3MHWU

The complex crystal structure of urokianse and 2-aminobenzothiazole
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structures of 2-Aminobenzothiazole-based Inhibitors in Complexes with Urokinase-type Plasminogen Activator
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 246
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mhwU01
1UTNA 2XWAA 3AAVA 1LTOA 2H6MA 4UFEH 3H7TA 2AMDA 2Y5HA 5JB9S 3D65E 2ZTXA 2CMYA 2PTCE 3RXMA 1EB2A 4D76A 1MQ6A 2FOHA 2UUKB 3LONA 3SZNA 1BJVA 1YCPK 4ZHLU 1O3GA 2GCTB 4X8VH 2AS9A 1WQVH 1DWDH 4YOGA 3A81A 1C1RA 1GJ5H 1C1VH 1QB1A 1QCPA 1TMUH 3A7XA 3RP2A 1ELTA 1GJBB 4LZ4B 1O0DH 2O8WA 1YPKH 1TA2A 2AH4X 4NFEA 4O3TA 1UHBA 3VPKA 5EQSA 3URCA 1GMHF 2O9QA 2H9HA 2PGBB 5EXLA 3AW1A 1OWKA 3RUOA 2SNWA 5F8XA 5BRRE 1EQ9A 1P2QA 1FY5A 1OPHB 3PO1C 1Y3XA 4YOJA 1UTPA 1JRTA 2SGEE 1MU6B 3BTQE 1W8BH 3SJ8A 4CRGA 1IQNA 1G3CA 3OU0A 1EPTA 1WAYB 4UD9H 5L2YH 1D3TB 1PJPA 1S5SA 4TWWA 3UWIA 1ESTA 3IITA 4AGKA 1C5NH 1ANDA 4XDEA 1GJDB 2EI7A 3SU5A 6CHAB 3QZRA 3A8DA 1MD8A 5GIBA 1O2TA 1XM1A 5F6MA 1TOMH 1GBHA 1KXBA 3M61U 3ZZ3A 2ZFFH 1TNHA 1MTWA 2WPIS 5FCKA 5FBEA 2WYJA 3SO3A 2VIOA 3F68H 4IC5A 1DXWA 1V2MT 1HFDA 4TY6A 1P10A 2ZKSA 2ZHDA 3PB1E 3VB5A 4KTUA 1YPLH 3HGPA 2R0LA 3GOVB 4GUXA 3ZYEA 3G01A 4DY7B 3TU7H 1HB0B 1ZR0A 4BXSA 4AYVB 5FX6A 2Y5FA 4CR9A 1NRRH 1N6XA 4U2WA 2WPLS 3UNQA 1AZZA 1HGTH 1UJ1A 1O3MA 2O8TA 2W3IA 5FX5A 7GCHF 2AMQA 3MNSA 2V3OH 1XUKA 1SHYA 1AKSB 4K69A 1O2PA 3RXRA 2DE9A 8ESTE 1AGJA 3RXBA 1EXFA 2EEKA 1MKXK 2QXHA 2ALVA 1O3DA 1E35B 2ANKH 2WINI 4WH6A 1YCPM 1CSOE 1DWCH 2RG3A 1DSTA 1O3PB 1YBWA 4J2YB 1OYTH 2SGAA 7LPRA 1A0JA 2BDCA 2H5CA 3SU4A 1YYY1 1KDQA 2ZGHA 3TIUA 4XBCA 3MU0A 1BBRE 1BIOA 1LVMA 3NZIA 4I33A 3P95A 2SFAA 2BQ6B 1AB9C 5HM9A 2ANMH 3LGVA 1C5ZB 2ZCHP 2ZPQA 3LGUA 3BG4B 5FBIA 1YM0A 1YPJH 1KXDA 1MCVA 2FO9A 3RXIA 1BTHH 2ZG0H 1THPB 1HAVA 1T8OA 5C1YA 1HIAB 1ZTJA 2AIPA 2SNVA 1RFNA 2BD4A 2ZFQH 2GDEH 1UTJA 4INLA 1VZQH 4NG9H 4DG4A 1TNKA 4CREA 3NUMA 2Q6GA 3SQEE 3TH2H 3UQVA 4ISNA 1GL0E 1HAOH 1D3QB 1RTKA 4AFUA 1NRQH 5JDUB 1NPMA 1FJSA 3OY6U 1LKAA 1RIWC 2UWLA 2XTTB 1JIRA 1C4V2 2JH6D 3BN9A 4BOHA 1ZRKA 2Z94A 1O33A 2BZ6H 2CHAC 4RSPA 3ZZ8A 3T5FH 2BDIA 4ZKOU 1FN8A 4ZAEA 1GHVH 3PMBB 2ZP0H 1TX8A 1GBJA 2UUJB 3RXFA 1FAXA 1MAYA 4Y0YE 3NPSA 3RXAA 1D6RA 1ZRBA 4Z6AH 1IAUA 3S69A 1ACBE 3Q76A 2BLVA 1QJ7B 1QNJA 4FUDA 5C3NA 4U32A 3BTME 4ZUHA 3ZZ6A 2WUBA 1ELFA 2BX4A 4WWYA 4HI3A 1HXFH 1A5IA 1TPOA 3MH4A 3LJJA 1OXGA 1GJCB 2VVVA 3NKKA 3MO9A 1AWFH 1FONA 3LKWA 2PSXA 1L1GA 3NCLA 4INKA 1HAXB 2R2WU 1D3DB 4Y8XA 1LDTT 1NO9H 3EQ0H 3LGWA 2TGAA 4Q7YA 1EJNA 2H9TH 2RA3A 4FUFA 2ZDVH 4XFQA 2ZDAH 2QGRA 2A2QH 1K2I1 1ZJDA 3ZZAA 3T27A 2ZF0H 3QZQA 1EP6A 3B23B 1QL8A 2ZHFH 2ANYA 2AMPA 2SGQE 1A3EH 1HBTH 4DOQA 4FVDA 1ELDE 1S0QA 1DVAH 4Y11E 1O34A 2BD8A 1TONA 4ZXYH 4BTTB 3SU3A 1DE7H 1SG8B 5ETXA 2FTLE 1K1OA 2NU3E 2VGCC 5EQRA 4ABHA 2FDAA 2ASUB 3RXSA 4XOJA 1ZHMA 1A2CH 1F5KU 1NU7B 1YP9A 3A7YA 1E37B 3S9AA 3SNAA 1EJMA 1OKXA 1O3FA 1HLTH 1JMOH 1UTMA 2GZ7A 2QC2A 2V6NA 2BD7A 3EDXB 2VNTA 1H9IE 3L33A 1BZXE 4K1TA 1KXEA 1XUGA 1GG6B 3ZZ9A 5AF9H 2VU8E 4WMDA 1ZSJA 3U8RH 4YO9A 2OBQA 2Z9JA 2BYAX 2YNBA 1SL3A 2Z3CA 3T28A 4TPYA 1ANEA 1GJ7B 3KL6A 1W7XH 2A5IA 1T8MA 1TMBH 1P2JA 1L4ZA 1YC0A 3ATWA 1C9PA 5A0AE 3R3GB 1IOEA 3SV6A 1VCPA 3RXJA 3F9EA 1LVOA 3UY9A 