3MHVC

Crystal structure of vps4 and vta1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
102
Chain Sequence
GSPDLAARTTMFEINVGDTPCVLTKEDYRTLGAMTEGYSGSDIAVVVKDALMQPIRKIQSATHFKDVSETRKLTPCSPGDDGAIEMSPDLTIKDFLKAIKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural role of the Vps4-Vta1 interface in ESCRT-III recycling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein 4
total genus 29
structure length 102
sequence length 117
ec nomenclature
pdb deposition date 2010-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3mhvC00
2KRKA 1L8QA 1JR3A 2ZANA 4FCWA 4L16A 5EXXA 4D82A 3AJIB 3KW6A 2ZAOA 4LY6A 1OFHA 3DZDA 3CF0A 2HCBA 1C1KA 3D8BA 3EIHA 2DVWB 2R65A 1J7KA 3VLFB 4FW9A 4GITA 1X37A 1QVRA 4EIWA 1HT2E 4LJAA 1XXHA 3GLIA 4FD2A 4JN6A 4D80A 1HQCA 4LZZA 4LCBA 3WHKA 4LJ8A 3BOSA 1KSFX 2CHVA 2FNAA 1NJFA 4QHTA 5JI2E 1NVMA 4LJ9A 4I81A 1IXRC 1DO2A 2C9CA 1NSFA 3K1JA 4ZPXA 1QZMA 4FCTA 2DZOB 2QP9X 3GLGA 3U5ZB 3SYLA 1G4AE 2C9OA 5EP3A 2ZAMA 1E94E 1IN5A 1LV7A 1NY5A 2QENA 1IY1A 1NY6A 2CHGA 4LJ5A 1IQPA 1NJGA 1UM8A 2RKOA 4WW0A 3HU3A 1SXJA 5EP2A 5FTLA 5EXTA 3GLFB 4Z8XA 2BJWA 1IM2A 2XSZD 3PFIA 1E32A 1HT1E 2DWZB 3B9PA 3PVSA 1S3SA 1IXZA 3U60B 3EIEA 2VIIA 2C98A 3M0EA 3MHVC 1R7RA 1R6BX 3H4MA 3PXGA 4LJ7A 1IN7A 3SYKA 5EXSA 2V1UA 3GLHA 4LRTA 3GLGB 2CE7A 5EQTA 4FWDA 4LJ6A 3HU1A 1SXJD 4LGMA 5EXPA 1IXSB 2DHRA 2QZ4A 4QHSA 3GLFA 2XSZA 3U61B 3WHLA 5EP4A 1G41A 5JI3E 1KYIA 2CEAA 3CF2A 1W5TA 5DYGA 4L4UA 2V6ZM 3GLHB 1JQJC 1IY0A 1G3IA 5DYIA 1OJLA 3ZH9B 1XXHB 2DZNB 3M6AA 5FTJA 2QPAA 1OFIA 4KODA 2BJVA 4I4LA 3UK6A 4FWHA 3KDSE 4QOSA 3VFDA 2Z4SA 4A3VB 3R8FA 1JR3D 2Z4RA 4QNRA 1DO0A 1FNNA 3HWSA 2X8AA 1IN6A 4KLNA 4L15A 4FWGA 1SXJB 3SC3A 5FTNA 4LJ4A 4LRSA 1D2NA 3HU2A 4KO8A 1SXJE 5C1BA 5FTMA 5EP1A 1XWIA 2CHQA 5C18A 4QNMA 5FTKA 4D81A 2QBYA 3GLIB 1IN4A 1HQYE 1W5SA 4FCVA 2QBYB 2R62A 2C99A 2C96A 1IY2A 1IN8A 1SXJC
chains in the Genus database with same CATH superfamily
3SMPA 1JR3A 1NV8A 4L16A 3T1HM 1VG5A 3GLHE 3AJIB 1L2BA 3KOXE 4IBFA 4AKIA 3KS4A 1NO1A 5ITQA 2HCBA 2QNJA 2FS1A 1N78A 4AQYM 2C5RA 1JR3E 1E9SA 3HX3A 4B3MM 2RRUA 1HT2E 4LJAA 4M9ZA 2BNKA 2L2DA 5GKNA 3GP1A 3SMSA 2UUBM 2LVOC 5L8RF 1EE8A 2KHHA 2VF7A 2R4JA 2MROB 4YHHM 1ORYB 3BOSA 3T38A 2LVNC 1DGGA 4PDGA 1PJIA 3GRVA 1L1TA 2F4VM 2FNAA 3RGPA 3SHGB 2XH9A 4OVZB 2K6BA 2ZM6M 5IWAM 3L26A 4HEOA 3BBZA 3AV0A 3U5ZB 3D8LA 2DHYA 3SYLA 2C9OA 4GIPA 4IBJA 2DWLA 4QOZC 1IN5A 1LV7A 1NY5A 1QYRA 1Z5CA 2QENA 1IY1A 1NY6A 4CHTB 4LJ5A 3T15A 1JB0F 1NJGA 4JI6M 2L7IA 5IREB 2XF3A 5KQDA 3HU3A 3W67A 2JP7A 2EA0A 5EXTA 3KVWA 2Z3XA 4JI8M 4Z8XA 4MGZE 4R7GA 1IM2A 2XSZD 3IG5A 3PFIA 2YR0A 2Y21A 3CGWA 1WHCA 3LCVB 3PVSA 4X64M 4G4RA 2X4AA 3M7GA 2RGHA 3FE3A 2VIIA 2P5TA 3HJ8A 3UZUA 3SAVA 1ZV1A 2F5SA 3H4MA 4CIZA 3UJNA 1GLNA 1QANA 3SAUA 2L6OA 4B7HA 4NRWA 3JR4A 5EXSA 4L6V6 3T1YM 3U6EA 3U6CA 2HHHM 3K9OA 2ZTCA 3CF6E 2QCUA 2CE7A 5EQTA 1GJTA 3KSXA 2XFTA 1RU3A 2KEBA 5EXPA 4DV7M 3L25A 1IXSB 4GRIA 1IXSA 3GLFA 2XSZA 4R3DA 3B7NA 3B89A 3L28A 5EP4A 4B7GA 4PCZA 5ITTA 1OQYA 2N35A 1G41A 5KQ8A 5ITRA 2KXEA 2LBCA 4IBIA 1L2CA 2DXIA 3CF2A 3L2AA 4F2LA 1I4WA 5F3WA 3KOYE 4PD2A 3LVVA 3GO8A 3VDPA 5ITYA 4XK8F 3ZH9B 1YE9A 1Z5BA 4KODA 3GLGE 3FUTA 5ITXA 3UK6A 4AG5A 1T3TA 2D7HA 3KDSE 4I5SA 2Z4SA 2WSCF 3VFDA 4A3VB 3SARA 4QNRA 1DO0A 1PJTA 4IBCA 2FFJA 4GHLA 4KLNA 4L15A 4FWGA 4JI3M 1FJGM 2KA6B 4I8OA 3FUVA 4LF7M 1NV9A 3UMMA 2QHOB 3R9XB 2Z8YM 1NHWC 2KDLA 2YQZA 1QDTA 2O01F 3SHFA 3LMMA 1XWIA 4GMQA 1D0KA 2FH0A 4LFAM 2DAKA 4D81A 2R45A 3W68A 1IN4A 1W5SA 4AZFA 5LMNM 3HGIA 2ZBKB 2JY6B 4DR6M 4AW4A 4QHSA 3QYEA 4OU7A 1L8QA 1N77A 5EXXA 3AL0C 3K8ZA 1Z5AA 1D0LA 4NXNM 1VDLA 2OO9A 5EJCA 1XXHE 4X66M 1AIPC 3I4VA 1J7KA 4JI4M 3SBJA 4NSOB 4F1IA 1X37A 1Q39A 1N36M 1BVSA 4RNAA 2UXDM 3GLIA 2UXBM 4FD2A 1Z59A 4LF8M 2F5PA 3FTDA 3UGJA 3J81S 2F5QA 3A42A 3WHKA 1XMQM 1KSFX 5FLXS 4DV0M 4NOOB 1QUSA 4QHTA 4B7FA 1KFVA 3PNVA 3HJSA 3GQ5A 3TQSA 4LJ9A 4DR2M 3H4JA 4GC9A 3AOEC 1IXRC 2C9CA 2H5XA 4AKGA 4PDIA 4ITQA 1G71A 3ZQJA 