3MHWU

The complex crystal structure of urokianse and 2-aminobenzothiazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structures of 2-Aminobenzothiazole-based Inhibitors in Complexes with Urokinase-type Plasminogen Activator
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU01
2FP7B 4D8NA 1C2IA 1P3CA 1C9TA 1XUFA 1O38A 3JZ2B 2F83A 1NRPH 1FIWA 3O8DA 1MBMA 3RXLA 2VVUA 2ZF0H 1OWDA 1YPMH 4CRGA 4ABAA 4CBOA 1SG8B 4F4OC 4AN7A 1ZYOA 1DY8A 3DT0H 3GY7A 1K2I1 1W14U 3TVJB 6CHAC 1BITA 1GL1A 2V0BA 4IS5A 5GIBA 1ACBE 1ELEE 1HAVA 3PMAB 1P9SA 2AGIX 1W10U 1EZSC 3QWCH 2ZTZA 1AO5A 2I6QA 4YM9A 1ZOMA 2BY5X 1NC6A 1TIOA 1ZMNA 1CBWB 1T4UH 1GMHF 2Q1JA 3UIRA 1PYTD 3NCLA 1VR1H 3ZZAA 2VWOA 2PHBA 2BY6X 1MMJN 3H7TA 1EQ9A 1DWDH 3ZVCA 3F9GA 1RD3B 2PKAA 1LVOA 5EQSA 1NRSH 1C5OH 1C5UA 1G37A 1S81A 1UCYE 1RJXB 3A81A 5EQQA 3OSYA 1NROH 1TX8A 1BHXB 1FNIA 1QL9A 3PROA 5EW2H 1ZPCA 3F6UH 3TK6A 2AMDA 3QO6A 5K0HA 2GCHG 1B0FA 1AZ8A 3MYWA 4I8GA 4Z6AH 4ZXYH 3TITA 2OBQA 1MTSA 3UR9A 1A2CH 5A8YA 2QGRA 5E0GA 4ISLA 1MD8A 4Y11E 2V3HH 3S9BA 1DPOA 1AB9B 3UWIA 2VVVA 1B0EA 4ZHAA 4INKA 3PMJA 2QCYA 1PPFE 2ZU1A 1F7ZA 2P3FH 3RMLH 3ZZ5A 4TPYA 1G9IE 3ZV8A 2A4GA 3GYLB 3PM3A 2NU2E 2BLVA 1UVUH 3PWBA 1TGNA 1H8DH 3RXIA 1AWHB 2BQ7B 1C5XB 1WOFA 1GJDB 1ZJKA 5FAHA 3SUDA 2PFEA 4DJZB 3KQDA 1Z1JA 4BTUB 1TGCA 3TH2H 4BAQB 1YCPH 3QZQA 4ISOA 2H9HA 1MUEB 3A80A 4K69A 1SGNE 3VB3A 1KDQB 4FXGH 3Q00A 1O5GH 1CVWH 4LK4A 4DY7B 2WPHS 2WUCA 1SHYA 1EP5A 1KLIH 2C8XB 1ABIH 2G51A 1EPTC 1ESTA 1BMLA 2JETB 3I77A 1S82A 1Z7KA 1CA0B 2ZDKA 2GD4B 3A86A 2ZQ1A 4Y10E 1EJMA 1QJ6B 2TGAA 4OS1A 3L33A 1O3LA 4K3JA 2SGQE 2ZO3H 3A84A 5FPSA 1AVWA 1GBCA 4GAWA 4IN1A 5BRRE 1ABJH 4X0WU 4X1NU 2VIDA 4WJG2 1YLCA 4X1SU 1PPZA 3SU4A 3C1KA 1GBKA 1DS2E 1EUFA 2OCVB 1ZRKA 4K2YA 2OUAA 2JH5D 1O2PA 5DP4A 1Y5AT 2B9LA 1NESE 1P02A 1TGTA 5C3NA 1NU7B 2H5CA 4ABHA 1GBAA 1MAYA 4HI3A 2O8LA 1BA8B 1PQ5A 2GCHF 3BTHE 4NWKA 3SI3H 2VH0A 3SN8A 1L1NA 1F92A 2Z94A 3AASA 1LPKB 1UTMA 1GI8B 1PQ8A 4KKDA 1YPGH 1IQFA 3SNAA 1CSOE 1P04A 3NZIA 1O2RA 5AFZH 3A7WA 2A2XH 1WUNH 1BTYA 2WYJA 4WMDA 1GJ7B 3NWUA 4FUIA 1O2HA 4OGXA 4NFFA 1FY3A 2VH6A 4BANB 2ZI2H 1K22H 1OXGA 4LZ4B 3NUMA 4DCDA 4YOIA 1E37B 2BXTH 3MNSA 2H1UA 3BG8A 1PFXC 1TFXA 1QNJA 1GMDG 1KIGH 1Y59T 5JB8S 3ATKA 3KHVA 1O32A 1F5RA 4FU7A 2GGVB 2ZPRA 1O2YA 1P2MA 4WH8A 4YZUA 1O3JA 1SGRE 1C5YB 1H1BA 2KAIA 5TJXA 1GG6B 1PPBH 4BNRA 3SV2H 2ZDMA 1ELVA 4FU9A 3S9AA 3RXHA 1L1JA 1A46H 1Y3XA 5FCKA 4ABEA 3TJVA 1QBNA 4H42U 1DLEA 2D26C 4X6OA 4AFUA 4OGYA 1FI8A 1CQQA 2ZU3A 5E2PA 1C2GA 1A5HA 5EPNA 5GDSH 3NPSA 1T4VH 2ZDLA 1PPGE 3DFLA 1AFQB 1ZLRA 5C2ZA 1C4V2 2VWNA 3UNQA 3UOUA 1QCPA 2BD2A 4XBDA 1GI7B 1NPMA 5EXNA 1O3NA 1JIMA 1V2RT 1HXFH 5DG6A 3G01A 1S85A 3C27B 1GI5A 1DXWA 3MH5A 1O2QA 4TY7A 1DT2A 2Z9IA 1ZMJA 1JMOH 2XWBI 3VPKA 1NTPA 2HALA 3E6PH 3F9FA 3KQEA 4XDEA 2G52A 7GCHG 1EJNA 2SGEE 3OY6U 4SGAE 5A0AE 1O2UA 2AIQA 3ZZ9A 1GHWH 1MTNB 2BDHA 3LC5A 1BDAA 3SQEE 1ZRBA 3RXSA 1DFPA 4X8UH 3DA9B 1C2HA 2PUQH 3E0PB 3PMBB 2ZU4A 1T31A 1S83A 1SVPA 4X8VH 2F9BH 2THFB 1C2FA 1ZTKA 1KSNA 4X6MA 1C1TA 1SMFE 4GCHG 2HPQH 5B6OA 4XBCA 3DFJA 1YPHE 1EAIA 1YPKH 2O9QA 3SQHE 2SFAA 1P2JA 4FUBA 2VB0A 4YO9A 2ANYA 4BXWA 3NXPA 2ZHFH 5GWZA 2AMPA 2BY7X 1BRBE 2Y82A 1ZJDA 2WPMS 4H6TA 1RIWB 2Y6TA 4AFSA 1XM1A 1YPHC 1YPEH 1GMDF 2R2WU 4YLUA 1O3IA 4AZ2B 3O8RA 2P3TB 3ATLA 1EAXA 4CRBA 2RA0A 4XOJA 4ABJA 3LGUA 3FZDA 3PYHA 1P05A 3TPIZ 3RC5A 3UNRA 1YC0A 3MFJA 3SV8A 1T7CA 1DDJA 1TMUH 2I6SA 1C9PA 1OS8A 4UEHH 2ZGJA 5ESTE 3P8FA 1L0ZA 3BF6H 3GDUA 5CE1A 3SV6A 2GMTB 1ELTA 2BDGA 4INLA 3GY3A 2Z9GA 2XTTB 1XUGA 2F3CE 1D3QB 4KTCA 1C1QA 3SZNA 1YBWA 2ZHQH 1O5DH 3A82A 4IGDA 1YLDA 1L4DA 1O3DA 3SNCA 1A5GH 1YF4A 1XXFA 2Z9LA 3BIVH 3RU4T 2FOFA 2G55A 1TRYA 1TRMA 3LGYA 5EODA 1H9HE 2BQ6B 2W7UA 1HUTH 4ASHA 7GCHF 1TNKA 3BTME 1VGCB 2TGDA 2OXSA 3UQOA 1PPHE 3VGCB 1C2DA 3I29A 1CBWC 1H8IH 1NZQH 1ZPBA 1UVOA 2F91A 1JRSA 3SNDA 5FBIA 1LHFH 4CHAC 4JZEH 1FDPA 3RXAA 3RXTA 4FUHA 5EPYA 4GCHF 5CMXH 1O3MA 1O5AB 3ITIA 3VB6A 3RDZA 5FXLA 3ZZBA 3LDXH 3TGIE 4X1QU 3MMGA 1GVLA 1TGBA 2YOLA 1SGDE 1HDTH 1MD7A 2F9OA 2WV4A 1P8VC 2Z9JA 1CO7E 1ZGIA 1P0SH 2VIPA 1P03A 2P93A 3Q3YA 3ELAH 5GCHF 1MU8B 1AB9C 4XE4A 4NZQA 1LHEH 2RG3A 2ZCHP 5AFYH 1GJ5H 4MNXA 4Q7YA 4AORA 2PV9B 1C2EA 1SLUB 3PTNA 1CE5A 4DOQA 1SHHB 1UTOA 3A89A 1C5PA 1T8MA 1HYLA 1BBRH 2WYGA 2J4IA 2BDAA 8ESTE 2XC0A 4D9QA 1UTPA 1VITG 4NG9H 2ZCKP 4FUFA 1NU9A 3PB1E 3SORA 1O37A 3U1JB 2CV3A 3URDA 1FY4A 1KLTA 1O2MA 1V2TT 2J9NA 3GY4A 2QF0A 4ZH8A 1HJAC 1KXCA 2CN0H 3A85A 1NFUA 1UCYK 4O97A 2A4QA 2QAAA 3RXPA 1C2JA 2FI4E 3K2UA 4MG3A 5F8XA 4UD9H 4B2CA 3K6YA 3LC3A 1P10A 1QB9A 3RXUA 1GHVH 2BLWA 1ELBA 3TNSA 1DSTA 5DJ7A 1O3BA 2ZC9H 1BTZA 1D3PB 4I33A 3HPTB 2UWOA 5ESBA 3TJOA 5C67A 2FPZA 2JETC 1CA0C 2OQ5A 1SLWB 1S0RA 2W3IA 2HLCA 2FOCA 5DP3A 1ETRH 1LHGH 4CREA 1HB0B 1UK2A 1C1OA 1IQLA 1O34A 5JBAS 1BJVA 2XCFA 5DP7A 2FZZA 1EASA 1YP9A 2Q6DA 2BYAX 2IPHA 4NA8A 2KAIB 1AWFH 4Q2KA 4A6LA 4TY6A 2AFQB 3EA7A 2QXHA 3E3TA 1EATA 1O2SA 1G2LA 1BOQA 2H9TH 4ESTE 5DP8A 2QC2A 1V2VT 1V2UT 3T26A 1HLTH 1W12U 2PSYA 1KY9A 2WPLS 3FVFB 