3MHWU

The complex crystal structure of urokianse and 2-aminobenzothiazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of 2-Aminobenzothiazole-based Inhibitors in Complexes with Urokinase-type Plasminogen Activator
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 59
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU01
1JXPA 3VPKA 3M35A 8LPRA 1YPJH 1F7ZA 2ZI2H 3A7XA 8ESTE 1W7GH 1GCTC 5JPMH 4ZHMU 2SGDE 4NSVA 1GCDA 1NFUA 3VB4A 1O3HA 1CA8B 2BY5X 2A31A 2EA3A 5DP5A 2JH6D 4ZHLU 3Q3XA 1H9LB 2ZU2A 2PUXB 2XTTB 3Q77A 5E2OA 2J2UA 4Y0YE 1KIGH 3TLOA 2BZAA 3A89A 3P70B 4UE7H 1NN6A 3RMOH 4NG9H 3TH3H 3S9AA 1K9OE 2IJOB 2BLOA 2XWAA 3MO3A 1F2SE 2K1QA 3C1KA 1O2LA 3NKKA 4GAWA 3GDVA 5JBBS 3D65E 3QZQA 1AVXA 3SU1A 1SGEE 2HNTC 3E6PH 4XOJA 4BAOB 2Z9LA 3UQVA 2VIPA 3ZZAA 1C4Y2 1ZMLA 2VIWA 1PQAA 5GCHF 1LVOA 5C1YA 4AFUA 3GCHC 1GBJA 4X8UH 2CGAA 1GHYH 3A8BA 5ESTE 2SNWA 1CHOG 2Y5GA 1MTSA 3A8AA 1UCYH 1ESBA 3KHVA 4AFZA 1QGFA 1HAVA 1GJCB 4DW2U 2Z3EA 1G3BA 3TH2H 2GD4B 1BCUH 2VU8E 3BTGE 1JWTA 4WXVA 1C5QA 1GVLA 1RJXB 3NWUA 1BUIA 2PLXA 4JZ1A 4UFGH 1CGJE 3TJNA 2J34A 6CHAC 4GLYA 3V12A 1C9PA 4X1SU 3AASA 3GCNA 3K2UA 2BD9A 3M5NA 3RXKA 1ZHPA 3VGCC 4BAQB 3FVFB 5DP7A 3BF6H 3UPEA 4U32A 2A7CA 1IHSH 4ZH8A 2SFAA 4FVBA 1A1RA 1FZZA 1TNIA 4ZKSU 4CHAC 1GJ6A 2QIQA 4J2YB 3MTYA 1S84A 1LVMA 1GJAB 2VVUA 1O35A 2XYAA 4H4FA 3MU4A 1GBTA 3HGNA 3TJUA 1AN1E 2G81E 2QV1A 1P0SH 1QB1A 3E1XB 3T27A 1TQ7B 1O2TA 4KTSA 3PO1B 1IQEA 2IN2A 3SZNA 1B0EA 1SMFE 3RXFA 1N8OB 2O9QA 1XUGA 2CV3A 3F9FA 1D3QB 1RXPA 1TRNA 2ZECA 1GJ8B 3W95A 3BEIB 5AVDA 3SOSA 1EKBB 4FUJA 1P11E 2AS9A 4MPWA 1YP9A 1A5IA 4A1TA 2XBXA 4IS5A 1L1GA 1QB9A 2BY8X 4IMZA 1NO9H 1UVUH 3HKIB 4UONA 1C4V2 1W0YH 1SBWA 2UWOA 1S6HA 5C67A 2HGTH 1W14U 2EC9H 3NK8A 3P8OA 2J92A 2O8TA 3ZVDA 3A86A 3CP7A 2Q6GA 3GICB 4FU7A 5HYOA 2CHAC 2FIRH 1SI5H 2BM2A 4F49A 1F0SA 1C2GA 3HK3B 3KF2A 1IQIA 1MU8B 3T29A 4ZKNU 3AW0A 2UWLA 4Y7BA 2FDAA 2AGIX 3RC4A 1KLJH 3SNAA 3U8TH 4NIYA 4KKDA 3RU4D 2FS8A 3ZZ5A 5LPRA 1EZUC 1C1SA 1PYTD 3M3VA 1AU8A 3NUMA 5A09A 8GCHG 2EI6A 1NU7B 3PMHB 1FV9A 2HNTF 2B7DH 2OP9A 1YLCA 1DM4B 1V2QT 2WUCA 3GYMA 3SNDA 3UR6A 1EOLA 1CT0E 1HAIH 1SFQB 1KY9A 1SGFG 1RTLA 1TB6H 1A4WH 1O31A 3RXEA 1O2SA 2BLQA 2QAAA 1C2HA 4BANB 4NA8A 1UTOA 1AVWA 5EOKA 2GKVE 4MVNA 1CT2E 2HWLB 3GYLB 1UVSH 1BTZA 2PKSB 4FUCA 1K1IA 1ABIH 1O3CA 1TX6A 1HBTH 3RXDA 1O2IA 2VWOA 1L0ZA 3ZZCA 2OXSA 1K1JA 5C5OA 2XCFA 1LHCH 1UCYK 2AERH 1LHDH 1T31A 4YOIA 1O32A 1T8MA 1DUAA 1GMCG 4Y0ZE 2NU1E 4B2AA 1BRBE 2ALPA 1S0RA 1TMUH 3RMNH 1ESTA 1BHXB 4OGXA 1TWXB 2R2MB 3MNXA 1TBZH 4VGCC 4RSPA 3A87A 5F8TA 2PKAB 2Q6DA 5LGOA 1EPTA 1EP5A 1UHBB 7GCHG 2A45B 3TPIZ 1WTHD 3UWIA 4CH2B 5A8YA 4OS2A 1C5XB 4Y10E 1NTPA 1TQ0B 1G36A 1DVAH 4WY3A 3SQHE 1ZPZA 3A7YA 2H9HA 1KXFA 3S7HB 3OY6U 3P95A 1FY3A 2XWBI 1C5LH 1K1LA 1OWKA 2FOBA 2WPMS 3CS7A 2G4UA 3OY5U 3RLYH 1C5SA 1P03A 1SPJA 1HLTH 5E8EH 4YOGA 1IQHA 1NFWA 3SW2B 2TBSA 1THRH 1V2PT 3BIUH 3EA8A 2A2XH 3BG4B 1HJ8A 2FX6A 2O8UA 1WBGB 3FZZA 1SLWB 5F6MA 4A7IB 3UNQA 4IGDA 3RXBA 2GCTC 5E0HA 3SJOA 1KDQA 3VGCB 2BD7A 1P2IA 2Z9IA 2J38A 3EA7A 2AGGX 2PR3A 4X6NA 3ZZDA 1UTQA 1UVOA 1HIAB 1XVOA 3LKWA 1UTJA 2FI4E 1O5BB 2GMTC 3RU4E 4B1TA 5J4QA 5EQSA 1LPZB 2THFB 5HGGA 1EZSC 1MBQA 1B7XB 1E34B 1AFQB 1FAXA 5H4IB 4I8LA 1SSXA 3A7VA 1ARCA 1ZPCA 5E2PA 2VIQA 3P8GA 1P04A 2WPJS 1TNKA 2LPRA 1H8DH 2ZDNA 4INLA 1ANDA 1S6FA 4LK4A 2VVCA 4NA9H 1ZMJA 1SGTA 2WINI 1IQKA 1O2KA 4WWYA 5JYIA 3S0NA 1E0FD 3DA9B 1GJDB 3ENSB 2ZGBH 1XVMA 2HNTE 1BA8B 2FOCA 1MUEB 2OC8A 4OS5A 4FXGH 2DUCA 1O3LA 2ZU1A 1Q3XA 4IN2A 3GY7A 2C4FH 5PTPA 1V2OT 4Z6AH 1O3EA 3M7UA 1ZJDA 1MMJN 1IQJA 3CS0A 2TGDA 4K60A 1F5LA 1CBWB 2BLWA 3LGYA 3BTDE 2BVRH 2ZDVH 4BTIB 1T7CA 1P2NA 1KXDA 1TIOA 2D8WA 1DDJA 3ATKA 3RXVA 1P05A 1D6WA 5A8XA 1FMGA 2ANKH 4XBBA 2UWPA 3RDZA 2A4RA 1FDPA 1NFXA 2H6MA 2OD3B 4X1PU 3LJOA 2QC2A 2C8WB 2GCHF 1D6RA 4QT8C 4WJG2 3RXUA 3SU0A 1X7AC 1S82A 2AEIH 4X8VH 5IYTA 2ODYB 3MH6A 3N7OA 3U8OH 3BEUA 4AG2A 1HPGA 1CT4E 4YESB 4JYTA 1J15A 1J17T 2ZKSA 5T6DA 2F9PA 1C5WB 3TK9A 1DWDH 2BY9X 2I6QA 1FQ3A 1INCA 1GDNA 1RTKA 5FCKA 4DG4A 5DJ7A 4ZAEA 3RXRA 1BTYA 1IQGA 1TA6A 2A4GA 1ZMNA 1YPKH 2R0LA 2V0BA 1QA0A 1VJAU 2R3UA 2FOHA 2ZCHP 1DE7H 1T8OA 2HVXA 5EXLA 1LHEH 2F9VA 3ZYDA 3IITA 3SBKA 4IMQA 3TIUA 4ASHA 4X6PA 1PPEE 1CBWC 1OWIA 1FAKH 3KQCA 2V3HH 1CQQA 2WV4A 1HGTH 3D62A 2QF3A 1AB9C 4ZUHA 1O2WA 7GCHF 2ZU4A 2J9NA 1T4UH 1KXEA 2FPZA 4KP0A 2PW8H 4M7GA 4AORA 1T8NA 1BJVA 1OWDA 1KXAA 4O3UA 1HXFH 1C1TA 1SGPE 1DWBH 3SNCA 1FIZA 3ELAH 3LIWA 5A0CA 3QWCH 2NWNA 3VB3A 1PQ7A 2TIOA 2TRMA 2R9PA 1Y8TA 3ATWA 4I8KA 4ABFA 5FPTA 2AMPA 3RXCA 1O5GH 1GGDC 3GY3A 1AUJA 3RXJA 1AFQC 3HATH 2XW9A 4DVAU 1TGBA 2BHGA 1O3KA 2ZCLP 3UFAA 1TMTH 4UFEH 2VGCB 1CHOF 1J14A 1H8IH 4X6MA 1OS8A 3OTJE 3ZVAA 1O5CB 1ZSJA 3S9BA 2HPQH 1TGTA 5I25A 2XC4A 4JZEH 2BDIA 4OGYA 3UNSA 5CMXH 1EAXA 4INKA 1MCVA 5FPSA 1AHTH 1AZ8A 1GBCA 5DP8A 1XM1A 3QK1A 2D26C 1DT2A 4YOJA 3LU9B 1O2HA 1TRMA 2CHAB 1GI6A 4D76A 1LMWB 1CE5A 1ANEA 2Y7XA 1P2JA 5L2YH 1G3DA 5L2ZH 1YC0A 4I33A 1ZR0A 3LPRA 1NT1A 4Y6DA 3VXFH 3RUOA 1EATA 1Y3XA 4WVPE 4K2YA 