3SAVA 3ZH9B 3K1JA 1E9SA 3QAUA 3SMPA 2UXCM 5EP4A 3KVWA 1L1ZA 2Z3XA 3FUWA 4IBCA 4WURA 2Y0QA 4DUZM 4PDGA 1W5TA 3JAMS 3KS4A 2HCBA 2D7HA 3FUVA 1IXZA 2BJVA 3DFZA 1HQCA 4OVZA 2DVWB 1C1KA 3SASA 1G4AE 2R46A 4FW9A 4LY6A 1XNQM 2NQ8C 4R7GA 3CF0A 4B3SM 4AI6A 1QAQA 1E94E 3GLIB 3TWMA 2YQZA 3GPPA 1IQPA 1WXQA 3HU3A 4BB9A 1IN4A 5FTJA 4LFCM 2Y21A 1JR3D 2KW0A 4L4UA 5FTNA 2CV0A 3AKZA 3RE8A 2KZSA 4MGIE 3C58A 1K3WA 3SARA 4IBEA 3J2PB 4I4LA 3PVSA 3L28A 2V1UA 4QHTA 3J80S 3U6EA 4PT5A 3LMMA 3U60B 1GVNA 4M9SA 4LFAM 1NJGA 3HJSA 1G3IA 3RGPA 5KPRA 5FTKA 1HR0M 1QVRA 3LVWA 2J7OA 3TE6A 4OX9M 4IJFA 4L16A 1I4WA 1TDHA 4DR5M 4K0KM 2CHQA 3AJIB 5EP3A 5A2QS 2EA0A 1DGBA 2X49A 4G4QA 3KOWE 1ZAEA 1L1TA 3U5ZB 3DOAA 3GP1A 2F4VM 4LRSA 3U60A 5EXSA 3SAWA 2XGNA 1IXSB 4JI0M 4NXMM 4Z8XA 2CFOA 3UK6A 4NL4H 5JI2E 2XFTA 4DV3M 1EE8A 1TH3A 2ZAMA 4KLNA 4M9ZA 3THGA 2Y0TA 1IBLM 4X66M 3WHKA 2FE8A 3GO8A 5C18A 2QPAA 4LFBM 4BBAA 4BLCA 4DR3M 4XBOA 4LGYA 1DO0A 3RFWA 4W5WA 4GC5A 4NOOB 4LJAA 4LJ8A 3PXGA 5ITYA 4QOSA 3FTFA 1IN5A 4HL4A 4NXNM 3SATA 4M9XA 2XEPA 1X37A 5ITTA 4NRWA 4RNAA 1L2BA 5FSWA 4GC9A 1HT1E 4I5SA 4OW0A 3SHFA 2R4EA 3KOZE 3H4MA 4KO8A 3L29A 4FD2A 3VDUA 5IWAM 2F5SA 2LXEA 3HU1A 4B08A 1IN7A 2CV1A 3AOGA 1YSYA 5GKNA 7CATA 1N78A 2A5YB 2AHMA 3VLFB 4L8RC 1E32A 2K47A 4DUYM 5FTLA 4CHTB 2KRUA 3AFHA 4REZA 4LJ9A 5BPVA 3NWLA 3SYKA 1OJLA 4XGIA 2F5OA 1K3XA 3U6SA 2UU9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EP2 A;  4FWG A;  2HCB A;  1IXZ A;  1G41 A;  2BJV A;  2DHR A;  1QZM A;  4I81 A;  4LJ4 A;  1HQC A;  2DWZ B;  4GIT A;  3B9P A;  4FWD A;  1SXJ B;  2DVW B;  1C1K A;  4FWH A;  1G4A E;  4FW9 A;  4LY6 A;  3CF0 A;  1E94 E;  3GLI B;  1IY0 A;  4LGM A;  4QNR A;  2Z4R A;  3BOS A;  1R7R A;  2C9C A;  1IQP A;  3HU3 A;  1L8Q A;  1IN4 A;  5FTJ A;  3PFI A;  3HWS A;  1NY6 A;  2VII A;  4LJ5 A;  5EP1 A;  3GLF A;  2QBY B;  1JR3 D;  4EIW A;  3DZD A;  4L4U A;  5FTN A;  3M0E A;  1KYI A;  2FNA A;  1JR3 A;  4I4L A;  3PVS A;  2ZAN A;  2V1U A;  4QHT A;  3R8F A;  3GLH B;  1HT2 E;  4FCT A;  4D80 A;  3U60 B;  1IN6 A;  3WHL A;  2R65 A;  4LCB A;  1NJG A;  3D8B A;  4QHS A;  1G3I A;  1FNN A;  1SXJ C;  2QP9 X;  1KSF X;  2DZO B;  4A3V B;  3EIH A;  5FTK A;  1QVR A;  5DYG A;  2CHG A;  5JI3 E;  2X8A A;  1XWI A;  4L16 A;  5C1B A;  2XSZ A;  1J7K A;  5EXP A;  2CE7 A;  3GLF B;  2QBY A;  1OFH A;  5DYI A;  2CHQ A;  3AJI B;  5EP3 A;  3M6A A;  4D81 A;  3HU2 A;  2C96 A;  5EXX A;  1NY5 A;  3MHV C;  1UM8 A;  3KDS E;  3U5Z B;  1OFI A;  2CHV A;  3GLH A;  4LRS A;  3KW6 