4AFZA 2XC4A 2Y81A 2R0KA 4BXWA 1SGEE 2BLWA 4X6PA 1VITG 2UWPA 1AWHB 2QY0B 1V2NT 4GLYA 2FMJA 2TGPZ 2FI4E 1LO6A 2RDLA 1EOJA 1P2MA 1C2HA 3VGCC 3MO3A 2G55A 1WCZA 4XE4A 4AGJA 1MKWH 1P2IA 1F2SE 3P8NA 1IQHA 5JPMH 2KAIB 5JBTA 1UVSH 2PV9B 1P0SH 5GPIB 3MNCA 1O2MA 3SW2B 3ZYDA 2G8TA 3S0NA 2VVUA 1W7GH 2BXUH 1SGTA 2ZPRA 1CVWH 1S6FA 1ZOMA 1BBRH 1XUFA 5AFYH 1J15A 1P11E 1TGCA 2CJIA 5CHAC 2ILNA 1RRKA 4I32A 4E06H 2BY5X 2Y7XA 1C9TA 3E90B 3RXLA 4GPGA 1VJAU 2SGDE 1YGCH 1CHOG 1Z1IA 4JMYA 1F0UA 1L2EA 1AE8H 1O2LA 1BMLA 5FXLA 6GCHG 1O2OA 3LOXA 1JWTA 4INHA 2J95A 3SNCA 2BD5A 4THNH 1W10U 1MU8B 4TYDA 3FZDA 4DJZB 3MHWU 1TBRH 4WXVA 5LGOA 1BRUP 2ZHWH 1LPZB 3FP8E 1VITH 4I31A 3E91A 1O2YA 3O8BA 2M5TA 2GT8A 3ATKA 3GCOA 1FY3A 3BEFB 3RC5A 1ZPZA 2FOBA 5T6FA 3PLKA 1QRXA 4Y10E 1PQAA 1J16A 2BD9A 5JB8S 5C1UA 3ATMA 1DANH 3PMJA 1LCYA 1ZLRA 2W3KA 1QJ1B 1Z6JH 4CHAB 1G37A 2J9NA 2G00A 2NWNA 1EKBB 1QQ4A 1TMTH 3KCGH 1GDUA 4FUHA 4JZFH 1SOTA 2ZO3H 3L6PA 1O2GH 1C1SA 1PPFE 2I6SA 3A84A 1ANCA 3F6UH 1HJAB 1J14A 5DPAA 4CBNA 1F0RA 1FAKH 3SNDA 5EQQA 4Y0ZE 1GI5A 3SJKA 1NTPA 1PYTD 1UVOA 1KLTA 2FI5E 2BVRH 4D7FA 1VCWA 4ZH8A 2VIPA 3GCNA 1CQQA 5TCAA 4ABIA 2Z9GA 2XYAA 3UUZA 5JBCS 4JK5A 2HNTE 3TNTA 5PTPA 4LZ1H 2R2MB 4A92A 1P12E 2Q1JA 2FLBH 3MNXA 3STIA 1CBWB 2OINA 1A1RA 1N6YA 3PM3A 4GCHF 3HKIB 4JK6A 3S7HB 1H9HE 3PYHA 3TGKE 2XWBI 1DT2A 1HAIH 3MH6A 1DOJA 1EPTC 2BY7X 1F5RA 2A4RA 3SV7A 1JOUB 1BDAA 1VITF 1DY9A 1TNGA 1IQFA 1FUJA 2W7SA 3CP7A 2F9BH 4YZUA 1SBWA 2V35A 2O8MA 3RXEA 3DD2H 2C90B 5HMAA 2BDGA 2HLCA 2VINA 3KQBA 5TJXA 1UK3A 1MTVA 4AX9H 1KLIH 1GCTB 5JBBS 4D8NA 1FY8E 1HCGA 4ABDA 1BT7A 3GCHC 1HAZB 3VXFH 4MG3A 2GDDA 1PFXC 2BOKA 3M3VA 3SGQE 3EAJA 3SNBA 3ZZDA 4KTSA 1G2MA 1ETSH 4MNVA 1C1OA 2ZTYA 2Y5GA 3MU4A 4IC6A 2FYRA 2QIQA 5EPYA 3U1IB 4IGDA 3A80A 3TJNA 1EZUC 1N8OB 2ZGXH 3RLWH 1ZYOA 8KME2 1BMAA 3ZVEA 1CHOF 5I46H 6GCHF 4AN7A 3KQEA 3VXEH 3CENA 1UVTH 1N8OC 3M7QA 1O2IA 2CXVA 3SV8A 1GJ9B 1TBQH 4GAWA 1ZZZA 2C8XB 1BTXA 1FZZA 5DG6A 3CS0A 4CRFA 3NK8A 1RXPA 3ZZ4A 3Q3YA 5L30H 3RC6A 2BTCE 2WV5A 1O3AA 1TA6A 3SOSA 1O5BB 5SGAE 2ZDKA 1GHBG 1ABIH 2BHGA 1TIOA 2Q6FA 4ABBA 3S7KB 2ZC9H 1TX7A 1P8VC 3FVFB 1HAGE 4YOIA 3GY7A 1C5YB 1XMNB 3A87A 4CRBA 1P02A 3GY6A 2P8OC 5DP6A 3OSYA 1LHCH 4B2BA 1XX9A 3U69H 2CV3A 2GVFA 3TNSA 4FUGA 4FVBA 1GBKA 4YT6H 1IQMA 1ZHPA 2GD4B 1MTNC 2GCHG 4YT7H 3SUGA 5E0JA 4BAOB 2XXLA 1FDPA 4FUJA 1H8IH 2IJOB 3UNSA 4IBLH 3RXCA 1EAUA 1OP8A 2UWOA 1BJUA 4F49A 3DUXH 2OBOA 4DT7B 1GBDA 1S84A 2W5EA 3RXQA 4D7GA 4NGAH 2BZAA 1AU8A 4K5ZA 3M5MA 2FYQA 4AYYB 4TWYA 3PO1B 1YLDA 3BIUH 3MO6A 3KNXA 2P3FH 3MWIU 2FS8A 1V6DA 3M3TA 4DURA 1V2OT 1C5OH 3ENSB 2HWLB 1T8LA 5DO4H 1DLEA 2JETC 1QFKH 1Z8GA 2V0BA 1VR1H 1KTTB 3LGYA 4WJG2 1HAHH 1FY4A 3T25A 1CGIE 2WUCA 1AFQB 2FM2A 5DGJA 1KYNA 2AFQB 1C2LA 2OCVB 8GCHG 4WH8A 2EC9H 2NU2E 3I29A 1MQ5A 1G32B 2ZWLH 1G2LA 2LPRA 1SGYE 1V2KT 2CN0H 1E34B 1JIMA 4MNXA 1AFQC 1K22H 4B76A 2XCFA 2XCNA 1QGFA 2BDBA 5DJ7A 1QA7A 2PKAA 1O5EH 3Q00A 4Q80A 2JH0D 1VCQA 1D3PB 1ELGA 1CT0E 1QBOA 1TWXB 2HPPH 5J4QA 1KXCA 4FUEA 4LXBH 4NSYA 2FWWA 2FS9A 1SGQE 2YNAA 1C1MA 5FCRA 3RXTA 1C1NA 3QX5H 2B9LA 2XRCA 1MKWK 4X2XA 3SI3H 3LJOA 1FLEE 2Y82A 3BEIB 1SB1H 3HKJB 4Y71A 1TNIA 2VJ1A 2D8WA 4AG1A 1K1JA 1EASA 2TBSA 5FHTA 1WTHD 1V2JT 2ULLA 1DXPA 4A5TS 3ODDA 5DKMA 5A8XA 2ZFRH 3GCTG 1NFYA 1S85A 4ISLA 