1K1OA 2Y80A 4ISNA 1Y3VA 1TABE 1YF4A 3TK6A 5EW2H 1CGHA 1PPFE 3RXAA 1TOMH 2D2DA 2OQUA 1VCWA 2STAE 1TNJA 1O38A 4TPIZ 5T3HA 1XX9A 4D9RA 1P3EA 1ZHRA 4O03A 4X2VA 4MDSA 1UK3A 1FY8E 1GMHF 2ZFSA 1GI4A 3SO3A 1ELTA 1P8VC 5FAHA 1ZOMA 2QXIA 2BX3A 3GCHB 1HAXB 2EI8A 2BLVA 1KLTA 3UUZA 4YM9A 1Y5UT 1GHXH 1DLKB 3RXMA 4GVUA 3PWBA 3SV6A 2BY6X 1KSNA 1J9CH 1O2XA 3RXSA 2PKSC 3HK6B 1S0QA 3MU1A 2B9LA 2ZDAH 1TYNA 3KGPA 1YPMH 1OWHA 2TGAA 2HRVA 1NZQH 4MNWA 2ZF0H 4FUDA 1GHZA 2QN5T 2A2QH 5TJXA 5CHAB 4E7NA 3RXIA 3A84A 2BD2A 3QDZB 3GCOA 3R0FA 2W3IA 1YPHE 3BN9A 4UEHH 1SL3A 1G30B 2J95A 4CRDA 2Z9KA 1O3DA 3NPSA 4ZXYH 1EB1H 1BMMH 1LQDB 1RGQA 2BD5A 4ABDA 1HAPH 1MTWA 3H5CB 3FAOA 2ZTYA 4RKJB 4B2BA 2F9BH 3K65B 4FUFA 1O5EH 1MZAA 4Y71A 1P9UA 4Y8YA 1G37A 3NCLA 3PMAB 1QY6A 1HJAC 2FOEA 7ESTE 4NIVA 2QYIA 1FPHH 2CF8H 1ZTKA 1ZJKA 4KTCA 4R8TB 4CRAA 1GHAF 1V2VT 2GV7A 4XSKU 3UREA 5EU8A 2FXRA 3RC5A 1TLDA 1N1LA 1D3PB 4GCHF 1ANBA 1A5GH 4AX9H 9LPRA 1Q2WA 3O8DA 2BB4A 4IBLH 2QF0A 2EEKA 2BQ6B 1ARBA 5EXNA 1O5AB 2G8TA 4Q7ZA 9ESTA 1NC6A 5AFYH 1F92A 3SORA 4DY7B 3DUXH 1A3BH 1OWEA 1C1QA 2Z3CA 1YPLH 2H9TH 4X8SH 1ETSH 2C8ZB 1BTWA 3Q3KA 1CVWH 2UUJB 3QUMP 1UTNA 1GVZA 1GHWH 2SGEE 4DGJA 1XXDA 1EAIA 4NZQA 3T26A 4B73A 2A4OA 1QBNA 3TGIE 1QIXB 1GI9B 1MTVA 2TPIZ 2P8OB 2ZHWH 2UUYA 1PPZA 2Z9GA 5DG6A 4AYYB 3ZVEA 1Z71A 4NIXA 4UDWH 4A6LA 2ZIQH 1JIMA 5LPEA 5C1XA 3PLBA 1NFYA 3F9HA 3URCA 1VITH 2NU0E 5DP4A 1K1MA 2ZTZA 4ZROA 4H42U 1ID5H 2A7JA 4O3TA 2VH6A 1T32A 2FX4A 3SJKA 5T6GA 1GJ9B 1VJ9U 1RIWB 1LO6A 1V2MT 4I8JA 4YT6H 1UTPA 1VCQA 1SHYA 3SV9A 2XBYA 1MD8A 1WQVH 2Z7FE 4ISOA 4YO9A 4WMFA 3D49H 2ZCKP 1FJSA 3PLKA 2FZZA 4TWYA 3KIDU 3SJ8A 1ANCA 1GBHA 1GJ4H 4HZHA 2CMYA 1DUEA 1XMNB 2GV6A 2FO9A 2ZHDA 4X0WU 5SGAE 4HTCH 1F5RA 2NU3E 1FIWA 2PWXA 3P17H 3QO6A 1TFXA 1GI5A 1SQOA 1ZSKA 1H4WA 2ZGXH 1NU9A 1HDTH 3BG4C 4FVDA 2KAIA 1TMBH 3P92A 1BBRE 3GY8A 5JDUB 4X6OA 1BBRK 4BTUB 1YCPM 2Y6TA 1AWFH 5BPEA 3M5OA 3SQEE 4IC5A 2F3CE 1PYTC 4GCHG 1ELDE 5JB8S 3QN7A 1U6QA 2ZA5A 4B75A 1O2PA 4F4OC 4ABJA 3BIVH 4BTTB 4JZIA 1TPOA 3DHKH 2BDHA 2ZEBA 1O37A 2GZ9A 1WYKA 2ZQ2A 2Y82A 4JK6A 2BD3A 3I29A 1ELEE 3A8CA 1LPKB 1XUFA 1QNJA 4FUEA 3R3GB 3KL6A 3BTWE 3PTNA 3A80A 1C1NA 3E3TA 2TGPZ 1QRZA 3FFGA 4E05H 1KXBA 5HXFA 1TNHA 1P12E 2PSYA 3L3TA 1HRTH 1MAXA 1O3GA 1PJPA 3MI4A 2ODQA 2XBWA 3VB5A 1UO6A 2W7UA 4B71A 3ZZ3A 4CRBA 4U2WA 1UTLM 7LPRA 5FBIA 1QL7A 4B2CA 1DXPA 3T62A 5EQRA 2P3FH 1O5DH 1GHAG 1QFKH 1TAWA 2ZHFH 1K21H 1C5YB 4AOQA 1GDQA 1B0FA 1K1PA 1A61H 1FN6A 1EAUA 3M36A 2FTMA 1YM0A 4WH8A 3MHWU 3EQ0H 4JZDH 6ESTA 2P94A 1FN8A 2CJIA 1ZGIA 2P16A 2QA9E 1G9IE 1QR3E 2AMDA 3TNTA 4JYUH 1W10U 1V2NT 1FY4A 2GTBA 1W3CA 3LGVA 2UUFB 2BDBA 1IOEA 1FXYA 3M3TA 1O3BA 1QRXA 3E0NB 3AVZA 2OBQA 1C5VA 1SR5C 2XCNA 1B5GH 1P3CA 2ZGJA 2HALA 2EI7A 5A8ZA 3SUEA 1MAYA 1K28D 2VB0A 4OS4A 2W26A 3ZVBA 5GJ4B 3ODFA 1MKWH 5L6NH 1NPMA 3SI4H 4B76A 1QB6A 5F8ZA 1HXEH 2FOGA 5C5NA 2ZFQH 1SG8B 1F5KU 1TX8A 3PO1C 3LT3A 1DANH 2XBVA 4MNXA 1OSSA 1SGRE 1O2OA 1PPGE 2ZDKA 5EODA 1F0TA 3SHAH 3BTHE 1Y3WA 4CRCA 2ZDMA 2AIPA 2RCEA 2AIQA 1YBWA 1WU1A 1AQ7A 2G00A 1N6XA 3OYPA 3RXLA 1WTGH 1O3JA 2BQWB 1C1MA 2WYJA 5C3NA 3M5MA 1C2LA 1F0RA 2GCHG 4LOYH 4UFFH 1GL1A 4CHAB 1RRKA 1FLEE 2C8YB 1Z1IA 1HAOH 1AUTC 2YNBA 3BEFB 2FTLE 1G32B 4LXBH 4ZKRU 2PGQB 3M7TA 1Z8IB 1UTMA 4A5TS 2J4IA 5K0HA 4I7YH 3ATIA 5JB9S 1TPPA 1OP0A 5E0GA 4NIWA 4Z0KA 3F9EA 1P2MA 1QA7A 3BTKE 1G2MA 1QQ4A 1IAUA 2PHBA 2VNTA 3EE0B 1DICA 1W0ZU 1O36A 1C2EA 3PM3A 3SU3A 1ZGVA 1OX1A 1WCZA 3ZZ9A 4YZUA 1A46H 2FYRA 1SGNE 2F83A 2A5IA 3MO9A 1L4ZA 1ELGA 2ZWLH 1FI8A 5FXLA 1UHBA 3ZZ8A 4TPYA 2STBE 1ZZZA 2OBOA 2V35A 5A2MH 3GCTF 1MH0A 1DITH 1BQYA 3SNBA 2ZPRA 1TNGA 6GCHG 1YCPK 1C1VH 1FUJA 1GI0A 2VVVA 3A83A 3NZIA 4NA7A 3VB6A 1MZDA 1CSOE 2CF9H 4Y76A 4X2XA 5FPYA 4WXIA 2FLRH 2WPIS 1KDQB 2IOTA 3MOCA 2DE8A 1MTUA 1EPTC 2FI5E 3QLPH 2ZFTA 5EGMA 2BDCA 3SU4A 1Y59T 4SGBE 1N6YA 5T6FA 4DCDA 3RM2H 3T25A 1GBAA 3E90B 2W7SA 4SGAE 1AD8H 1MTNC 1AMHA 3L33A 1MKXH 1S5SA 1DFPA 2SNVA 4X8TH 1VGCC 1OXGA 2OQ5A 4XBCA 1YGCH 3EDXB 3OSYA 1QBVH 3EAJA 1XKAC 3SU5A 3UWJH 1W7XH 1V2TT 3LGWA 2ZPSA 1AO5A 1GGDB 3E8LA 1P06A 3K6YA 4O9VA 2ODPA 2BMGB 1V2ST 2G52A 5HM2A 4K3JA 1O2QA 1EX3A 4D7FA 2LNCA 1O2MA 1SGDE 4KTUA 3U1IB 4RKOB 2GCTB 4YLQH 4VGCB 2GDDA 3BTME 1GBDA 1TE0A 1TRYA 1V2WT 4HGCA 5AFZH 1C5NH 1LDTT 1TPAE 2ZPQA 1GHVH 1P2OA 1FY1A 5LPFA 2BOKA 2WPHS 2OC7A 1IHTH 1TALA 3PYHA 4GSOA 2JKHA 5C1UA 2SGFE 3MFJA 4H6SB 1E38B 4ISLA 3LONA 3B23B 3QGNB 1GPZA 2HLCA 2ZG0H 1SGFA 1EUFA 3IG6B 4K69A 2JH5D 1DOJA 1GI1A 1SGYE 4DIHH 3O8CA 2ZP0H 4BAHB 3A82A 4K5ZA 1TBQH 1PPCE 3TGKE 3P6ZB 3RXGA 1SLVB 3HPTB 1BHXF 1NRPH 1MQ5A 1TOCB 1BRUP 1LKBA 1MD7A 4Q2KA 2GMTB 2ZFRH 4K8BA 2SGPE 3FANA 1AE5A 2BDGA 4NZLA 1V2RT 2G5VA 1AB9B 4H6TA 1O3OA 1KTTB 4X2WA 5JBCS 1CGIE 1D3DB 3ZV8A 3VXEH 5FX5A 1XUKA 1Z6EA 1ZRBA 3RU4T 2CN0H 2F9UA 1ZTJA 2ZO3H 2ZFFH 3UOPA 1DX5M 2PFEA 1ABJH 2Z94A 2C93B 2ZC9H 3ZYEA 3HKJB 5JBAS 3SGAE 2FWWA 3ESTA 4AG1A 1SLUB 5DPAA 1P9SA 3OU0A 1S85A 4ABHA 2ZU3A 1P2QA 4GPGA 4U01A 4X2YA 1Y5BT 1O3FA 1DWCH 4XDEA 1H1BA 2RA0A 2FOMB 1YYY1 1AKSA 2ZZUH 1WAYB 1MBMA 