A;  2C98 A;  1R6B X;  2C9O A;  4QNM A;  5EQT A;  5EXS A;  3SYL A;  2R62 A;  1IXS B;  4FCV A;  4KOD A;  1IN8 A;  1NVM A;  4LRT A;  4Z8X A;  2RKO A;  2KRK A;  2QEN A;  4ZPX A;  3UK6 A;  5JI2 E;  2ZAM A;  4KLN A;  3CF2 A;  1D2N A;  3VFD A;  3WHK A;  1SXJ E;  5C18 A;  2QPA A;  1XXH A;  2DZN B;  1DO2 A;  1JQJ C;  3SC3 A;  3GLG B;  2ZAO A;  2QZ4 A;  1DO0 A;  2CEA A;  4LJA A;  4LJ8 A;  2BJW A;  3PXG A;  1IM2 A;  4QOS A;  1IN5 A;  1HQY E;  1X37 A;  2XSZ D;  4JN6 A;  1IXR C;  5FTM A;  1HT1 E;  4WW0 A;  4D82 A;  5EXT A;  1IY1 A;  3H4M A;  4KO8 A;  1LV7 A;  1W5S A;  4FD2 A;  1SXJ D;  1NSF A;  3HU1 A;  1IN7 A;  4FCW A;  1SXJ A;  4LJ7 A;  1XXH B;  1IY2 A;  3GLG A;  3ZH9 B;  3K1J A;  4LJ6 A;  3GLI A;  3VLF B;  1E32 A;  3EIE A;  5FTL A;  2V6Z M;  1NJF A;  4LZZ A;  1S3S A;  3U61 B;  4LJ9 A;  5EP4 A;  3SYK A;  1OJL A;  4L15 A;  2Z4S A;  2C99 A;  1W5T A; 
#chains in the Genus database with same CATH topology
 2BWE A;  1Z5C A;  3L27 A;  5FLX S;  4LF7 M;  4MGH A;  2UUC M;  4DV0 M;  4LJ4 A;  5LMU M;  3A98 B;  2O01 F;  3B9P A;  1YUB A;  1R5L A;  2KA6 B;  3NBX X;  4OU7 A;  1SXJ B;  3KP0 E;  3KSJ A;  3CTW B;  3B7Q A;  1V92 A;  2FOI C;  1XC8 A;  2CUZ A;  1IY0 A;  1ZQ9 A;  4JV5 M;  2DHY A;  3E21 A;  2DAG A;  8CAT A;  3L26 A;  1R7R A;  3SBJ A;  4LF5 M;  3PNV A;  3TWK A;  4LF4 M;  2L7I A;  1IFY A;  5KPT A;  4IBF A;  4JI3 M;  3TPZ A;  1XMO M;  3L25 A;  2EKK A;  2DAI A;  2OOA A;  4L78 A;  4IBD A;  1WGL A;  1OTR A;  3HHY A;  3I4V A;  4AKI A;  4UN2 B;  3B7N A;  2DWN A;  2UUB M;  2XFS A;  2YNM D;  1PJT A;  3M0E A;  2H1R A;  2FNA A;  1JR3 A;  3DA1 A;  1PGY A;  1Q02 A;  1QAM A;  3TWL A;  3GLH E;  3UGJ A;  5ITR A;  3R8F A;  2VQE M;  1R2Y A;  1Z5B A;  3FRI A;  3WHL A;  1L2C A;  4QOZ C;  4LCB A;  4QHS A;  3D8B A;  4CIS A;  3U6L A;  3E4R A;  4JI1 M;  2DZO B;  3B7Z A;  1NHW C;  4AQY M;  2DAM A;  3EIH A;  5IZ7 D;  1HJP A;  3KFU G;  5DYG A;  1R2Z A;  5JI3 E;  2G3Q A;  2MGW A;  2V1C A;  2X8A A;  3FYC A;  1L2D A;  2R0I A;  3A45 A;  2XSZ A;  1J7K A;  3QYE A;  1JB0 F;  2VDB B;  3HHW A;  3M6A A;  2Y20 A;  4CJ6 A;  4D81 A;  2C96 A;  3KOX E;  3MJ5 A;  2L09 A;  2DAK A;  1UM8 A;  3KDS E;  2APL A;  1LTM A;  1OFI A;  2DWM A;  3KW6 A;  2MH8 A;  2C98 A;  2C9O A;  2LVQ D;  3SYL A;  4JI4 M;  2R62 A;  2M60 A;  1AIP C;  4YHH M;  4GMQ A;  1IN8 A;  1ORY B;  1PJS A;  2KRK A;  3K8Z A;  1GJS A;  1JR3 E;  2J7N A;  2LBC A;  2C5R A;  3B89 A;  4IBK A;  2D7E A;  1N32 M;  4L6V 6;  2D7G A;  4Z6Y A;  1GL7 A;  3FUU A;  