2ZTDA 4ZPXA 3L27A 1TF0B 3GRYA 4JI5M 5IT9S 2QP9X 2KRUA 4MM3B 1K3WA 2F5OA 4B3RM 1TH3A 1TDZA 3FRIA 4W5WA 2XLJA 2WSFF 2CHGA 1IQPA 4GKKM 1PM5A 2KZSA 3TWLA 2RKOA 2L4FA 4RKUF 2EKFA 5FTLA 5EP2A 2LVQD 3LW5F 4ANRA 3HHXA 3QWLA 3MMPA 2BJWA 2VF8A 1HNZM 1HNWM 1VEJA 4NRVA 3B9PA 1XC8A 4LF5M 1IXZA 1WGLA 4GC5A 3EIEA 2CV0A 3ILKA 4JI2M 1HNXM 3AKZA 3MK6A 1PJJA 2MR9A 3SYKA 5H37D 1TGUA 2DAGA 2K47A 2V1UA 2VQFM 1ZAEA 4LRTA 4JV5M 3U5ZA 2CP8A 2DNAA 1CUKA 3U6PA 3J7BA 1Z6TA 3U60A 2VQEM 3DOAA 4CGYB 3GRUA 4KHPM 3GQ4A 1C7YA 2LVPC 2Y0TA 4OVZA 2DHRA 1N34M 3U61A 3W0LB 1VEKA 2V1CA 2QQ8A 4NC6A 4DUZM 1OIPA 1YLAA 4B3TM 5JI3E 1KYIA 2JY7A 1DGFA 1DGHB 2Q2EB 3AOEA 1NNUC 3F92A 3HY5A 3I4YA 2LWXA 4IBKA 4L4UA 2V6ZM 1PRBA 2DWNA 3JAMS 4G4QA 2L7HA 1IY0A 1G3IA 4MGIE 5KPRA 3FYDA 1V33A 2CUZA 2D7EA 3DA1A 1T6OA 3THGA 1QDRA 2LXEA 3OTOM 3K92A 2QPAA 5BPVA 3B74A 3TWMA 1WGNA 3FRHA 3U6LA 1TH2A 1V92A 3HHWA 4FWHA 4IJEA 1IBMM 4KT0F 3R8FA 4HL4A 3ZC7B 3KP1E 4DR3M 1Q02A 3HWSA 3U6SA 1QQWA 1IN6A 1YSYA 5FTNA 2MGWA 3VK8A 4LJ4A 3TE6A 4KO8A 1MX0A 2BWBA 5C1BA 5FTMA 4AI6A 4JYAM 5EP1A 5LMUM 1DV0A 2D7GA 5C18A 4QNMA 4IBGA 5FTKA 3GPXA 3AOGA 4DV6M 2QBYA 4FCVA 2Y20A 5A2QS 3E46A 3FD9A 1GL6A 4LF6M 1IY2A 3K2LA 1GL7A 4NL4H 3U6QA 1N33M 1QAMA 2KRKA 2ZANA 4DV1M 3GRRA 4D82A 1QAOA 3C3DA 2ZAOA 3KW6A 4LY6A 1OFHA 3DZDA 3D8BA 3EIHA 3LQQA 3VLFB 4GITA 1WJ7A 4CJ6A 2CV2A 3C9PA 2LTUA 4K0KM 2Z7JA 4EIWA 4II7A 1XXHA 4D80A 2CV1A 2G5GX 4NXMM 3KXEC 3SASA 2FOIC 2H1RA 2JY5A 2QSFX 1EIJA 3RFWA 7CATA 4JI1M 1N75A 1QZEA 4G6ZA 4MH0E 1UFZA 2YNMD 4BLCA 3GLIE 1Q3BA 3TWKA 1XNRM 2BWEA 3FTEA 2R4EA 5JI2E 1SG9A 2DAIA 1TH4A 1L1ZA 1NVMA 4XBOA 4R71A 4B3SM 1OTRA 1DO2A 2XFSA 3I04M 2JA2A 3JR5A 3CTWB 4OX9M 2R6FA 3GQ3A 2L09A 2JZ1A 1G4AE 2LNHC 3FYCA 4IJFA 3L29A 4M9XA 5EP3A 1AUAA 1E94E 3J80S 2DWMA 2LHGA 5E26A 3RE8A 3VKHA 4WP2A 1UM8A 2YFQA 1DGHA 4LGYA 2GNOA 4Y28F 3A46A 3BXWA 2W82A 2KNVA 4LF9M 3GPPA 1SXJA 5DNYA 2FE8A 5BR8M 2J7NA 1K82A 1E32A 1MN3A 2DWZB 1MU5A 4DR1M 3U60B 4DBGB 2I7NA 2HL7A 1TR8A 3E9SA 4IIWA 2C98A 3M0EA 3C58A 1R7RA 2HAKA 3PNYA 4LJ7A 3LVWA 1GABA 2J5YA 3ZCBB 2CFOA 3GLHA 3KSJA 1Q3CA 3GLGB 1GO5A 1ZMUA 4L8RC 2R44A 1P3QQ 3HHYA 2UU9M 4FWDA 4LJ6A 2E5LM 2O5RA 3VDUA 1SXJD 3AFHA 4MGYE 4REZA 4LGMA 4AKHA 1YUBA 2DENA 1OAIA 1GVNA 3E4RA 1IFYA 4RF1A 1PJQA 2DI0A 4DR5M 4LF4M 4FVMA 1F4IA 3U6DA 2CEAA 1H6UA 1W5TA 2JNHA 5ITXE 2MH8A 4P17A 3GLHB 4G4NA 3GLFE 3T6PA 4GHAA 4Q7JA 3B7QA 3J27B 5DFLA 3V76A 2WSEF 3M6AA 5FTJA 3NBIA 4P16A 4Z6YA 2OPFA 2UXCM 3FUXA 1EFUB 4LG2A 4QOSA 1LTMA 2K9DA 2R46A 1A5TA 2X8AA 3LQRA 3Q8XA 8CATA 2OQ4A 1PJSA 1SXJB 3FKEA 3SAWA 4DV2M 4LRSA 3DFZA 4DUYM 3HKPA 4MGHA 1TDHA 1I94M 2F5NA 1ZQ9A 2CHQA 2K0BX 2J7OA 4LZJA 2Y0QA 3GLIB 1HQYE 2G3QA 5ITUA 2EO2A 2R62A 2C99A 2M5ZA 4NSRA 1N32M 4JXJA 2C96A 1WR1B 2CRUA 4UN2B 3J2PB 1IN8A 1SXJC 4X62M 4FCWA 1OKSA 1R4GA 2R18A 4DV5M 3U6OA 1G59A 4G4OA 1OAOC 3HHZA 2EJSA 3CF0A 3FTCA 1C1KA 3B7ZA 2DVWB 2KZUA 2R65A 2KNZA 4RF0A 4FW9A 2NQ8C 1HJPA 2LHCA 2WZJA 2M60A 3IG8A 2LVAA 2MJ5B 2OOBA 1QVRA 4JN6A 1NNJA 4L78A 1HQCA 3NWLA 1HR0M 2R0IA 4LZZA 2UUAM 3I01M 4LCBA 4M0DA 4XGIA 3VKGA 4LJ8A 4WURA 4DV4M 3Q8GA 3TL4X 1XMOM 2CHVA 2XZUA 1NJFA 1NHGC 5KPZA 1G8PA 1E9RA 3C3EA 4MGKE 2EUCA 1VEGA 4I81A 1NSFA 4CISA 2B3TA 3K1JA 2XGNA 2JWSA 1QZMA 4S12A 4FCTA 2DZOB 2G8LA 1V34A 3GLGA 4DR7M 2HWJA 2ZAMA 2AHMA 5FSWA 1R2ZA 1ZMVA 2APLA 3W0FA 4LFBM 1TTEA 2VDBB 3A45A 4WW0A 3GPYA 2DZLA 3GLFB 3SATA 3HZJA 2ERCA 1HT1E 4BB9A 4HLQA 1S3SA 2JXNA 2L4EA 4M9SA 3QAUA 5KO3A 3RGSA 3MHVC 3J7AS 1R6BX 3PXGA 2DAEA 1J09A 3HJQA 4MB7A 4G3OA 1IN7A 2X49A 1T43A 1QUTA 3SFZA 2KNAA 3QYBA 5E6JA 3FUUA 3NBXX 4IBDA 2O25A 2OOAA 3U6MA 2LH0A 3HU1A 4X65M 1R2YA 3FUWA 5IZ7D 2QZ4A 1XB2B 3U61B 3LCUA 2JY8A 4IBEA 2I7PA 2HKJA 3WHLA 3IECA 2CWBA 1MJGM 3KP0E 1WXQA 2UUCM 3KS8A 4DV3M 1GKIA 2KW0A 3KOWE 5DYGA 2EKKA 1IBKM 3VK7A 1JQJC 1R5LA 5DYIA 3MJ5A 1IBLM 1OJLA 4GKJM 2GQFA 1PGYA 1XXHB 1ZMWA 1GJSA 2DZNB 4M0WA 3FTFA 1D0MA 3E21A 3GPUA 1XNQM 1OFIA 1K3XA 4LFCM 1OIZA 1Y8GA 2BJVA 4I4LA 3TPZA 2DKLA 4TUWA 4OW0A 3I51A 4AG6A 1JR3D 2Z4RA 4BBAA 4JI7M 1FNNA 1L2DA 2XEPA 3KFUG 4IBBA 3SC3A 2XZFA 1D2NA 1VQ1A 3HU2A 1SXJE 4YY3M 2RGOA 3K9PA 1J5EM 2DAMA 5KPTA 1VDDA 4B08A 4PT5A 3IHPA 4DR4M 3KOZE 1XHBA 2QBYB 1DGBA 1WIVA 4GEWA 3A98B 2JUJA 1QAQA 4JI0M 4GH9A 2A5YB 2JZ0A