2P93A 1A0HB 1VCPA 2FM2A 1AZZA 4ZKOU 4YTAA 2PTCE 3FZDA 2BDYA 4MQAA 1O5FH 2RDLA 4B74A 3TU7H 4BXWA 1H9HE 1WOFA 1GHBF 3C27B 4FU9A 4TY6A 5IDKA 1Z8RA 2BY7X 4HFPB 1P2KA 3LDXH 3LGUA 3O8BA 1XKBC 3MU0A 1QL9A 1QL8A 3MU8A 3T28A 1HIAA 4OS7A 1VZQH 2FI3E 2ZNKH 1O2RA 5ESBA 4IC6A 6CHAB 3MO6A 1HAHH 4NSYA 2BZ6H 1C1PA 2FOAA 1BTPA 4Y79A 2FP7B 2BOHB 3LGTA 4CR9A 1RS0A 3GY6A 4JMYA 5AF9H 4THNH 4O97A 4BAMB 3F9GA 4MNVA 2B0FA 2ILNA 1HCGA 1P10A 3Q76A 2ULLA 1DWEH 5C20A 2GDEH 1W12U 2H5CA 2ZHEH 5CE1A 4BAKB 4FUIA 1CHGA 1LVYA 1AWHB 5TCAA 3I77A 2ZDLA 1Y3YA 1P01A 2HOBA 2PGBB 1SVPA 4TYDA 5A0AE 3S69A 1O33A 2XNIA 1PPHE 1GJBB 3STIA 1EAWA 1QJ1B 3F6UH 3CENA 2XC0A 1RD3B 3GDSA 1VGCB 4TY7A 8KME2 3QGJA 2QXJA 1IQNA 1MKXK 1EJNA 5JBTA 5EPNA 1GI3A 3SGQE 4GHQA 4MTBA 1S81A 1H9IE 1QHRB 1PQ8A 2P3UB 1A3EH 4CRGA 1DY9A 1UTKA 5DP9A 5GCHG 1LCYA 4NWLA 4I32A 1FPCH 1VITF 3M3SA 4E06H 2BQ7B 2A5KA 2BD4A 2C3SA 4JCNA 3ZZBA 1O3IA 1A5HA 1LPGB 4R0IA 1S83A 2M5TA 1O34A 1QCPA 3SJIA 1CA0C 1GJ5H 2A4QA 4FUGA 1XUIA 1UJ1A 1HJAB 6GCHF 2FEQH 4HI3A 1WV7H 4AYVB 1BT7A 1MU6B 1BRAA 2XRCA 2WYGA 1HJ9A 2OTVA 5GPIB 1RFNA 1NRSH 1BITA 1C1WH 1C5PA 3VEQB 2FMJA 3AAUA 1PQ5A 1G3EA 5L30H 2OCVB 3SJ9A 3ODDA 2TGTA 1Y5AT 2G5NA 2AYWA 3H7OA 2PSXA 2AH4X 2OC1A 1NROH 2H1UA 1ZRKA 1A0JA 1MTNB 2VINA 2GZ8A 2GZ7A 4CBNA 3ZVGA 5HM9A 1NS3A 1UVPA 1QQUA 4I31A 1P57B 1OYQA 2QGRA 1GBIA 1EZQA 1YPGH 3G01A 1K22H 3A7TA 1VR1H 5ABWA 1C2IA 3SGBE 2O8LA 3S9CA 2VIVA 1EQ9A 3BSQA 3SHCH 1Y3UA 1BTHH 1MCTA 2FESH 1JOUB 3RXTA 1JIRA 3WY8A 3T2NA 3DD2H 5GWZA 1P09A 2O8MA 1O39A 6LPRA 5I46H 1AY6H 1DSUA 4Y7AA 2VWMA 1QJ7B 4DIIH 5GIBA 1NESE 1CU1A 1ELVA 1Z8JB 1C2DA 1RTFB 4ESTE 1GBBA 4D8NA 4MLFB 1UK4A 1SFIA 3QZRA 3KQEA 4A92A 1OYTH 2V3OH 2BX4A 1JRTA 2Z9JA 1GBEA 1ESAA 1AVGH 3ZV9A 3MNSA 2WPKS 3DFLA 2I6SA 1SOZA 4ABBA 1C2KA 1C5OH 1GVKB 1V6DA 2W5EA 3F68H 3ATMA 3AW1A 2ZGHA 4CH8B 1EJMA 1BMNH 1MKWK 2SGAA 3FP8E 4MG3A 2OUAA 5GXPA 1DXWA 2Y7ZA 2QY0B 1LHGH 5BRRE 1DY8A 1PFXC 2PTNA 4J1YA 1O2VA 3MNCA 5C2ZA 1FNIA 4ZHAA 3W94A 4ABIA 1GMCF 4XE4A 3KNXA 2OC0A 1GWAA 2VJ1A 5DP3A 3JZ1B 2A32A 2PUQH 1BZXE 2YOLA 1ZPBA 4DJZB 4XBDA 1GBFA 1GBLA 1K2I1 2AFQB 3U8RH 2FLBH 4NFEA 3RXHA 3E0PB 3UIRA 1V3XA 4INHA 1J8AA 1AI8H 3MH7A 4NGAH 3ZVFA 2VGCC 3M61U 1W2KH 1C5MD 3PMBB 5A0BA 1HAGE 2ALVA 2BYAX 1HAVB 1NRNH 1C2FA 4K1SA 1E35B 1L1JA 1SQTA 3AAVA 3K6ZA 1QRWA 1THSH 1TNLA 1TBRH 3PROA 3LC5A 3VB7A 1AGJA 2BXTH 2VIOA 4BXSA 2BTCE 4ABEA 2XXLA 1W8BH 1XXFA 1YKTA 3PWCA 4MPXA 1M9UA 3SNEA 1BTXA 1GI8B 4PROA 1GBMA 2FYQA 1DSTA 3UNRA 1F0UA 3H7TA 1N8OC 3STJA 3ZZ4A 1GMHG 3QX5H 2R2WU 2GP9B 2JETC 2VWNA 4NCYA 4OS6A 1IQFA 2A1DB 3MWIU 3MH4A 1D3TB 5ETXA 3DT0H 3UTUH 4YT7H 4X1NU 3RC6A 2QCYA 1GG6B 4K8YA 3RXPA 1OPHB 1ACBE 1SQAA 1TPSA 1TX7A 3MU5A 3PLPA 4UD9H 1BJUA 2O8WA 3LH3A 3B8JA 1FONA 5EQQA 5TCCA 2ESTE 2Y5HA 2ANYA 3U98H 1E37B 1A7SA 4IN1A 4K1TA 2VIDA 4FU8A 3EYDA 1HB0B 1DPOA 4GHTA 3UY9A 4Y11E 1BTUA 3E91A 5F8XA 3LOXA 1C1UH 1BIOA 3TVJB 4D7GA 2UUKB 2WUBA 4FUBA 4ABAA 1O2JA 2HPPH 2J94A 5HMAA 1HUTH 1NY22 2ZHQH 3M37A 4JZFH 1DS2E 1O3PB 2F91A 4Y8XA 5B6OA 3V13A 3TK5A 3BTTE 1HNEE 2FODA 1BDAA 3TITA 4ABGA 1C1OA 1ZYOA 1QBOA 4JK5A 1ORFA 3TJOA 1JMOH 3GOVB 1LVBA 2ZTXA 1EP6A 3E16B 5DO4H 1UCYE 5DK1A 5GDSH 2R0KA 1VITG 5FCRA 3DFJA 1SHHB 4FUHA 4OS1A 4ISIH 1OOKB 3MNBA 1V2UT 3U9AH 3EA9A 1XUJA 1GBKA 4AGJA 1V2JT 3V0XA 3MYWA 2AGEX 4Q7XA 1GDUA 2R3YA 1BBRH 4MNYA 1EXFA 3V7TA 4A1XA 4BOHA 1QJ6B 1O2NA 5FHTA 1O3NA 1BB0B 1C2JA 4AZ2B 2ZGCA 4WMEA 2NU2E 4E7RG 1D9IA 3U1JB 1PPBH 3RLWH 3ZVCA 2GVFA 1W13U 5LH8A 1EPTB 2QXHA 2PKAA 1ETRH 2GX4A 4AB9A 2V6NA 3KN2A 1KYNA 4X1QU 2W3KA 2VH0A 1NM6A 3O8RA 5FBEA 4WF8A 2WV5A 1ELFA 1BMLA 3SN8A 1A0LA 1G2LA 3FP7E 4CR5A 3BTFE 4ZXXH 1IQMA 1O0DH 3A88A 2Q1JA 2QXGA 3T5FH 4KGAA 3ZZ6A 1EZXC 1SOTA 4AFSA 2B8OH 2WPLS 3UQOA 4AN7A 1K1NA 1ZLRA 3SU2A 2BVSH 1HAYB 1QTFA 4GUXA 3A8DA 1GI2A 2Z6BD 1QURH 3SUGA 7KMEH 5AHGH 1KXCA 1UMAH 1OP2A 1XUHA 1AFEH 2YNAA 1IQLA 1Q31A 3A85A 3GCTG 2C8XB 4Q80A 5G4BA 1O2UA 3B9FH 1C5UA 3HGPA 3KQDA 2ZQ1A 3GY2A 4I8GA 1EOJA 4LZ4B 1ELBA 2KAIB 1YPHC 4AGKA 1HFDA 4NFFA 4LZ1H 5CHAC 1MQ6A 2GT7A 2Q6FA 3A7ZA 1G3CA 4XFQA 1AE8H 2B5TB 5DGJA 4BNRA 3VFEA 8GCHF 4AB8A 1C1RA 1Z1JA 4RN6A 3D23A 1WSSH 2ANMH 3A81A 3ITIA 3FP6E 2H5DA 3Q00A 3TGJE 1SB1H 3BTEE 5DP6A 1L1NA 2RA3A 1THPB 1LQEA 4DURA 5EPYA 2A5AA 1SGQE 4ZMAH 3U69H 3F1SB 3UOUA 3PB1E 2OLGA 1CO7E 5K7RA 2Y81A 1ZHMA 4AFQA 2RG3A 3K9XB 2ASUB 2P8OC 2AMQA 1A2CH 4Y8ZA 3SI3H 1HAZB 2D1JA 5E0JA 3SUFA 3PMJA 2NU4E 2CXVA 4I8HA 4NWKA 1O3MA 3A7WA 1C5TA 1LKAA 2P95A 1V2LT 3EGKH 1BOQA 3BV9B 3OX7U 2BDAA 1GL0E 1WUNH 3BG8A 2OINA 3L6PA 3TNSA 1SGIB 3RXQA 1D4PB 2F9NA 1C5ZB 1EJAA 2A0QB 4D9QA 3MH5A 1P02A 2BXUH 3GY5A 1L4DA 2F9OA 3LH1A 1HV7A 4CREA 1LTOA 3SUDA 2IPHA 4CRFA 1GMDG 1TGSZ 1C9TA 2G4TA 4WMDA 1W11U 3RMMH 2GT8A 2H9EH 3PTBA 3SV2H 1TGNA 1O2ZA 1T4VH 2G51A 1GJ7B 3ZZ7A 3TH4H 1YPEH 1KTSB 2BD8A 1YCPH 1LHFH 1BMAA 4JYVH 1J16A 1V2KT 1OP8A 3TJVA 1SLXB 3GISB 1O30A 2G55A 3KCGH 1Z6JH 1C4U2 1TA2A 1OKXA 2XC5A 4YLUA 2A7HA 4Q7YA 1E36B 1FY5A 5EW1H 4KELA 1SGCA 1TGCA 3S7KB 1JRSA 2ANWA 1HYLA 3BTQE 1UVTH 1NRRH 4UFDH 1ELCA 3MMGA 3LJJA 1Z7KA 1T8LA 4X1RU 1C5RA 3RXOA 3JZ2B 3NXPA 3M7QA 4U30A 3UR9A 2SGQE 1GMDF 2GGVB 4CBOA 3GY4A 3IWMA 1GG6C 2BVXH 5EG4A 3GDUA 1GCTB 2DE9A 2JETB 2P3TB 4A1VA 3RMLH 4MPVA 2P59A 1AKSB 2H2ZA 3V3MA 1EB2A 3P8FA 1NRQH 2VWLA 1UK2A 1O2GH 1O3AA 4ISHH 2PV9B 3RP2A 2Y5FA 3SU6A 1AIXH 1JBUH 1Z8GA 2JH0D 2FS9A 3LGIA 4WH6A 1ZSLA 1CA0B 2ZFPH 1L2EA 3LC3A 1C2MA 3Q3YA 1OWJA 1WQSA 2ZU5A 1BRCE 2FOFA 3URDA 1YLDA 3M5LA 4MPUA 3QTOH 5J4SA 1O2YA 3RM0H 1GHBG 3KEEA 3SV8A 3QTVH 1GI7B 1KLIH 1ETTH 3I78A 1ELAA 3P8NA 1RIWC 4DT7B 1DLEA 3PV4A 1EASA 1SC8U 2Z3DA 5DKMA 5EXMA 4DOQA 4IW4E 1TONA 4TWWA 4K1EA 3ATLA 3SV7A 5FX6A 5F03A 2C90B 3KQBA 1ZTLA