3VFD A;  1MU5 A;  2EUC A;  3E46 A;  3OTO M;  3VKH A;  4IIW A;  1SXJ E;  3HGI A;  3ZQJ A;  1XXH A;  3T38 A;  2R44 A;  4PD2 A;  3T1H M;  1Z6T A;  3GLG B;  1IBM M;  4MGZ E;  2JY8 A;  5IT9 S;  3C3D A;  3AOE C;  1HQY E;  3GRU A;  4S12 A;  1XNR M;  1G71 A;  2JNH A;  3LCU A;  2KZU A;  4NRV A;  2R6F A;  3LQR A;  3W67 A;  3J27 B;  4B3T M;  4WW0 A;  1KFV A;  2R18 A;  3UZU A;  4AG5 A;  2O5R A;  1GLN A;  4M0W A;  4AG6 A;  4AW4 A;  1SXJ D;  2CP8 A;  5IRE B;  3A46 A;  3HJ8 A;  2XZF A;  2WSE F;  5LMN M;  1YLA A;  4MM3 B;  4LF6 M;  1QAN A;  2XZU A;  3F92 A;  1E9R A;  2MR9 A;  2LVO C;  2OO9 A;  4JI8 M;  1RU3 A;  5KQD A;  3FYD A;  3GLG A;  4LJ6 A;  4NC6 A;  1IBK M;  5ITX E;  3K9O A;  3ZC7 B;  5L8R F;  4GIP A;  1TTE A;  5BR8 M;  3L2A A;  1Q3B A;  1S3S A;  4LZZ A;  3R9X B;  2XH9 A;  2F5P A;  1XXH E;  1GO5 A;  1N33 M;  1PJI A;  4ITQ A;  1NO1 A;  3RGS A;  2QNJ A;  1TH4 A;  4L15 A;  2Z4S A;  2DWL A;  2C99 A;  2JZ0 A;  1TGU A;  4PCZ A;  4FWG A;  3MK6 A;  2JA2 A;  1PRB A;  2DHR A;  5KO3 A;  1Z59 A;  5H37 D;  3ILK A;  4DV1 M;  2VF8 A;  3GQ5 A;  3W0L B;  3HJQ A;  4FWD A;  3U6C A;  2EJS A;  4FWH A;  4LF9 M;  2KDL A;  1XMQ M;  1VEG A;  1QUS A;  2DI0 A;  3C9P A;  2LHG A;  3I51 A;  3A42 A;  1HNW M;  1D0M A;  1DV0 A;  2ZTC A;  4X65 M;  3HHZ A;  1SG9 A;  4IBB A;  3U61 A;  2UUA M;  3HWS A;  1Q3C A;  1CUK A;  3HHX A;  1HNZ M;  4GRI A;  1PJJ A;  5EP1 A;  4DV7 M;  2YFQ A;  4EIW A;  2HHH M;  3DZD A;  1ZMV A;  4KHP M;  4JI6 M;  3CGW A;  1HNX M;  4B7G A;  1KYI A;  3BBZ A;  4PDI A;  3U5Z A;  3GLH B;  2CV2 A;  3K2L A;  4FCT A;  1IN6 A;  1VDD A;  2KEB A;  2R65 A;  3KP1 E;  1G59 A;  1YE9 A;  2QP9 X;  1SXJ C;  3D8L A;  3IG8 A;  1A5T A;  4DV4 M;  1D0K A;  4IBG A;  2CHG A;  4M0D A;  3UMM A;  3I01 M;  1XWI A;  1NNU C;  4MB7 A;  5EXP A;  2R4J A;  2F5N A;  1OFH A;  2LWX A;  5DYI A;  1QAO A;  5E6J A;  3PNY A;  4RKU F;  1P3Q Q;  3KOY E;  4NSO B;  4HLQ A;  5EXX A;  4B3M M;  2LVN C;  3MHV C;  1WIV A;  5EJC A;  3SHG B;  3GPY A;  1T43 A;  1N34 M;  3Q8G A;  4LF8 M;  1TR8 A;  2DEN A;  3U6P A;  3GLH A;  4X62 M;  4AKG A;  4B3R M;  3W0F A;  4G4R A;  1QZE A;  2WZJ A;  4II7 A;  1TDZ A;  4QNM A;  3GQ3 A;  1J5E M;  4DBG B;  4FCV A;  1XHB A;  1GAB A;  3E9S A;  4LRT A;  3GPU A;  4JXJ A;  3GLI E;  1T3T A;  1Z5A A;  2L4F A;  4XK8 F;  4I8O A;  2F5Q A;  2EO2 A;  1NV8 A;  4DV5 M;  1H6U A;  2DZN B;  4R3D A;  2ZAO A;  3VK7 A;  4MH0 E;  2B3T A;  1G8P A;  2CEA A;  3BXW A;  3V76 A;  5ITQ A;  3UJN A;  4MGY E;  4P16 A;  1IM2 A;  