3AW0A 1O3LA 5LPEA 2ZECA 3GISB 1ZTLA 4MPXA 1KY9A 1SOZA 1B5GH 1T31A 1C2MA 3GDSA 2CF9H 4OS1A 8LPRA 2XBVA 3TGJE 1WYKA 2WPMS 2Y6TA 1GHXH 3TH4H 4AZ2B 4CRAA 1AB9B 3QO6A 4MTBA 1S81A 1O37A 1P3EA 3GICB 1PPEE 5A0BA 1GMCG 4GSOA 1V2TT 2QYIA 1GHBF 3MU5A 1PYTC 4O9VA 1ARCA 5C67A 1Y5UT 4I7YH 4JZIA 5F8ZA 3ZVGA 5GJ4B 1LVBA 2A31A 3PMHB 4FUCA 4X8TH 1TPSA 1DM4B 1H8DH 3P8GA 7KMEH 3B9FH 1DY8A 3F9GA 1L1NA 3HPTB 5EXNA 2GT7A 2FOEA 1GGDC 5FPSA 5ESBA 4I8GA 4CRCA 1UTKA 3E3TA 2FEQH 3U8OH 3ESTA 3ZZBA 5CMXH 1RIWB 2ZDLA 1C5RA 2ZQ2A 3T2NA 5J4SA 1AZ8A 2GCHF 2CHAB 3T62A 2FP7B 2Z7FE 5G4BA 2OQUA 2F9VA 4MPVA 1XXDA 2J92A 1WBGB 1SPJA 1GI6A 5L2ZH 3UNRA 2A4OA 2QF3A 4BAKB 2HPQH 2SGPE 2HNTF 2PHBA 1MBMA 1O31A 1O2SA 3NWUA 1DICA 2D2DA 1TOCB 2VWNA 1GL1A 3SHCH 5DK1A 4KTCA 1GJAB 1Z8JB 2F91A 3SBKA 2BLOA 2XNIA 3QWCH 5DP5A 3ZZ5A 1W0ZU 1S6HA 2TIOA 1SLUB 3MOCA 4RKOB 1EOLA 5DP3A 3O8RA 3GDUA 2AGEX 4O97A 3E16B 1MAXA 1K1LA 1WOFA 2XBWA 3B8JA 3BG8A 2K1QA 1SGFG 1QRZA 4ISIH 3AAUA 1V2WT 1C2GA 8GCHF 1L0ZA 3ZVCA 1T7CA 1TYNA 1O2HA 1UTLM 2C8ZB 3GY2A 4OS4A 1G3EA 1SLXB 2GV6A 5GDSH 1GVLA 3MNBA 3A88A 2OD3B 3LC3A 3SHAH 1XKAC 3RU4T 2ZFTA 1OSSA 5IYTA 1O2ZA 3EA8A 1J8AA 4E7RG 2QV1A 9LPRA 2FIRH 1GDNA 1TGSZ 5A0CA 3ZZCA 3ZV9A 1BTWA 2GMTC 3W95A 4UE7H 1TRNA 3TJOA 1F92A 3WY8A 2VIQA 1W11U 4JYVH 1TAWA 4B1TA 2AIQA 2PUXB 3F1SB 4ASHA 3T29A 5E2OA 1O3KA 2VGCB 3R0FA 1Z8RA 3EA7A 3KGPA 1GI2A 1ABJH 2Z3DA 1E36B 3BEUA 1UCYK 4HGCA 4MLFB 5C20A 2FOCA 3V0XA 1D9IA 4AFSA 1SGRE 1O2QA 1T4VH 1SLVB 1B7XB 4Y8ZA 1FY1A 2QXGA 2CGAA 1YCPH 1XUJA 3M5NA 2ZGBH 2H1UA 1AUTC 1EX3A 2G81E 1JRSA 1EB1H 2F9NA 2ANWA 2G51A 1GMCF 3LH3A 4ABJA 4Y76A 4K3JA 2ALPA 3A8BA 2WPHS 3VB4A 2IPHA 2B5TB 1O3BA 2F9UA 1AD8H 1EUFA 2D26C 1W0YH 4IS5A 3QDZB 2FX4A 2ODPA 2PUQH 1Q31A 1BTYA 2AEIH 2GV7A 1O3JA 1RS0A 1OWIA 1OWJA 4BTIB 1SQAA 3RC4A 2ZTZA 1ELEE 1TFXA 3Q77A 1Z6EA 2XW9A 1GI7B 3VGCB 1AKSA 1Q3XA 1A5HA 1EAIA 1GMDG 1UTOA 3M3SA 3RU4D 5ABWA 2STBE 3QUMP 1THRH 1BRBE 1QQUA 3DT0H 3LGIA 4I8KA 2ZEBA 3EYDA 5LPFA 1SR5C 4MDSA 1A61H 1NFXA 2A5AA 4RKJB 4TY7A 4A6LA 4FXGH 1NS3A 1P3CA 1O3EA 1FXYA 1ETTH 2HGTH 1QA0A 1O35A 3MH7A 5GCHG 4F4OC 1O2UA 1CA0C 4K1SA 1GBBA 1Y3YA 3MFJA 4FUIA 2IOTA 1QL7A 3BTEE 1O2KA 3M7TA 1CHGA 1O2VA 2AGGX 1KTSB 5CHAB 2PKSC 2J4IA 2P93A 3PWBA 3ITIA 1Q2WA 4O03A 5E0GA 2QXJA 1WSSH 1T32A 1XUHA 2G4TA 3SORA 1GVKB 1HIAA 1XVOA 1M9UA 2BQ7B 1C5SA 1T4UH 5CE1A 4IN1A 3BTGE 2Z9IA 1DWEH 2QAAA 1W13U 1O5FH 1GBCA 3EGKH 3F9HA 4DW2U 1TRYA 2A2XH 2ZU4A 2YOLA 1QR3E 5FAHA 1GBMA 1ORFA 3FFGA 3BSQA 4WMEA 4B73A 4AG2A 2ZFPH 1A5GH 4CBOA 3PLBA 1SFQB 2JKHA 1AI8H 1DPOA 1W3CA 3SU1A 2A1DB 2Y7ZA 1C2FA 1GDQA 1NZQH 2R3YA 1LHFH 4I8HA 2F3CE 2ZGJA 1C5XB 2A7JA 1PPCE 1TGNA 2J2UA 1SHHB 5AHGH 5HYOA 1LHGH 4AFQA 1O5GH 4A1VA 3NXPA 3A83A 3TPIZ 2NU4E 3OY5U 1ELCA 3SI4H 1LQDB 1O36A 1C1PA 4M7GA 1O39A 1Y5AT 1SLWB 3K6YA 1BMMH 4Z0KA 2Z9KA 1GI1A 3STJA 4X0WU 1TPPA 3U1JB 3QLPH 3P8OA 1C4U2 4BAMB 5EGMA 3TJVA 2BDAA 2OC8A 3SJOA 1A3BH 1BTZA 4X1QU 1SGPE 2C3SA 2G4UA 4NCYA 4XBBA 4BAQB 3UIRA 1IHTH 1NM6A 4LOYH 4X1NU 1FMGA 1UHBB 3RXGA 5GWZA 3IWMA 1ELBA 2WYGA 3RXUA 1ELVA 3GY4A 3I78A 2VIDA 1NROH 1NU9A 4U01A 1C5VA 1LQEA 1YPHE 1QL9A 1SMFE 2BDHA 2BD3A 3URDA 4NA8A 1O3NA 2BLQA 3RXVA 2QN5T 1EPTB 5A8YA 5DP8A 2Z9LA 3VEQB 3MYWA 1ZMLA 3FP6E 2PGQB 3Q3XA 1TQ7B 1AY6H 1SQTA 3W94A 1E0FD 1V2ST 4YTAA 1QY6A 1HAYB 