4E05H 2Y5GA 3UPEA 5FHTA 1GPZA 3GOVB 1K1MA 5J4QA 1T8LA 5FBEA 7LPRA 3TGKE 2FOHA 3UR6A 3L3TA 4LZ1H 2BMGB 3D62A 5EQRA 1TOCB 1VITF 1OWHA 3ZVAA 2DE9A 2SGPE 1RTLA 1K1PA 4PROA 2A31A 3B9FH 1XUHA 2GDDA 2Z7FE 1QGFA 2QV1A 2GVFA 1IOEA 2NU4E 3RXEA 1QBOA 3VB7A 1N8OB 1Q3XA 1A0JA 1DLKB 1GBFA 4Q7ZA 1TONA 2FOMB 3F1SB 4ABDA 3TK5A 2FS9A 4GPGA 2BDBA 1AE8H 3SJIA 5JBTA 1QRWA 3LGTA 3OTJE 1Y5BT 1GG6C 4A1VA 1CHOG 1MTUA 3RLWH 3NKKA 3P8OA 2NU3E 1GCDA 5C1UA 4IC5A 3E16B 3LONA 1GBLA 1NFWA 1QB1A 1IQHA 2GP9B 4OS4A 1SQTA 1J15A 4UFEH 1KXEA 3TIUA 4DIHH 5AVDA 3ZZ7A 1AFQC 1GVKB 2CF9H 2FX6A 3A8BA 1X7AC 4K1TA 4OS7A 2PLXA 3SNBA 1O31A 1PJPA 4XSKU 4SGBE 2G5NA 1WTHD 4THNH 3QK1A 1BQYA 3GICB 5FX6A 1RFNA 3M36A 4AYYB 2OC1A 2ZCLP 2GV7A 3AW1A 1SGIB 3P92A 1D3DB 4IMQA 1E34B 2OD3B 4AGJA 2Y5FA 1TBQH 1LQEA 3SI4H 1Y3VA 2QN5T 3BSQA 2ZHEH 2GCTB 2BXUH 2PSXA 3ZYEA 1RTFB 1ZTJA 1RTKA 1MTNC 4RN6A 3GCHB 3VEQB 3MU5A 1TALA 4K5ZA 1Z8IB 4ABIA 1ANBA 1FV9A 1KXAA 1DSUA 1UK3A 2DE8A 2ASUB 1VCQA 2IJOB 1O3FA 3BTDE 1QFKH 1V2NT 3HGPA 4I8LA 1A5IA 2B7DH 2V3OH 1ELCA 4AFQA 1Q31A 4NSYA 1QHRB 3UFAA 3VB4A 2AGEX 1THPB 1K1IA 1MKXK 4I8JA 4X2VA 3SW2B 2ZP0H 2BHGA 5JB9S 3GDSA 1A4WH 1MKWK 1QL7A 1FY8E 1RIWC 4AX9H 1P2KA 3E0NB 1TGSZ 5DK1A 5HMAA 2JH6D 3BTTE 1GGDB 1J17T 1SGEE 1PPEE 5GXPA 1THSH 2A5KA 1F0TA 1O3AA 1O3PB 1E36B 1LKAA 1GCTB 4MQAA 3RXMA 1S84A 1KXFA 2HPPH 1FONA 1G3CA 1YKTA 4VGCC 3BTFE 2WPIS 4B73A 4QT8C 1GI6A 1CHOF 2AEIH 4JK5A 2XNIA 1S5SA 2GZ7A 3GCNA 3OY5U 1EB1H 1AKSB 4WWYA 4ZAEA 4JZFH 3LGVA 2GMTC 3KEEA 1DOJA 1VCWA 1P2IA 1GDUA 1L1GA 1GBTA 1C4Y2 1D9IA 3FP8E 2R0LA 1RS0A 2GTBA 5DO4H 4MTBA 4YESB 3EAJA 2R2MB 2XC4A 1ELGA 1G2MA 2CF8H 2SNWA 2FI3E 4D7FA 3RP2A 4INHA 4AYVB 1HPGA 1MBQA 2P8OB 5T6FA 4BAHB 1MU6B 1EJAA 1P11E 3KIDU 4D76A 1GDQA 2H2ZA 1H4WA 1OX1A 2IN2A 3SU1A 4B2AA 2O8TA 2TIOA 2LNCA 2PUXB 1VGCC 2Z9KA 2CGAA 1AUJA 2M5TA 4U32A 3MTYA 3VGCC 1IQIA 2Z3DA 3URCA 3F68H 1DE7H 3T62A 1ZZZA 1ESBA 1QB6A 4R0IA 3STJA 2ZGCA 3SO3A 3RU4D 2C3SA 3BTQE 2WPKS 4Y8ZA 8LPRA 1FN8A 1MQ5A 1XVOA 4D9RA 3KCGH 1C1SA 1KYNA 3S7HB 1BTPA 3M35A 4B71A 2WV5A 2Y7XA 4ABBA 2QY0B 3K6ZA 3BG4B 2A4OA 4I8KA 2VIQA 3BEUA 3ZV9A 2AS9A 2GKVE 2ESTE 1BTUA 1GL0E 1JRTA 1ARBA 4ISNA 3T5FH 3TK9A 3HKIB 1MQ6A 4FVBA 3HK6B 4ZXXH 2CHAB 5DPAA 3T2NA 1W0ZU 7ESTE 2BLQA 1ETSH 1O36A 2QXJA 5C20A 3IWMA 5LPRA 4ISIH 3QUMP 3ESTA 4IN2A 4DG4A 2BM2A 2V6NA 5F8ZA 4X2XA 4JCNA 1GI9B 1WV7H 3IITA 1ANCA 2QIQA 3R0FA 1DICA 1O5FH 1XVMA 4CR9A 1BBRE 3RXQA 1SGPE 3SJ8A 1XUJA 2ULLA 1OPHB 1UTNA 5JBBS 2TPIZ 2J2UA 1FUJA 1SGFA 2BY9X 5AF9H 4NSVA 3VB5A 1NRNH 5DP6A 1HAIH 4JZIA 3O8CA 5JBCS 1GBBA 2FS8A 3OX7U 5I25A 5HM2A 2FESH 1ZHPA 2ZTXA 1GHAG 2P94A 3W95A 4CR5A 1P01A 1NO9H 5F8TA 1G32B 3A7YA 1TX6A 1TRNA 5A09A 4AOQA 1O2ZA 1OP8A 6GCHG 4WXIA 1P06A 1OWIA 6ESTA 2O8UA 2ZFQH 1S6HA 2UWLA 3DD2H 2EC9H 4Y76A 1TA6A 1G3BA 3EQ0H 6CHAB 2HGTH 4MDSA 1J8AA 2YNBA 1C1RA 1MZAA 1QJ7B 2AYWA 3MH7A 5T3HA 3K65B 2A5IA 2ZEBA 5ETXA 1JXPA 1CGIE 3ZVDA 2XBWA 1HAXB 2C93B 1FY5A 2WUBA 2ZU5A 1MTWA 2QA9E 4I31A 3V13A 3RC6A 1AN1E 2A7JA 4Y7AA 4Z0KA 2BVXH 1VJAU 4AG2A 3AVZA 3GY8A 1SFQB 4GHQA 1K1OA 1BTXA 1D6WA 1QR3E 2F9UA 1GI4A 1EKBB 3RXKA 3IG6B 1SOTA 1ARCA 2TBSA 1S0QA 2F9VA 2Q6FA 3QZRA 4U01A 2F9PA 3GY5A 1DWBH 3TJNA 4E7RG 3UWJH 2FLRH 1T8OA 1A1RA 1P57B 2RDLA 3UTUH 1GMCG 1ID5H 1XUKA 1SQAA 1V6DA 2PTNA 3ZVFA 4D7GA 2ZG0H 4GHTA 5GCHG 1GHYH 3T28A 5AHGH 3V3MA 1JOUB 1C5MD 4ZHMU 1ZSJA 3M5OA 1ANEA 8GCHF 1UMAH 1P9UA 2FOGA 2OQUA 3MU8A 1YGCH 4OS5A 1PYTC 3SUGA 1MAXA 3PLKA 3VXEH 4UFGH 1H9LB 1UHBB 4E06H 1N8OC 3BN9A 1MH0A 1LMWB 3GCTG 1AHTH 1P3EA 1SI5H 4IMZA 1GHAF 2DUCA 2BQWB 1BHXF 4AB9A 1Y8TA 1QQ4A 2R3UA 2ODYB 1NFYA 2HOBA 1O2LA 4JZ1A 2FI5E 4WH6A 5K7RA 6GCHF 8KME2 1ZHMA 1HNEE 2R0KA 3BTEE 4BAMB 1HCGA 2W5EA 3U1IB 5A2MH 4A5TS 3F9HA 4U30A 3GYMA 1GBHA 1HFDA 5I46H 2ANWA 4WMFA 2UUJB 2EEKA 2PGQB 3KF2A 4UE7H 4MNVA 1C5NH 4ABFA 1Z6EA 2FIRH 1DVAH 1A61H 1O0DH 3PLBA 3ZZDA 5A0CA 1EPTB 4UFDH 1TMTH 2ZFSA 2BZ6H 1KTSB 3V0XA 4KGAA 1IAUA 3OU0A 4FUJA 2BD5A 3QDZB 2FTMA 2A0QB 4H4FA 1E0FD 1FPCH 2WPJS 4K8BA 3GCOA 3RXJA 3B23B 2Y7ZA 3TH4H 3A7VA 1MCVA 1WBGB 1HGTH 3U69H 1C1WH 4KTUA 1F0UA 1AKSA 2Z3CA 4KTSA 3DHKH 1WQSA 1GMCF 1HBTH 1LO6A 2VGCB 2ZA5A 1XKBC 1SGYE 1AE5A 1G3EA 2CMYA 2A5AA 2XRCA 2WINI 2ODPA 3RUOA 1OSSA 3H5CB 5HYOA 1OWJA 3UUZA 1BCUH 1LHCH 1SLVB 4WVPE 1QA7A 4RKJB 4XBBA 4AGKA 1K28D 2ZDNA 3GY2A 1F0RA 4BTTB 5FPTA 2C8ZB 2B0FA 4A1XA 1W7GH 4NA9H 4B75A 1GGDC 1VCPA 3L6PA 5F6MA 5DGJA 1BB0B 5A8ZA 4HTCH 4GSOA 1CGJE 1GCTC 3GCTF 1V3XA 2OC8A 3QTVH 1NS3A 1K1NA 5T6GA 3EA9A 3ZYDA 1AI8H 2PKSB 3RXBA 3P70B 2BDCA 1WYKA 1TNGA 1GBJA 2SNVA 1CGHA 1QQUA 3QGNB 1IHTH 3A83A 1BMMH 2ILNA 1CT0E 4Y7BA 1SPJA 2R9PA 4FVDA 1TNHA 3SHAH 2C4FH 2ZDVH 1T32A 1TB6H 1NFXA 1P12E 3SHCH 1B5GH 1GDNA 3JZ1B 1IQMA 1AQ7A 1XXDA 2ZPSA 4MPWA 4MPVA 2TGPZ 2PGBB 5E0HA 1EZUC 4CRAA 4NIWA 1P2OA 3QGJA 1GJ4H 1C1NA 3BTKE 1MKXH 3QN7A 2OC0A 3AAUA 1GI0A 4MPXA 1W11U 1J9CH 2VVCA 3T29A 1MKWH 3Q3XA 4A92A 2XBVA 4FUEA 5EG4A 1GHZA 3T25A 1D6RA 2JH0D 3CS0A 1BT7A 1BTWA 1P2QA 1YCPM 5F03A 4DURA 1KLJH 1C5SA 1HRTH 1ZMLA 1FXYA 3ATWA 2J94A 2A7CA 2J92A 1W7XH 