1GL6 A;  2HL7 A;  2RRU A;  3TQS A;  4JN6 A;  2ZBK B;  4DR4 M;  1QQW A;  4G3O A;  4D82 A;  1IY1 A;  3U6Q A;  3LQQ A;  1LV7 A;  1MN3 A;  3J7B A;  4GKJ M;  4DV6 M;  1DGG A;  2OOB A;  2LTU A;  1DGH A;  4IBI A;  2XLJ A;  1SXJ A;  3FRH A;  1XXH B;  3U6O A;  2HWJ A;  4G4O A;  2GNO A;  1IY2 A;  4B7H A;  3FD9 A;  3VDP A;  3IEC A;  2KXE A;  2QCU A;  2I7P A;  3LCV B;  4FVM A;  5KPZ A;  3GLI A;  4GH9 A;  2HKJ A;  1QDT A;  3EIE A;  1J09 A;  1DGF A;  1NJF A;  2V6Z M;  5E26 A;  2OQ4 A;  3FTE A;  3U61 B;  2LNH C;  4B7F A;  3C3E A;  1ZV1 A;  3SMS A;  2WSF F;  3SAU A;  1TH2 A;  2QZ4 A;  2JXN A;  4IJE A;  5EP2 A;  2DZL A;  4DR6 M;  1EFU B;  4ANR A;  2MJ5 B;  3MMP A;  2LVP C;  1G41 A;  2K9D A;  2ZTD A;  1QZM A;  4I81 A;  4GHA A;  4NSR A;  2DWZ B;  4GIT A;  2KNZ A;  1OIP A;  3T15 A;  3SFZ A;  1K82 A;  3B74 A;  3U6D A;  4RF0 A;  4GHL A;  4F2L A;  2KHH A;  2Z7J A;  3VKG A;  3GQ4 A;  2FS1 A;  5ITU A;  4MGK E;  4JI5 M;  4LGM A;  4QNR A;  2LVA A;  2Z4R A;  5ITX A;  2L6O A;  3BOS A;  1VEJ A;  2C9C A;  2RGO A;  3HKP A;  4LG2 A;  1WJ7 A;  2MRO B;  1L8Q A;  1FJG M;  3PFI A;  3GRV A;  1NY6 A;  4IBJ A;  2VII A;  3I4Y A;  4LJ5 A;  3K9P A;  2EKF A;  3KSX A;  3GLF A;  2QBY B;  4YY3 M;  1N36 M;  2J5Y A;  2UXB M;  4HEO A;  3FTC A;  4G4N A;  4JI2 M;  2W82 A;  3IG5 A;  3AV0 A;  2L7H A;  3JR5 A;  2BNK A;  4JYA M;  1ZMW A;  2ZAN A;  2K0B X;  1HT2 E;  2L4E A;  4RF1 A;  4D80 A;  2OPF A;  4TUW A;  3CF6 E;  2LH0 A;  1QDR A;  1N75 A;  1N77 A;  1FNN A;  4DR2 M;  3ZCB B;  1KSF X;  4A3V B;  3GRY A;  1OAO C;  2UXD M;  2JY7 A;  2R45 A;  3QYB A;  3J81 S;  1OKS A;  5C1B A;  2BWB A;  2CE7 A;  3GLF B;  2QBY A;  3LVV A;  2CWB A;  3TL4 X;  1QYR A;  2VQF M;  2G8L A;  3HY5 A;  3HU2 A;  3AOE A;  1NY5 A;  4P17 A;  4DV2 M;  3JR4 A;  3AL0 C;  2ZM6 M;  4AKH A;  2P5T A;  2CHV A;  2H5X A;  3LW5 F;  2LHC A;  3J7A S;  3GLF E;  1OQY A;  1R6B X;  1PJQ A;  5EQT A;  4CGY B;  4JI7 M;  5KQ8 A;  4KOD A;  1NVM A;  3FTD A;  2RKO A;  2QEN A;  4ZPX A;  1MX0 A;  3IHP A;  1Q39 A;  1NNJ A;  3CF2 A;  1D2N A;  2Q2E B;  1I94 M;  1NHG C;  4LZJ A;  2FFJ A;  2RGH A;  2E5L M;  2O25 A;  2QHO B;  3FUX A;  3M7G A;  1DO2 A;  1JQJ C;  3SC3 A;  3GPX A;  1ZMU A;  1D0L A;  2M5Z A;  2G5G X;  3FKE A;  1WR1 B;  2BJW A;  5F3W A;  3KXE C;  4G6Z A;  5DNY A;  3QWL A;  2XSZ D;  4KT0 F;  1IXR C;  5FTM A;  4DR7 M;  4AZF A;  1VDL A;  2I7N A;  5EXT A;  3KS8 A;  3FUT A;  3T1Y M;  1W5S A;  1WHC A;  2VF7 A;  4DR1 M;  1NSF A;  3U6M A;  2YR0 A;  2ERC A;  3GRR A;  