1V3XA 1Z7KA 3GYMA 1PPGE 1Y59T 1CGJE 1GMDF 2OC7A 1V2UT 3TVJB 3GYLB 4BAHB 4GHQA 3K6ZA 1A46H 1K28D 4K8BA 1UK4A 3TJUA 5BPEA 1AVGH 3M36A 4OGXA 1GMHG 2P3TB 2HOBA 3GCHB 1GWAA 3RU4E 1HJ9A 1EZSC 1C2IA 3DHKH 3DFJA 3DFLA 1ZPBA 1TRMA 4FUBA 3P92A 3TGIE 4ABFA 5L6NH 3RXHA 1C5LH 3BTWE 3QTVH 5ESTE 2BVSH 3RMMH 4K60A 2XC5A 3A85A 3QTOH 3UQOA 1NT1A 2SGFE 3RMNH 1MMJN 2STAE 2Z3EA 1GHAG 2G5VA 3FAOA 4IN2A 2ZU2A 2ZIQH 2VWOA 1GI4A 1K1PA 1FN6A 1KIGH 1LPGB 1CT2E 3UR9A 5EODA 1KXAA 2A4GA 1SI5H 1D4PB 3SUDA 2TPIZ 1KDQB 4K2YA 3M37A 1HPGA 1C2KA 1Z71A 5LPRA 3UTUH 5HXFA 4Q7ZA 1DUAA 2QXIA 1O32A 1YPEH 4HZHA 4JYTA 4KGAA 3FP7E 1D6WA 1G9IE 1FNIA 1GHWH 3SJIA 2ZFSA 2FOAA 1S83A 1BTPA 1FI8A 1YF4A 3ODFA 3KN2A 2W7UA 3QN7A 1O3CA 1AHTH 1HAVB 3M35A 4MPUA 3RXKA 1DITH 1EAXA 4NSVA 1P9UA 5E8EH 1TB6H 1YPHC 2HVXA 4B2AA 5GXPA 1PPHE 3JZ1B 2P8OB 1C5QA 1J17T 1GJ8B 3P17H 1TX6A 1EZXC 4WY3A 2FOGA 1NN6A 1XUIA 3OYPA 1ZPCA 2THFB 5T6GA 4Q2KA 3A7ZA 1MTNB 1HAPH 2H9EH 1PQ8A 1O5DH 1VGCC 1UMAH 1W14U 5C2ZA 1GI0A 3KHVA 1HV7A 2ZI2H 3HGNA 1SGDE 4VGCC 1HJ8A 2B8OH 5E2PA 1GPZA 1AVWA 1O3HA 3HK3B 2ZDNA 2C4FH 3BTKE 1BA8B 2FESH 2BB4A 3TH3H 3TLOA 2ZU3A 4B71A 1ID5H 1C2EA 1DS2E 3RMOH 1MTUA 3RXOA 1YPGH 2O8UA 1P03A 3OX7U 1INCA 3LGTA 1L4DA 3PMAB 1BRAA 4Y7BA 4PROA 3MH5A 1H1BA 1C1QA 1TABE 2JETB 2WPKS 1GBTA 2P16A 4CH2B 1SVPA 1C1TA 2AYWA 5DP9A 3VB7A 1SQOA 1X7AC 2Z6BD 4TPIZ 4WXIA 1WU1A 2BOHB 2QF0A 3UR6A 1DFPA 4AB9A 1O2WA 2H5DA 2XC0A 1OS8A 3IG6B 1JXPA 1AQ7A 4YLUA 4X8SH 1C5WB 2FPZA 1SC8U 1ZHRA 2GCTC 3A8CA 2A32A 1ZSKA 4R8TB 4DVAU 4MQAA 3O8DA 1HRTH 1KSNA 1V2PT 1CO7E 2QA9E 2ZA5A 1FQ3A 4Q7XA 1P09A 2NU1E 1SSXA 4WVPE 1GBLA 2FTMA 1HNEE 2FLRH 1C4Y2 3FANA 1ZSLA 3H5CB 4ABAA 4UFGH 2GZ8A 2J94A 4IW4E 3V7TA 5C5OA 1P2KA 1GHAF 3QGJA 4OS6A 3A89A 2V3HH 4NIXA 2VB0A 1ESAA 2TRMA 1HUTH 1C1WH 3SUFA 1C5UA 4AORA 1GHYH 2P95A 1UO6A 6CHAC 1TQ0B 1C2DA 1DSUA 1NFUA 1KXFA 1ZMNA 4DIHH 1DX5M 2TGDA 3LU9B 1BBRK 3GY5A 4H4FA 1MTSA 3OTJE 4UDWH 2PW8H 3BTTE 3EE0B 3MU1A 2F9OA 2P59A 4DIIH 4ZKNU 1OWEA 4JZEH 1HXEH 3A7WA 1NFWA 4GVUA 1TBZH 5AVDA 2C8WB 1ZJKA 4D9RA 3V12A 3I77A 3BTHE 4OS5A 2DUCA 4NFFA 1K21H 3SNEA 5A8ZA 2IN2A 1CA8B 1FPHH 1G3BA 4K8YA 2RA0A 1O3IA 1QB6A 1GGDB 1Y3VA 4OS2A 3LT3A 1YLCA 2PSYA 5EPNA 4UFFH 4BNRA 3PV4A 4XBDA 5K7RA 1DUEA 1GVZA 1V2QT 4H42U 4OS7A 1S82A 3U8TH 3KEEA 4ZHMU 2P3UB 1OX1A 1TE0A 3HATH 1LPKB 2HALA 3AASA 1HYLA 1QTFA 1GHZA 1BUIA 4NWKA 1AFEH 1PQ5A 4LK4A 4KKDA 1A7SA 3BG4C 5T3HA 3BF6H 2BMGB 1UVUH 2Q6DA 3TITA 1CGHA 2ZZUH 1F0SA 3TK9A 4ZROA 3A7TA 3UFAA 3UOPA 4ZXXH 2UUFB 2FX6A 3P8FA 1P01A 3ZZ7A 2OC1A 4B2CA 3MU8A 4MPWA 2FOFA 4JCNA 5TCCA 3ZVFA 1MZAA 1IQJA 2G5NA 1RGQA 2ZCLP 1BITA 3QGNB 4X8UH 3S9CA 4ABEA 4JZ1A 1IQKA 2GP9B 3O8CA 1G30B 2FXRA 4NIVA 1NY22 1WUNH 1QB9A 2B0FA 1IQLA 1O30A 3E1XB 2C93B 1FIZA 2G52A 3PROA 5F03A 4DGJA 3N7OA 1O2NA 1EAWA 3LH1A 4CH8B 5EXMA 1TGBA 1J9CH 5IDKA 2GMTB 1RJXB 2ESTE 4B74A 1EP5A 3V13A 1Y8TA 5FPTA 3KQCA 4NZLA 2OXSA 2EI8A 1LHEH 1E38B 1NC6A 2DE8A 1BHXB 1OP2A 1OWHA 1GBFA 2D1JA 3LPRA 4ESTE 2ZDMA 4R0IA 2BDYA 1ZGIA 4I8LA 3M5LA 3BTDE 1B0FA 3A86A 3TK6A 4JZDH 1LVYA 1GJ6A 1P57B 5I25A 4QT8C 1FV9A 1GCDA 4B75A 1IQEA 3GCTF 3SV2H 3E6PH 1LKBA 1Z1JA 2PTNA 2P94A 5HM2A 2JH5D 5H4IB 1HDTH 2NU0E 3HK6B 1P05A 2OC0A 7ESTE 1O2RA 1GBAA 2PR3A 3ZVBA 1TNLA 5A09A 1WTGH 4Y8YA 3RMLH 1MZDA 1AIXH 4A1XA 3SJ9A 5EG4A 2GTBA 3ZVAA 