chains in the Genus database with same CATH topology
3SMPA 1JR3A 4L16A 3T1HM 3AJIB 1L2BA 3KOXE 4IBFA 4AKIA 3KS4A 5ITQA 2HCBA 1N78A 4AQYM 2C5RA 1E9SA 4B3MM 1HT2E 4LJAA 4M9ZA 2BNKA 5GKNA 3GP1A 3SMSA 2UUBM 1EE8A 2R4JA 4YHHM 1PJIA 1ORYB 3BOSA 4PDGA 1L1TA 1DGGA 3GRVA 2F4VM 2FNAA 3RGPA 3SHGB 2XH9A 4OVZB 2ZM6M 5IWAM 3L26A 3AV0A 3U5ZB 3D8LA 3SYLA 2C9OA 4GIPA 4IBJA 2DWLA 4QOZC 1IN5A 1LV7A 1NY5A 1QYRA 1Z5CA 2QENA 1IY1A 1NY6A 4CHTB 4LJ5A 3T15A 1NJGA 4JI6M 2L7IA 5IREB 2XF3A 5KQDA 3HU3A 2EA0A 5EXTA 3KVWA 2Z3XA 4JI8M 4Z8XA 4MGZE 4R7GA 1IM2A 2XSZD 3IG5A 3PFIA 2YR0A 2Y21A 3PVSA 4X64M 4G4RA 2X4AA 3M7GA 2RGHA 3HJ8A 2VIIA 2P5TA 3UZUA 3SAVA 2F5SA 3H4MA 3UJNA 1GLNA 1QANA 3SAUA 2L6OA 4B7HA 4NRWA 3JR4A 5EXSA 3U6EA 3U6CA 2HHHM 3CF6E 2QCUA 2CE7A 5EQTA 3KSXA 2XFTA 2KEBA 5EXPA 4DV7M 3L25A 1IXSB 4GRIA 3GLFA 2XSZA 4R3DA 4B7GA 3L28A 5EP4A 4PCZA 5ITTA 5ITRA 5KQ8A 2DXIA 1G41A 2KXEA 4IBIA 1L2CA 3CF2A 3L2AA 5F3WA 1I4WA 3KOYE 4PD2A 3LVVA 3GO8A 3VDPA 5ITYA 3ZH9B 1YE9A 1Z5BA 4KODA 3FUTA 5ITXA 3UK6A 4AG5A 1T3TA 2D7HA 3KDSE 4I5SA 2Z4SA 3VFDA 4A3VB 3SARA 4QNRA 1DO0A 4IBCA 2FFJA 4GHLA 4KLNA 4L15A 4FWGA 4JI3M 1FJGM 2KA6B 4I8OA 3FUVA 4LF7M 3UMMA 3R9XB 1NHWC 2YQZA 3SHFA 3LMMA 1XWIA 4GMQA 4LFAM 4D81A 2R45A 1IN4A 1W5SA 4AZFA 5LMNM 3HGIA 2ZBKB 4DR6M 4AW4A 4QHSA 4OU7A 1L8QA 1N77A 5EXXA 3AL0C 3K8ZA 1Z5AA 4NXNM 5EJCA 4X66M 3I4VA 1J7KA 4JI4M 3SBJA 4NSOB 1X37A 1Q39A 1N36M 4RNAA 2UXDM 3GLIA 2UXBM 4FD2A 1Z59A 4LF8M 2F5PA 3FTDA 3UGJA 3J81S 2F5QA 3A42A 3WHKA 1XMQM 1KSFX 5FLXS 4DV0M 4NOOB 4B7FA 4QHTA 1KFVA 3PNVA 3HJSA 3GQ5A 3TQSA 4LJ9A 4DR2M 4GC9A 3AOEC 1IXRC 2C9CA 4AKGA 4PDIA 4ITQA 4ZPXA 3L27A 4JI5M 3GRYA 5IT9S 2QP9X 2KRUA 4MM3B 1K3WA 2F5OA 4B3RM 1TH3A 1TDZA 4W5WA 2XLJA 2CHGA 1IQPA 4GKKM 1PM5A 2KZSA 3TWLA 2RKOA 5FTLA 5EP2A 3HHXA 3QWLA 2BJWA 1HNZM 1HNWM 4NRVA 3B9PA 1XC8A 4LF5M 1IXZA 4GC5A 3EIEA 2CV0A 3ILKA 4JI2M 1HNXM 3AKZA 3MK6A 1PJJA 3SYKA 5H37D 1TGUA 2K47A 2V1UA 2VQFM 1ZAEA 4LRTA 4JV5M 3U5ZA 3U60A 3U6PA 3J7BA 1Z6TA 2VQEM 3DOAA 4CGYB 3GRUA 4KHPM 3GQ4A 2Y0TA 4OVZA 2DHRA 1N34M 3U61A 3W0LB 2V1CA 4DUZM 4B3TM 5JI3E 1KYIA 1DGFA 1DGHB 2Q2EB 3AOEA 1NNUC 4IBKA 3I4YA 2LWXA 4L4UA 2V6ZM 2DWNA 3JAMS 4G4QA 2L7HA 1IY0A 1G3IA 4MGIE 5KPRA 3FYDA 2CUZA 2D7EA 3DA1A 3THGA 2LXEA 3OTOM 3K92A 2QPAA 5BPVA 3TWMA 3U6LA 1TH2A 4FWHA 3HHWA 4IJEA 1IBMM 3R8FA 4HL4A 3ZC7B 3KP1E 4DR3M 3HWSA 3U6SA 1QQWA 1IN6A 1YSYA 5FTNA 3VK8A 4LJ4A 3TE6A 4KO8A 1MX0A 5C1BA 5FTMA 4AI6A 4JYAM 5EP1A 5LMUM 2D7GA 5C18A 4QNMA 4IBGA 5FTKA 3GPXA 3AOGA 4DV6M 2QBYA 4FCVA 2Y20A 5A2QS 3FD9A 1GL6A 4LF6M 1IY2A 3K2LA 1GL7A 4NL4H 3U6QA 1N33M 1QAMA 2KRKA 2ZANA 4DV1M 3GRRA 4D82A 1QAOA 3KW6A 2ZAOA 4LY6A 1OFHA 3DZDA 3D8BA 3EIHA 3LQQA 3VLFB 4GITA 2CV2A 4K0KM 2Z7JA 4EIWA 4II7A 1XXHA 4D80A 2CV1A 2G5GX 4NXMM 3KXEC 3SASA 2FOIC 2H1RA 3RFWA 7CATA 4JI1M 1N75A 4G6ZA 4MH0E 2YNMD 1XNRM 4BLCA 1Q3BA 3TWKA 3FTEA 2R4EA 5JI2E 1TH4A 1L1ZA 1NVMA 4XBOA 4B3SM 2XFSA 1DO2A 2JA2A 3JR5A 3CTWB 4OX9M 3GQ3A 2L09A 3T38A 1G4AE 2LNHC 3FYCA 4IJFA 3L29A 4M9XA 5EP3A 1E94E 3J80S 2DWMA 5E26A 3RE8A 3VKHA 1UM8A 2YFQA 1DGHA 4LGYA 3A46A 2W82A 4LF9M 3GPPA 1SXJA 5DNYA 2FE8A 5BR8M 2J7NA 1K82A 1E32A 2DWZB 1MU5A 4DR1M 3U60B 2I7NA 2HL7A 3E9SA 4IIWA 3T1YM 2C98A 3M0EA 3C58A 1R7RA 3PNYA 4LJ7A 3LVWA 3ZCBB 2CFOA 3GLHA 3KSJA 1Q3CA 3GLGB 4L8RC 3HHYA 2UU9M 4FWDA 4LJ6A 2E5LM 2O5RA 3VDUA 1SXJD 3AFHA 4MGYE 4REZA 4LGMA 4AKHA 1YUBA 1GVNA 3E4RA 4RF1A 4DR5M 4LF4M 4FVMA 3U6DA 2CEAA 1H6UA 1W5TA 5ITXE 3GLHB 4G4NA 4GHAA 3J27B 3M6AA 5FTJA 3NBIA 4P16A 4Z6YA 2OPFA 2UXCM 3FUXA 4LG2A 4QOSA 2R46A 3LQRA 2X8AA 3Q8XA 8CATA 2OQ4A 1SXJB 3FKEA 3SAWA 4DV2M 4LRSA 3DFZA 4DUYM 3HKPA 4MGHA 1TDHA 1I94M 2F5NA 1ZQ9A 2CHQA 2J7OA 4LZJA 2Y0QA 3GLIB 1HQYE 5ITUA 2EO2A 