3KGPA 4AG1A 3DUXH 3SU2A 1YYY1 1OOKB 2Z3EA 1UVSH 2BD7A 4X6NA 3P8NA 2A32A 4I7YH 5L30H 3RM0H 2IOTA 4AB8A 5DKMA 2BDIA 2Z6BD 2ZECA 3MO9A 4ZKRU 3BG4C 4TWYA 2FM2A 1FMGA 4O3TA 4TYDA 5LPFA 1U6QA 5T6DA 6LPRA 1BZXE 3LPRA 3K9XB 1SGTA 1O2OA 4I32A 1GHBF 4DT7B 4OS2A 1VJ9U 1UJ1A 2XW9A 1C5ZB 4DVAU 2FYQA 2P95A 2P3UB 4TWWA 4ZMAH 1UTLM 1O30A 2Y5HA 1CA8B 3HGNA 5PTPA 4FUDA 3SGBE 4GUXA 4MVNA 1TPPA 2W26A 4Y71A 2C90B 3MNCA 5J4SA 5CHAB 1TOMH 1GJ6A 1V2KT 1WTGH 2FX4A 2HNTE 3CS7A 4B76A 1QL8A 3V7TA 2VIOA 3MOCA 1FJSA 1QA0A 4Y8XA 5FCRA 1DY9A 3SGAE 1IQKA 1HAZB 3M7QA 1FAKH 1GBDA 3ATMA 1QURH 3EDXB 2A7HA 2OBOA 3M37A 2HNTC 1BMNH 1PQAA 3MU1A 1DUAA 1OYTH 1PPCE 3ZZ4A 1TE0A 4Y79A 3M7TA 3BEIB 1O3KA 3FZZA 2ZFTA 5DP9A 1EXFA 2BOKA 9ESTA 2ANKH 1HAPH 1AFEH 4UONA 1O3HA 2GDEH 1WQVH 3GDVA 1INCA 3CENA 5E0JA 1LHDH 2ANMH 1IQEA 1F5LA 1O33A 3EGKH 1ZTLA 3SJOA 2G4TA 3FFGA 3U8TH 2OLGA 1LVYA 1GHXH 2ZHWH 1UTKA 1AGJA 1N6YA 1FIZA 1A3EH 4MLFB 2FWWA 3LIWA 4B74A 1BBRK 4ABGA 1V2ST 1UHBA 3UREA 3PO1B 2D1JA 1TNIA 3A8DA 4HFPB 1SOZA 2XWAA 1W0YH 2AGGX 1SC8U 4CHAB 2BTCE 3S69A 1Z8GA 3N7OA 1A7SA 5TCCA 4JMYA 1W13U 3SGQE 3SU5A 4DW2U 1HAGE 1UO6A 2YNAA 1EZQA 2UUYA 3ZZCA 1V2PT 1QJ1B 3EE0B 1QY6A 4CBNA 3SU6A 3I78A 1RGQA 5HM9A 1LKBA 1FZZA 4I8HA 1ZSLA 4NGAH 2GZ8A 2ZFFH 3LGWA 3UOPA 2Y80A 1EOLA 1C5TA 4CH8B 1WAYB 1NM6A 1FPHH 4B1TA 5EGMA 4WMEA 2J95A 1Z71A 4BOHA 4A1TA 3EYDA 4LOYH 2UUKB 3R3GB 2BD3A 1HAOH 5H4IB 1EPTA 1TNJA 2ZWLH 4K1SA 3ODFA 3SUEA 1HIAB 2ZQ2A 3RMMH 2XCNA 3MH6A 1AUTC 3A8AA 3P6ZB 2ZGHA 1G30B 4DGJA 1C1VH 1SGFG 1O3GA 1FN6A 1LDTT 1ZSKA 3LJOA 1H9IE 1V2LT 2QF3A 3A7XA 1IQJA 4B2BA 1O2GH 2OP9A 4WF8A 7KMEH 1GBMA 2XBXA 4NFEA 1D4PB 1HJAB 3RXOA 1OKXA 3QX5H 3Q76A 2FDAA 2XBYA 4TPIZ 3ZZ6A 2BLOA 2P16A 2BD8A 3BTWE 1AD8H 4X6PA 2BD4A 3F9EA 2VINA 1O5EH 3H7OA 3GY6A 1F5KU 1SL3A 1OYQA 4GLYA 1LPGB 4YOGA 3S7KB 1HXEH 1UVTH 5A8XA 4E7NA 2QYIA 3FP7E 1BRCE 1K1LA 2EI8A 3RXDA 4A7IB 4ZKSU 5IDKA 1DITH 5GPIB 1ELAA 3SV9A 2GX4A 2UWPA 1W3CA 2VNTA 3SJ9A 2AH4X 3RXRA 4UFFH 1FAXA 3D65E 3E91A 1N1LA 3SNEA 1EAWA 2F9NA 2STAE 2R3YA 1SQOA 1DUEA 1E35B 2B5TB 3WY8A 3ZZ8A 4FU8A 4FUGA 1V2WT 1J14A 2FOBA 3U8RH 1DWCH 1NY22 3A88A 4JYVH 1TNLA 5HGGA 2H5DA 1AIXH 2NU0E 4BAKB 2SGDE 2ZU2A 2G81E 3EA8A 3D49H 1S6FA 1Y5UT 3A7ZA 3SU3A 1SGQE 3MU4A 1SSXA 2VGCC 9LPRA 1KXBA 1O3CA 3KN2A 3LOXA 4J2YB 2FOEA 5FPYA 1L2EA 2SGAA 3PTBA 4JYTA 4Y8YA 1P2NA 2HRVA 3SOSA 1EOJA 2ZHDA 3U8OH 3FAOA 2NWNA 5BPEA 1YPJH 1AVGH 1CHGA 1OP2A 1IQNA 3STIA 4Y0ZE 1WSSH 2VU8E 4IW4E 3Q3KA 1DX5M 1B7XB 5HXFA 1C2KA 8GCHG 2BOHB 1V2JT 2FEQH 4KP0A 1UK4A 3SUFA 1EP6A 4BXSA 2PKSC 5TCAA 1Z6JH 1O2JA 2P59A 2W3KA 4NWLA 3LU9B 1W8BH 2PTCE 4CRDA 4O9VA 1BIOA 4AFZA 4K8YA 1HAYB 4YLQH 2EA3A 4CH2B 1G36A 4K1EA 1DM4B 1TA2A 1K21H 1TLDA 3MWIU 4ZKOU 1ESAA 2FODA 1GBIA 1RRKA 1C5RA 1PQ7A 4DIIH 3M3TA 1BRAA 4RKOB 4RSPA 4ZKNU 1ETTH 1VITH 2XC5A 1IHSH 2O8WA 3MNBA 2K1QA 3Q77A 1K9OE 2Y81A 3E1XB 1O2TA 2HWLB 3M5MA 1LPZB 2OC7A 2C8WB 1QIXB 5DP5A 2AMQA 1LVMA 2OINA 2ZIQH 4ZUHA 3HKJB 1FQ3A 3S0NA 3HK3B 2O8MA 4M7GA 5JPMH 2JKHA 1A0LA 1N6XA 1SBWA 2OTVA 1AMHA 2GV6A 3GISB 3BTGE 1HV7A 4IC6A 1SB1H 4X2YA 1UTQA 3QLPH 2G5VA 2A1DB 1NRRH 1UCYH 3PV4A 2ZDAH 3CP7A 1CT4E 3VFEA 1SR5C 1K1JA 2NU1E 1GVZA 1KXDA 1QTFA 1YCPK 1AVXA 1BMAA 1O2VA 2H9EH 1XMNB 2ZZUH 2TRMA 1C1MA 1HJ9A 1VZQH 1TWXB 2UUFB 3AAVA 4BAOB 2C8YB 2VWLA 3M61U 3TLOA 3ZVEA 4YT7H 4UDWH 3S9CA 1HAVB 1GBEA 1GWAA 3TU7H 1THRH 2VIWA 1GJCB 3UNSA 2J38A 3VXFH 1HJ8A 1TMBH 1P09A 1QBVH 3LT3A 3LKWA 5C5OA 1LTOA 3MH4A 2BZAA 4MNYA 4XFQA 2XYAA 1FY1A 1G3DA 5CHAC 2GT7A 3M3SA 1KTTB 1SGCA 1ELFA 3KL6A 2D8WA 1BUIA 1ORFA 4Y6DA 1TAWA 5G4BA 1C4U2 2FLBH 5L2YH 3ENSB 4YTAA 4VGCB 1GI2A 3RMNH 2CJIA 2PKAB 1TBZH 2J34A 3O8BA 5C1XA 4HGCA 5JYIA 1E38B 1GJAB 2ZKSA 4FUCA 1V2QT 1LQDB 2RCEA 3P8GA 1TBRH 3UQVA 1TABE 1D3TB 3LH3A 2D2DA 1XKAC 3KQCA 5C5NA 3D23A 4Q7XA 1C2MA 5LGOA 5EXLA 5EU8A 3E90B 4X2WA 2ZGXH 1O2KA 3W94A 1A3BH 4HZHA 1NN6A 3B8JA 4NCYA 3RC4A 1SFIA 3PMHB 1TQ0B 2HVXA 3NK8A 1F0SA 2BVRH 2BD9A 2BY8X 1Y3YA 4NIXA 2GCTC 1GJ9B 3T27A 2G8TA 3V12A 4ISHH 3TNTA 1GI3A 1O3EA 1TPOA 1T8NA 2VWMA 4KELA 2ZFRH 1QRXA 3GCHC 3M3VA 3A7TA 1ANDA 1HIAA 2ZGBH 3PO1C 1O2NA 1C5WB 1BRUP 3ODDA 3A8CA 3HATH 2Q6GA 1Q2WA 3SU0A 2VJ1A 4X1PU 1NT1A 2G4UA 1TQ7B 2A2QH 1EZXC 4NIYA 2FYRA 4NIVA 5ABWA 2A4RA 2GZ9A 1JWTA 3KQBA 1MCTA 1F2SE 5L6NH 1M9UA 2FO9A 1SLXB 2EI6A 1NRQH 3PLPA 4LXBH 3MNXA 1C5VA 4JK6A 1AU8A 3PWCA 2FOAA 3RXFA 2FMJA 1GHBG 3RU4E 3MO3A 3M7UA 4Q80A 1O2IA 1Z8JB 5EOKA 2H6MA 1C1PA 1KDQA 1YPLH 1ZGVA 1WU1A 1J16A 3RM2H 3SJKA 1V2OT 1LVBA 1O2WA 1C5LH 5EXMA 2SGFE 1O5CB 2B8OH 2QXIA 2ALPA 1UVPA 2LPRA 3MI4A 1RXPA 2PR3A 1XUIA 3P95A 5EW1H 4IBLH 3TGJE 4GVUA 1CU1A 1GI1A 2BX4A 1EX3A 3LH1A 1W2KH 3OYPA 2ALVA 2AERH 3SBKA 4ZHLU 1WCZA 1LCYA 4U2WA 1DANH 1L4ZA 1O35A 1TPAE 1Y3UA 2CXVA 5FX5A 1C2LA 3RMOH 3TH3H 2BB4A 4YOJA 2TGTA 4JYUH 1XX9A 1JBUH 3SV7A 5E2OA 2EI7A 3TJUA 1UTJA 2P8OC 4Y0YE 3E8LA 1TX7A 4X1RU 3BIUH 3A87A 1Z8RA 3RXVA 4R8TB 1V2MT 2ZPQA 4MNWA 1C5QA 4H6SB 2STBE 4J1YA 4ZROA 2FXRA 5C1YA 1OP0A 2XXLA 2ZFPH 2PWXA 4O3UA 1CT2E 1OWKA 1EB2A 1Z1IA 1A0HB 2QXGA 3KNXA 3RXGA 1GJ8B 1C1UH 2ZNKH 4WXVA 1O39A 3M5LA 4K60A 1AY6H 3LJJA 1DXPA 2BDYA 1OWEA 4X8SH 5E8EH 3LGIA 2HNTF 1HAHH 2A45B 1ZR0A 4F49A 3BV9B 2BVSH 1TPSA 3RLYH 1JIRA 1GMHG 1O5BB 2VIVA 4WY3A 4NA7A 3U9AH 3ATIA 1BTHH 3ZVBA 5GJ4B 1DWEH 2PW8H 4BTIB 4YT6H 2CHAC 1O2XA 5A0BA 2BX3A 3BEFB 3MO6A 1MZDA 3FP6E 5SGAE 2ODQA 1FLEE 1QRZA 1YM0A 4X8TH 2AIPA 4O03A 2FTLE 1GJBB 3ZVGA 5L2ZH 2RA3A 1ZPZA 5LPEA 3U98H 3UY9A 1EAUA 3ZZ3A 3RXCA 1BJUA 1ELDE 1AZZA 3MHWU 4MPUA 4CRCA 3MU0A 2ZTYA 3P17H 3QTOH 1MTVA 4CRFA 4OS6A 2GT8A 5JDUB 4JZDH 1Y3WA 3M5NA 5IYTA 1O3OA 2W7SA 2V35A 4NZLA 5LH8A 3AW0A 2G00A 1IQGA 1ZHRA 3FANA 1TYNA