chains in the Genus database with same CATH superfamily
1JXPA 3VPKA 3M35A 8LPRA 1YPJH 1F7ZA 2ZI2H 3A7XA 8ESTE 1W7GH 1GCTC 5JPMH 4ZHMU 2SGDE 4NSVA 1GCDA 1NFUA 3VB4A 1O3HA 1CA8B 2BY5X 2A31A 2EA3A 5DP5A 2JH6D 4ZHLU 2OK5A 1H8HD 3Q3XA 1H9LB 2ZU2A 2PUXB 2XTTB 3Q77A 5E2OA 2J2UA 4Y0YE 1KIGH 3TLOA 2BZAA 3A89A 3P70B 4UE7H 1NN6A 3RMOH 4NG9H 3TH3H 3S9AA 1K9OE 2IJOB 2BLOA 2XWAA 3MO3A 1F2SE 2K1QA 3C1KA 1O2LA 3NKKA 4GAWA 3GDVA 5JBBS 3D65E 3QZQA 1AVXA 3SU1A 1SGEE 2HNTC 3E6PH 4XOJA 4BAOB 2YMSC 2Z9LA 5CHBA 3UQVA 2VIPA 3ZZAA 2V7QD 1C4Y2 1ZMLA 2VIWA 1PQAA 5GCHF 1LVOA 5C1YA 4AFUA 3GCHC 1GBJA 2KX4A 4X8UH 2CGAA 1GHYH 3A8BA 5ESTE 2SNWA 1CHOG 3W1EA 2Y5GA 1MTSA 3A8AA 4Z1MD 1UCYH 1ESBA 3KHVA 4AFZA 1QGFA 1HAVA 1GJCB 4DW2U 2Z3EA 1G3BA 3TH2H 2GD4B 1BCUH 2VU8E 3BTGE 1JWTA 4WXVA 1C5QA 1GVLA 1RJXB 3NWUA 2PLXA 1BUIA 4JZ1A 4UFGH 1CGJE 3TJNA 2J34A 6CHAC 4GLYA 3V12A 1C9PA 4X1SU 3AASA 1EFRD 3GCNA 3K2UA 2BD9A 3M5NA 3RXKA 1ZHPA 3VGCC 4BAQB 3FVFB 5DP7A 3BF6H 3UPEA 4U32A 4P02A 2A7CA 1IHSH 4ZH8A 2CK3D 2SFAA 4FVBA 1A1RA 1FZZA 1TNIA 4ZKSU 4CHAC 1GJ6A 2QIQA 4J2YB 3MTYA 1S84A 1LVMA 1GJAB 2VVUA 1O35A 1KMHB 2XYAA 1WXRA 4H4FA 3MU4A 1GBTA 3HGNA 3TJUA 1AN1E 2G81E 2QV1A 1P0SH 1QB1A 3E1XB 3T27A 1TQ7B 1O2TA 4KTSA 3PO1B 1IQEA 2IN2A 3SZNA 1B0EA 1SMFE 3RXFA 1N8OB 2O9QA 1XUGA 2CV3A 3PRBA 3F9FA 1D3QB 1RXPA 1TRNA 2ZECA 1GJ8B 3W95A 3BEIB 5AVDA 3SOSA 1EKBB 4FUJA 1P11E 2AS9A 4MPWA 1YP9A 1A5IA 4A1TA 2XBXA 4IS5A 1L1GA 1QB9A 2BY8X 4IMZA 1NO9H 1UVUH 3HKIB 2J97A 4UONA 1C4V2 1W0YH 1SBWA 2UWOA 1S6HA 5C67A 2HGTH 1W14U 2EC9H 3NK8A 3P8OA 3F2FA 2J92A 2O8TA 3ZVDA 3A86A 3CP7A 2Q6GA 3GICB 4FU7A 5HYOA 3WWFA 2CHAC 2FIRH 1SI5H 2BM2A 4F49A 1F0SA 4I7YH 1C2GA 3HK3B 3KF2A 1IQIA 1MU8B 3T29A 4ZKNU 3AW0A 2UWLA 4Y7BA 2FDAA 2AGIX 3RC4A 1KLJH 3SNAA 3U8TH 4NIYA 4KKDA 3RU4D 2FS8A 2QF4A 3ZZ5A 5LPRA 1EZUC 1C1SA 1PYTD 3M3VA 1AU8A 3NUMA 5A09A 8GCHG 2EI6A 1NU7B 3PMHB 1FV9A 2HNTF 2B7DH 2OP9A 1YLCA 1DM4B 1V2QT 2WUCA 3GYMA 3SNDA 3UR6A 1EOLA 1CT0E 1HAIH 1SFQB 1KY9A 1SGFG 1RTLA 1TB6H 1A4WH 1O31A 3RXEA 1O2SA 2BLQA 2QAAA 1C2HA 4BANB 4NA8A 1UTOA 1AVWA 5EOKA 2GKVE 4MVNA 1CT2E 2HWLB 3GYLB 1UVSH 1BTZA 2PKSB 4FUCA 1K1IA 1ABIH 1O3CA 1TX6A 1HBTH 3RXDA 1O2IA 2VWOA 1L0ZA 3ZZCA 2OXSA 1K1JA 5C5OA 2KCYA 1LHCH 2AERH 1UCYK 2XCFA 1LHDH 1T31A 4YOIA 1O32A 3FOAA 1T8MA 1DUAA 1GMCG 4Y0ZE 1YWUA 2NU1E 4B2AA 1BRBE 2ALPA 1S0RA 1TMUH 3RMNH 1ESTA 1BHXB 4OGXA 1TWXB 2R2MB 3MNXA 1TBZH 4VGCC 4RSPA 3A87A 5F8TA 2PKAB 2Q6DA 5LGOA 1EPTA 1EP5A 1UHBB 7GCHG 2A45B 5HIZA 3TPIZ 1WTHD 3UWIA 4CH2B 5A8YA 1H8ED 3OEED 4OS2A 1C5XB 4Y10E 1NTPA 1TQ0B 1G36A 1DVAH 4WY3A 3SQHE 1ZPZA 3A7YA 2H9HA 1KXFA 3S7HB 3OY6U 3P95A 1FY3A 1C5LH 1K1LA 1OWKA 2FOBA 2WPMS 2XWBI 3CS7A 2G4UA 4FETA 3OY5U 3RLYH 1C5SA 1P03A 1SPJA 1HLTH 5E8EH 4YOGA 1IQHA 1NFWA 3SW2B 2TBSA 1THRH 1V2PT 3BIUH 3EA8A 2A2XH 3BG4B 1HJ8A 2FX6A 2O8UA 1WBGB 3FZZA 1SLWB 5F6MA 3GS9A 4A7IB 3UNQA 4ACAA 4IGDA 3RXBA 2GCTC 5E0HA 3SJOA 1KDQA 3VGCB 2BD7A 1P2IA 2Z9IA 2J38A 3EA7A 2AGGX 2PR3A 4X6NA 3ZZDA 1UTQA 1UVOA 1HIAB 1XVOA 3LKWA 2M2AA 1UTJA 2FI4E 1O5BB 2JJ1D 2GMTC 3RU4E 4B1TA 5J4QA 5EQSA 4XRNA 1LPZB 2THFB 3KYFA 5HGGA 1EZSC 1MBQA 1B7XB 1E34B 1AFQB 1FAXA 5H4IB 4I8LA 1SSXA 3A7VA 1ARCA 1ZPCA 5E2PA 2VIQA 1QZ8A 3P8GA 1P04A 2WPJS 1TNKA 2LPRA 1H8DH 2ZDNA 4INLA 1ANDA 1S6FA 4LK4A 2VVCA 4NA9H 1ZMJA 1SGTA 2WINI 1IQKA 1O2KA 4WWYA 5JYIA 3S0NA 1E0FD 3DA9B 1GJDB 3ENSB 2ZGBH 1XVMA 2HNTE 1BA8B 2FOCA 1MUEB 2OC8A 4OS5A 4FXGH 2YMSB 2DUCA 1O3LA 2ZU1A 5FL7D 1Q3XA 4IN2A 3GY7A 2C4FH 5PTPA 1V2OT 4Z6AH 3DCLA 1O3EA 3M7UA 1ZJDA 1MMJN 1IQJA 3CS0A 2TGDA 4K60A 1F5LA 1CBWB 2BLWA 3LGYA 3BTDE 2BVRH 2ZDVH 3KYGA 1T7CA 1P2NA 4BTIB 1KXDA 1TIOA 2D8WA 1DDJA 3ATKA 3RXVA 1P05A 1D6WA 5A8XA 1FMGA 2ANKH 4XBBA 2UWPA 2WZQA 3RDZA 2A4RA 1FDPA 1NFXA 2H6MA 2OD3B 4X1PU 4F55A 3LJOA 2QC2A 2C8WB 2GCHF 1D6RA 4QT8C 4WJG2 3RXUA 3SU0A 1X7AC 1S82A 2AEIH 4X8VH 5IYTA 2ODYB 3MH6A 3N7OA 3U8OH 3BEUA 4AG2A 1HPGA 1CT4E 4YESB 4JYTA 1J15A 1J17T 2ZKSA 5T6DA 2F9PA 1C5WB 5F53A 5KECA 3TK9A 1DWDH 2BY9X 2I6QA 1FQ3A 1INCA 1GDNA 1RTKA 5FCKA 1WDIA 4DG4A 5DJ7A 4ZAEA 5DN6D 3RXRA 1BTYA 1IQGA 1TA6A 2A4GA 1ZMNA 1YPKH 2R0LA 2V0BA 1QA0A 1VJAU 2J5UA 2R3UA 2FOHA 2ZCHP 1DE7H 1T8OA 2HVXA 5EXLA 1LHEH 2F9VA 3ZYDA 3IITA 3SBKA 4IMQA 3TIUA 4ASHA 1S6LA 4X6PA 1PPEE 1CBWC 1OWIA 1FAKH 3KQCA 4M9FA 2V3HH 1CQQA 2WV4A 1HGTH 2LP6A 3D62A 2QF3A 1AB9C 4ZUHA 1O2WA 7GCHF 2ZU4A 2J9NA 1T4UH 2XOKD 1KXEA 2FPZA 4KP0A 2PW8H 4M7GA 4AORA 1T8NA 