1DLKB 2A4QA 2ZU5A 4IMQA 5LH8A 3E8LA 1QBVH 1VJ9U 4H6SB 3VB6A 3ZV8A 3RM2H 2VWLA 1O5CB 1UCYE 4A7IB 2ZGCA 1GJ4H 4X1PU 1PPZA 1FPCH 3UPEA 5A2MH 4X1SU 3K65B 1EJAA 3LC5A 1T8NA 4X1RU 4NA9H 3GY8A 2EA3A 2I6QA 4X2WA 3SV9A 1CA0B 3CS7A 1GG6C 3K2UA 2HRVA 3UOUA 2LNCA 5JBAS 1TGTA 2PKSB 2ZPSA 1NRSH 4GCHG 4NIYA 3C1KA 1UTQA 5C5NA 4E7NA 2RCEA 1IHSH 4YLQH 1TLDA 3V3MA 5EW2H 2OTVA 1OWDA 4WF8A 1BTUA 1K1NA 1V2RT 1EATA 1P06A 3F9FA 1CE5A 3GY3A 2R3UA 2VH0A 1SGIB 1A0HB 1GI9B 1ZGVA 3U98H 4U30A 3T26A 3ZVDA 3A82A 2A45B 5B6OA 1OOKB 4RN6A 4D9QA 3SGAE 4E05H 1SGFA 4NIWA 3MI4A 1P2NA 4ZMAH 4H6TA 3SGBE 4Y79A 1ARBA 2FOMB 1ESBA 1SFIA 1MKXH 2ZQ1A 1B0EA 1C5MD 2BY6X 5K0HA 1RTFB 1XVMA 3ATLA 1FIWA 1C5TA 4O3UA 1MCTA 1SGCA 2F9PA 3K9XB 4YESB 1ETRH 2F83A 1JBUH 1H4WA 1QJ6B 2BM2A 4CRDA 4SGAE 4ZKRU 1GBIA 1NRNH 1P04A 1NESE 4ZKSU 3UWJH 1UK2A 4YM9A 1F7ZA 3RXPA 2FI3E 3KIDU 4OGYA 2VIVA 4BTUB 1WQSA 4XSKU 2AERH 1DDJA 4NWLA 1XXFA 3U9AH 2PWXA 1N1LA 3SUEA 2PFEA 4X2YA 2W26A 2WV4A 1S0RA 2CF8H 1PPBH 3A7VA 2ZNKH 1AE5A 1ANBA 3BTFE 2A7HA 2OQ5A 1IQGA 1O3OA 2XBYA 3QK1A 1LHDH 3ELAH 4FU7A 1C5PA 4DCDA 4FU8A 2A0QB 2A5KA 3DA9B 2O8LA 1AMHA 3LDXH 1K1IA 2BD2A 1ZMJA 3GDVA 4CHAC 1C1UH 1QRWA 3TK5A 1G36A 1BHXF 4I8JA 2ODYB 1TALA 3Q3KA 2BQWB 1Y3UA 3E0NB 3LIWA 3L3TA 3AVZA 4X6NA 5DP4A 4KP0A 3SQHE 1QHRB 1XKBC 1P9SA 1BQYA 2BX3A 1NRPH 3FZZA 1A0LA 2GKVE 2ZHQH 1HJAC 2BY8X 1OYQA 1ZTKA 2XBXA 2J34A 2BXTH 2PKAB 1EZQA 2WPJS 5EW1H 1RTLA 3PLPA 2QCYA 1CU1A 1SGNE 1P2OA 4X6MA 2GGVB 4ZHAA 3PTNA 4X2VA 1ELAA 4BANB 1BB0B 5EU8A 1QBNA 3ATIA 3UREA 3D49H 2GX4A 1K9OE 5GCHF 4ABGA 5FPYA 1TPAE 4Y6DA 2ODQA 4MVNA 4CR5A 1BOQA 4UONA 1W12U 4KELA 1O2XA 1WV7H 1QIXB 1DWBH 1Y3WA 1CBWC 2H2ZA 9ESTA 4HFPB 4ISHH 3S9BA 4MNYA 3BV9B 3RDZA 1H9LB 4AB8A 1OP0A 1A4WH 3RM0H 2C8YB 1F0TA 4GHTA 1AVXA 1PQ7A 1G3DA 2B7DH 3SU6A 1Y5BT 5HGGA 2UUYA 5DP7A 3MMGA 3SN8A 1MD7A 1QURH 4HTCH 2AGIX 2PLXA 3P70B 1UCYH 3PTBA 1L1JA 1U6QA 4Y7AA 1GCTC 1YKTA 4NA7A 5E0HA 1BCUH 3VFEA 2FODA 3M7UA 3A8AA 5F8TA 2KAIA 3D23A 3BIVH 2GZ9A 1GI8B 2OUAA 3H7OA 5JYIA 3SU0A 2VVCA 4K1EA 3SU2A 1O38A 2ZHEH 4FU9A 4UFDH 1V2VT 3VB3A 3KQDA 1W2KH 1RD3B 7GCHG 2ZU1A 3PWCA 1TNJA 1VGCB 6ESTA 2BY9X 1AN1E 2VH6A 4MNWA 5C1XA 3C27B 4VGCB 1THSH 2OP9A 2VIWA 4UEHH 1AUJA 3MTYA 1V2LT 1YPMH 3RLYH 1Z8IB 4IMZA 1BRCE 1MUEB 4NZQA 4A1TA 5EOKA 1GI3A 3KF2A 2EI6A 1K1MA 3M5OA 1C2JA 1CT4E 2HNTC 2OLGA 6LPRA 1BMNH 2J38A 2TGTA 4J1YA 2ZCKP 2Y80A 2A7CA 2R9PA 1F5LA 3EA9A 4AOQA 4WMFA 5AFZH 3E0PB 2VWMA 1LMWB 4ISOA 4X6OA 3D62A 1O2JA 4JYUH 1O5AB 1MH0A 3JZ2B 5T6DA 2FZZA 3P6ZB 3RXDA 1AO5A 1KLJH 2BVXH 1UVPA 1IQIA 1GBEA 4SGBE 1MBQA
chains in the Genus database with same CATH superfamily
1UTNA 2XWAA 3AAVA 1LTOA 2H6MA 4UFEH 3H7TA 2AMDA 2Y5HA 5JB9S 3D65E 2K0QA 2ZTXA 2CMYA 2PTCE 3RXMA 1EB2A 4D76A 1MQ6A 2FOHA 2UUKB 3LONA 3SZNA 1BJVA 1YCPK 4ZHLU 1O3GA 2GCTB 4X8VH 2AS9A 1WQVH 2YMSD 1DWDH 5HIYA 4YOGA 3A81A 1C1RA 2J97A 1GJ5H 1C1VH 1QB1A 1QCPA 1TMUH 3A7XA 3RP2A 1ELTA 1GJBB 4LZ4B 1O0DH 2O8WA 1YPKH 1TA2A 2AH4X 4NFEA 4O3TA 1UHBA 3N7DA 3VPKA 5EQSA 3URCA 1GMHF 2O9QA 2H9HA 2PGBB 5EXLA 3AW1A 1OWKA 3RUOA 2SNWA 3OEED 5F8XA 5BRRE 1EQ9A 1P2QA 4Q63A 1FY5A 1OPHB 3PO1C 1Y3XA 4YOJA 1UTPA 1JRTA 2SGEE 1MU6B 3BTQE 1W8BH 3SJ8A 4CRGA 1W0KD 1IQNA 1G3CA 3OU0A 1EPTA 1WAYB 4UD9H 5L2YH 1D3TB 1PJPA 1S5SA 2RFKC 4TWWA 3UWIA 1ESTA 3IITA 