4OVZ B;  1OAI A;  4X64 M;  4FCW A;  1PM5 A;  1GKI A;  2XF3 A;  3Q8X A;  3K92 A;  3NBI A;  2X4A A;  4LJ7 A;  2DXI A;  3VK8 A;  1DGH B;  4GKK M;  3SAV A;  3ZH9 B;  3K1J A;  1E9S A;  1NV9 A;  3QAU A;  3SMP A;  1F4I A;  2UXC M;  5EP4 A;  3KVW A;  1L1Z A;  1Y8G A;  2HAK A;  2DAE A;  3FUW A;  4IBC A;  2Y0Q A;  4WUR A;  2Z3X A;  4DUZ M;  4PDG A;  1W5T A;  3JAM S;  3KS4 A;  2HCB A;  2D7H A;  3FUV A;  3W68 A;  1IXZ A;  2BJV A;  3DFZ A;  1HQC A;  4OVZ A;  2DVW B;  1C1K A;  3SAS A;  1G4A E;  2R46 A;  4FW9 A;  4LY6 A;  1XNQ M;  2NQ8 C;  4R7G A;  2DNA A;  3CF0 A;  4B3S M;  1QAQ A;  4AI6 A;  1E94 E;  3GLI B;  3TWM A;  4CIZ A;  2YQZ A;  1VG5 A;  3GPP A;  1IQP A;  1WXQ A;  3HU3 A;  4BB9 A;  1IN4 A;  5FTJ A;  4LFC M;  2Y21 A;  1UFZ A;  1JR3 D;  2CRU A;  2KW0 A;  4L4U A;  5FTN A;  2CV0 A;  3AKZ A;  3RE8 A;  2KZS A;  4MGI E;  3C58 A;  1K3W A;  2QQ8 A;  1QUT A;  3SAR A;  2KNA A;  4IBE A;  3J2P B;  4I4L A;  3PVS A;  3L28 A;  2V1U A;  4QHT A;  3HX3 A;  1V33 A;  3J80 S;  3U6E A;  4PT5 A;  3LMM A;  2L2D A;  3U60 B;  1GVN A;  4M9S A;  4LFA M;  1NJG A;  1IXS A;  3HJS A;  4F1I A;  1G3I A;  3RGP A;  5KPR A;  1V34 A;  1MJG M;  1GJT A;  5FTK A;  1HR0 M;  1QVR A;  3LVW A;  2J7O A;  3TE6 A;  2GQF A;  2JUJ A;  4OX9 M;  4IJF A;  4L16 A;  3HZJ A;  1I4W A;  1TDH A;  4DR5 M;  4K0K M;  2CHQ A;  3AJI B;  5EP3 A;  5A2Q S;  2EA0 A;  5DFL A;  1DGB A;  2X49 A;  2JY6 B;  4G4Q A;  3KOW E;  1ZAE A;  1L1T A;  3U5Z B;  3DOA A;  3GP1 A;  2F4V M;  4R71 A;  4LRS A;  1EIJ A;  3U60 A;  5EXS A;  3SAW A;  2XGN A;  2JZ1 A;  1IXS B;  3I04 M;  2FH0 A;  4JI0 M;  4NXM M;  4Z8X A;  2CFO A;  3UK6 A;  4NL4 H;  2K6B A;  2XFT A;  5JI2 E;  4DV3 M;  1EE8 A;  1TH3 A;  2ZAM A;  4KLN A;  4M9Z A;  4Q7J A;  2JWS A;  2KNV A;  3T6P A;  3THG A;  2Y0T A;  1BVS A;  4X66 M;  3WHK A;  2FE8 A;  1IBL M;  3GO8 A;  5C18 A;  2QPA A;  4LFB M;  4BBA A;  4BLC A;  3GLG E;  4DR3 M;  4WP2 A;  2JY5 A;  4XBO A;  1XB2 B;  4LGY A;  1DO0 A;  3RFW A;  4W5W A;  4GC5 A;  4NOO B;  4LJA A;  4LJ8 A;  3PXG A;  5ITY A;  4QOS A;  3FTF A;  1IN5 A;  4HL4 A;  4NXN M;  3SAT A;  4M9X A;  2XEP A;  1X37 A;  5ITT A;  4NRW A;  4RNA A;  1L2B A;  4Y28 F;  5FSW A;  4GC9 A;  1HT1 E;  4I5S A;  4OW0 A;  3SHF A;  2R4E A;  3KOZ E;  2QSF X;  3H4M A;  3H4J A;  4KO8 A;  3L29 A;  4FD2 A;  3VDU A;  5IWA M;  2F5S A;  2LXE A;  3HU1 A;  4B08 A;  1IN7 A;  1T6O A;  2CV1 A;  3AOG A;  1VQ1 A;  1AUA A;  1YSY A;  5GKN A;  7CAT A;  1N78 A;  1VEK A;  1TF0 B;  2A5Y B;  2N35 A;  2WSC F;  2AHM A;  3VLF B;  4L8R C;  1E32 A;  2K47 A;  1WGN A;  2Z8Y M;  1R4G A;  4GEW A;  4DUY M;  5FTL A;  4CHT B;  1OIZ A;  2KRU A;  3AFH A;  4REZ A;  2JP7 A;  4LJ9 A;  5BPV A;  3NWL A;  1C7Y A;  2DKL A;  3SYK A;  1OJL A;  4XGI A;  3FE3 A;  2F5O A;  1K3X A;  3U6S A;  2UU9 M; 