2R62A 2C99A 2M5ZA 4NSRA 1N32M 4JXJA 2C96A 3J2PB 1IN8A 1SXJC 4X62M 4FCWA 2R18A 4DV5M 3U6OA 1G59A 4G4OA 3HHZA 3CF0A 3FTCA 1C1KA 2DVWB 2KZUA 2R65A 4RF0A 4FW9A 2NQ8C 2M60A 3IG8A 1QVRA 4JN6A 1NNJA 4L78A 1HQCA 3NWLA 1HR0M 4LZZA 2UUAM 4LCBA 4M0DA 4XGIA 3VKGA 4LJ8A 4WURA 4DV4M 3TL4X 1XMOM 2CHVA 2XZUA 1NJFA 1NHGC 5KPZA 1G8PA 1E9RA 4MGKE 2EUCA 4I81A 1NSFA 4CISA 3K1JA 2XGNA 1QZMA 4S12A 4FCTA 2DZOB 2G8LA 3GLGA 4DR7M 2ZAMA 2AHMA 5FSWA 1R2ZA 3W0FA 4LFBM 3A45A 4WW0A 3GPYA 3GLFB 3SATA 2ERCA 1HT1E 4BB9A 4HLQA 1S3SA 4M9SA 3QAUA 5KO3A 3RGSA 3MHVC 3J7AS 1R6BX 3PXGA 3HJQA 1J09A 4MB7A 1IN7A 2X49A 3SFZA 5E6JA 3FUUA 4IBDA 3U6MA 2LH0A 3HU1A 4X65M 1R2YA 3FUWA 5IZ7D 2QZ4A 3U61B 4IBEA 2I7PA 2HKJA 3WHLA 3KP0E 1WXQA 2UUCM 3KS8A 4DV3M 1GKIA 2KW0A 3KOWE 5DYGA 1IBKM 3VK7A 1JQJC 5DYIA 3MJ5A 1IBLM 1OJLA 4GKJM 1XXHB 2DZNB 4M0WA 3FTFA 3GPUA 1XNQM 1OFIA 1K3XA 4LFCM 2BJVA 4I4LA 3TPZA 4TUWA 4OW0A 3I51A 4AG6A 1JR3D 2Z4RA 4BBAA 4JI7M 1FNNA 1L2DA 2XEPA 3KFUG 4IBBA 3SC3A 2XZFA 1D2NA 3HU2A 1SXJE 4YY3M 2RGOA 1J5EM 5KPTA 1VDDA 4B08A 4PT5A 4DR4M 3KOZE 1XHBA 2QBYB 1DGBA 3A98B 1QAQA 4JI0M 4GH9A 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRK A;  1L8Q A;  1JR3 A;  2ZAN A;  4FCW A;  4L16 A;  5EXX A;  4D82 A;  3AJI B;  3KW6 A;  2ZAO A;  4LY6 A;  1OFH A;  3DZD A;  3CF0 A;  2HCB A;  1C1K A;  3D8B A;  3EIH A;  2DVW B;  2R65 A;  1J7K A;  3VLF B;  4FW9 A;  4GIT A;  1X37 A;  1QVR A;  4EIW A;  1HT2 E;  4LJA A;  1XXH A;  3GLI A;  4FD2 A;  4JN6 A;  4D80 A;  1HQC A;  4LZZ A;  4LCB A;  3WHK A;  4LJ8 A;  3BOS A;  1KSF X;  2CHV A;  2FNA A;  1NJF A;  4QHT A;  5JI2 E;  1NVM A;  4LJ9 A;  4I81 A;  1IXR C;  1DO2 A;  2C9C A;  1NSF A;  3K1J A;  4ZPX A;  1QZM A;  4FCT A;  2DZO B;  2QP9 X;  3GLG A;  3U5Z B;  3SYL A;  1G4A E;  2C9O A;  5EP3 A;  2ZAM A;  1E94 E;  1IN5 A;  1LV7 A;  1NY5 A;  2QEN A;  1IY1 A;  1NY6 A;  2CHG A;  4LJ5 A;  1IQP A;  1NJG A;  1UM8 A;  2RKO A;  4WW0 A;  3HU3 A;  1SXJ A;  5EP2 A;  5FTL A;  5EXT A;  3GLF B;  4Z8X A;  2BJW A;  1IM2 A;  2XSZ D;  3PFI A;  1E32 A;  1HT1 E;  2DWZ B;  3B9P A;  3PVS A;  1S3S A;  1IXZ A;  3U60 B;  3EIE A;  2VII A;  2C98 A;  3M0E A;  3MHV C;  1R7R A;  1R6B X;  3H4M A;  3PXG A;  4LJ7 A;  1IN7 A;  3SYK A;  5EXS A;  2V1U A;  3GLH A;  4LRT A;  3GLG B;  2CE7 A;  5EQT A;  4FWD A;  4LJ6 A;  3HU1 A;  1SXJ D;  4LGM A;  5EXP A;  1IXS B;  2DHR A;  2QZ4 A;  4QHS A;  3GLF A;  2XSZ A;  3U61 B;  3WHL A;  5EP4 A;  1G41 A;  5JI3 E;  1KYI A;  2CEA A;  3CF2 A;  1W5T A;  5DYG A;  4L4U A;  2V6Z M;  3GLH B;  1JQJ C;  1IY0 A;  1G3I A;  5DYI A;  1OJL A;  3ZH9 B;  1XXH B;  2DZN B;  3M6A A;  5FTJ A;  2QPA A;  1OFI A;  4KOD A;  2BJV A;  4I4L A;  3UK6 A;  4FWH A;  3KDS E;  4QOS A;  3VFD A;  2Z4S A;  4A3V B;  3R8F A;  1JR3 D;  2Z4R A;  4QNR A;  1DO0 A;  1FNN A;  3HWS A;  2X8A A;  1IN6 A;  4KLN A;  4L15 A;  4FWG A;  1SXJ B;  3SC3 A;  5FTN A;  4LJ4 A;  4LRS A;  1D2N A;  3HU2 A;  4KO8 A;  1SXJ E;  5C1B A;  5FTM A;  5EP1 A;  1XWI A;  2CHQ A;  5C18 A;  4QNM A;  5FTK A;  4D81 A;  2QBY A;  3GLI B;  1IN4 A;  1HQY E;  1W5S A;  4FCV A;  2QBY B;  2R62 A;  2C99 A;  2C96 A;  1IY2 A;  1IN8 A;  1SXJ C; 
#chains in the Genus database with same CATH topology
 3SMP A;  1JR3 A;  1NV8 A;  4L16 A;  3T1H M;  1VG5 A;  3GLH E;  3AJI B;  1L2B A;  3KOX E;  4IBF A;  4AKI A;  3KS4 A;  1NO1 A;  5ITQ A;  2HCB A;  2QNJ A;  2FS1 A;  1N78 A;  4AQY M;  2C5R A;  1JR3 E;  1E9S A;  3HX3 A;  4B3M M;  2RRU A;  1HT2 E;  4LJA A;  4M9Z A;  2BNK A;  2L2D A;  5GKN A;  3GP1 A;  3SMS A;  2UUB M;  2LVO C;  5L8R F;  1EE8 A;  2KHH A;  2VF7 A;  2R4J A;  2MRO B;  4YHH M;  1ORY B;  3BOS A;  3T38 A;  2LVN C;  1DGG A;  4PDG A;  1PJI A;  3GRV A;  1L1T A;  2F4V M;  2FNA A;  3RGP A;  3SHG B;  2XH9 A;  4OVZ B;  2K6B A;  2ZM6 M;  5IWA M;  3L26 A;  4HEO A;  3BBZ A;  3AV0 A;  3U5Z B;  3D8L A;  2DHY A;  3SYL A;  2C9O A;  4GIP A;  4IBJ A;  2DWL A;  4QOZ C;  1IN5 A;  1LV7 A;  1NY5 A;  1QYR A;  1Z5C A;  2QEN A;  1IY1 A;  