chains in the Genus database with same CATH superfamily
2FP7B 4D8NA 1C2IA 1P3CA 1C9TA 1XUFA 1O38A 3JZ2B 2F83A 1NRPH 1FIWA 3O8DA 1MBMA 3RXLA 2VVUA 2ZF0H 1OWDA 1YPMH 4CRGA 4ABAA 4CBOA 1SG8B 4F4OC 4AN7A 1ZYOA 1DY8A 3DT0H 3GY7A 1K2I1 1W14U 3TVJB 6CHAC 1BITA 4XD7D 1GL1A 2V0BA 4IS5A 5GIBA 4ACBA 1ACBE 1ELEE 1HAVA 3PMAB 1P9SA 2AGIX 1W10U 1EZSC 3QWCH 5IK2D 2ZTZA 1AO5A 2I6QA 4YM9A 1ZOMA 2BY5X 1NC6A 1TIOA 1ZMNA 1CBWB 1T4UH 1GMHF 2Q1JA 3UIRA 1PYTD 3NCLA 1VR1H 3ZZAA 2VWOA 2PHBA 2BY6X 1MMJN 3H7TA 1EQ9A 1DWDH 3ZVCA 3F9GA 1RD3B 2PKAA 1LVOA 5EQSA 1NRSH 1C5OH 1C5UA 1G37A 1S81A 1UCYE 1RJXB 3A81A 5EQQA 3OSYA 1NROH 1TX8A 1BHXB 1FNIA 1QL9A 3PROA 5EW2H 1H8HD 1ZPCA 3F6UH 3TK6A 2AMDA 3QO6A 5K0HA 2GCHG 1B0FA 1AZ8A 3MYWA 4I8GA 4Z6AH 4ZXYH 3TITA 2OBQA 1MTSA 3UR9A 1A2CH 5A8YA 2QGRA 5E0GA 4ISLA 1MD8A 4Y11E 2V3HH 3S9BA 1DPOA 1AB9B 3UWIA 2VVVA 1B0EA 4ZHAA 4INKA 3PMJA 2QCYA 1PPFE 2ZU1A 1F7ZA 2P3FH 3RMLH 3ZZ5A 4TPYA 1G9IE 3ZV8A 2A4GA 3GYLB 3PM3A 2NU2E 2BLVA 1UVUH 3PWBA 1TGNA 1H8DH 3RXIA 1AWHB 2BQ7B 1C5XB 1WOFA 1GJDB 1ZJKA 5FAHA 3OE7D 3SUDA 2PFEA 4DJZB 3KQDA 1Z1JA 4BTUB 1TGCA 3TH2H 4BAQB 1YCPH 3QZQA 4ISOA 2H9HA 1MUEB 3A80A 4K69A 1SGNE 3VB3A 1KDQB 4FXGH 3Q00A 1O5GH 1CVWH 4LK4A 4DY7B 2WPHS 2WUCA 1SHYA 1EP5A 1KLIH 2C8XB 1ABIH 2G51A 1EPTC 1ESTA 1BMLA 2JETB 3I77A 1S82A 1Z7KA 1CA0B 2ZDKA 3SZEA 2GD4B 3A86A 2ZQ1A 4Y10E 1EJMA 1QJ6B 2TGAA 4OS1A 3L33A 1O3LA 4K3JA 2SGQE 2ZO3H 3A84A 5FPSA 1AVWA 4ZCNA 1GBCA 4GAWA 4IN1A 5BRRE 1ABJH 4X0WU 4X1NU 2VIDA 4WJG2 1YLCA 4X1SU 1PPZA 3SU4A 3C1KA 1GBKA 1DS2E 2F43B 1EUFA 2OCVB 1ZRKA 4K2YA 2JH5D 2OUAA 4Q4LA 1O2PA 5DP4A 1Y5AT 2B9LA 1NESE 1P02A 1TGTA 5C3NA 1NU7B 2H5CA 4ABHA 1GBAA 1MAYA 4HI3A 5KEDA 2O8LA 1BA8B 1PQ5A 2GCHF 3BTHE 4NWKA 3SI3H 5HIZA 2VH0A 3SN8A 2QF5A 1L1NA 1F92A 2Z94A 3AASA 1LPKB 1UTMA 1GI8B 1PQ8A 4KKDA 1YPGH 1IQFA 3SNAA 3DSGA 1CSOE 1P04A 3NZIA 1O2RA 5AFZH 3A7WA 2A2XH 1WUNH 1BTYA 2WYJA 4WMDA 1GJ7B 3NWUA 2W6JD 4FUIA 1O2HA 4OGXA 4NFFA 1FY3A 2VH6A 4BANB 2ZI2H 1K22H 1OXGA 4LZ4B 3NUMA 1KMHB 4DCDA 4YOIA 1E37B 2BXTH 3MNSA 2H1UA 2EY4C 1PFXC 3BG8A 1TFXA 1QNJA 1GMDG 1KIGH 1Y59T 5JB8S 3ATKA 3KHVA 1O32A 1F5RA 4FU7A 2GGVB 2ZPRA 1O2YA 1P2MA 4WH8A 4YZUA 1O3JA 1SGRE 1C5YB 1H1BA 2KAIA 5TJXA 1GG6B 1PPBH 4BNRA 3SV2H 2ZDMA 1ELVA 4FU9A 3S9AA 3RXHA 1L1JA 1A46H 1Y3XA 5FCKA 4ABEA 3TJVA 1QBNA 4H42U 1DLEA 2D26C 3KYFA 4X6OA 4AFUA 4OGYA 1FI8A 3ZIAD 1CQQA 2ZU3A 5E2PA 1C2GA 1A5HA 5EPNA 5GDSH 3NPSA 1T4VH 4P02A 2ZDLA 1PPGE 3DFLA 1AFQB 1ZLRA 5C2ZA 1C4V2 2VWNA 3UNQA 3UOUA 1QCPA 2BD2A 4XBDA 1GI7B 1NPMA 5EXNA 1O3NA 1JIMA 1V2RT 1HXFH 5DG6A 3G01A 1S85A 3C27B 5EIYA 1GI5A 1DXWA 3MH5A 1O2QA 4TY7A 2J98A 1DT2A 2Z9IA 1COWD 1ZMJA 1JMOH 2XWBI 3VPKA 1SKYE 1NTPA 2HALA 3E6PH 3F9FA 3KQEA 4XDEA 2G52A 7GCHG 1EJNA 2KX4A 2SGEE 3OY6U 4SGAE 5A0AE 1O2UA 2AIQA 3ZZ9A 1GHWH 1MTNB 2BDHA 3LC5A 1BDAA 3SQEE 1ZRBA 3RXSA 4F48B 1DFPA 4X8UH 3DA9B 1C2HA 2PUQH 3E0PB 3PMBB 2ZU4A 1T31A 1S83A 1SVPA 3DSOA 4X8VH 2F9BH 2THFB 1C2FA 1ZTKA 1KSNA 4X6MA 1C1TA 1SMFE 4GCHG 2HPQH 5B6OA 2KZ4A 4XBCA 3DFJA 1YPHE 1EAIA 1YPKH 2O9QA 3SQHE 2SFAA 1P2JA 4FUBA 2VB0A 4YO9A 2ANYA 4BXWA 3NXPA 2ZHFH 5GWZA 2AMPA 2BY7X 1BRBE 3MQKC 2Y82A 1ZJDA 2WPMS 4H6TA 1RIWB 2Y6TA 4AFSA 1XM1A 1YPHC 1YPEH 1GMDF 2R2WU 4YLUA 1O3IA 4AZ2B 3O8RA 2P3TB 3ATLA 1EAXA 4CRBA 2RA0A 4XOJA 4ABJA 3LGUA 3FZDA 3PYHA 1P05A 3OAAD 3TPIZ 3RC5A 3UNRA 1YC0A 3MFJA 3SV8A 1T7CA 1DDJA 1TMUH 2I6SA 1C9PA 1OS8A 4UEHH 2ZGJA 5ESTE 3P8FA 1L0ZA 3BF6H 3GDUA 5CE1A 3SV6A 2GMTB 1ELTA 2BDGA 4INLA 3GY3A 2Z9GA 2XTTB 1XUGA 2F3CE 1D3QB 4KTCA 1C1QA 3SZNA 1YBWA 2ZHQH 1O5DH 3A82A 4IGDA 1YLDA 2WZQA 1L4DA 1O3DA 3SNCA 1A5GH 1YF4A 1XXFA 2Z9LA 3BIVH 3RU4T 2FOFA 2G55A 1TRYA 3SYJA 1TRMA 3LGYA 5EODA 2L6OA 1H9HE 2BQ6B 2W7UA 1HUTH 4ASHA 7GCHF 1TNKA 3BTME 1VGCB 2TGDA 2OXSA 3UQOA 1PPHE 3VGCB 1C2DA 3I29A 1CBWC 1H8IH 1NZQH 5B6LA 1ZPBA 1UVOA 3N7EA 2F91A 1JRSA 3SNDA 5FBIA 1LHFH 4CHAC 4JZEH 1FDPA 3RXAA 3RXTA 3FO8D 4FUHA 5EPYA 4GCHF 5CMXH 1QZ8A 1O3MA 1O5AB 1YWUA 5HIYA 3ITIA 3VB6A 3RDZA 5FXLA 3ZZBA 3LDXH 3TGIE 4X1QU 3MMGA 1GVLA 1TGBA 2YOLA 1SGDE 2RFKC 1HDTH 1MD7A 2F9OA 2WV4A 1P8VC 2GJGA 1CO7E 1ZGIA 2Z9JA 1P0SH 2VIPA 1P03A 2P93A 3Q3YA 3ELAH 5GCHF 1MU8B 1AB9C 4XE4A 4NZQA 1LHEH 2RG3A 2ZCHP 5AFYH 1GJ5H 4MNXA 4Q7YA 4AORA 2PV9B 2VBCA 1C2EA 1SLUB 3PTNA 1CE5A 4DOQA 1SHHB 1UTOA 3A89A 1C5PA 1T8MA 1HYLA 1BBRH 2WYGA 2J4IA 2BDAA 8ESTE 2XC0A 4D9QA 1UTPA 1VITG 4NG9H 2ZCKP 4FUFA 1NU9A 3PB1E 3SORA 1O37A 3U1JB 2CV3A 3URDA 1FY4A 1KLTA 1O2MA 