#chains in the Genus database with same CATH homology
 1Z5C A;  3L27 A;  5FLX S;  4LF7 M;  4MGH A;  2UUC M;  4DV0 M;  4LJ4 A;  5LMU M;  3A98 B;  3B9P A;  1YUB A;  2KA6 B;  4OU7 A;  1SXJ B;  3KP0 E;  3KSJ A;  3CTW B;  2FOI C;  1XC8 A;  2CUZ A;  1IY0 A;  1ZQ9 A;  4JV5 M;  8CAT A;  3L26 A;  1R7R A;  3SBJ A;  4LF5 M;  3PNV A;  3TWK A;  4LF4 M;  2L7I A;  5KPT A;  4IBF A;  4JI3 M;  3TPZ A;  1XMO M;  3L25 A;  4L78 A;  4IBD A;  3HHY A;  3I4V A;  4AKI A;  2DWN A;  2UUB M;  2XFS A;  2YNM D;  3M0E A;  2H1R A;  2FNA A;  1JR3 A;  3DA1 A;  1QAM A;  3TWL A;  3UGJ A;  5ITR A;  3R8F A;  2VQE M;  1R2Y A;  1Z5B A;  3WHL A;  1L2C A;  4QOZ C;  4LCB A;  4QHS A;  3D8B A;  4CIS A;  3U6L A;  3E4R A;  4JI1 M;  2DZO B;  1NHW C;  4AQY M;  3EIH A;  5IZ7 D;  3KFU G;  5DYG A;  1R2Z A;  5JI3 E;  2V1C A;  2X8A A;  3FYC A;  1L2D A;  3A45 A;  2XSZ A;  1J7K A;  3HHW A;  3M6A A;  2Y20 A;  4D81 A;  2C96 A;  3KOX E;  3MJ5 A;  2L09 A;  1UM8 A;  3KDS E;  1OFI A;  2DWM A;  3KW6 A;  2C98 A;  2C9O A;  3SYL A;  4JI4 M;  2R62 A;  2M60 A;  4YHH M;  4GMQ A;  1IN8 A;  1ORY B;  2KRK A;  3K8Z A;  2J7N A;  2C5R A;  4IBK A;  2D7E A;  1N32 M;  2D7G A;  4Z6Y A;  1GL7 A;  3FUU A;  3VFD A;  1MU5 A;  2EUC A;  3OTO M;  3VKH A;  4IIW A;  1SXJ E;  3HGI A;  1XXH A;  3T38 A;  4PD2 A;  3T1H M;  1Z6T A;  3GLG B;  1IBM M;  4MGZ E;  5IT9 S;  3GRU A;  3AOE C;  1HQY E;  4S12 A;  1XNR M;  2KZU A;  4NRV A;  3LQR A;  3J27 B;  4B3T M;  4WW0 A;  1KFV A;  2R18 A;  3UZU A;  4AG5 A;  2O5R A;  1GLN A;  4M0W A;  4AG6 A;  4AW4 A;  1SXJ D;  5IRE B;  3A46 A;  3HJ8 A;  2XZF A;  5LMN M;  4LF6 M;  4MM3 B;  1QAN A;  2XZU A;  1E9R A;  4JI8 M;  5KQD A;  3FYD A;  3GLG A;  4LJ6 A;  1IBK M;  5ITX E;  3ZC7 B;  4GIP A;  5BR8 M;  3L2A A;  1Q3B A;  1S3S A;  4LZZ A;  3R9X B;  2XH9 A;  2F5P A;  1N33 M;  1PJI A;  4ITQ A;  3RGS A;  1TH4 A;  4L15 A;  2Z4S A;  2DWL A;  2C99 A;  1TGU A;  4PCZ A;  4FWG A;  3MK6 A;  2JA2 A;  2DHR A;  5KO3 A;  1Z59 A;  5H37 D;  3ILK A;  4DV1 M;  3GQ5 A;  3W0L B;  3HJQ A;  4FWD A;  3U6C A;  4FWH A;  4LF9 M;  1XMQ M;  3I51 A;  3A42 A;  1HNW M;  4X65 M;  3HHZ A;  4IBB A;  3U61 A;  2UUA M;  3HWS A;  1Q3C A;  3HHX A;  1HNZ M;  4GRI A;  1PJJ A;  5EP1 A;  4DV7 M;  