1NY6 A;  4CHT B;  4LJ5 A;  3T15 A;  1JB0 F;  1NJG A;  4JI6 M;  2L7I A;  5IRE B;  2XF3 A;  5KQD A;  3HU3 A;  3W67 A;  2JP7 A;  2EA0 A;  5EXT A;  3KVW A;  2Z3X A;  4JI8 M;  4Z8X A;  4MGZ E;  4R7G A;  1IM2 A;  2XSZ D;  3IG5 A;  3PFI A;  2YR0 A;  2Y21 A;  3CGW A;  1WHC A;  3LCV B;  3PVS A;  4X64 M;  4G4R A;  2X4A A;  3M7G A;  2RGH A;  3FE3 A;  2VII A;  2P5T A;  3HJ8 A;  3UZU A;  3SAV A;  1ZV1 A;  2F5S A;  3H4M A;  4CIZ A;  3UJN A;  1GLN A;  1QAN A;  3SAU A;  2L6O A;  4B7H A;  4NRW A;  3JR4 A;  5EXS A;  4L6V 6;  3T1Y M;  3U6E A;  3U6C A;  2HHH M;  3K9O A;  2ZTC A;  3CF6 E;  2QCU A;  2CE7 A;  5EQT A;  1GJT A;  3KSX A;  2XFT A;  1RU3 A;  2KEB A;  5EXP A;  4DV7 M;  3L25 A;  1IXS B;  4GRI A;  1IXS A;  3GLF A;  2XSZ A;  4R3D A;  3B7N A;  3B89 A;  3L28 A;  5EP4 A;  4B7G A;  4PCZ A;  5ITT A;  1OQY A;  2N35 A;  1G41 A;  5KQ8 A;  5ITR A;  2KXE A;  2LBC A;  4IBI A;  1L2C A;  2DXI A;  3CF2 A;  3L2A A;  4F2L A;  1I4W A;  5F3W A;  3KOY E;  4PD2 A;  3LVV A;  3GO8 A;  3VDP A;  5ITY A;  4XK8 F;  3ZH9 B;  1YE9 A;  1Z5B A;  4KOD A;  3GLG E;  3FUT A;  5ITX A;  3UK6 A;  4AG5 A;  1T3T A;  2D7H A;  3KDS E;  4I5S A;  2Z4S A;  2WSC F;  3VFD A;  4A3V B;  3SAR A;  4QNR A;  1DO0 A;  1PJT A;  4IBC A;  2FFJ A;  4GHL A;  4KLN A;  4L15 A;  4FWG A;  4JI3 M;  1FJG M;  2KA6 B;  4I8O A;  3FUV A;  4LF7 M;  1NV9 A;  3UMM A;  2QHO B;  3R9X B;  2Z8Y M;  1NHW C;  2KDL A;  2YQZ A;  1QDT A;  2O01 F;  3SHF A;  3LMM A;  1XWI A;  4GMQ A;  1D0K A;  2FH0 A;  4LFA M;  2DAK A;  4D81 A;  2R45 A;  3W68 A;  1IN4 A;  1W5S A;  4AZF A;  5LMN M;  3HGI A;  2ZBK B;  2JY6 B;  4DR6 M;  4AW4 A;  4QHS A;  3QYE A;  4OU7 A;  1L8Q A;  1N77 A;  5EXX A;  3AL0 C;  3K8Z A;  1Z5A A;  1D0L A;  4NXN M;  1VDL A;  2OO9 A;  5EJC A;  1XXH E;  4X66 M;  1AIP C;  3I4V A;  1J7K A;  4JI4 M;  3SBJ A;  4NSO B;  4F1I A;  1X37 A;  1Q39 A;  1N36 M;  1BVS A;  4RNA A;  2UXD M;  3GLI A;  2UXB M;  4FD2 A;  1Z59 A;  4LF8 M;  2F5P A;  3FTD A;  3UGJ A;  3J81 S;  2F5Q A;  3A42 A;  3WHK A;  1XMQ M;  1KSF X;  5FLX S;  4DV0 M;  4NOO B;  1QUS A;  4QHT A;  4B7F A;  1KFV A;  3PNV A;  3HJS A;  3GQ5 A;  3TQS A;  4LJ9 A;  4DR2 M;  3H4J A;  4GC9 A;  3AOE C;  1IXR C;  2C9C A;  2H5X A;  4AKG A;  4PDI A;  4ITQ A;  1G71 A;  3ZQJ A;  2ZTD A;  4ZPX A;  3L27 A;  1TF0 B;  3GRY A;  4JI5 M;  5IT9 S;  2QP9 X;  2KRU A;  4MM3 B;  1K3W A;  2F5O A;  4B3R M;  1TH3 A;  1TDZ A;  3FRI A;  4W5W A;  2XLJ A;  2WSF F;  2CHG A;  1IQP A;  4GKK M;  1PM5 A;  2KZS A;  3TWL A;  2RKO A;  2L4F A;  4RKU F;  2EKF A;  5FTL A;  5EP2 A;  2LVQ D;  3LW5 F;  4ANR A;  3HHX A;  3QWL A;  3MMP A;  2BJW A;  2VF8 A;  1HNZ M;  1HNW M;  1VEJ A;  4NRV A;  3B9P A;  1XC8 A;  4LF5 M;  1IXZ A;  1WGL A;  4GC5 A;  3EIE A;  2CV0 A;  3ILK A;  4JI2 M;  1HNX M;  3AKZ A;  3MK6 A;  1PJJ A;  2MR9 A;  3SYK A;  5H37 D;  1TGU A;  2DAG A;  2K47 A;  2V1U A;  2VQF M;  1ZAE A;  4LRT A;  4JV5 M;  3U5Z A;  2CP8 A;  2DNA A;  1CUK A;  3U6P A;  3J7B A;  1Z6T A;  3U60 A;  2VQE M;  3DOA A;  4CGY B;  3GRU A;  4KHP M;  3GQ4 A;  1C7Y A;  2LVP C;  2Y0T A;  4OVZ A;  2DHR A;  1N34 M;  3U61 A;  3W0L B;  1VEK A;  2V1C A;  2QQ8 A;  4NC6 A;  4DUZ M;  1OIP A;  1YLA A;  4B3T M;  5JI3 E;  1KYI A;  2JY7 A;  1DGF A;  1DGH B;  2Q2E B;  3AOE A;  1NNU C;  3F92 A;  3HY5 A;  3I4Y A;  2LWX A;  4IBK A;  4L4U A;  2V6Z M;  1PRB A;  2DWN A;  3JAM S;  4G4Q A;  2L7H A;  1IY0 A;  1G3I A;  4MGI E;  5KPR A;  3FYD A;  1V33 A;  2CUZ A;  2D7E A;  3DA1 A;  1T6O A;  3THG A;  1QDR A;  2LXE A;  3OTO M;  3K92 A;  2QPA A;  5BPV A;  3B74 A;  3TWM A;  1WGN A;  3FRH A;  3U6L A;  1TH2 A;  1V92 A;  3HHW A;  4FWH A;  4IJE A;  1IBM M;  4KT0 F;  3R8F A;  4HL4 A;  3ZC7 B;  3KP1 E;  4DR3 M;  1Q02 A;  3HWS A;  3U6S A;  1QQW A;  1IN6 A;  1YSY A;  5FTN A;  2MGW A;  3VK8 A;  4LJ4 A;  3TE6 A;  4KO8 A;  1MX0 A;  2BWB A;  5C1B A;  5FTM A;  4AI6 A;  4JYA M;  5EP1 A;  5LMU M;  1DV0 A;  2D7G A;  5C18 A;  4QNM A;  4IBG A;  5FTK A;  3GPX A;  3AOG A;  