1V2TT 2J9NA 3GY4A 2QF0A 4ZH8A 1HJAC 1KXCA 2CN0H 3A85A 1NFUA 1UCYK 4O97A 2A4QA 2QAAA 3H09A 3RXPA 1C2JA 2JDID 2FI4E 3K2UA 4MG3A 5F8XA 4UD9H 4B2CA 3K6YA 3LC3A 1P10A 1QB9A 3RXUA 1GHVH 2BLWA 1ELBA 3TNSA 1DSTA 5DJ7A 1O3BA 2ZC9H 1BTZA 1D3PB 4I33A 3HPTB 2UWOA 5ESBA 3TJOA 5C67A 2FPZA 2JETC 1CA0C 2OQ5A 1SLWB 1S0RA 2W3IA 2HLCA 2FOCA 5DP3A 1ETRH 1LHGH 4CREA 1HB0B 1UK2A 1C1OA 1IQLA 1O34A 5JBAS 1BJVA 2XCFA 5DP7A 2FZZA 1EASA 1YP9A 2Q6DA 2BYAX 2IPHA 4NA8A 2KAIB 1AWFH 4Q2KA 3W1EA 4A6LA 4TY6A 2AFQB 3EA7A 2QXHA 3E3TA 1EATA 1O2SA 1G2LA 1BOQA 2H9TH 4ESTE 5DP8A 2QC2A 1V2VT 1V2UT 3T26A 1HLTH 1W12U 2PSYA 1KY9A 2WPLS 3FVFB 4E05H 2Y5GA 3UPEA 5FHTA 1GPZA 3UB0A 3GOVB 1K1MA 5J4QA 1T8LA 5FBEA 7LPRA 3TGKE 2FOHA 3UR6A 3L3TA 2J98B 4LZ1H 2BMGB 3D62A 5EQRA 1TOCB 1VITF 1OWHA 3ZVAA 2DE9A 2SGPE 1RTLA 1K1PA 4PROA 2A31A 3B9FH 1XUHA 2GDDA 2Z7FE 1QGFA 2QV1A 2GVFA 5DN6D 1IOEA 2NU4E 3RXEA 1QBOA 3VB7A 1N8OB 1Q3XA 1A0JA 1DLKB 1GBFA 4Q7ZA 1TONA 2FOMB 3F1SB 4ABDA 3TK5A 2FS9A 4GPGA 2BDBA 1AE8H 3SJIA 5JBTA 1QRWA 3LGTA 3OTJE 1Y5BT 1GG6C 4A1VA 1CHOG 1MTUA 3RLWH 3NKKA 3P8OA 2NU3E 1GCDA 5C1UA 4IC5A 3E16B 3LONA 2KFWA 1GBLA 1NFWA 1QB1A 1IQHA 2GP9B 2K8IA 4OS4A 3F2GA 1SQTA 1J15A 4UFEH 1KXEA 3TIUA 4DIHH 5AVDA 3ZZ7A 1AFQC 1GVKB 2CF9H 2FX6A 3N7DA 3A8BA 1X7AC 4K1TA 4OS7A 2PLXA 3SNBA 1O31A 1PJPA 4XSKU 4SGBE 2G5NA 1WTHD 4THNH 3QK1A 1BQYA 2OK5A 3GICB 5FX6A 1RFNA 3M36A 4AYYB 2OC1A 2ZCLP 2GV7A 3AW1A 1SGIB 3P92A 1D3DB 4IMQA 1E79D 1E34B 2OD3B 4AGJA 2Y5FA 1TBQH 1LQEA 3SI4H 1Y3VA 2QN5T 3BSQA 2ZHEH 2GCTB 2BXUH 2PSXA 3ZYEA 1RTFB 4DT4A 1ZTJA 1RTKA 1MTNC 4RN6A 3GCHB 3VEQB 3MU5A 1TALA 4K5ZA 1Z8IB 4ABIA 1ANBA 1FV9A 1KXAA 1DSUA 1UK3A 2DE8A 2ASUB 1VCQA 2IJOB 1O3FA 3BTDE 1QFKH 1V2NT 3HGPA 4I8LA 1A5IA 2B7DH 2V3OH 1ELCA 4AFQA 1Q31A 4NSYA 1QHRB 3UFAA 3VB4A 1MABB 2AGEX 1THPB 2W6ID 3N99A 1K1IA 1MKXK 4I8JA 4X2VA 3SW2B 2ZP0H 2BHGA 5JB9S 3GDSA 1A4WH 1MKWK 1QL7A 1FY8E 4Z1MD 1RIWC 4AX9H 1YY3A 1P2KA 3E0NB 1TGSZ 5DK1A 5HMAA 2JH6D 3BTTE 1GGDB 1J17T 1SGEE 1PPEE 5GXPA 1THSH 2A5KA 1F0TA 1O3AA 3EE7A 1O3PB 1E36B 1LKAA 1GCTB 4MQAA 3RXMA 1S84A 1KXFA 2HPPH 1FONA 1G3CA 1YKTA 4VGCC 3BTFE 2WPIS 4B73A 4QT8C 1GI6A 1CHOF 2AEIH 3DCLA 4JK5A 2XNIA 1S5SA 2GZ7A 3GCNA 3OY5U 1EB1H 1AKSB 4WWYA 1H8ED 4ZAEA 4JZFH 3LGVA 2GMTC 3KEEA 1DOJA 1VCWA 1P2IA 1GDUA 1L1GA 1GBTA 1C4Y2 1D9IA 3FP8E 2R0LA 1RS0A 2GTBA 5DO4H 4MTBA 4YESB 4I86A 3EAJA 2R2MB 2XC4A 1K0HA 5EJ1A 1ELGA 1G2MA 2V7QD 2CF8H 4RT0A 2SNWA 2FI3E 3F0PA 4D7FA 3RP2A 4INHA 4AYVB 1HPGA 1MBQA 2P8OB 5T6FA 4BAHB 1MU6B 1EJAA 1P11E 3KIDU 4D76A 1GDQA 2H2ZA 1H4WA 1OX1A 2IN2A 3SU1A 4B2AA 2O8TA 2TIOA 2LNCA 2PUXB 1VGCC 2Z9KA 2CGAA 1AUJA 2M5TA 4U32A 3MTYA 3VGCC 2KM0A 1IQIA 2L74A 2Z3DA 3URCA 3F68H 1DE7H 2KCPA 3T62A 1ZZZA 2V3MA 1ESBA 1QB6A 4R0IA 3STJA 2ZGCA 3SO3A 3RU4D 2C3SA 3BTQE 2WPKS 4Y8ZA 8LPRA 1FN8A 1MQ5A 1XVOA 4D9RA 3KCGH 1C1SA 1KYNA 3S7HB 1BTPA 3M35A 4B71A 2WV5A 2Y7XA 4ABBA 2QY0B 3K6ZA 3BG4B 2A4OA 4I8KA 2VIQA 3BEUA 3ZV9A 2AS9A 2GKVE 2ESTE 1FX0B 1BTUA 1GL0E 1JRTA 4Q63A 1ARBA 4ISNA 3T5FH 3TK9A 3HKIB 1MQ6A 4FVBA 3HK6B 4ZXXH 2CHAB 5DPAA 3T2NA 1W0ZU 7ESTE 2BLQA 1ETSH 1O36A 2QXJA 5C20A 3IWMA 5HKKD 4ISIH 5LPRA 3QUMP 3ESTA 4IN2A 4DG4A 2BM2A 2V6NA 5F8ZA 4X2XA 4ASUD 4JCNA 1GI9B 1WV7H 3IITA 1ANCA 2QIQA 4B6EA 3R0FA 1DICA 2IPQX 3PV2A 1O5FH 2YMSD 1XVMA 4CR9A 1BBRE 3RXQA 1SGPE 3SJ8A 1XUJA 2ULLA 1OPHB 1UTNA 5JBBS 2TPIZ 2J2UA 1FUJA 1SGFA 2BY9X 5AF9H 4NSVA 3VB5A 1NRNH 5DP6A 1HAIH 3FKSD 4JZIA 3O8CA 5JBCS 1GBBA 2FS8A 3OX7U 5I25A 5HM2A 2FESH 1ZHPA 2ZTXA 1GHAG 2P94A 3W95A 4CR5A 1P01A 1NO9H 5F8TA 1G32B 3A7YA 1TX6A 1TRNA 5CDFE 5A09A 4AOQA 5KECA 1O2ZA 1OP8A 6GCHG 4WXIA 1P06A 1OWIA 6ESTA 2O8UA 2ZFQH 1S6HA 2UWLA 3DD2H 2EC9H 4Y76A 1TA6A 1G3BA 3EQ0H 6CHAB 2HGTH 4MDSA 1J8AA 2YNBA 1C1RA 1MZAA 1QJ7B 2KCAA 2AYWA 3MH7A 2HVYB 5T3HA 3K65B 2A5IA 2ZEBA 5ETXA 1JXPA 1CGIE 3ZVDA 5C94A 2QF4A 2XBWA 1HAXB 2C93B 1FY5A 2WUBA 2ZU5A 1MTWA 2QA9E 4I31A 3V13A 3RC6A 1AN1E 2A7JA 4Y7AA 4Z0KA 2BVXH 1VJAU 4AG2A 3AVZA 3GY8A 3WWBA 1SFQB 4GHQA 1K1OA 1BTXA 1D6WA 1QR3E 2F9UA 1GI4A 1EKBB 3OTPA 1WDIA 3RXKA 3IG6B 5FL7D 1SOTA 1ARCA 2TBSA 1S0QA 2F9VA 2Q6FA 3QZRA 4U01A 2F9PA 3GY5A 1DWBH 3TJNA 4E7RG 3UWJH 2FLRH 1T8OA 1A1RA 1P57B 2RDLA 3UTUH 1GMCG 1ID5H 1XUKA 1SQAA 1V6DA 2PTNA 3ZVFA 4D7GA 2ZG0H 4GHTA 5GCHG 1GHYH 3T28A 5AHGH 3V3MA 1JOUB 1C5MD 4ZHMU 1ZSJA 3M5OA 1ANEA 8GCHF 1UMAH 1P9UA 2FOGA 2OQUA 3MU8A 1YGCH 4OS5A 1PYTC 1SQRA 3SUGA 1MAXA 3PLKA 3VXEH 4UFGH 1H9LB 1UHBB 4E06H 1N8OC 2QE7D 3BN9A 1MH0A 1LMWB 3GCTG 1AHTH 1P3EA 1SI5H 4IMZA 1GHAF 2DUCA 2BQWB 1BHXF 2WHXA 4AB9A 1Y8TA 1QQ4A 2R3UA 2ODYB 1NFYA 2HOBA 1O2LA 4JZ1A 2FI5E 4WH6A 5K7RA 6GCHF 8KME2 1ZHMA 1HNEE 2R0KA 3BTEE 4BAMB 1HCGA 2W5EA 3U1IB 5A2MH 4A5TS 3F9HA 4U30A 3GYMA 1GBHA 1HFDA 5I46H 2ANWA 4WMFA 2UUJB 2EEKA 2PGQB 3KF2A 4UE7H 4MNVA 1C5NH 4ABFA 5T1VA 1Z6EA 2FIRH 1DVAH 1A61H 1O0DH 3PLBA 3ZZDA 5A0CA 1EPTB 4UFDH 1TMTH 2ZFSA 2BZ6H 1KTSB 3V0XA 4KGAA 1IAUA 3OU0A 4FUJA 2BD5A 3QDZB 2FTMA 3AK5A 2A0QB 4H4FA 1E0FD 1FPCH 2WPJS 4K8BA 3GCOA 3RXJA 3B23B 2Y7ZA 3TH4H 3A7VA 1MCVA 1W0JD 1WBGB 2KCYA 1HGTH 3U69H 1C1WH 