4AGKA 1C5NH 1ANDA 4XDEA 1GJDB 2EI7A 3SU5A 6CHAB 3QZRA 3A8DA 1MD8A 5GIBA 1O2TA 1XM1A 5F6MA 1TOMH 1GBHA 1KXBA 3M61U 3ZZ3A 2ZFFH 1TNHA 1MTWA 2WPIS 5FCKA 5FBEA 2WYJA 3SO3A 5HIZA 2VIOA 3F68H 4IC5A 1DXWA 1V2MT 1HFDA 4TY6A 1P10A 2ZKSA 2ZHDA 3PB1E 3VB5A 3AK5A 4KTUA 1YPLH 3HGPA 2R0LA 3GOVB 4GUXA 3ZYEA 3G01A 4DY7B 3TU7H 1HB0B 1ZR0A 4BXSA 4AYVB 5FX6A 2Y5FA 4CR9A 1NRRH 1N6XA 4U2WA 2WPLS 3UNQA 1AZZA 1HGTH 1UJ1A 1O3MA 2O8TA 2W3IA 5FX5A 7GCHF 2AMQA 3MNSA 2V3OH 1XUKA 1SHYA 1AKSB 1NBMD 4K69A 1O2PA 3RXRA 2DE9A 8ESTE 1AGJA 3RXBA 1EXFA 2EEKA 1MKXK 2QXHA 2ALVA 1O3DA 1E35B 2ANKH 2WINI 4WH6A 1YCPM 1CSOE 1DWCH 2RG3A 1DSTA 1O3PB 1YBWA 2KCPA 4J2YB 1OYTH 2SGAA 7LPRA 1A0JA 2BDCA 2H5CA 4XRNA 3SU4A 1YYY1 1KDQA 2ZGHA 3TIUA 4XBCA 3MU0A 1BBRE 1BIOA 1LVMA 3NZIA 4I33A 3P95A 2SFAA 2BQ6B 1AB9C 1KMHB 5HM9A 2ANMH 3LGVA 1C5ZB 2ZCHP 2ZPQA 3LGUA 3BG4B 5FBIA 1YM0A 1YPJH 1KXDA 1MCVA 2FO9A 3RXIA 1BTHH 2ZG0H 1THPB 1HAVA 1T8OA 5C1YA 1HIAB 1ZTJA 2AIPA 2SNVA 2KCOA 1RFNA 2BD4A 2ZFQH 2GDEH 1UTJA 4INLA 1VZQH 4NG9H 4DG4A 1TNKA 4CREA 3NUMA 2Q6GA 3SQEE 3TH2H 3UQVA 4ISNA 3WW7A 1GL0E 1HAOH 1D3QB 1RTKA 1VKYA 1NRQH 4AFUA 1COWD 5JDUB 1NPMA 1FJSA 3OY6U 1W0JD 1LKAA 1RIWC 2UWLA 2XTTB 1JIRA 1C4V2 2JH6D 3BN9A 4BOHA 1ZRKA 2Z94A 1O33A 2BZ6H 2CHAC 4RSPA 3ZZ8A 3T5FH 2BDIA 4ZKOU 1FN8A 4ZAEA 1GHVH 3PMBB 2ZP0H 1TX8A 1GBJA 2UUJB 3RXFA 1FAXA 1MAYA 4Y0YE 1YY3A 3NPSA 3RXAA 1D6RA 4ACAA 1ZRBA 4Z6AH 5KEDA 1IAUA 3S69A 1ACBE 3Q76A 2BLVA 1QJ7B 1QNJA 4FUDA 5C3NA 4U32A 3BTME 4ZUHA 3ZZ6A 2WUBA 1ELFA 2BX4A 4WWYA 4HI3A 4DT4A 1HXFH 1A5IA 1TPOA 3MH4A 3LJJA 1OXGA 1GJCB 2VVVA 3NKKA 3MO9A 1AWFH 1FONA 3LKWA 2PSXA 1L1GA 3NCLA 4INKA 1HAXB 2R2WU 1D3DB 4Y8XA 1LDTT 1NO9H 3EQ0H 3LGWA 2TGAA 4Q7YA 1EJNA 2H9TH 2RA3A 4FUFA 2ZDVH 4XFQA 2ZDAH 2QGRA 2A2QH 1K2I1 1ZJDA 3ZZAA 3T27A 2ZF0H 3QZQA 4Q4LA 1EP6A 3B23B 1QL8A 2ZHFH 2ANYA 2AMPA 2SGQE 1A3EH 2LP6A 1HBTH 4DOQA 2XOKD 1ELDE 4FVDA 1UW7A 1S0QA 1DVAH 4Y11E 1O34A 2BD8A 1TONA 4ZXYH 4BTTB 3GS9A 3SU3A 1DE7H 1SG8B 4F48B 5ETXA 2FTLE 1K1OA 2NU3E 2VGCC 5EQRA 5CDFE 4ABHA 2FDAA 2ASUB 3RXSA 4XOJA 1ZHMA 1A2CH 1F5KU 1NU7B 1YP9A 3A7YA 1E37B 3S9AA 3SNAA 1EJMA 1OKXA 1O3FA 1HLTH 1JMOH 1UTMA 2GZ7A 2QC2A 2QE7D 2V6NA 2BD7A 5C17A 3EDXB 2VNTA 1H9IE 3L33A 1BZXE 4K1TA 1KXEA 1XUGA 1GG6B 3ZZ9A 5AF9H 2VU8E 4WMDA 1ZSJA 3U8RH 4YO9A 2OBQA 2YMSC 2Z9JA 2BYAX 4F55A 2YNBA 1SL3A 2Z3CA 3T28A 4TPYA 1ANEA 1GJ7B 3KL6A 1W7XH 2A5IA 1T8MA 1TMBH 1P2JA 1L4ZA 1YC0A 3ATWA 1C9PA 5A0AE 3R3GB 1IOEA 3SV6A 1VCPA 3RXJA 3F9EA 1LVOA 3UY9A 4AFZA 2XC4A 2Y81A 2R0KA 4BXWA 1SGEE 2BLWA 4X6PA 1VITG 2UWPA 1AWHB 2QY0B 4ACBA 1V2NT 4GLYA 2FMJA 2TGPZ 2FI4E 2EY4C 1LO6A 2RDLA 1EOJA 1P2MA 1C2HA 3VGCC 3MO3A 2G55A 1WCZA 4XE4A 4AGJA 1MKWH 1P2IA 1F2SE 2VBCA 3P8NA 1IQHA 5JPMH 2KAIB 5JBTA 1UVSH 2K8IA 2PV9B 1P0SH 5GPIB 3MNCA 1O2MA 3SW2B 3ZYDA 2G8TA 3S0NA 2VVUA 1W7GH 2BXUH 1SGTA 2ZPRA 1CVWH 1S6FA 1ZOMA 1BBRH 1XUFA 5AFYH 1J15A 1P11E 1TGCA 3F3BA 2CJIA 5CHAC 2ILNA 1RRKA 4I32A 4E06H 2BY5X 2Y7XA 1C9TA 3E90B 3RXLA 4GPGA 1VJAU 2SGDE 1YGCH 1CHOG 1Z1IA 4JMYA 1F0UA 1L2EA 1AE8H 1O2LA 1BMLA 5FXLA 6GCHG 3U28C 1O2OA 1WDIA 3LOXA 1JWTA 4INHA 2J95A 3SNCA 4YXWD 2BD5A 4THNH 1W10U 1MU8B 4TYDA 3FZDA 4DJZB 3MHWU 1TBRH 4WXVA 5LGOA 1BRUP 2ZHWH 1LPZB 3FP8E 1VITH 4I31A 3E91A 1O2YA 3O8BA 2M5TA 2GT8A 3ATKA 5C94A 3GCOA 1FY3A 3BEFB 3RC5A 1ZPZA 