4DV6 M;  2QBY A;  4FCV A;  2Y20 A;  5A2Q S;  3E46 A;  3FD9 A;  1GL6 A;  4LF6 M;  1IY2 A;  3K2L A;  1GL7 A;  4NL4 H;  3U6Q A;  1N33 M;  1QAM A;  2KRK A;  2ZAN A;  4DV1 M;  3GRR A;  4D82 A;  1QAO A;  3C3D A;  2ZAO A;  3KW6 A;  4LY6 A;  1OFH A;  3DZD A;  3D8B A;  3EIH A;  3LQQ A;  3VLF B;  4GIT A;  1WJ7 A;  4CJ6 A;  2CV2 A;  3C9P A;  2LTU A;  4K0K M;  2Z7J A;  4EIW A;  4II7 A;  1XXH A;  4D80 A;  2CV1 A;  2G5G X;  4NXM M;  3KXE C;  3SAS A;  2FOI C;  2H1R A;  2JY5 A;  2QSF X;  1EIJ A;  3RFW A;  7CAT A;  4JI1 M;  1N75 A;  1QZE A;  4G6Z A;  4MH0 E;  1UFZ A;  2YNM D;  4BLC A;  3GLI E;  1Q3B A;  3TWK A;  1XNR M;  2BWE A;  3FTE A;  2R4E A;  5JI2 E;  1SG9 A;  2DAI A;  1TH4 A;  1L1Z A;  1NVM A;  4XBO A;  4R71 A;  4B3S M;  1OTR A;  1DO2 A;  2XFS A;  3I04 M;  2JA2 A;  3JR5 A;  3CTW B;  4OX9 M;  2R6F A;  3GQ3 A;  2L09 A;  2JZ1 A;  1G4A E;  2LNH C;  3FYC A;  4IJF A;  3L29 A;  4M9X A;  5EP3 A;  1AUA A;  1E94 E;  3J80 S;  2DWM A;  2LHG A;  5E26 A;  3RE8 A;  3VKH A;  4WP2 A;  1UM8 A;  2YFQ A;  1DGH A;  4LGY A;  2GNO A;  4Y28 F;  3A46 A;  3BXW A;  2W82 A;  2KNV A;  4LF9 M;  3GPP A;  1SXJ A;  5DNY A;  2FE8 A;  5BR8 M;  2J7N A;  1K82 A;  1E32 A;  1MN3 A;  2DWZ B;  1MU5 A;  4DR1 M;  3U60 B;  4DBG B;  2I7N A;  2HL7 A;  1TR8 A;  3E9S A;  4IIW A;  2C98 A;  3M0E A;  3C58 A;  1R7R A;  2HAK A;  3PNY A;  4LJ7 A;  3LVW A;  1GAB A;  2J5Y A;  3ZCB B;  2CFO A;  3GLH A;  3KSJ A;  1Q3C A;  3GLG B;  1GO5 A;  1ZMU A;  4L8R C;  2R44 A;  1P3Q Q;  3HHY A;  2UU9 M;  4FWD A;  4LJ6 A;  2E5L M;  2O5R A;  3VDU A;  1SXJ D;  3AFH A;  4MGY E;  4REZ A;  4LGM A;  4AKH A;  1YUB A;  2DEN A;  1OAI A;  1GVN A;  3E4R A;  1IFY A;  4RF1 A;  1PJQ A;  2DI0 A;  4DR5 M;  4LF4 M;  4FVM A;  1F4I A;  3U6D A;  2CEA A;  1H6U A;  1W5T A;  2JNH A;  5ITX E;  2MH8 A;  4P17 A;  3GLH B;  4G4N A;  3GLF E;  3T6P A;  4GHA A;  4Q7J A;  3B7Q A;  3J27 B;  5DFL A;  3V76 A;  2WSE F;  3M6A A;  5FTJ A;  3NBI A;  4P16 A;  4Z6Y A;  2OPF A;  2UXC M;  3FUX A;  1EFU B;  4LG2 A;  4QOS A;  1LTM A;  2K9D A;  2R46 A;  1A5T A;  2X8A A;  3LQR A;  3Q8X A;  8CAT A;  2OQ4 A;  1PJS A;  1SXJ B;  3FKE A;  3SAW A;  4DV2 M;  4LRS A;  3DFZ A;  4DUY M;  3HKP A;  4MGH A;  1TDH A;  1I94 M;  2F5N A;  1ZQ9 A;  2CHQ A;  2K0B X;  2J7O A;  4LZJ A;  2Y0Q A;  3GLI B;  1HQY E;  2G3Q A;  5ITU A;  2EO2 A;  2R62 A;  2C99 A;  2M5Z A;  4NSR A;  1N32 M;  4JXJ A;  2C96 A;  1WR1 B;  2CRU A;  4UN2 B;  3J2P B;  1IN8 A;  1SXJ C;  4X62 M;  4FCW A;  1OKS A;  1R4G A;  2R18 A;  4DV5 M;  3U6O A;  1G59 A;  4G4O A;  1OAO C;  3HHZ A;  2EJS A;  3CF0 A;  3FTC A;  1C1K A;  3B7Z A;  2DVW B;  2KZU A;  2R65 A;  2KNZ A;  4RF0 A;  4FW9 A;  2NQ8 C;  1HJP A;  2LHC A;  2WZJ A;  2M60 A;  3IG8 A;  2LVA A;  2MJ5 B;  2OOB A;  1QVR A;  4JN6 A;  1NNJ A;  4L78 A;  1HQC A;  3NWL A;  1HR0 M;  2R0I A;  4LZZ A;  2UUA M;  3I01 M;  4LCB A;  4M0D A;  4XGI A;  3VKG A;  4LJ8 A;  4WUR A;  4DV4 M;  3Q8G A;  3TL4 X;  1XMO M;  2CHV A;  2XZU A;  1NJF A;  1NHG C;  5KPZ A;  1G8P A;  1E9R A;  3C3E A;  4MGK E;  2EUC A;  1VEG A;  4I81 A;  1NSF A;  4CIS A;  2B3T A;  3K1J A;  2XGN A;  2JWS A;  1QZM A;  4S12 A;  4FCT A;  2DZO B;  2G8L A;  1V34 A;  3GLG A;  4DR7 M;  2HWJ A;  2ZAM A;  2AHM A;  5FSW A;  1R2Z A;  1ZMV A;  2APL A;  3W0F A;  4LFB M;  1TTE A;  2VDB B;  3A45 A;  4WW0 A;  3GPY A;  2DZL A;  3GLF B;  3SAT A;  3HZJ A;  2ERC A;  1HT1 E;  4BB9 A;  4HLQ A;  1S3S A;  2JXN A;  2L4E A;  4M9S A;  3QAU A;  5KO3 A;  3RGS A;  3MHV C;  3J7A S;  1R6B X;  3PXG A;  2DAE A;  1J09 A;  3HJQ A;  4MB7 A;  4G3O A;  1IN7 A;  2X49 A;  1T43 A;  1QUT A;  3SFZ A;  2KNA A;  3QYB A;  5E6J A;  3FUU A;  3NBX X;  4IBD A;  2O25 A;  2OOA A;  3U6M A;  2LH0 A;  3HU1 A;  4X65 M;  1R2Y A;  3FUW A;  5IZ7 D;  2QZ4 A;  1XB2 B;  3U61 B;  3LCU A;  2JY8 A;  4IBE A;  2I7P A;  2HKJ A;  3WHL A;  3IEC A;  2CWB A;  1MJG M;  3KP0 E;  1WXQ A;  2UUC M;  3KS8 A;  4DV3 M;  1GKI A;  2KW0 A;  3KOW E;  5DYG A;  2EKK A;  1IBK