1BJVA 1OWDA 1KXAA 4O3UA 1HXFH 1C1TA 1SGPE 1DWBH 3SNCA 1FIZA 3ELAH 3LIWA 5A0CA 1UW7A 3QWCH 2NWNA 3VB3A 5KEDA 1PQ7A 2TIOA 2TRMA 2R9PA 1Y8TA 3ATWA 2VBCA 4I8KA 4ABFA 5FPTA 2AMPA 3RXCA 1O5GH 1GGDC 3GY3A 1AUJA 3RXJA 5C0TA 1AFQC 3HATH 2XW9A 4DVAU 1TGBA 2BHGA 1O3KA 2ZCLP 3UFAA 1TMTH 4UFEH 2VGCB 1CHOF 1J14A 1H8IH 4X6MA 1OS8A 3OTJE 3ZVAA 1O5CB 1ZSJA 3S9BA 2HPQH 1TGTA 5I25A 2XC4A 4JZEH 2BDIA 4OGYA 3UNSA 5CMXH 1EAXA 4INKA 1MCVA 5FPSA 1AHTH 1AZ8A 1GBCA 5DP8A 1XM1A 3QK1A 2D26C 1DT2A 4YOJA 3LU9B 1O2HA 1TRMA 2CHAB 1GI6A 4D76A 3FO8D 1LMWB 1CE5A 1ANEA 2Y7XA 1P2JA 5L2YH 1G3DA 5L2ZH 1YC0A 4I33A 1ZR0A 3F0OA 3LPRA 1NT1A 4Y6DA 3VXFH 3RUOA 1EATA 1Y3XA 4WVPE 4K2YA 1K1OA 2Y80A 4ISNA 3PV5A 1Y3VA 1TABE 1YF4A 3TK6A 5EW2H 1CGHA 1PPFE 3RXAA 1TOMH 2D2DA 2OQUA 1VCWA 2STAE 1TNJA 1O38A 4TPIZ 5T3HA 1XX9A 4D9RA 1P3EA 1ZHRA 4O03A 4X2VA 4MDSA 1UK3A 1FY8E 4B6EA 1GMHF 2ZFSA 1GI4A 3SO3A 1ELTA 1P8VC 5FAHA 1ZOMA 2QXIA 2BX3A 3GCHB 1HAXB 2EI8A 2BLVA 1KLTA 3UUZA 3WW7A 4YM9A 1Y5UT 1GHXH 5HKKD 1DLKB 3RXMA 4GVUA 3PWBA 3SV6A 1K0HA 2BY6X 1KSNA 1J9CH 1O2XA 3RXSA 2PKSC 3HK6B 1S0QA 3MU1A 2B9LA 2ZDAH 1TYNA 3KGPA 1YPMH 1OWHA 2TGAA 2HRVA 5GNDA 1NZQH 4MNWA 2ZF0H 4FUDA 1GHZA 2QN5T 2A2QH 3N7EA 5TJXA 1E79D 5CHAB 4E7NA 3RXIA 3A84A 2BD2A 3QDZB 3GCOA 3R0FA 2W3IA 1YPHE 3BN9A 4UEHH 1SL3A 1G30B 2J95A 4CRDA 2Z9KA 1O3DA 3NPSA 4ZXYH 1EB1H 1BMMH 1LQDB 1RGQA 3OEHD 5T1VA 2BD5A 4ABDA 1SKYE 1HAPH 1MTWA 3H5CB 3FAOA 2ZTYA 4RKJB 4B2BA 2F9BH 3K65B 4FUFA 1O5EH 1MZAA 4Y71A 1P9UA 4Y8YA 1G37A 3NCLA 3PMAB 1QY6A 1HJAC 2FOEA 4HG6A 7ESTE 4NIVA 2QYIA 1FPHH 2CF8H 1ZTKA 1ZJKA 4KTCA 4R8TB 4CRAA 1GHAF 1V2VT 2GV7A 4XSKU 3UREA 5EU8A 2FXRA 3RC5A 1TLDA 1N1LA 1D3PB 4GCHF 1ANBA 1A5GH 4AX9H 9LPRA 1Q2WA 3O8DA 2BB4A 4IBLH 2RFKC 2QF0A 2EEKA 2BQ6B 1ARBA 2W6JD 5EXNA 1O5AB 2G8TA 4Q7ZA 9ESTA 1NC6A 5AFYH 1F92A 3SORA 4DY7B 3DUXH 1A3BH 1OWEA 1C1QA 2Z3CA 1YPLH 2H9TH 4X8SH 1ETSH 2C8ZB 1BTWA 3Q3KA 1CVWH 2UUJB 2WHXA 3QUMP 1UTNA 1GVZA 1GHWH 2SGEE 4DGJA 1XXDA 1EAIA 4NZQA 3T26A 4B73A 2A4OA 1QBNA 3TGIE 1QIXB 1GI9B 1MTVA 2TPIZ 2P8OB 2ZHWH 2UUYA 1PPZA 2Z9GA 5DG6A 4AYYB 2IPQX 3ZVEA 3OAAD 1Z71A 4NIXA 4UDWH 4A6LA 2ZIQH 1JIMA 5LPEA 5C1XA 3PLBA 1NFYA 3F9HA 3URCA 1VITH 2LELA 2NU0E 5DP4A 1K1MA 2WV9A 2ZTZA 4ZROA 4H42U 1ID5H 2A7JA 4O3TA 2VH6A 1T32A 2FX4A 3SJKA 5T6GA 1GJ9B 1VKYA 1VJ9U 1RIWB 1LO6A 1V2MT 4I8JA 4YT6H 1UTPA 1VCQA 1SHYA 3SV9A 2XBYA 1MD8A 1WQVH 2Z7FE 4ISOA 4YO9A 4WMFA 3D49H 2ZCKP 1FJSA 3PLKA 2FZZA 4TWYA 3KIDU 3SJ8A 3UB0A 1ANCA 1GBHA 1GJ4H 4HZHA 2CMYA 1DUEA 1XMNB 2GV6A 2FO9A 2ZHDA 4X0WU 5SGAE 4HTCH 1F5RA 2NU3E 1FIWA 2PWXA 3P17H 3QO6A 1TFXA 1GI5A 1SQOA 1ZSKA 1H4WA 2ZGXH 1NU9A 1HDTH 3BG4C 4FVDA 2KAIA 1TMBH 4DT4A 3P92A 1BBRE 3GY8A 5JDUB 4X6OA 1BBRK 4BTUB 1YCPM 2Y6TA 1AWFH 5BPEA 3M5OA 3SQEE 4IC5A 2F3CE 1PYTC 4GCHG 1ELDE 5JB8S 3QN7A 1U6QA 2ZA5A 4B75A 1O2PA 4F4OC 4ABJA 3BIVH 4BTTB 4JZIA 1TPOA 3DHKH 2BDHA 2ZEBA 1O37A 2GZ9A 1WYKA 2ZQ2A 2Y82A 4JK6A 2BD3A 3I29A 1ELEE 3A8CA 1LPKB 1XUFA 1QNJA 4FUEA 4RI0A 3R3GB 3KL6A 3BTWE 3PTNA 3A80A 1C1NA 3E3TA 2TGPZ 1QRZA 3FFGA 4E05H 1KXBA 5C17A 5HXFA 1TNHA 1P12E 2PSYA 3L3TA 1HRTH 1MAXA 1O3GA 1PJPA 3MI4A 2ODQA 2XBWA 3VB5A 1UO6A 2W7UA 4B71A 3ZZ3A 4CRBA 4U2WA 1UTLM 4ACBA 7LPRA 5FBIA 1QL7A 4B2CA 1DXPA 3T62A 5EQRA 2P3FH 1O5DH 1GHAG 1QFKH 1TAWA 2ZHFH 1K21H 1C5YB 4AOQA 1GDQA 1B0FA 1K1PA 1A61H 1FN6A 1EAUA 3M36A 2FTMA 1YM0A 4WH8A 3MHWU 3EQ0H 4JZDH 6ESTA 2P94A 1FN8A 2CJIA 1ZGIA 2P16A 2QA9E 1G9IE 1QR3E 2AMDA 3TNTA 4JYUH 1W10U 1V2NT 1FY4A 2GTBA 1W3CA 3LGVA 2UUFB 2BDBA 1IOEA 1FXYA 3M3TA 1O3BA 1QRXA 3E0NB 3AVZA 2OBQA 1C5VA 1SR5C 2XCNA 1B5GH 1P3CA 2ZGJA 2HALA 2EI7A 5A8ZA 3SUEA 3OE7D 1MAYA 1K28D 2VB0A 4OS4A 2W26A 3ZVBA 5GJ4B 3ODFA 1MKWH 5L6NH 2WSSD 1NPMA 3SI4H 4B76A 1QB6A 5F8ZA 1HXEH 2FOGA 5C5NA 2ZFQH 1SG8B 1F5KU 1TX8A 3PO1C 3LT3A 1DANH 2XBVA 4MNXA 1OSSA 1SGRE 1O2OA 1PPGE 2ZDKA 5EODA 1F0TA 3SHAH 3BTHE 1Y3WA 4CRCA 2ZDMA 2AIPA 2RCEA 2AIQA 1YBWA 1WU1A 1AQ7A 2G00A 1N6XA 3OYPA 3RXLA 1WTGH 1O3JA 2BQWB 1C1MA 3N99A 2WYJA 5C3NA 3M5MA 1C2LA 1F0RA 2GCHG 4LOYH 4UFFH 1GL1A 4CHAB 1RRKA 1FLEE 2C8YB 1Z1IA 1HAOH 1AUTC 2YNBA 3BEFB 2FTLE 1G32B 4LXBH 4ZKRU 2PGQB 3M7TA 1Z8IB 1UTMA 3PRDA 2J4IA 4A5TS 5K0HA 3ATIA 5JB9S 1TPPA 1OP0A 5E0GA 4NIWA 4Z0KA 3F9EA 1P2MA 1QA7A 4Q4LA 3BTKE 1G2MA 1QQ4A 1IAUA 2PHBA 2VNTA 3EE0B 1DICA 1W0ZU 1O36A 2IJD1 1C2EA 3PM3A 3SU3A 5DSFA 1ZGVA 1OX1A 1WCZA 2JIZD 3ZZ9A 4YZUA 1A46H 2FYRA 1SGNE 2F83A 2A5IA 3MO9A 1L4ZA 1ELGA 2ZWLH 1FI8A 5FXLA 1UHBA 3ZZ8A 4TPYA 2STBE 1ZZZA 2OBOA 2V35A 5A2MH 3GCTF 1MH0A 1DITH 1BQYA 3SNBA 2ZPRA 1TNGA 6GCHG 1YCPK 1C1VH 1FUJA 1GI0A 2VVVA 3A83A 3NZIA 4NA7A 3VB6A 1MZDA 1CSOE 2CF9H 4Y76A 3DSGA 4X2XA 5FPYA 4WXIA 2FLRH 2WPIS 1KDQB 2IOTA 3MOCA 2DE8A 1MTUA 1EPTC 2FI5E 3QLPH 2ZFTA 5EGMA 2BDCA 3SU4A 1Y59T 4SGBE 1N6YA 5T6FA 4DCDA 3RM2H 3T25A 1GBAA 3E90B 2W7SA 4SGAE 1AD8H 1MTNC 1AMHA 3L33A 3N7DA 1MKXH 1S5SA 1DFPA 2SNVA 4X8TH 1VGCC 1OXGA 2OQ5A 1NBME 4XBCA 1YGCH 3EDXB 3OSYA 1QBVH 3EAJA 1XKAC 3SU5A 3UWJH 1W7XH 1V2TT 3LGWA 2ZPSA 1AO5A 3F2GA 1GGDB 3E8LA 1P06A 3K6YA 4O9VA 2ODPA 2BMGB 1V2ST 2G52A 5HM2A 5IK2D 4K3JA 