2FOBA 3OE7D 5T6FA 3PLKA 1QRXA 2KR7A 4Y10E 1PQAA 1J16A 2BD9A 5JB8S 5C1UA 3ATMA 1DANH 1EFRD 1LCYA 1ZLRA 2W3KA 3PMJA 1QJ1B 1Z6JH 4CHAB 1G37A 2J9NA 2G00A 2NWNA 1OHHD 1EKBB 1QQ4A 1TMTH 3KCGH 1GDUA 4FUHA 4JZFH 1SOTA 2ZO3H 3L6PA 1O2GH 1C1SA 1PPFE 2I6SA 3A84A 1ANCA 3F6UH 1HJAB 1J14A 5DPAA 4CBNA 1F0RA 1FAKH 3SNDA 5EQQA 4Y0ZE 1GI5A 3SJKA 1NTPA 5DN6D 1PYTD 1UVOA 1KLTA 2FI5E 2BVRH 4D7FA 1VCWA 4ZH8A 2VIPA 3GCNA 1CQQA 5TCAA 4ABIA 2Z9GA 2XYAA 2KCAA 3UUZA 5JBCS 4JK5A 2HNTE 3TNTA 5PTPA 2CK3D 4LZ1H 2R2MB 4A92A 1P12E 4HG6A 2Q1JA 2FLBH 3MNXA 3STIA 1CBWB 2OINA 1A1RA 1N6YA 3PM3A 4GCHF 3HKIB 4JK6A 3S7HB 1H9HE 3PRDA 3PYHA 3TGKE 2XWBI 1DT2A 1HAIH 3MH6A 1DOJA 1EPTC 2BY7X 1F5RA 2A4RA 3SV7A 1JOUB 1BDAA 1VITF 1DY9A 1TNGA 1IQFA 1FUJA 2W7SA 3CP7A 2F9BH 4YZUA 1SBWA 2V35A 2O8MA 3RXEA 3DD2H 2C90B 5HMAA 2BDGA 4M9FA 2HLCA 2VINA 3KQBA 5TJXA 1UK3A 1MTVA 4AX9H 1KLIH 1GCTB 5JBBS 4D8NA 1FY8E 1HCGA 4ABDA 1BT7A 3GCHC 1HAZB 3VXFH 4MG3A 2GDDA 1PFXC 2BOKA 3M3VA 3SGQE 3EAJA 3SNBA 3ZZDA 4KTSA 1G2MA 1ETSH 4MNVA 1C1OA 2ZTYA 2WPDD 2Y5GA 3MU4A 4IC6A 2FYRA 2QIQA 5EPYA 3U1IB 4IGDA 3A80A 3TJNA 1EZUC 1N8OB 2ZGXH 3RLWH 1ZYOA 8KME2 1BMAA 3ZVEA 1CHOF 5I46H 2J98A 6GCHF 4AN7A 3KQEA 3VXEH 3CENA 1UVTH 1N8OC 3M7QA 1O2IA 2CXVA 3SV8A 1GJ9B 1TBQH 4GAWA 1ZZZA 2C8XB 1BTXA 1FZZA 5DG6A 3CS0A 4CRFA 3NK8A 1RXPA 3ZZ4A 3Q3YA 2GJGA 5L30H 3RC6A 2BTCE 2WV5A 1O3AA 1TA6A 2W6ID 3EE7A 3SOSA 1O5BB 5SGAE 2ZDKA 1GHBG 1ABIH 2BHGA 2F4LA 1TIOA 2Q6FA 4ABBA 3S7KB 2ZC9H 1TX7A 1P8VC 3FVFB 1HAGE 4YOIA 3GY7A 1C5YB 1XMNB 3A87A 4CRBA 1P02A 3PV5A 3GY6A 2P8OC 5DP6A 3OSYA 1LHCH 4B2BA 1XX9A 3U69H 2CV3A 2GVFA 3TNSA 4FUGA 4FVBA 4P00A 1GBKA 4YT6H 4OM9A 1IQMA 1ZHPA 2GD4B 1MTNC 5F53A 2GCHG 4YT7H 3SUGA 5E0JA 4BAOB 3F2FA 2XXLA 1FDPA 4FUJA 1H8IH 2IJOB 3UNSA 4IBLH 3RXCA 1EAUA 1OP8A 2UWOA 1BJUA 4F49A 3DUXH 2OBOA 4DT7B 1GBDA 1S84A 2W5EA 3RXQA 5EJLA 4D7GA 4NGAH 2BZAA 1AU8A 4K5ZA 3M5MA 2FYQA 4AYYB 4TWYA 3PO1B 1YLDA 3BIUH 3MO6A 3KNXA 3DCLA 2P3FH 3MWIU 2FS8A 1V6DA 3M3TA 4DURA 1V2OT 1C5OH 3ENSB 2HWLB 1T8LA 5DO4H 1DLEA 2JETC 1QFKH 1Z8GA 2V0BA 1VR1H 1KTTB 3LGYA 4WJG2 1HAHH 1FY4A 3T25A 1CGIE 2WUCA 1AFQB 2FM2A 5DGJA 1KYNA 2AFQB 1C2LA 2OCVB 8GCHG 4WH8A 2EC9H 2NU2E 3I29A 1MQ5A 5C0TA 1G32B 2ZWLH 1G2LA 2LELA 2LPRA 1SGYE 1V2KT 2CN0H 1E34B 1JIMA 4MNXA 1AFQC 1K22H 3UAIC 4B76A 2XCFA 2XCNA 1QGFA 2BDBA 5DJ7A 1QA7A 1O5EH 2PKAA 3Q00A 4Q80A 2JH0D 1VCQA 1D3PB 1ELGA 1CT0E 1QBOA 1TWXB 2HPPH 5J4QA 1KXCA 4FUEA 4LXBH 4NSYA 2FWWA 2FS9A 1SGQE 2YNAA 1C1MA 5FCRA 3RXTA 1C1NA 3QX5H 2B9LA 2XRCA 1S6LA 1MKWK 4X2XA 3SI3H 3LJOA 1FLEE 2Y82A 3BEIB 1SB1H 3HKJB 4Y71A 1TNIA 2VJ1A 2D8WA 4AG1A 1K1JA 1EASA 2TBSA 5FHTA 1WTHD 1V2JT 2ULLA 1DXPA 4A5TS 3ODDA 5DKMA 5A8XA 2ZFRH 3GCTG 1NFYA 1S85A 4ISLA 3AW0A 1O3LA 5LPEA 2ZECA 3GISB 1ZTLA 3DSPA 4MPXA 1KY9A 1SOZA 1B5GH 1T31A 1C2MA 3GDSA 2CF9H 4OS1A 8LPRA 2XBVA 3TGJE 1WYKA 2WPMS 2Y6TA 1GHXH 3TH4H 4AZ2B 4CRAA 1AB9B 3QO6A 4MTBA 1S81A 1O37A 1P3EA 3GICB 1PPEE 5A0BA 1GMCG 4GSOA 2WZQA 1V2TT 2QYIA 1GHBF 3MU5A 1PYTC 4O9VA 1ARCA 5C67A 1Y5UT 4I7YH 4JZIA 5F8ZA 3ZVGA 5GJ4B 1LVBA 2A31A 3PMHB 4FUCA 4X8TH 1TPSA 1DM4B 1H8DH 3P8GA 4P02A 7KMEH 3B9FH 1DY8A 3F9GA 1L1NA 3HPTB 5EXNA 2GT7A 2FOEA 1GGDC 5FPSA 3F2HA 4I8GA 5ESBA 4CRCA 1UTKA 3E3TA 2FEQH 3U8OH 3ESTA 3ZZBA 5CMXH 1RIWB 2ZDLA 4RT1A 1QZ8A 1C5RA 2ZQ2A 3T2NA 5J4SA 1AZ8A 