2YFQ A;  4EIW A;  2HHH M;  3DZD A;  4KHP M;  4JI6 M;  1HNX M;  4B7G A;  1KYI A;  4PDI A;  3U5Z A;  3GLH B;  2CV2 A;  3K2L A;  4FCT A;  1IN6 A;  1VDD A;  2KEB A;  2R65 A;  3KP1 E;  1G59 A;  1YE9 A;  2QP9 X;  1SXJ C;  3D8L A;  3IG8 A;  4DV4 M;  4IBG A;  2CHG A;  4M0D A;  3UMM A;  1XWI A;  1NNU C;  4MB7 A;  5EXP A;  2R4J A;  2F5N A;  1OFH A;  2LWX A;  5DYI A;  1QAO A;  5E6J A;  3PNY A;  3KOY E;  4NSO B;  4HLQ A;  5EXX A;  4B3M M;  3MHV C;  5EJC A;  3SHG B;  3GPY A;  4LF8 M;  1N34 M;  3U6P A;  3GLH A;  4X62 M;  4AKG A;  4B3R M;  3W0F A;  4G4R A;  4II7 A;  1TDZ A;  4QNM A;  3GQ3 A;  1J5E M;  4FCV A;  1XHB A;  3E9S A;  4LRT A;  3GPU A;  4JXJ A;  1T3T A;  1Z5A A;  4I8O A;  2F5Q A;  2EO2 A;  4DV5 M;  1H6U A;  2DZN B;  4R3D A;  2ZAO A;  3VK7 A;  4MH0 E;  2CEA A;  1G8P A;  5ITQ A;  3UJN A;  4MGY E;  4P16 A;  1IM2 A;  1GL6 A;  2HL7 A;  3TQS A;  4JN6 A;  2ZBK B;  4DR4 M;  1QQW A;  4D82 A;  1IY1 A;  3U6Q A;  3LQQ A;  1LV7 A;  3J7B A;  4GKJ M;  4DV6 M;  1DGG A;  1DGH A;  4IBI A;  2XLJ A;  1SXJ A;  1XXH B;  3U6O A;  4G4O A;  1IY2 A;  4B7H A;  3FD9 A;  3VDP A;  2KXE A;  2QCU A;  2I7P A;  4FVM A;  5KPZ A;  3GLI A;  4GH9 A;  2HKJ A;  3EIE A;  1J09 A;  1DGF A;  1NJF A;  2V6Z M;  5E26 A;  2OQ4 A;  3FTE A;  3U61 B;  2LNH C;  4B7F A;  3SMS A;  3SAU A;  1TH2 A;  2QZ4 A;  4IJE A;  5EP2 A;  4DR6 M;  1G41 A;  1QZM A;  4I81 A;  4GHA A;  4NSR A;  2DWZ B;  4GIT A;  3T15 A;  3SFZ A;  1K82 A;  3U6D A;  4RF0 A;  4GHL A;  2Z7J A;  3VKG A;  3GQ4 A;  5ITU A;  4MGK E;  4JI5 M;  4LGM A;  4QNR A;  2Z4R A;  5ITX A;  2L6O A;  3BOS A;  3HKP A;  2C9C A;  2RGO A;  4LG2 A;  1FJG M;  1L8Q A;  3PFI A;  3GRV A;  1NY6 A;  4IBJ A;  2VII A;  3I4Y A;  4LJ5 A;  3KSX A;  3GLF A;  2QBY B;  4YY3 M;  1N36 M;  2UXB M;  3FTC A;  4G4N A;  4JI2 M;  2W82 A;  3IG5 A;  3AV0 A;  2L7H A;  3JR5 A;  2BNK A;  4JYA M;  2ZAN A;  1HT2 E;  4RF1 A;  4D80 A;  2OPF A;  4TUW A;  3CF6 E;  2LH0 A;  1N75 A;  1N77 A;  1FNN A;  4DR2 M;  3ZCB B;  1KSF X;  4A3V B;  3GRY A;  2UXD M;  2R45 A;  3J81 S;  5C1B A;  2CE7 A;  3GLF B;  2QBY A;  3LVV A;  3TL4 X;  1QYR A;  2VQF M;  2G8L A;  3HU2 A;  3AOE A;  1NY5 A;  4DV2 M;  3JR4 A;  3AL0 C;  2ZM6 M;  4AKH A;  2P5T A;  2CHV A;  3J7A S;  1R6B X;  5EQT A;  4CGY B;  4JI7 M;  5KQ8 A;  4KOD A;  1NVM A;  3FTD A;  2RKO A;  2QEN A;  4ZPX A;  1MX0 A;  1NNJ A;  1Q39 A;  3CF2 A;  1D2N A;  2Q2E B;  1I94 M;  1NHG C;  4LZJ A;  2FFJ A;  2RGH A;  2E5L M;  3FUX A;  3M7G A;  1DO2 A;  1JQJ C;  3SC3 A;  3GPX