M;  3VK7 A;  1JQJ C;  1R5L A;  5DYI A;  3MJ5 A;  1IBL M;  1OJL A;  4GKJ M;  2GQF A;  1PGY A;  1XXH B;  1ZMW A;  1GJS A;  2DZN B;  4M0W A;  3FTF A;  1D0M A;  3E21 A;  3GPU A;  1XNQ M;  1OFI A;  1K3X A;  4LFC M;  1OIZ A;  1Y8G A;  2BJV A;  4I4L A;  3TPZ A;  2DKL A;  4TUW A;  4OW0 A;  3I51 A;  4AG6 A;  1JR3 D;  2Z4R A;  4BBA A;  4JI7 M;  1FNN A;  1L2D A;  2XEP A;  3KFU G;  4IBB A;  3SC3 A;  2XZF A;  1D2N A;  1VQ1 A;  3HU2 A;  1SXJ E;  4YY3 M;  2RGO A;  3K9P A;  1J5E M;  2DAM A;  5KPT A;  1VDD A;  4B08 A;  4PT5 A;  3IHP A;  4DR4 M;  3KOZ E;  1XHB A;  2QBY B;  1DGB A;  1WIV A;  4GEW A;  3A98 B;  2JUJ A;  1QAQ A;  4JI0 M;  4GH9 A;  2A5Y B;  2JZ0 A; 
#chains in the Genus database with same CATH homology
 3SMP A;  1JR3 A;  4L16 A;  3T1H M;  3AJI B;  1L2B A;  3KOX E;  4IBF A;  4AKI A;  3KS4 A;  5ITQ A;  2HCB A;  1N78 A;  4AQY M;  2C5R A;  1E9S A;  4B3M M;  1HT2 E;  4LJA A;  4M9Z A;  2BNK A;  5GKN A;  3GP1 A;  3SMS A;  2UUB M;  1EE8 A;  2R4J A;  4YHH M;  1PJI A;  1ORY B;  3BOS A;  4PDG A;  1L1T A;  1DGG A;  3GRV A;  2F4V M;  2FNA A;  3RGP A;  3SHG B;  2XH9 A;  4OVZ B;  2ZM6 M;  5IWA M;  3L26 A;  3AV0 A;  3U5Z B;  3D8L A;  3SYL A;  2C9O A;  4GIP A;  4IBJ A;  2DWL A;  4QOZ C;  1IN5 A;  1LV7 A;  1NY5 A;  1QYR A;  1Z5C A;  2QEN A;  1IY1 A;  1NY6 A;  4CHT B;  4LJ5 A;  3T15 A;  1NJG A;  4JI6 M;  2L7I A;  5IRE B;  2XF3 A;  5KQD A;  3HU3 A;  2EA0 A;  5EXT A;  3KVW A;  2Z3X A;  4JI8 M;  4Z8X A;  4MGZ E;  4R7G A;  1IM2 A;  2XSZ D;  3IG5 A;  3PFI A;  2YR0 A;  2Y21 A;  3PVS A;  4X64 M;  4G4R A;  2X4A A;  3M7G A;  2RGH A;  3HJ8 A;  2VII A;  2P5T A;  3UZU A;  3SAV A;  2F5S A;  3H4M A;  3UJN A;  1GLN A;  1QAN A;  3SAU A;  2L6O A;  4B7H A;  4NRW A;  3JR4 A;  5EXS A;  3U6E A;  3U6C A;  2HHH M;  3CF6 E;  2QCU A;  2CE7 A;  5EQT A;  3KSX A;  2XFT A;  2KEB A;  5EXP A;  4DV7 M;  3L25 A;  1IXS B;  4GRI A;  3GLF A;  2XSZ A;  4R3D A;  4B7G A;  3L28 A;  5EP4 A;  4PCZ A;  5ITT A;  5ITR A;  5KQ8 A;  2DXI A;  1G41 A;  2KXE A;  4IBI A;  1L2C A;  3CF2 A;  3L2A A;  5F3W A;  1I4W A;  3KOY E;  4PD2 A;  3LVV A;  3GO8 A;  3VDP A;  5ITY A;  3ZH9 B;  1YE9 A;  1Z5B A;  4KOD A;  3FUT A;  5ITX A;  3UK6 A;  4AG5 A;  1T3T A;  2D7H A;  3KDS E;  4I5S A;  2Z4S A;  3VFD A;  4A3V B;  3SAR A;  4QNR A;  1DO0 A;  4IBC A;  2FFJ A;  4GHL A;  4KLN A;  4L15 A;  4FWG A;  4JI3 M;  1FJG M;  2KA6 B;  4I8O A;  3FUV A;  4LF7 M;  3UMM A;  3R9X B;  1NHW C;  2YQZ A;  3SHF A;  3LMM A;  1XWI A;  4GMQ A;  4LFA M;  4D81 A;  2R45 A;  1IN4 A;  1W5S A;  4AZF A;  5LMN M;  3HGI A;  2ZBK B;  4DR6 M;  4AW4 A;  4QHS A;  4OU7 A;  1L8Q A;  1N77 A;  5EXX A;  3AL0 C;  3K8Z A;  1Z5A A;  4NXN M;  5EJC A;  4X66 M;  3I4V A;  1J7K A;  4JI4 M;  3SBJ A;  4NSO B;  1X37 A;  1Q39 A;  1N36 M;  4RNA A;  2UXD M;  3GLI A;  2UXB M;  4FD2 A;  1Z59 A;  4LF8 M;  2F5P A;  3FTD A;  3UGJ A;  3J81 S;  2F5Q A;  3A42 A;  3WHK A;  1XMQ M;  1KSF X;  5FLX S;  4DV0 M;  4NOO B;  4B7F A;  4QHT A;  1KFV A;  3PNV A;  3HJS A;  3GQ5 A;  3TQS A;  4LJ9 A;  4DR2 M;  4GC9 A;  3AOE C;  1IXR C;  2C9C A;  4AKG A;  4PDI A;  4ITQ A;  4ZPX A;  3L27 A;  4JI5 M;  3GRY A;  5IT9 S;  2QP9 X;  2KRU A;  4MM3 B;  1K3W A;  2F5O A;  4B3R M;  1TH3 A;  1TDZ A;  4W5W A;  2XLJ A;  2CHG A;  1IQP A;  4GKK M;  1PM5 A;  2KZS A;  3TWL A;  2RKO A;  5FTL A;  5EP2 A;  3HHX A;  3QWL A;  2BJW A;  1HNZ M;  1HNW M;  4NRV A;  3B9P A;  1XC8 A;  4LF5 M;  1IXZ A;  4GC5 A;  3EIE A;  2CV0 A;  3ILK A;  4JI2 M;  1HNX M;  3AKZ A;  3MK6 A;  1PJJ A;  3SYK A;  5H37 D;  1TGU A;  2K47 A;  2V1U A;  2VQF M;  1ZAE A;  4LRT A;  4JV5 M;  3U5Z A;  3U60 A;  3U6P A;  3J7B A;  1Z6T A;  2VQE M;  3DOA A;  4CGY B;  3GRU A;  4KHP M;  3GQ4 A;  2Y0T A;  4OVZ A;  2DHR A;  1N34 M;  3U61 A;  3W0L B;  2V1C A;  4DUZ M;  4B3T M;  5JI3 E;  1KYI A;  1DGF A;  1DGH B;  2Q2E B;  3AOE A;  1NNU C;  4IBK A;  3I4Y A;  2LWX A;  4L4U A;  2V6Z M;  2DWN A;  3JAM S;  4G4Q A;  2L7H A;  1IY0 A;  1G3I A;  4MGI E;  