1O2QA 1EX3A 4D7FA 2LNCA 1O2MA 1SGDE 4KTUA 3U1IB 4RKOB 2GCTB 4YLQH 4VGCB 2GDDA 3BTME 1GBDA 1TE0A 1TRYA 1V2WT 4HGCA 5AFZH 1C5NH 1LDTT 1TPAE 2ZPQA 1GHVH 1P2OA 1FY1A 5LPFA 2BOKA 2WPHS 2OC7A 1IHTH 1TALA 3PYHA 4GSOA 1OHHD 2JKHA 5C1UA 2SGFE 3MFJA 4H6SB 1E38B 4ISLA 3LONA 3B23B 3QGNB 1GPZA 2HLCA 2ZG0H 1SGFA 1EUFA 3IG6B 4K69A 2JH5D 1DOJA 1GI1A 1SGYE 4DIHH 3O8CA 2ZP0H 4BAHB 3A82A 4K5ZA 1TBQH 1PPCE 3TGKE 3P6ZB 3RXGA 1SLVB 3HPTB 1BHXF 1NRPH 1MQ5A 1TOCB 1BRUP 1LKBA 1MD7A 4Q2KA 2GMTB 2ZFRH 4K8BA 2YMSD 2SGPE 3FANA 1AE5A 2BDGA 4NZLA 5HIYA 1V2RT 2G5VA 1AB9B 4H6TA 1O3OA 1KTTB 4X2WA 5JBCS 1CGIE 1D3DB 3ZV8A 3VXEH 4I86A 5FX5A 1XUKA 1Z6EA 1ZRBA 3RU4T 2CN0H 2F9UA 1ZTJA 2ZO3H 2ZFFH 3UOPA 1DX5M 2PFEA 1ABJH 2Z94A 2C93B 2ZC9H 3ZYEA 3HKJB 5JBAS 3SGAE 2FWWA 3ESTA 4AG1A 1SLUB 5DPAA 1P9SA 3OU0A 1S85A 4ABHA 2ZU3A 1P2QA 4GPGA 4U01A 4X2YA 1Y5BT 1O3FA 1DWCH 4XDEA 1H1BA 2RA0A 4OM9A 2FOMB 1YYY1 1AKSA 2ZZUH 1E1RD 1WAYB 1MBMA 2P93A 1A0HB 1VCPA 1FX0B 2FM2A 1AZZA 4ZKOU 4YTAA 2PTCE 3FZDA 2BDYA 4MQAA 1O5FH 2RDLA 4B74A 2W6ID 3TU7H 4BXWA 1H9HE 1WOFA 1GHBF 3C27B 4FU9A 4TY6A 5IDKA 1Z8RA 2BY7X 4HFPB 1P2KA 3LDXH 3LGUA 3O8BA 1XKBC 3H09A 3MU0A 1QL9A 1QL8A 3MU8A 3T28A 3WWBA 1HIAA 4OS7A 1VZQH 2FI3E 2ZNKH 1O2RA 5ESBA 4IC6A 6CHAB 3MO6A 1HAHH 4NSYA 3SYJA 2BZ6H 1C1PA 2FOAA 5CDFE 1BTPA 4Y79A 2FP7B 2BOHB 3LGTA 4CR9A 1RS0A 3GY6A 4JMYA 5AF9H 4THNH 4O97A 4BAMB 3F9GA 4MNVA 2B0FA 2ILNA 1HCGA 1P10A 2KFWA 3Q76A 2ULLA 1DWEH 5C20A 3OFND 2GDEH 1W12U 2H5CA 2ZHEH 2K0QA 5CE1A 4BAKB 4FUIA 1CHGA 1LVYA 1AWHB 5TCAA 3I77A 2ZDLA 1Y3YA 1P01A 2HOBA 2PGBB 1SVPA 4TYDA 5A0AE 3S69A 1O33A 2XNIA 1PPHE 1GJBB 3STIA 1EAWA 1QJ1B 5C0UA 2QE7D 3F6UH 3CENA 2XC0A 1RD3B 3GDSA 1VGCB 4TY7A 8KME2 3QGJA 2QXJA 1IQNA 1MKXK 1EJNA 5JBTA 5EPNA 2HVYB 1GI3A 3SGQE 2KCAA 3EE7A 4GHQA 4MTBA 1S81A 1H9IE 1QHRB 1PQ8A 2P3UB 1A3EH 4CRGA 1DY9A 1UTKA 5DP9A 5GCHG 5EJLA 1LCYA 4NWLA 4I32A 1FPCH 1VITF 3M3SA 4E06H 2BQ7B 2A5KA 2BD4A 2C3SA 4JCNA 3ZZBA 1O3IA 1A5HA 1LPGB 4R0IA 3F3BA 1S83A 2M5TA 1O34A 1QCPA 3SJIA 1CA0C 1GJ5H 2A4QA 4FUGA 1XUIA 1UJ1A 1HJAB 6GCHF 2FEQH 4HI3A 1WV7H 4AYVB 2F4LA 1BT7A 1MU6B 2V3MA 5EJZA 1BRAA 1HJ9A 2OTVA 2WYGA 2XRCA 5GPIB 1RFNA 2XNDD 1NRSH 2EY4C 1BITA 1C1WH 1C5PA 3VEQB 2FMJA 1W0JD 3AAUA 1PQ5A 1G3EA 5L30H 2OCVB 3SJ9A 3ODDA 2TGTA 1Y5AT 2G5NA 2AYWA 3AK5A 3H7OA 1COWD 2PSXA 2AH4X 2OC1A 1NROH 2H1UA 1ZRKA 1A0JA 1MTNB 2WPDD 2VINA 2GZ8A 2GZ7A 4CBNA 3ZVGA 5HM9A 1NS3A 1UVPA 1QQUA 4I31A 1P57B 2J98B 2KCPA 2J98A 1OYQA 2QGRA 1GBIA 1EZQA 1YPGH 3G01A 1K22H 1BMFD 3A7TA 5EJ1A 1VR1H 5ABWA 1C2IA 3SGBE 2O8LA 3S9CA 2VIVA 1EQ9A 3BSQA 3SHCH 1Y3UA 1BTHH 1MCTA 2FESH 3CNRA 1JOUB 3RXTA 1JIRA 3WY8A 3T2NA 3DD2H 5GWZA 1P09A 2O8MA 3FN8A 1O39A 6LPRA 5I46H 1AY6H 1DSUA 4Y7AA 2VWMA 1QJ7B 4DIIH 5GIBA 1NESE 1CU1A 1ELVA 1Z8JB 1C2DA 1RTFB 2L6OA 4ESTE 1GBBA 4D8NA 4MLFB 1UK4A 1SFIA 3QZRA 3KQEA 4A92A 1OYTH 2V3OH 2BX4A 1JRTA 2Z9JA 3KQ5A 1GBEA 2KM0A 1ESAA 1AVGH 3ZV9A 3MNSA 2WPKS 3DFLA 4AC9A 2I6SA 5KGOA 1SOZA 4ABBA 1C2KA 1C5OH 1GVKB 1V6DA 2W5EA 3F68H 3ATMA 3AW1A 2L74A 2ZGHA 4CH8B 1EJMA 3ZIAD 1BMNH 1MKWK 2SGAA 3FP8E 4MG3A 2OUAA 5GXPA 1DXWA 2Y7ZA 2QY0B 1LHGH 5BRRE 1DY8A 1PFXC 2PTNA 3NRLA 4J1YA 1O2VA 3MNCA 5C2ZA 1FNIA 4ZHAA 3W94A 4ABIA 1GMCF 4XE4A 3KNXA 2OC0A 1GWAA 2VJ1A 5DP3A 3JZ1B 2A32A 2F43B 2PUQH 1BZXE 2YOLA 1ZPBA 4DJZB 4XBDA 1GBFA 1GBLA 1K2I1 2AFQB 3U8RH 2FLBH 4NFEA 3RXHA 3E0PB 3UIRA 1V3XA 4YXWD 4INHA 1J8AA 1AI8H 3MH7A 4NGAH 3ZVFA 2VGCC 4FOUC 3M61U 1W2KH 1C5MD 3PMBB 5A0BA 1HAGE 2ALVA 3F2HA 2BYAX 1HAVB 1NRNH 1C2FA 4K1SA 1E35B 1L1JA 1SQTA 3AAVA 3K6ZA 1QRWA 1THSH 1TNLA 1TBRH 3PROA 3LC5A 3VB7A 1AGJA 2BXTH 2VIOA 4BXSA 2BTCE 4RT0A 4ABEA 2XXLA 1W8BH 1XXFA 1YKTA 3PWCA 4MPXA 1M9UA 3SNEA 1BTXA 1GI8B 4PROA 1GBMA 2FYQA 1DSTA 3UNRA 1F0UA 2HLDD 1N8OC 3H7TA 3STJA 3ZZ4A 1GMHG 3QX5H 2KR7A 2R2WU 2GP9B 2JETC 2VWNA 4NCYA 4OS6A 1IQFA 2A1DB 3MWIU 3MH4A 1D3TB 5ETXA 3DT0H 3UTUH 4YT7H 4X1NU 3RC6A 3OTPA 2QCYA 1GG6B 4K8YA 3RXPA 1OPHB 1ACBE 1SQRA 1SQAA 1TPSA 1TX7A 3MU5A 3PLPA 4UD9H 1BJUA 2O8WA 3LH3A 3B8JA 1FONA 5EQQA 5TCCA 2ESTE 2Y5HA 2ANYA 3U98H 1E37B 1A7SA 4IN1A 4K1TA 2VIDA 4FU8A 3EYDA 1HB0B 1YLNA 1DPOA 4GHTA 3UY9A 4Y11E 1BTUA 4F48B 3E91A 5F8XA 3LOXA 1C1UH 1BIOA 3TVJB 4D7GA 2UUKB 2WUBA 4FUBA 4ABAA 1O2JA 2HPPH 2J94A 5HMAA 1HUTH 1NY22 2ZHQH 3M37A 4JZFH 1DS2E 1O3PB 2F91A 4Y8XA 5B6OA 3V13A 3TK5A 3BTTE 1HNEE 2FODA 1BDAA 3TITA 2JJ2D 4ABGA 1C1OA 1ZYOA 1QBOA 4JK5A 1ORFA 2EQNA 3TJOA 1JMOH 3GOVB 1LVBA 2ZTXA 1EP6A 3E16B 5DO4H 1UCYE 5DK1A 2GJGA 5GDSH 2R0KA 1VITG 5FCRA 3DFJA 1SHHB 4FUHA 4OS1A 4ISIH 1YY3A 1OOKB 3MNBA 3SZEA 1V2UT 3U9AH 3EA9A 1XUJA 2AHME 1GBKA 4AGJA 1V2JT 3V0XA 3MYWA 2AGEX 4Q7XA 1GDUA 2R3YA 1BBRH 4MNYA 1EXFA 3V7TA 4A1XA 4BOHA 1QJ6B 1O2NA 5FHTA 1O3NA 1BB0B 1C2JA 4AZ2B 2ZGCA 4WMEA 2NU2E 4E7RG 1D9IA 3U1JB 1PPBH 3RLWH 3ZVCA 2GVFA 1W13U 5LH8A 1EPTB 2QXHA 2PKAA 1ETRH 2GX4A 4AB9A 2V6NA 3KN2A 1KYNA 4X1QU 2W3KA 2VH0A 1NM6A 3O8RA 5FBEA 4WF8A 2WV5A 1ELFA 3UAIC 1BMLA 5C94A 3SN8A 1A0LA 1G2LA 3FP7E 4CR5A 1MABB 3BTFE 4ZXXH 1IQMA 1O0DH 3A88A 2Q1JA 2QXGA 3T5FH 4KGAA 3PV2A 3ZZ6A 1EZXC 1SOTA 