4KTUA 1F0UA 1AKSA 2Z3CA 4KTSA 3DHKH 1WQSA 1GMCF 3OEHD 1HBTH 1LO6A 2VGCB 2ZA5A 1XKBC 1SGYE 1AE5A 1G3EA 2CMYA 2A5AA 2XRCA 2WINI 2ODPA 3RUOA 1OSSA 3H5CB 5HYOA 1OWJA 3UUZA 1BCUH 1EFRD 1LHCH 1SLVB 4WVPE 1QA7A 4RKJB 4XBBA 4AGKA 1YLNA 1K28D 2ZDNA 3GY2A 1F0RA 4BTTB 5FPTA 2C8ZB 2B0FA 4A1XA 2PP6A 1W7GH 4NA9H 4B75A 1GGDC 1VCPA 3L6PA 5F6MA 5DGJA 1BB0B 3WW7A 5A8ZA 4HTCH 4GSOA 1CGJE 1GCTC 3GCTF 1V3XA 2OC8A 3QTVH 1NS3A 1K1NA 5T6GA 3EA9A 3ZYDA 1AI8H 2PKSB 3RXBA 3P70B 2BDCA 1WYKA 1TNGA 1GBJA 2SNVA 1CGHA 1QQUA 3QGNB 1IHTH 2LELA 3A83A 1BMMH 2ILNA 1CT0E 4Y7BA 1SPJA 2R9PA 3F0OA 4FVDA 1TNHA 3SHAH 5CHBA 2C4FH 2ZDVH 1T32A 1TB6H 1NFXA 1P12E 3SHCH 1B5GH 1GDNA 3JZ1B 1IQMA 1AQ7A 1XXDA 2ZPSA 4AC9A 4MPWA 4MPVA 2TGPZ 2JIZD 2PGBB 5E0HA 1EZUC 4CRAA 4NIWA 1P2OA 3QGJA 5EJLA 1GJ4H 1C1NA 3BTKE 1MKXH 3QN7A 2OC0A 3AAUA 1GI0A 4MPXA 1W11U 1J9CH 2VVCA 3T29A 1MKWH 3Q3XA 4A92A 2XBVA 4FUEA 5EG4A 1GHZA 3T25A 1D6RA 2JH0D 3CS0A 1BT7A 1BTWA 1P2QA 1YCPM 5F03A 4DURA 1KLJH 1C5SA 1HRTH 4ACAA 1E1QD 1FXYA 1ZMLA 3ATWA 2J94A 2A7CA 2J92A 1W7XH 3KGPA 4AG1A 3F3BA 3DUXH 3SU2A 1YYY1 1OOKB 2Z3EA 1UVSH 2BD7A 4X6NA 3P8NA 2A32A 4I7YH 5L30H 3RM0H 2IOTA 4AB8A 5DKMA 2BDIA 2Z6BD 2ZECA 3MO9A 4ZKRU 3BG4C 4TWYA 2FM2A 1FMGA 4O3TA 4TYDA 5LPFA 1U6QA 5T6DA 6LPRA 1BZXE 3LPRA 3K9XB 1SGTA 1O2OA 4I32A 3KYGA 1GHBF 4DT7B 4OS2A 1VJ9U 1UJ1A 2XW9A 1C5ZB 4DVAU 2FYQA 2P95A 2P3UB 1OHHD 4TWWA 4ZMAH 1UTLM 1O30A 2Y5HA 1CA8B 3HGNA 5PTPA 4FUDA 3SGBE 4GUXA 4MVNA 1TPPA 2W26A 4Y71A 2C90B 3MNCA 5J4SA 5CHAB 1TOMH 1GJ6A 1V2KT 1WTGH 2FX4A 2HNTE 3CS7A 4B76A 1QL8A 3V7TA 2VIOA 3MOCA 1FJSA 1QA0A 4Y8XA 5FCRA 1DY9A 3SGAE 1IQKA 1HAZB 3M7QA 1FAKH 1GBDA 3ATMA 1QURH 3EDXB 3OFND 4B6FA 2A7HA 2OBOA 3M37A 2HNTC 1BMNH 1PQAA 3MU1A 1DUAA 1OYTH 1PPCE 3ZZ4A 1TE0A 4Y79A 2HLDD 3M7TA 3BEIB 1O3KA 3FZZA 1VKYA 2ZFTA 1EXFA 5DP9A 2BOKA 9ESTA 2ANKH 1HAPH 1AFEH 4UONA 1O3HA 2GDEH 1WQVH 1BMFD 3GDVA 1INCA 3CENA 5E0JA 1LHDH 2ANMH 1IQEA 1F5LA 1O33A 3EGKH 1ZTLA 3SJOA 2G4TA 3FFGA 3U8TH 4YXWD 2OLGA 1LVYA 1GHXH 2ZHWH 1UTKA 1AGJA 1N6YA 1FIZA 1A3EH 4MLFB 2FWWA 3LIWA 4B74A 1BBRK 4ABGA 1V2ST 1UHBA 3UREA 3PO1B 2D1JA 1TNIA 3A8DA 2JJ1D 4HFPB 1SOZA 2XWAA 1W0YH 2AGGX 1SC8U 4CHAB 2BTCE 3S69A 1Z8GA 3N7OA 1E1RD 1A7SA 5TCCA 4JMYA 1W13U 3SGQE 3SU5A 4DW2U 1HAGE 1UO6A 2YNAA 1EZQA 2UUYA 3ZZCA 1V2PT 1QJ1B 3EE0B 1QY6A 4CBNA 3SU6A 3I78A 1RGQA 5HM9A 1LKBA 1FZZA 4I8HA 1ZSLA 4NGAH 2GZ8A 2ZFFH 3LGWA 5GNDA 3VG8A 1UW7A 3UOPA 2Y80A 1EOLA 1C5TA 4CH8B 1WAYB 2M2AA 1NM6A 1FPHH 4B1TA 5EGMA 4WMEA 2J95A 1Z71A 4BOHA 4A1TA 3EYDA 4LOYH 4RT1A 2UUKB 3R3GB 2BD3A 1HAOH 5H4IB 1EPTA 1TNJA 2ZWLH 4K1SA 3ODFA 3SUEA 1HIAB 2ZQ2A 3RMMH 2XCNA 3MH6A 1AUTC 3A8AA 3P6ZB 2ZGHA 1G30B 4DGJA 1C1VH 1SGFG 4FOUC 1O3GA 1FN6A 1LDTT 1ZSKA 3LJOA 1H9IE 1V2LT 2QF3A 3A7XA 1IQJA 4B2BA 1O2GH 2OP9A 4WF8A 4M9FA 7KMEH 1GBMA 2XBXA 4NFEA 1D4PB 1HJAB 3RXOA 1OKXA 3QX5H 4XRNA 3Q76A 2FDAA 2XBYA 3DSPA 4TPIZ 3ZZ6A 2BLOA 2P16A 2BD8A 3BTWE 1AD8H 4X6PA 2BD4A 3F9EA 2VINA 1O5EH 3H7OA 3GY6A 1F5KU 1SL3A 1OYQA 4GLYA 1LPGB 4YOGA 3S7KB 1HXEH 1UVTH 5A8XA 4E7NA 2QYIA 3FP7E 1BRCE 1K1LA 2EI8A 3RXDA 4A7IB 4ZKSU 5IDKA 2J97A 1DITH 5GPIB 2YMSB 1ELAA 3SV9A 2GX4A 2UWPA 1W3CA 2VNTA 3SJ9A 2AH4X 2F4LA 3RXRA 4UFFH 1FAXA 3D65E 3E91A 1N1LA 3SNEA 1EAWA 4HG6A 2F9NA 2WSSD 2STAE 2R3YA 1SQOA 1DUEA 1E35B 2B5TB 3WY8A 3ZZ8A 4FU8A 4FUGA 1V2WT 1J14A 2FOBA 3U8RH 1DWCH 1NY22 3A88A 4JYVH 1TNLA 5HGGA 2H5DA 1AIXH 1W0KD 2NU0E 3FN8A 4BAKB 2SGDE 2ZU2A 2G81E 3EA8A 3D49H 1S6FA 5KGOA 1Y5UT 3A7ZA 3SU3A 1SGQE 3MU4A 1SSXA 2VGCC 9LPRA 1KXBA 1O3CA 3KN2A 3LOXA 3U28C 4J2YB 2FOEA 5FPYA 1L2EA 2SGAA 3PTBA 4JYTA 4Y8YA 1P2NA 2J5UA 2HRVA 3SOSA 1EOJA 2ZHDA 3U8OH 4F55A 3FAOA 2NWNA 5BPEA 3UAIC 1YPJH 1AVGH 1CHGA 1OP2A 1IQNA 3STIA 4Y0ZE 1WSSH 2VU8E 4IW4E 3Q3KA 5C17A 2XNDD 1DX5M 1B7XB 5HXFA 1C2KA 8GCHG 2BOHB 1V2JT 1NBMD 3KQ5A 2FEQH 4KP0A 1UK4A 3SUFA 1EP6A 4BXSA 2PKSC 5TCAA 1Z6JH 2XOKD 1O2JA 2P59A 2W3KA 4NWLA 3LU9B 1W8BH 2PTCE 4CRDA 4O9VA 1BIOA 4AFZA 4K8YA 1HAYB 4YLQH 2EA3A 4CH2B 1G36A 4K1EA 1DM4B 1TA2A 1K21H 1TLDA 3MWIU 4ZKOU 1ESAA 2FODA 1GBIA 1RRKA 1C5RA 1PQ7A 4DIIH 3PRDA 3M3TA 1BRAA 4RKOB 4RSPA 4ZKNU 1ETTH 1VITH 2XC5A 1IHSH 2O8WA 3MNBA 2K1QA 3Q77A 1K9OE 2Y81A 3E1XB 1O2TA 2HWLB 3M5MA 1LPZB 2OC7A 2C8WB 1QIXB 5DP5A 2AMQA 1LVMA 2OINA 2ZIQH 4ZUHA 3HKJB 1FQ3A 3S0NA 3HK3B 2K0QA 2O8MA 3PV5A 4M7GA 5JPMH 2JKHA 1A0LA 1N6XA 1SBWA 2OTVA 1AMHA 2GV6A 3GISB 3BTGE 1HV7A 4IC6A 1SB1H 2KR7A 4X2YA 1UTQA 3QLPH 2G5VA 2A1DB 1NRRH 1UCYH 3PV4A 2ZDAH 3CP7A 1CT4E 3VFEA 1SR5C 1K1JA 2NU1E 2CK3D 1GVZA 1KXDA 1QTFA 1YCPK 1AVXA 1BMAA 1O2VA 2H9EH 4TT3D 1XMNB 2ZZUH 2TRMA 1C1MA 1HJ9A 1VZQH 1TWXB 2UUFB 3AAVA 4BAOB 2C8YB 2VWLA 3M61U 3TLOA 3ZVEA 4YT7H 4UDWH 5C0TA 3S9CA 1HAVB 1GBEA 1GWAA 3TU7H 1THRH 2VIWA 1GJCB 3UNSA 2J38A 3VXFH 1HJ8A 1TMBH 3F2HA 1P09A 1QBVH 3LT3A 3LKWA 5C5OA 1LTOA 3MH4A 2BZAA 4MNYA 4XFQA 2XYAA 1FY1A 1G3DA 5CHAC 2GT7A 3M3SA 1KTTB 1SGCA 1ELFA 3KL6A 2D8WA 1BUIA 1ORFA 4Y6DA 1TAWA 5G4BA 1C4U2 2FLBH 5L2YH 3ENSB 4YTAA 3F2FA 4VGCB 1GI2A 3RMNH 2CJIA 2PKAB 1TBZH 2J34A 5C0UA 3O8BA 5C1XA 4HGCA 2WV9A 5JYIA 1E38B 