A;  2M5Z A;  3FKE A;  2G5G X;  2BJW A;  5F3W A;  3KXE C;  4G6Z A;  5DNY A;  3QWL A;  2XSZ D;  1IXR C;  5FTM A;  4DR7 M;  4AZF A;  2I7N A;  5EXT A;  3KS8 A;  3FUT A;  3T1Y M;  1W5S A;  4DR1 M;  1NSF A;  3U6M A;  2YR0 A;  2ERC A;  3GRR A;  4OVZ B;  4X64 M;  1PM5 A;  4FCW A;  1GKI A;  2XF3 A;  3Q8X A;  3K92 A;  3NBI A;  2X4A A;  4LJ7 A;  2DXI A;  3VK8 A;  1DGH B;  4GKK M;  3SAV A;  3ZH9 B;  3K1J A;  1E9S A;  3QAU A;  3SMP A;  2UXC M;  5EP4 A;  3KVW A;  1L1Z A;  2Z3X A;  3FUW A;  4IBC A;  4WUR A;  2Y0Q A;  4DUZ M;  4PDG A;  1W5T A;  3JAM S;  3KS4 A;  2HCB A;  2D7H A;  3FUV A;  1IXZ A;  2BJV A;  3DFZ A;  1HQC A;  4OVZ A;  2DVW B;  1C1K A;  3SAS A;  1G4A E;  2R46 A;  4FW9 A;  4LY6 A;  1XNQ M;  2NQ8 C;  4R7G A;  3CF0 A;  4B3S M;  4AI6 A;  1QAQ A;  1E94 E;  3GLI B;  3TWM A;  2YQZ A;  3GPP A;  1IQP A;  1WXQ A;  3HU3 A;  4BB9 A;  1IN4 A;  5FTJ A;  4LFC M;  2Y21 A;  1JR3 D;  2KW0 A;  4L4U A;  5FTN A;  2CV0 A;  3AKZ A;  3RE8 A;  2KZS A;  4MGI E;  3C58 A;  1K3W A;  3SAR A;  4IBE A;  3J2P B;  4I4L A;  3PVS A;  3L28 A;  2V1U A;  4QHT A;  3J80 S;  3U6E A;  4PT5 A;  3LMM A;  3U60 B;  1GVN A;  4M9S A;  4LFA M;  1NJG A;  3HJS A;  1G3I A;  3RGP A;  5KPR A;  5FTK A;  1HR0 M;  1QVR A;  3LVW A;  2J7O A;  3TE6 A;  4OX9 M;  4IJF A;  4L16 A;  1I4W A;  1TDH A;  4DR5 M;  4K0K M;  2CHQ A;  3AJI B;  5EP3 A;  5A2Q S;  2EA0 A;  1DGB A;  2X49 A;  4G4Q A;  3KOW E;  1ZAE A;  1L1T A;  3U5Z B;  3DOA A;  3GP1 A;  2F4V M;  4LRS A;  3U60 A;  5EXS A;  3SAW A;  2XGN A;  1IXS B;  4JI0 M;  4NXM M;  4Z8X A;  2CFO A;  3UK6 A;  4NL4 H;  5JI2 E;  2XFT A;  4DV3 M;  1EE8 A;  1TH3 A;  2ZAM A;  4KLN A;  4M9Z A;  3THG A;  2Y0T A;  1IBL M;  4X66 M;  3WHK A;  2FE8 A;  3GO8 A;  5C18 A;  2QPA A;  4LFB M;  4BBA A;  4BLC A;  4DR3 M;  4XBO A;  4LGY A;  1DO0 A;  3RFW A;  4W5W A;  4GC5 A;  4NOO B;  4LJA A;  4LJ8 A;  3PXG A;  5ITY A;  4QOS A;  3FTF A;  1IN5 A;  4HL4 A;  4NXN M;  3SAT A;  4M9X A;  2XEP A;  1X37 A;  5ITT A;  4NRW A;  4RNA A;  1L2B A;  5FSW A;  4GC9 A;  1HT1 E;  4I5S A;  4OW0 A;  3SHF A;  2R4E A;  3KOZ E;  3H4M A;  4KO8 A;  3L29 A;  4FD2 A;  3VDU A;  5IWA M;  2F5S A;  2LXE A;  3HU1 A;  4B08 A;  1IN7 A;  2CV1 A;  3AOG A;  1YSY A;  5GKN A;  7CAT A;  1N78 A;  2A5Y B;  2AHM A;  3VLF B;  4L8R C;  1E32 A;  2K47 A;  4DUY M;  5FTL A;  4CHT B;  2KRU A;  3AFH A;  4REZ A;  4LJ9 A;  5BPV A;  3NWL A;  3SYK A;  1OJL A;  4XGI A;  2F5O A;  1K3X A;  3U6S A;  2UU9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...