4AFSA 2B8OH 2WPLS 3UQOA 4AN7A 1K1NA 1ZLRA 3SU2A 2BVSH 2RDEA 1HAYB 1QTFA 4GUXA 3A8DA 1GI2A 2Z6BD 1QURH 3SUGA 7KMEH 5AHGH 1KXCA 1UMAH 1OP2A 5EIYA 1XUHA 1AFEH 2YNAA 1IQLA 1Q31A 3A85A 4XD7D 3GCTG 2C8XB 4Q80A 5G4BA 1O2UA 3B9FH 1C5UA 3HGPA 3KQDA 5B6LA 2ZQ1A 3GY2A 4I8GA 1EOJA 4LZ4B 1ELBA 2KAIB 1YPHC 4AGKA 1HFDA 4NFFA 4LZ1H 5CHAC 1MQ6A 2GT7A 2Q6FA 3A7ZA 1G3CA 4XFQA 1AE8H 4P00A 2B5TB 5DGJA 2QF5A 4BNRA 3VFEA 8GCHF 4AB8A 1C1RA 1Z1JA 4RN6A 3D23A 1WSSH 2ANMH 3A81A 3ITIA 3FP6E 2H5DA 3Q00A 3TGJE 1SB1H 4Q63A 3BTEE 5DP6A 1L1NA 2RA3A 1THPB 1LQEA 1NBMD 4B6FA 4DURA 5EPYA 2A5AA 1SGQE 4ZMAH 3U69H 3F1SB 3UOUA 3PB1E 2OLGA 1CO7E 4TSFD 4ASUD 5K7RA 2Y81A 1ZHMA 4AFQA 2RG3A 3K9XB 2ASUB 2P8OC 2AMQA 1A2CH 4Y8ZA 3SI3H 1HAZB 2D1JA 5E0JA 3SUFA 3PMJA 2NU4E 2CXVA 4I8HA 4NWKA 1O3MA 3A7WA 1C5TA 1LKAA 2P95A 3MQKC 1V2LT 3EGKH 1BOQA 3BV9B 3OX7U 2BDAA 1GL0E 1WUNH 3BG8A 2OINA 3L6PA 3TNSA 1SGIB 3RXQA 1D4PB 2F9NA 1C5ZB 1EJAA 2A0QB 4D9QA 3MH5A 1P02A 2BXUH 3GY5A 1L4DA 2F9OA 3LH1A 1HV7A 4CREA 1LTOA 3SUDA 2IPHA 4CRFA 1GMDG 1TGSZ 1C9TA 2G4TA 4WMDA 1W11U 3RMMH 2GT8A 2H9EH 2PP6A 3PTBA 3SV2H 1TGNA 1O2ZA 1T4VH 4TT3D 2G51A 1GJ7B 3DSOA 3ZZ7A 3TH4H 1YPEH 1KTSB 2BD8A 1E1QD 1YCPH 1LHFH 1BMAA 4JYVH 1J16A 1V2KT 1OP8A 3TJVA 1W0KD 1SLXB 3GISB 1O30A 2G55A 3KCGH 1Z6JH 1C4U2 1TA2A 1OKXA 2XC5A 4YLUA 2A7HA 4Q7YA 1E36B 1FY5A 5EW1H 4KELA 1SGCA 1TGCA 3S7KB 1JRSA 2K8IA 2ANWA 4RT1A 1HYLA 3BTQE 1UVTH 1NRRH 4UFDH 1ELCA 3MMGA 2KZ4A 3LJJA 1Z7KA 1T8LA 2KCOA 4X1RU 1C5RA 3DSPA 3RXOA 3JZ2B 3NXPA 3M7QA 4U30A 2JDID 3UR9A 2SGQE 4ZCNA 1GMDF 2GGVB 4CBOA 3GY4A 3IWMA 1GG6C 2BVXH 5EG4A 3GDUA 1GCTB 2DE9A 2JETB 2P3TB 4A1VA 3RMLH 4MPVA 2P59A 1AKSB 2H2ZA 3V3MA 1EB2A 3P8FA 1NRQH 2VWLA 1UK2A 1O2GH 1O3AA 4ISHH 2PV9B 3RP2A 2Y5FA 3SU6A 3U28C 1AIXH 1JBUH 1Z8GA 2JH0D 2FS9A 3LGIA 4WH6A 1ZSLA 1CA0B 2ZFPH 1L2EA 3LC3A 1C2MA 3Q3YA 3VG8A 1OWJA 1WQSA 2ZU5A 1BRCE 2FOFA 3URDA 1YLDA 3M5LA 4MPUA 3QTOH 5J4SA 3FKSD 1O2YA 3RM0H 1GHBG 3KEEA 3SV8A 3QTVH 1GI7B 1KLIH 1ETTH 3I78A 1ELAA 3P8NA 1RIWC 4DT7B 1DLEA 3PV4A 1EASA 1SC8U 2Z3DA 5DKMA 5EXMA 4DOQA 4IW4E 1TONA 4TWWA 4K1EA 3ATLA 3F0PA 3SV7A 5FX6A 5F03A 2C90B 3KQBA 1ZTLA
chains in the Genus database with same CATH topology
1JXPA 3VPKA 3M35A 8LPRA 1YPJH 1F7ZA 2ZI2H 3A7XA 8ESTE 1W7GH 1GCTC 5JPMH 4ZHMU 2SGDE 4NSVA 1GCDA 1NFUA 3VB4A 1O3HA 1CA8B 2BY5X 2A31A 2EA3A 5DP5A 2JH6D 4ZHLU 3Q3XA 1H9LB 2ZU2A 2PUXB 2XTTB 3Q77A 5E2OA 2J2UA 4Y0YE 1KIGH 3TLOA 2BZAA 3A89A 3P70B 4UE7H 1NN6A 3RMOH 4NG9H 3TH3H 3S9AA 1K9OE 2IJOB 2BLOA 2XWAA 3MO3A 1F2SE 2K1QA 3C1KA 1O2LA 3NKKA 4GAWA 3GDVA 5JBBS 3D65E 3QZQA 1AVXA 3SU1A 1SGEE 2HNTC 3E6PH 4XOJA 4BAOB 2Z9LA 3UQVA 2VIPA 3ZZAA 1C4Y2 1ZMLA 2VIWA 1PQAA 5GCHF 1LVOA 5C1YA 4AFUA 3GCHC 1GBJA 4X8UH 2CGAA 1GHYH 3A8BA 5ESTE 2SNWA 1CHOG 2Y5GA 1MTSA 3A8AA 1UCYH 1ESBA 3KHVA 4AFZA 1QGFA 1HAVA 1GJCB 4DW2U 2Z3EA 1G3BA 3TH2H 2GD4B 1BCUH 2VU8E 3BTGE 1JWTA 4WXVA 1C5QA 1GVLA 1RJXB 3NWUA 1BUIA 2PLXA 4JZ1A 4UFGH 1CGJE 3TJNA 2J34A 6CHAC 4GLYA 3V12A 1C9PA 4X1SU 3AASA 3GCNA 3K2UA 2BD9A 3M5NA 3RXKA 1ZHPA 3VGCC 4BAQB 3FVFB 5DP7A 3BF6H 3UPEA 4U32A 2A7CA 1IHSH 4ZH8A 2SFAA 4FVBA 1A1RA 1FZZA 1TNIA 4ZKSU 4CHAC 1GJ6A 2QIQA 4J2YB 3MTYA 1S84A 1LVMA 1GJAB 2VVUA 1O35A 2XYAA 4H4FA 3MU4A 1GBTA 3HGNA 3TJUA 1AN1E 2G81E 2QV1A 1P0SH 1QB1A 3E1XB 3T27A 1TQ7B 1O2TA 4KTSA 3PO1B 1IQEA 2IN2A 3SZNA 1B0EA 1SMFE 3RXFA 1N8OB 2O9QA 1XUGA 2CV3A 3F9FA 1D3QB 1RXPA 1TRNA 2ZECA 1GJ8B 3W95A 3BEIB 5AVDA 3SOSA 1EKBB 4FUJA 1P11E 2AS9A 4MPWA 1YP9A 1A5IA 4A1TA 2XBXA 4IS5A 1L1GA 1QB9A 2BY8X 4IMZA 1NO9H 1UVUH 3HKIB 4UONA 1C4V2 1W0YH 1SBWA 2UWOA 1S6HA 5C67A 2HGTH 1W14U 2EC9H 3NK8A 3P8OA 2J92A 2O8TA 3ZVDA 3A86A 3CP7A 2Q6GA 3GICB 4FU7A 5HYOA 2CHAC 2FIRH 1SI5H 2BM2A 4F49A 1F0SA 1C2GA 3HK3B 3KF2A 1IQIA 1MU8B 3T29A 4ZKNU 3AW0A 2UWLA 4Y7BA 2FDAA 2AGIX 3RC4A 1KLJH 3SNAA 3U8TH 4NIYA 4KKDA 3RU4D 2FS8A 3ZZ5A 5LPRA 1EZUC 1C1SA 1PYTD 3M3VA 1AU8A 3NUMA 5A09A 8GCHG 2EI6A 1NU7B 3PMHB 1FV9A 2HNTF 2B7DH 2OP9A 1YLCA 1DM4B 1V2QT 2WUCA 3GYMA 3SNDA 3UR6A 1EOLA 1CT0E 1HAIH 1SFQB 1KY9A 1SGFG 1RTLA 1TB6H 1A4WH 1O31A 3RXEA 1O2SA 2BLQA 2QAAA 1C2HA 4BANB 4NA8A 1UTOA 1AVWA 5EOKA 2GKVE 4MVNA 1CT2E 2HWLB 3GYLB 1UVSH 1BTZA 2PKSB 4FUCA 1K1IA 1ABIH 1O3CA 1TX6A 1HBTH 3RXDA 1O2IA 2VWOA 1L0ZA 3ZZCA 2OXSA 1K1JA 5C5OA 2XCFA 1LHCH 1UCYK 2AERH 1LHDH 1T31A 4YOIA 1O32A 1T8MA 1DUAA 1GMCG 4Y0ZE 2NU1E 4B2AA 1BRBE 2ALPA 1S0RA 1TMUH 3RMNH 1ESTA 1BHXB 4OGXA 1TWXB 2R2MB 3MNXA 1TBZH 4VGCC 4RSPA 3A87A 5F8TA 2PKAB 2Q6DA 5LGOA 1EPTA 1EP5A 1UHBB 7GCHG 2A45B 3TPIZ 1WTHD 3UWIA 4CH2B 5A8YA 4OS2A 1C5XB 4Y10E 1NTPA 1TQ0B 1G36A 1DVAH 4WY3A 3SQHE 1ZPZA 3A7YA 2H9HA 1KXFA 3S7HB 3OY6U 3P95A 1FY3A 2XWBI 1C5LH 1K1LA 1OWKA 2FOBA 2WPMS 3CS7A 2G4UA 3OY5U 3RLYH 1C5SA 1P03A 1SPJA 1HLTH 5E8EH 4YOGA 1IQHA 1NFWA 3SW2B 2TBSA 1THRH 1V2PT 3BIUH 3EA8A 2A2XH 3BG4B 1HJ8A 2FX6A 2O8UA 1WBGB 3FZZA 1SLWB 5F6MA 4A7IB 3UNQA 4IGDA 3RXBA 2GCTC 5E0HA 3SJOA 1KDQA 3VGCB 2BD7A 1P2IA 2Z9IA 2J38A 3EA7A 2AGGX 2PR3A 4X6NA 3ZZDA 1UTQA 1UVOA 1HIAB 1XVOA 3LKWA 1UTJA 2FI4E 1O5BB 2GMTC 3RU4E 4B1TA 5J4QA 5EQSA 1LPZB 2THFB 