1GJAB 2ZKSA 4FUCA 3OEED 1V2QT 1LQDB 2RCEA 3P8GA 1TBRH 3UQVA 1TABE 1D3TB 3LH3A 2D2DA 1XKAC 3KQCA 5C5NA 3D23A 4Q7XA 1C2MA 2RDEA 5LGOA 5EXLA 5EU8A 3E90B 4X2WA 2ZGXH 1O2KA 3W94A 1A3BH 4HZHA 1NN6A 3B8JA 4NCYA 3RC4A 1SFIA 2AHME 3GS9A 3PMHB 1TQ0B 2HVXA 3NK8A 3NRLA 1F0SA 2BVRH 2BD9A 2BY8X 1Y3YA 4NIXA 2GCTC 1GJ9B 3T27A 2G8TA 4P00A 3V12A 4ISHH 3TNTA 1GI3A 1O3EA 1TPOA 1T8NA 2VWMA 4KELA 2ZFRH 1QRXA 3GCHC 3M3VA 3A7TA 1ANDA 1HIAA 2ZGBH 3PO1C 1O2NA 1C5WB 1BRUP 3ODDA 3A8CA 3HATH 2Q6GA 1Q2WA 3SU0A 2VJ1A 4X1PU 1NT1A 2G4UA 1TQ7B 2A2QH 1EZXC 4NIYA 2FYRA 4NIVA 5ABWA 2A4RA 2GZ9A 1JWTA 3KQBA 1MCTA 1F2SE 5L6NH 5EJZA 1M9UA 2FO9A 1SLXB 2EI6A 1NRQH 3PLPA 4LXBH 3MNXA 1C5VA 4JK6A 1AU8A 2JJ2D 2FOAA 3PWCA 3RXFA 2FMJA 1GHBG 3RU4E 3MO3A 3M7UA 4Q80A 1O2IA 1Z8JB 5EOKA 2H6MA 1C1PA 1KDQA 1YPLH 1ZGVA 3WWFA 1WU1A 3FOAA 1S6LA 1J16A 3RM2H 3SJKA 1V2OT 1LVBA 1O2WA 1C5LH 5EXMA 2SGFE 1O5CB 2B8OH 2QXIA 2ALPA 1UVPA 3CNRA 2LPRA 3MI4A 1RXPA 2PR3A 1XUIA 3P95A 5EW1H 4IBLH 3TGJE 2KCOA 4GVUA 1CU1A 1GI1A 2BX4A 1EX3A 3LH1A 1W2KH 3OYPA 2ALVA 2AERH 3SBKA 2IJD1 4ZHLU 1WCZA 1LCYA 4OM9A 4U2WA 1DANH 1L4ZA 1O35A 1TPAE 1Y3UA 2CXVA 5FX5A 1C2LA 4TSFD 3RMOH 3TH3H 2BB4A 4RI0A 4YOJA 2TGTA 4JYUH 1XX9A 1JBUH 3SV7A 5E2OA 2EI7A 3TJUA 1UTJA 2P8OC 4Y0YE 3E8LA 1TX7A 4X1RU 3BIUH 3A87A 1Z8RA 3RXVA 1NBME 4R8TB 1V2MT 2ZPQA 4MNWA 1C5QA 4H6SB 2STBE 4J1YA 4ZROA 2FXRA 5C1YA 1OP0A 2XXLA 2ZFPH 2PWXA 4O3UA 1CT2E 2YMSC 1OWKA 1EB2A 1Z1IA 1A0HB 2QXGA 3KNXA 3RXGA 1WXRA 1GJ8B 1C1UH 2ZNKH 4WXVA 1O39A 3M5LA 4K60A 1AY6H 2WPDD 3LJJA 1DXPA 2BDYA 1OWEA 4X8SH 5E8EH 3LGIA 2HNTF 1HAHH 2A45B 1ZR0A 4F49A 3BV9B 2BVSH 1TPSA 3RLYH 1JIRA 1GMHG 1O5BB 2VIVA 4WY3A 4NA7A 3U9AH 3ATIA 1BTHH 3ZVBA 4FETA 2LP6A 5GJ4B 1DWEH 2PW8H 4BTIB 4YT6H 2CHAC 1O2XA 5A0BA 2BX3A 3BEFB 3MO6A 1MZDA 3FP6E 5SGAE 2ODQA 1FLEE 1QRZA 2EQNA 1YM0A 4X8TH 2AIPA 4O03A 2FTLE 1GJBB 3ZVGA 5L2ZH 5DSFA 2RA3A 1ZPZA 5LPEA 5F53A 3U98H 3UY9A 1EAUA 3ZZ3A 3RXCA 1BJUA 3PRBA 1ELDE 1AZZA 3MHWU 4MPUA 4CRCA 3MU0A 2ZTYA 3P17H 3QTOH 1MTVA 4CRFA 4OS6A 2GT8A 5JDUB 4JZDH 1Y3WA 3M5NA 5IYTA 1O3OA 2W7SA 2V35A 4NZLA 5LH8A 3AW0A 2G00A 1IQGA 1ZHRA 3FANA 1TYNA
chains in the Genus database with same CATH topology
2FP7B 4D8NA 1C2IA 1P3CA 1C9TA 1XUFA 1O38A 3JZ2B 2F83A 1NRPH 1FIWA 3O8DA 1MBMA 3RXLA 2VVUA 2ZF0H 1OWDA 1YPMH 4CRGA 4ABAA 4CBOA 1SG8B 4F4OC 4AN7A 1ZYOA 1DY8A 3DT0H 3GY7A 1K2I1 1W14U 3TVJB 6CHAC 1BITA 1GL1A 2V0BA 4IS5A 5GIBA 1ACBE 1ELEE 1HAVA 3PMAB 1P9SA 2AGIX 1W10U 1EZSC 3QWCH 2ZTZA 1AO5A 2I6QA 4YM9A 1ZOMA 2BY5X 1NC6A 1TIOA 1ZMNA 1CBWB 1T4UH 1GMHF 2Q1JA 3UIRA 1PYTD 3NCLA 1VR1H 3ZZAA 2VWOA 2PHBA 2BY6X 1MMJN 3H7TA 1EQ9A 1DWDH 3ZVCA 3F9GA 1RD3B 2PKAA 1LVOA 5EQSA 1NRSH 1C5OH 1C5UA 1G37A 1S81A 1UCYE 1RJXB 3A81A 5EQQA 3OSYA 1NROH 1TX8A 1BHXB 1FNIA 1QL9A 3PROA 5EW2H 1ZPCA 3F6UH 3TK6A 2AMDA 3QO6A 5K0HA 2GCHG 1B0FA 1AZ8A 3MYWA 4I8GA 4Z6AH 4ZXYH 3TITA 2OBQA 1MTSA 3UR9A 1A2CH 5A8YA 2QGRA 5E0GA 4ISLA 1MD8A 4Y11E 2V3HH 3S9BA 1DPOA 1AB9B 3UWIA 2VVVA 1B0EA 4ZHAA 4INKA 3PMJA 2QCYA 1PPFE 2ZU1A 1F7ZA 2P3FH 3RMLH 3ZZ5A 4TPYA 1G9IE 3ZV8A 2A4GA 3GYLB 3PM3A 2NU2E 2BLVA 1UVUH 3PWBA 1TGNA 1H8DH 3RXIA 1AWHB 2BQ7B 1C5XB 1WOFA 1GJDB 1ZJKA 5FAHA 3SUDA 2PFEA 4DJZB 3KQDA 1Z1JA 4BTUB 1TGCA 3TH2H 4BAQB 1YCPH 3QZQA 4ISOA 2H9HA 1MUEB 3A80A 4K69A 1SGNE 3VB3A 1KDQB 4FXGH 3Q00A 1O5GH 1CVWH 4LK4A 4DY7B 2WPHS 2WUCA 1SHYA 1EP5A 1KLIH 2C8XB 1ABIH 2G51A 1EPTC 1ESTA 1BMLA 2JETB 3I77A 1S82A 1Z7KA 1CA0B 2ZDKA 2GD4B 3A86A 2ZQ1A 4Y10E 1EJMA 1QJ6B 2TGAA 4OS1A 3L33A 1O3LA 4K3JA 2SGQE 2ZO3H 3A84A 5FPSA 1AVWA 1GBCA 4GAWA 4IN1A 5BRRE 1ABJH 4X0WU 4X1NU 2VIDA 4WJG2 1YLCA 4X1SU 1PPZA 3SU4A 3C1KA 1GBKA 1DS2E 1EUFA 2OCVB 1ZRKA 4K2YA 2OUAA 2JH5D 1O2PA 5DP4A 1Y5AT 2B9LA 1NESE 1P02A 1TGTA 5C3NA 1NU7B 2H5CA 4ABHA 1GBAA 1MAYA 4HI3A 2O8LA 1BA8B 1PQ5A 2GCHF 3BTHE 4NWKA 3SI3H 2VH0A 3SN8A 1L1NA 1F92A 2Z94A 3AASA 1LPKB 1UTMA 1GI8B 1PQ8A 4KKDA 1YPGH 1IQFA 3SNAA 1CSOE 1P04A 3NZIA 1O2RA 5AFZH 3A7WA 2A2XH 1WUNH 1BTYA 2WYJA 4WMDA 1GJ7B 3NWUA 4FUIA 1O2HA 4OGXA 4NFFA 1FY3A 2VH6A 4BANB 2ZI2H 1K22H 1OXGA 4LZ4B 3NUMA 4DCDA 4YOIA 1E37B 2BXTH 3MNSA 2H1UA 3BG8A 1PFXC 1TFXA 1QNJA 1GMDG 1KIGH 1Y59T 5JB8S 3ATKA 3KHVA 1O32A 1F5RA 4FU7A 2GGVB 2ZPRA 1O2YA 1P2MA 4WH8A 4YZUA 1O3JA 1SGRE 1C5YB 1H1BA 2KAIA 5TJXA 1GG6B 1PPBH 4BNRA 3SV2H 2ZDMA 1ELVA 4FU9A 3S9AA 3RXHA 1L1JA 1A46H 1Y3XA 5FCKA 4ABEA 3TJVA 1QBNA 4H42U 1DLEA 2D26C 4X6OA 4AFUA 4OGYA 1FI8A 1CQQA 2ZU3A 5E2PA 1C2GA 1A5HA 5EPNA 5GDSH 3NPSA 1T4VH 2ZDLA 1PPGE 3DFLA 1AFQB 1ZLRA 5C2ZA 1C4V2 2VWNA 3UNQA 3UOUA 1QCPA 2BD2A 4XBDA 1GI7B 1NPMA 5EXNA 1O3NA 1JIMA 1V2RT 1HXFH 5DG6A 3G01A 1S85A 3C27B 1GI5A 1DXWA 3MH5A 1O2QA 4TY7A 1DT2A 2Z9IA 1ZMJA 1JMOH 2XWBI 3VPKA 1NTPA 2HALA 3E6PH 3F9FA 3KQEA 4XDEA 2G52A 7GCHG 1EJNA 2SGEE 3OY6U 4SGAE 5A0AE 1O2UA 2AIQA 3ZZ9A 1GHWH 1MTNB 2BDHA 3LC5A 1BDAA 3SQEE 1ZRBA 3RXSA 1DFPA 4X8UH 3DA9B 1C2HA 2PUQH 3E0PB 3PMBB 2ZU4A 1T31A 1S83A 1SVPA 4X8VH 2F9BH 2THFB 1C2FA 1ZTKA 1KSNA 4X6MA 1C1TA 1SMFE 4GCHG 2HPQH 5B6OA 4XBCA 3DFJA 1YPHE 1EAIA 1YPKH 2O9QA 3SQHE 2SFAA 1P2JA 4FUBA 2VB0A 4YO9A 