5KPR A;  3FYD A;  2CUZ A;  2D7E A;  3DA1 A;  3THG A;  2LXE A;  3OTO M;  3K92 A;  2QPA A;  5BPV A;  3TWM A;  3U6L A;  1TH2 A;  4FWH A;  3HHW A;  4IJE A;  1IBM M;  3R8F A;  4HL4 A;  3ZC7 B;  3KP1 E;  4DR3 M;  3HWS A;  3U6S A;  1QQW A;  1IN6 A;  1YSY A;  5FTN A;  3VK8 A;  4LJ4 A;  3TE6 A;  4KO8 A;  1MX0 A;  5C1B A;  5FTM A;  4AI6 A;  4JYA M;  5EP1 A;  5LMU M;  2D7G A;  5C18 A;  4QNM A;  4IBG A;  5FTK A;  3GPX A;  3AOG A;  4DV6 M;  2QBY A;  4FCV A;  2Y20 A;  5A2Q S;  3FD9 A;  1GL6 A;  4LF6 M;  1IY2 A;  3K2L A;  1GL7 A;  4NL4 H;  3U6Q A;  1N33 M;  1QAM A;  2KRK A;  2ZAN A;  4DV1 M;  3GRR A;  4D82 A;  1QAO A;  3KW6 A;  2ZAO A;  4LY6 A;  1OFH A;  3DZD A;  3D8B A;  3EIH A;  3LQQ A;  3VLF B;  4GIT A;  2CV2 A;  4K0K M;  2Z7J A;  4EIW A;  4II7 A;  1XXH A;  4D80 A;  2CV1 A;  2G5G X;  4NXM M;  3KXE C;  3SAS A;  2FOI C;  2H1R A;  3RFW A;  7CAT A;  4JI1 M;  1N75 A;  4G6Z A;  4MH0 E;  2YNM D;  1XNR M;  4BLC A;  1Q3B A;  3TWK A;  3FTE A;  2R4E A;  5JI2 E;  1TH4 A;  1L1Z A;  1NVM A;  4XBO A;  4B3S M;  2XFS A;  1DO2 A;  2JA2 A;  3JR5 A;  3CTW B;  4OX9 M;  3GQ3 A;  2L09 A;  3T38 A;  1G4A E;  2LNH C;  3FYC A;  4IJF A;  3L29 A;  4M9X A;  5EP3 A;  1E94 E;  3J80 S;  2DWM A;  5E26 A;  3RE8 A;  3VKH A;  1UM8 A;  2YFQ A;  1DGH A;  4LGY A;  3A46 A;  2W82 A;  4LF9 M;  3GPP A;  1SXJ A;  5DNY A;  2FE8 A;  5BR8 M;  2J7N A;  1K82 A;  1E32 A;  2DWZ B;  1MU5 A;  4DR1 M;  3U60 B;  2I7N A;  2HL7 A;  3E9S A;  4IIW A;  3T1Y M;  2C98 A;  3M0E A;  3C58 A;  1R7R A;  3PNY A;  4LJ7 A;  3LVW A;  3ZCB B;  2CFO A;  3GLH A;  3KSJ A;  1Q3C A;  3GLG B;  4L8R C;  3HHY A;  2UU9 M;  4FWD A;  4LJ6 A;  2E5L M;  2O5R A;  3VDU A;  1SXJ D;  3AFH A;  4MGY E;  4REZ A;  4LGM A;  4AKH A;  1YUB A;  1GVN A;  3E4R A;  4RF1 A;  4DR5 M;  4LF4 M;  4FVM A;  3U6D A;  2CEA A;  1H6U A;  1W5T A;  5ITX E;  3GLH B;  4G4N A;  4GHA A;  3J27 B;  3M6A A;  5FTJ A;  3NBI A;  4P16 A;  4Z6Y A;  2OPF A;  2UXC M;  3FUX A;  4LG2 A;  4QOS A;  2R46 A;  3LQR A;  2X8A A;  3Q8X A;  8CAT A;  2OQ4 A;  1SXJ B;  3FKE A;  3SAW A;  4DV2 M;  4LRS A;  3DFZ A;  4DUY M;  3HKP A;  4MGH A;  1TDH A;  1I94 M;  2F5N A;  1ZQ9 A;  2CHQ A;  2J7O A;  4LZJ A;  2Y0Q A;  3GLI B;  1HQY E;  5ITU A;  2EO2 A;  2R62 A;  2C99 A;  2M5Z A;  4NSR A;  1N32 M;  4JXJ A;  2C96 A;  3J2P B;  1IN8 A;  1SXJ C;  4X62 M;  4FCW A;  2R18 A;  4DV5 M;  3U6O A;  1G59 A;  4G4O A;  3HHZ A;  3CF0 A;  3FTC A;  1C1K A;  2DVW B;  2KZU A;  2R65 A;  4RF0 A;  4FW9 A;  2NQ8 C;  2M60 A;  3IG8 A;  1QVR A;  4JN6 A;  1NNJ A;  4L78 A;  1HQC A;  3NWL A;  1HR0 M;  4LZZ A;  2UUA M;  4LCB A;  4M0D A;  4XGI A;  3VKG A;  4LJ8 A;  4WUR A;  4DV4 M;  3TL4 X;  1XMO M;  2CHV A;  2XZU A;  1NJF A;  1NHG C;  5KPZ A;  1G8P A;  1E9R A;  4MGK E;  2EUC A;  4I81 A;  1NSF A;  4CIS A;  3K1J A;  2XGN A;  1QZM A;  4S12 A;  4FCT A;  2DZO B;  2G8L A;  3GLG A;  4DR7 M;  2ZAM A;  2AHM A;  5FSW A;  1R2Z A;  3W0F A;  4LFB M;  3A45 A;  4WW0 A;  3GPY A;  3GLF B;  3SAT A;  2ERC A;  1HT1 E;  4BB9 A;  4HLQ A;  1S3S A;  4M9S A;  3QAU A;  5KO3 A;  3RGS A;  3MHV C;  3J7A S;  1R6B X;  3PXG A;  3HJQ A;  1J09 A;  4MB7 A;  1IN7 A;  2X49 A;  3SFZ A;  5E6J A;  3FUU A;  4IBD A;  3U6M A;  2LH0 A;  3HU1 A;  4X65 M;  1R2Y A;  3FUW A;  5IZ7 D;  2QZ4 A;  3U61 B;  4IBE A;  2I7P A;  2HKJ A;  3WHL A;  3KP0 E;  1WXQ A;  2UUC M;  3KS8 A;  4DV3 M;  1GKI A;  2KW0 A;  3KOW E;  5DYG A;  1IBK M;  3VK7 A;  1JQJ C;  5DYI A;  3MJ5 A;  1IBL M;  1OJL A;  4GKJ M;  1XXH B;  2DZN B;  4M0W A;  3FTF A;  3GPU A;  1XNQ M;  1OFI A;  1K3X A;  4LFC M;  2BJV A;  4I4L A;  3TPZ A;  4TUW A;  4OW0 A;  3I51 A;  4AG6 A;  1JR3 D;  2Z4R A;  4BBA A;  4JI7 M;  1FNN A;  1L2D A;  2XEP A;  3KFU G;  4IBB A;  3SC3 A;  2XZF A;  1D2N A;  3HU2 A;  1SXJ E;  4YY3 M;  2RGO A;  1J5E M;  5KPT A;  1VDD A;  4B08 A;  4PT5 A;  4DR4 M;  3KOZ E;  1XHB A;  2QBY B;  1DGB A;  3A98 B;  1QAQ A;  4JI0 M;  4GH9 A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...