5HGGA 1EZSC 1MBQA 1B7XB 1E34B 1AFQB 1FAXA 5H4IB 4I8LA 1SSXA 3A7VA 1ARCA 1ZPCA 5E2PA 2VIQA 3P8GA 1P04A 2WPJS 1TNKA 2LPRA 1H8DH 2ZDNA 4INLA 1ANDA 1S6FA 4LK4A 2VVCA 4NA9H 1ZMJA 1SGTA 2WINI 1IQKA 1O2KA 4WWYA 5JYIA 3S0NA 1E0FD 3DA9B 1GJDB 3ENSB 2ZGBH 1XVMA 2HNTE 1BA8B 2FOCA 1MUEB 2OC8A 4OS5A 4FXGH 2DUCA 1O3LA 2ZU1A 1Q3XA 4IN2A 3GY7A 2C4FH 5PTPA 1V2OT 4Z6AH 1O3EA 3M7UA 1ZJDA 1MMJN 1IQJA 3CS0A 2TGDA 4K60A 1F5LA 1CBWB 2BLWA 3LGYA 3BTDE 2BVRH 2ZDVH 4BTIB 1T7CA 1P2NA 1KXDA 1TIOA 2D8WA 1DDJA 3ATKA 3RXVA 1P05A 1D6WA 5A8XA 1FMGA 2ANKH 4XBBA 2UWPA 3RDZA 2A4RA 1FDPA 1NFXA 2H6MA 2OD3B 4X1PU 3LJOA 2QC2A 2C8WB 2GCHF 1D6RA 4QT8C 4WJG2 3RXUA 3SU0A 1X7AC 1S82A 2AEIH 4X8VH 5IYTA 2ODYB 3MH6A 3N7OA 3U8OH 3BEUA 4AG2A 1HPGA 1CT4E 4YESB 4JYTA 1J15A 1J17T 2ZKSA 5T6DA 2F9PA 1C5WB 3TK9A 1DWDH 2BY9X 2I6QA 1FQ3A 1INCA 1GDNA 1RTKA 5FCKA 4DG4A 5DJ7A 4ZAEA 3RXRA 1BTYA 1IQGA 1TA6A 2A4GA 1ZMNA 1YPKH 2R0LA 2V0BA 1QA0A 1VJAU 2R3UA 2FOHA 2ZCHP 1DE7H 1T8OA 2HVXA 5EXLA 1LHEH 2F9VA 3ZYDA 3IITA 3SBKA 4IMQA 3TIUA 4ASHA 4X6PA 1PPEE 1CBWC 1OWIA 1FAKH 3KQCA 2V3HH 1CQQA 2WV4A 1HGTH 3D62A 2QF3A 1AB9C 4ZUHA 1O2WA 7GCHF 2ZU4A 2J9NA 1T4UH 1KXEA 2FPZA 4KP0A 2PW8H 4M7GA 4AORA 1T8NA 1BJVA 1OWDA 1KXAA 4O3UA 1HXFH 1C1TA 1SGPE 1DWBH 3SNCA 1FIZA 3ELAH 3LIWA 5A0CA 3QWCH 2NWNA 3VB3A 1PQ7A 2TIOA 2TRMA 2R9PA 1Y8TA 3ATWA 4I8KA 4ABFA 5FPTA 2AMPA 3RXCA 1O5GH 1GGDC 3GY3A 1AUJA 3RXJA 1AFQC 3HATH 2XW9A 4DVAU 1TGBA 2BHGA 1O3KA 2ZCLP 3UFAA 1TMTH 4UFEH 2VGCB 1CHOF 1J14A 1H8IH 4X6MA 1OS8A 3OTJE 3ZVAA 1O5CB 1ZSJA 3S9BA 2HPQH 1TGTA 5I25A 2XC4A 4JZEH 2BDIA 4OGYA 3UNSA 5CMXH 1EAXA 4INKA 1MCVA 5FPSA 1AHTH 1AZ8A 1GBCA 5DP8A 1XM1A 3QK1A 2D26C 1DT2A 4YOJA 3LU9B 1O2HA 1TRMA 2CHAB 1GI6A 4D76A 1LMWB 1CE5A 1ANEA 2Y7XA 1P2JA 5L2YH 1G3DA 5L2ZH 1YC0A 4I33A 1ZR0A 3LPRA 1NT1A 4Y6DA 3VXFH 3RUOA 1EATA 1Y3XA 4WVPE 4K2YA 1K1OA 2Y80A 4ISNA 1Y3VA 1TABE 1YF4A 3TK6A 5EW2H 1CGHA 1PPFE 3RXAA 1TOMH 2D2DA 2OQUA 1VCWA 2STAE 1TNJA 1O38A 4TPIZ 5T3HA 1XX9A 4D9RA 1P3EA 1ZHRA 4O03A 4X2VA 4MDSA 1UK3A 1FY8E 1GMHF 2ZFSA 1GI4A 3SO3A 1ELTA 1P8VC 5FAHA 1ZOMA 2QXIA 2BX3A 3GCHB 1HAXB 2EI8A 2BLVA 1KLTA 3UUZA 4YM9A 1Y5UT 1GHXH 1DLKB 3RXMA 4GVUA 3PWBA 3SV6A 2BY6X 1KSNA 1J9CH 1O2XA 3RXSA 2PKSC 3HK6B 1S0QA 3MU1A 2B9LA 2ZDAH 1TYNA 3KGPA 1YPMH 1OWHA 2TGAA 2HRVA 1NZQH 4MNWA 2ZF0H 4FUDA 1GHZA 2QN5T 2A2QH 5TJXA 5CHAB 4E7NA 3RXIA 3A84A 2BD2A 3QDZB 3GCOA 3R0FA 2W3IA 1YPHE 3BN9A 4UEHH 1SL3A 1G30B 2J95A 4CRDA 2Z9KA 1O3DA 3NPSA 4ZXYH 1EB1H 1BMMH 1LQDB 1RGQA 2BD5A 4ABDA 1HAPH 1MTWA 3H5CB 3FAOA 2ZTYA 4RKJB 4B2BA 2F9BH 3K65B 4FUFA 1O5EH 1MZAA 4Y71A 1P9UA 4Y8YA 1G37A 3NCLA 3PMAB 1QY6A 1HJAC 2FOEA 7ESTE 4NIVA 2QYIA 1FPHH 2CF8H 1ZTKA 1ZJKA 4KTCA 4R8TB 4CRAA 1GHAF 1V2VT 2GV7A 4XSKU 3UREA 5EU8A 2FXRA 3RC5A 1TLDA 1N1LA 1D3PB 4GCHF 1ANBA 1A5GH 4AX9H 9LPRA 1Q2WA 3O8DA 2BB4A 4IBLH 2QF0A 2EEKA 2BQ6B 1ARBA 5EXNA 1O5AB 2G8TA 4Q7ZA 9ESTA 1NC6A 5AFYH 1F92A 3SORA 4DY7B 3DUXH 1A3BH 1OWEA 1C1QA 2Z3CA 1YPLH 2H9TH 4X8SH 1ETSH 2C8ZB 1BTWA 3Q3KA 1CVWH 2UUJB 3QUMP 1UTNA 1GVZA 1GHWH 2SGEE 4DGJA 1XXDA 1EAIA 4NZQA 3T26A 4B73A 2A4OA 1QBNA 3TGIE 1QIXB 1GI9B 1MTVA 2TPIZ 2P8OB 2ZHWH 2UUYA 1PPZA 2Z9GA 5DG6A 4AYYB 3ZVEA 1Z71A 4NIXA 4UDWH 4A6LA 2ZIQH 1JIMA 5LPEA 5C1XA 3PLBA 1NFYA 3F9HA 3URCA 1VITH 2NU0E 5DP4A 1K1MA 2ZTZA 4ZROA 4H42U 1ID5H 2A7JA 4O3TA 2VH6A 1T32A 2FX4A 3SJKA 5T6GA 1GJ9B 1VJ9U 1RIWB 1LO6A 1V2MT 4I8JA 4YT6H 1UTPA 1VCQA 1SHYA 3SV9A 2XBYA 1MD8A 1WQVH 2Z7FE 4ISOA 4YO9A 4WMFA 3D49H 2ZCKP 1FJSA 3PLKA 2FZZA 4TWYA 3KIDU 3SJ8A 1ANCA 1GBHA 1GJ4H 4HZHA 2CMYA 1DUEA 1XMNB 2GV6A 2FO9A 2ZHDA 4X0WU 5SGAE 4HTCH 1F5RA 2NU3E 1FIWA 2PWXA 3P17H 3QO6A 1TFXA 1GI5A 1SQOA 1ZSKA 1H4WA 2ZGXH 1NU9A 1HDTH 3BG4C 4FVDA 2KAIA 1TMBH 3P92A 1BBRE 3GY8A 5JDUB 4X6OA 1BBRK 4BTUB 1YCPM 2Y6TA 1AWFH 5BPEA 3M5OA 3SQEE 4IC5A 2F3CE 1PYTC 4GCHG 1ELDE 5JB8S 3QN7A 1U6QA 2ZA5A 4B75A 1O2PA 4F4OC 4ABJA 3BIVH 4BTTB 4JZIA 1TPOA 3DHKH 2BDHA 2ZEBA 1O37A 2GZ9A 1WYKA 2ZQ2A 2Y82A 4JK6A 2BD3A 3I29A 1ELEE 3A8CA 1LPKB 1XUFA 1QNJA 4FUEA 3R3GB 3KL6A 3BTWE 3PTNA 3A80A 1C1NA 3E3TA 2TGPZ 1QRZA 3FFGA 4E05H 1KXBA 5HXFA 1TNHA 1P12E 2PSYA 3L3TA 1HRTH 1MAXA 1O3GA 1PJPA 3MI4A 2ODQA 2XBWA 3VB5A 1UO6A 2W7UA 4B71A 3ZZ3A 4CRBA 4U2WA 1UTLM 7LPRA 5FBIA 1QL7A 4B2CA 1DXPA 3T62A 5EQRA 2P3FH 1O5DH 1GHAG 1QFKH 1TAWA 2ZHFH 1K21H 1C5YB 4AOQA 1GDQA 1B0FA 1K1PA 1A61H 1FN6A 1EAUA 3M36A 2FTMA 1YM0A 4WH8A 3MHWU 3EQ0H 4JZDH 6ESTA 2P94A 1FN8A 2CJIA 1ZGIA 2P16A 2QA9E 1G9IE 1QR3E 2AMDA 3TNTA 4JYUH 1W10U 1V2NT 1FY4A 2GTBA 1W3CA 3LGVA 2UUFB 2BDBA 1IOEA 1FXYA 3M3TA 1O3BA 1QRXA 3E0NB 3AVZA 2OBQA 1C5VA 1SR5C 2XCNA 1B5GH 1P3CA 2ZGJA 2HALA 2EI7A 5A8ZA 3SUEA 1MAYA 1K28D 2VB0A 4OS4A 2W26A 3ZVBA 5GJ4B 3ODFA 1MKWH 5L6NH 1NPMA 3SI4H 4B76A 1QB6A 5F8ZA 1HXEH 2FOGA 5C5NA 2ZFQH 1SG8B 1F5KU 1TX8A 3PO1C 3LT3A 1DANH 2XBVA 4MNXA 1OSSA 1SGRE 1O2OA 1PPGE 2ZDKA 5EODA 1F0TA 3SHAH 3BTHE 1Y3WA 4CRCA 2ZDMA 2AIPA 2RCEA 2AIQA 1YBWA 1WU1A 1AQ7A 2G00A 1N6XA 3OYPA 3RXLA 1WTGH 1O3JA 2BQWB 1C1MA 2WYJA 5C3NA 3M5MA 1C2LA 1F0RA 2GCHG 4LOYH 4UFFH 1GL1A 4CHAB 1RRKA 1FLEE 2C8YB 1Z1IA 1HAOH