2ANYA 4BXWA 3NXPA 2ZHFH 5GWZA 2AMPA 2BY7X 1BRBE 2Y82A 1ZJDA 2WPMS 4H6TA 1RIWB 2Y6TA 4AFSA 1XM1A 1YPHC 1YPEH 1GMDF 2R2WU 4YLUA 1O3IA 4AZ2B 3O8RA 2P3TB 3ATLA 1EAXA 4CRBA 2RA0A 4XOJA 4ABJA 3LGUA 3FZDA 3PYHA 1P05A 3TPIZ 3RC5A 3UNRA 1YC0A 3MFJA 3SV8A 1T7CA 1DDJA 1TMUH 2I6SA 1C9PA 1OS8A 4UEHH 2ZGJA 5ESTE 3P8FA 1L0ZA 3BF6H 3GDUA 5CE1A 3SV6A 2GMTB 1ELTA 2BDGA 4INLA 3GY3A 2Z9GA 2XTTB 1XUGA 2F3CE 1D3QB 4KTCA 1C1QA 3SZNA 1YBWA 2ZHQH 1O5DH 3A82A 4IGDA 1YLDA 1L4DA 1O3DA 3SNCA 1A5GH 1YF4A 1XXFA 2Z9LA 3BIVH 3RU4T 2FOFA 2G55A 1TRYA 1TRMA 3LGYA 5EODA 1H9HE 2BQ6B 2W7UA 1HUTH 4ASHA 7GCHF 1TNKA 3BTME 1VGCB 2TGDA 2OXSA 3UQOA 1PPHE 3VGCB 1C2DA 3I29A 1CBWC 1H8IH 1NZQH 1ZPBA 1UVOA 2F91A 1JRSA 3SNDA 5FBIA 1LHFH 4CHAC 4JZEH 1FDPA 3RXAA 3RXTA 4FUHA 5EPYA 4GCHF 5CMXH 1O3MA 1O5AB 3ITIA 3VB6A 3RDZA 5FXLA 3ZZBA 3LDXH 3TGIE 4X1QU 3MMGA 1GVLA 1TGBA 2YOLA 1SGDE 1HDTH 1MD7A 2F9OA 2WV4A 1P8VC 2Z9JA 1CO7E 1ZGIA 1P0SH 2VIPA 1P03A 2P93A 3Q3YA 3ELAH 5GCHF 1MU8B 1AB9C 4XE4A 4NZQA 1LHEH 2RG3A 2ZCHP 5AFYH 1GJ5H 4MNXA 4Q7YA 4AORA 2PV9B 1C2EA 1SLUB 3PTNA 1CE5A 4DOQA 1SHHB 1UTOA 3A89A 1C5PA 1T8MA 1HYLA 1BBRH 2WYGA 2J4IA 2BDAA 8ESTE 2XC0A 4D9QA 1UTPA 1VITG 4NG9H 2ZCKP 4FUFA 1NU9A 3PB1E 3SORA 1O37A 3U1JB 2CV3A 3URDA 1FY4A 1KLTA 1O2MA 1V2TT 2J9NA 3GY4A 2QF0A 4ZH8A 1HJAC 1KXCA 2CN0H 3A85A 1NFUA 1UCYK 4O97A 2A4QA 2QAAA 3RXPA 1C2JA 2FI4E 3K2UA 4MG3A 5F8XA 4UD9H 4B2CA 3K6YA 3LC3A 1P10A 1QB9A 3RXUA 1GHVH 2BLWA 1ELBA 3TNSA 1DSTA 5DJ7A 1O3BA 2ZC9H 1BTZA 1D3PB 4I33A 3HPTB 2UWOA 5ESBA 3TJOA 5C67A 2FPZA 2JETC 1CA0C 2OQ5A 1SLWB 1S0RA 2W3IA 2HLCA 2FOCA 5DP3A 1ETRH 1LHGH 4CREA 1HB0B 1UK2A 1C1OA 1IQLA 1O34A 5JBAS 1BJVA 2XCFA 5DP7A 2FZZA 1EASA 1YP9A 2Q6DA 2BYAX 2IPHA 4NA8A 2KAIB 1AWFH 4Q2KA 4A6LA 4TY6A 2AFQB 3EA7A 2QXHA 3E3TA 1EATA 1O2SA 1G2LA 1BOQA 2H9TH 4ESTE 5DP8A 2QC2A 1V2VT 1V2UT 3T26A 1HLTH 1W12U 2PSYA 1KY9A 2WPLS 3FVFB 4E05H 2Y5GA 3UPEA 5FHTA 1GPZA 3GOVB 1K1MA 5J4QA 1T8LA 5FBEA 7LPRA 3TGKE 2FOHA 3UR6A 3L3TA 4LZ1H 2BMGB 3D62A 5EQRA 1TOCB 1VITF 1OWHA 3ZVAA 2DE9A 2SGPE 1RTLA 1K1PA 4PROA 2A31A 3B9FH 1XUHA 2GDDA 2Z7FE 1QGFA 2QV1A 2GVFA 1IOEA 2NU4E 3RXEA 1QBOA 3VB7A 1N8OB 1Q3XA 1A0JA 1DLKB 1GBFA 4Q7ZA 1TONA 2FOMB 3F1SB 4ABDA 3TK5A 2FS9A 4GPGA 2BDBA 1AE8H 3SJIA 5JBTA 1QRWA 3LGTA 3OTJE 1Y5BT 1GG6C 4A1VA 1CHOG 1MTUA 3RLWH 3NKKA 3P8OA 2NU3E 1GCDA 5C1UA 4IC5A 3E16B 3LONA 1GBLA 1NFWA 1QB1A 1IQHA 2GP9B 4OS4A 1SQTA 1J15A 4UFEH 1KXEA 3TIUA 4DIHH 5AVDA 3ZZ7A 1AFQC 1GVKB 2CF9H 2FX6A 3A8BA 1X7AC 4K1TA 4OS7A 2PLXA 3SNBA 1O31A 1PJPA 4XSKU 4SGBE 2G5NA 1WTHD 4THNH 3QK1A 1BQYA 3GICB 5FX6A 1RFNA 3M36A 4AYYB 2OC1A 2ZCLP 2GV7A 3AW1A 1SGIB 3P92A 1D3DB 4IMQA 1E34B 2OD3B 4AGJA 2Y5FA 1TBQH 1LQEA 3SI4H 1Y3VA 2QN5T 3BSQA 2ZHEH 2GCTB 2BXUH 2PSXA 3ZYEA 1RTFB 1ZTJA 1RTKA 1MTNC 4RN6A 3GCHB 3VEQB 3MU5A 1TALA 4K5ZA 1Z8IB 4ABIA 1ANBA 1FV9A 1KXAA 1DSUA 1UK3A 2DE8A 2ASUB 1VCQA 2IJOB 1O3FA 3BTDE 1QFKH 1V2NT 3HGPA 4I8LA 1A5IA 2B7DH 2V3OH 1ELCA 4AFQA 1Q31A 4NSYA 1QHRB 3UFAA 3VB4A 2AGEX 1THPB 1K1IA 1MKXK 4I8JA 4X2VA 3SW2B 2ZP0H 2BHGA 5JB9S 3GDSA 1A4WH 1MKWK 1QL7A 1FY8E 1RIWC 4AX9H 1P2KA 3E0NB 1TGSZ 5DK1A 5HMAA 2JH6D 3BTTE 1GGDB 1J17T 1SGEE 1PPEE 5GXPA 1THSH 2A5KA 1F0TA 1O3AA 1O3PB 1E36B 1LKAA 1GCTB 4MQAA 3RXMA 1S84A 1KXFA 2HPPH 1FONA 1G3CA 1YKTA 4VGCC 3BTFE 2WPIS 4B73A 4QT8C 1GI6A 1CHOF 2AEIH 4JK5A 2XNIA 1S5SA 2GZ7A 3GCNA 3OY5U 1EB1H 1AKSB 4WWYA 4ZAEA 4JZFH 3LGVA 2GMTC 3KEEA 1DOJA 1VCWA 1P2IA 1GDUA 1L1GA 1GBTA 1C4Y2 1D9IA 3FP8E 2R0LA 1RS0A 2GTBA 5DO4H 4MTBA 4YESB 3EAJA 2R2MB 2XC4A 1ELGA 1G2MA 2CF8H 2SNWA 2FI3E 4D7FA 3RP2A 4INHA 4AYVB 1HPGA 1MBQA 2P8OB 5T6FA 4BAHB 1MU6B 1EJAA 1P11E 3KIDU 4D76A 1GDQA 2H2ZA 1H4WA 1OX1A 2IN2A 3SU1A 4B2AA 2O8TA 2TIOA 2LNCA 2PUXB 1VGCC 2Z9KA 2CGAA 1AUJA 2M5TA 4U32A 3MTYA 3VGCC 1IQIA 2Z3DA 3URCA 3F68H 1DE7H 3T62A 1ZZZA 1ESBA 1QB6A 4R0IA 3STJA 2ZGCA 3SO3A 3RU4D 2C3SA 3BTQE 2WPKS 4Y8ZA 8LPRA 1FN8A 1MQ5A 1XVOA 4D9RA 3KCGH 1C1SA 1KYNA 3S7HB 1BTPA 3M35A 4B71A 2WV5A 2Y7XA 4ABBA 2QY0B 3K6ZA 3BG4B 2A4OA 4I8KA 2VIQA 3BEUA 3ZV9A 2AS9A 2GKVE 2ESTE 1BTUA 1GL0E 1JRTA 1ARBA 4ISNA 3T5FH 3TK9A 3HKIB 1MQ6A 4FVBA 3HK6B 4ZXXH 2CHAB 5DPAA 3T2NA 1W0ZU 7ESTE 2BLQA 1ETSH 1O36A 2QXJA 5C20A 3IWMA 5LPRA 4ISIH 3QUMP 3ESTA 4IN2A 4DG4A 2BM2A 2V6NA 5F8ZA 4X2XA 4JCNA 1GI9B 1WV7H 3IITA 1ANCA 2QIQA 3R0FA 1DICA 1O5FH 1XVMA 4CR9A 1BBRE 3RXQA 1SGPE 3SJ8A 1XUJA 2ULLA 1OPHB 1UTNA 5JBBS 2TPIZ 2J2UA 1FUJA 1SGFA 2BY9X 5AF9H 4NSVA 3VB5A 1NRNH 5DP6A 1HAIH 4JZIA 3O8CA 5JBCS 1GBBA 2FS8A 3OX7U 5I25A 5HM2A 2FESH 1ZHPA 2ZTXA 1GHAG 2P94A 3W95A 4CR5A 1P01A 1NO9H 5F8TA 1G32B 3A7YA 1TX6A 1TRNA 5A09A 4AOQA 1O2ZA 1OP8A 6GCHG 4WXIA 1P06A 1OWIA 6ESTA 2O8UA 2ZFQH 1S6HA 2UWLA 3DD2H 2EC9H 4Y76A 1TA6A 1G3BA 3EQ0H 6CHAB 2HGTH 4MDSA 1J8AA 2YNBA 1C1RA 1MZAA 1QJ7B 2AYWA 3MH7A 5T3HA 3K65B 2A5IA 2ZEBA 5ETXA 1JXPA 1CGIE 3ZVDA 2XBWA 1HAXB 2C93B 1FY5A 2WUBA 2ZU5A 1MTWA 2QA9E 4I31A 3V13A 3RC6A 1AN1E 2A7JA 4Y7AA 4Z0KA 2BVXH 1VJAU 4AG2A 3AVZA 3GY8A 1SFQB 4GHQA 1K1OA 1BTXA 1D6WA 1QR3E 2F9UA 1GI4A 1EKBB 3RXKA 3IG6B 1SOTA 1ARCA 2TBSA 1S0QA 2F9VA 2Q6FA