2GCHF 2CHAB 3T62A 2FP7B 2Z7FE 5G4BA 2JJ2D 2OQUA 2F9VA 4MPVA 1XXDA 2J92A 3KYGA 1WBGB 1SPJA 1GI6A 5L2ZH 3UNRA 2A4OA 2QF3A 4BAKB 2HPQH 2SGPE 4RT0A 2HNTF 2PHBA 1MBMA 1O31A 1O2SA 3NWUA 1DICA 2D2DA 1TOCB 2VWNA 1GL1A 3SHCH 5DK1A 4KTCA 1GJAB 1Z8JB 2F91A 3SBKA 2BLOA 2WV9A 2XNIA 3QWCH 5DP5A 3OEHD 3ZZ5A 1W0ZU 1S6HA 2TIOA 1SLUB 3MOCA 2F43B 4RKOB 1EOLA 5DP3A 3O8RA 3GDUA 2AGEX 4O97A 3E16B 1MAXA 1K1LA 1WOFA 1WXRA 2XBWA 3B8JA 3BG8A 2K1QA 1SGFG 1QRZA 4ISIH 3AAUA 1V2WT 1C2GA 8GCHF 1L0ZA 3ZVCA 2V3MA 1T7CA 1TYNA 1O2HA 1UTLM 2C8ZB 3GY2A 4OS4A 1G3EA 1SLXB 2GV6A 5GDSH 1GVLA 3MNBA 3A88A 2OD3B 3LC3A 3SHAH 1XKAC 3RU4T 2ZFTA 1OSSA 5C0UA 5IYTA 1O2ZA 3EA8A 1J8AA 4E7RG 2QV1A 9LPRA 2FIRH 1GDNA 1TGSZ 5A0CA 3ZZCA 3ZV9A 1BTWA 2GMTC 3W95A 4UE7H 1TRNA 3TJOA 1F92A 3PRBA 3WY8A 2VIQA 1W11U 4JYVH 1TAWA 4B1TA 2AIQA 2PUXB 3F1SB 4ASHA 3T29A 3W1EA 5E2OA 1O3KA 2VGCB 3R0FA 1Z8RA 3EA7A 3KGPA 1GI2A 1ABJH 2WSSD 2Z3DA 1E36B 3BEUA 1UCYK 4HGCA 4MLFB 5C20A 2FOCA 3V0XA 1D9IA 4AFSA 1SGRE 1O2QA 1T4VH 1SLVB 1B7XB 2L6OA 1NBME 4Y8ZA 1FY1A 2QXGA 2CGAA 1YCPH 1XUJA 3M5NA 2ZGBH 2H1UA 1AUTC 1EX3A 2G81E 2YMSB 1JRSA 1EB1H 2F9NA 2ANWA 2G51A 1GMCF 3LH3A 4ABJA 4Y76A 4K3JA 2ALPA 3A8BA 5KGOA 2WPHS 3VB4A 2IPHA 2F9UA 1O3BA 2B5TB 1AD8H 1EUFA 1E1RD 2D26C 1W0YH 4IS5A 3QDZB 2FX4A 2ODPA 2PUQH 1Q31A 1BTYA 2AEIH 2GV7A 1O3JA 1RS0A 1OWIA 1OWJA 4BTIB 1SQAA 3RC4A 2ZTZA 1YWUA 1ELEE 1TFXA 3Q77A 1Z6EA 2XW9A 1GI7B 3VGCB 1AKSA 1Q3XA 1A5HA 1EAIA 1GMDG 1UTOA 3M3SA 3RU4D 5ABWA 2STBE 3QUMP 1THRH 1BRBE 1QQUA 3DT0H 3LGIA 4I8KA 2ZEBA 3EYDA 5LPFA 1SR5C 4MDSA 1A61H 1NFXA 2A5AA 4RKJB 2EQNA 4TY7A 4A6LA 4FXGH 1NS3A 1P3CA 1O3EA 1FXYA 1ETTH 2HGTH 1QA0A 2XNDD 3CNRA 1O35A 3MH7A 5GCHG 4F4OC 1O2UA 1CA0C 4K1SA 1GBBA 1Y3YA 3MFJA 4FUIA 2IOTA 1QL7A 3BTEE 1O2KA 3M7TA 1CHGA 1O2VA 2AGGX 1KTSB 5CHAB 2PKSC 2J4IA 2P93A 3PWBA 3ITIA 1Q2WA 4O03A 5E0GA 2QXJA 1WSSH 1T32A 1XUHA 2PP6A 2G4TA 3SORA 1GVKB 1HIAA 1XVOA 1M9UA 2BQ7B 1H8HD 1C5SA 1T4UH 5CE1A 4IN1A 3BTGE 2Z9IA 1DWEH 2QAAA 1W13U 1O5FH 1GBCA 3EGKH 3F9HA 4DW2U 1TRYA 5EJ1A 2A2XH 2ZU4A 2YOLA 1QR3E 5FAHA 4Z1MD 1GBMA 1ORFA 3FFGA 3BSQA 4WMEA 4B73A 4AG2A 2ZFPH 1A5GH 1BMFD 4CBOA 3PLBA 1SFQB 4ZCNA 2JKHA 1AI8H 1DPOA 1W3CA 3SU1A 2A1DB 2Y7ZA 1C2FA 1GDQA 1NZQH 2R3YA 1LHFH 4I8HA 2F3CE 2ZGJA 1C5XB 2A7JA 1PPCE 1TGNA 2J2UA 1SHHB 5AHGH 5HYOA 1LHGH 4AFQA 1O5GH 4A1VA 3NXPA 3A83A 3TPIZ 2NU4E 3OY5U 1ELCA 3SI4H 1LQDB 1O36A 1C1PA 4M7GA 1O39A 1Y5AT 1SLWB 3K6YA 1BMMH 4Z0KA 2Z9KA 1GI1A 3STJA 4X0WU 1TPPA 3U1JB 3VG8A 3QLPH 3P8OA 1C4U2 4BAMB 5EGMA 3TJVA 2BDAA 2OC8A 3SJOA 3KQ5A 1A3BH 1BTZA 4X1QU 1SGPE 2C3SA 2G4UA 4NCYA 4XBBA 4BAQB 3UIRA 1IHTH 1NM6A 4LOYH 4X1NU 2V7QD 1FMGA 1UHBB 3RXGA 5GWZA 3IWMA 1ELBA 2WYGA 2KZ4A 3RXUA 1ELVA 3GY4A 3I78A 2VIDA 1NROH 1NU9A 4U01A 2KFWA 1C5VA 3OTPA 1LQEA 1YPHE 1QL9A 1SMFE 3OFND 2BDHA 2BD3A 5CHBA 3URDA 4NA8A 1O3NA 2BLQA 3RXVA 2QN5T 1EPTB 5A8YA 5DP8A 2Z9LA 3VEQB 3MYWA 1ZMLA 3FP6E 2PGQB 3Q3XA 1TQ7B 1AY6H 1SQTA 3W94A 1E0FD 1V2ST 4YTAA 1QY6A 1HAYB 1V3XA 1Z7KA 3GYMA 1PPGE 1Y59T 1CGJE 1GMDF 2OC7A 1V2UT 3WWFA 3TVJB 3GYLB 4BAHB 4GHQA 3K6ZA 1A46H 1K28D 4K8BA 3FOAA 1UK4A 3TJUA 5BPEA 1AVGH 3M36A 4OGXA 1GMHG 2P3TB 2HOBA 3GCHB 1GWAA 3RU4E 1HJ9A 1EZSC 1C2IA 3DHKH 3DFJA 3DFLA 4TSFD 1ZPBA 1TRMA 4FUBA 3P92A 3TGIE 3FO8D 4ABFA 5L6NH 3RXHA 1C5LH 3BTWE 3QTVH 3F2GA 3F0OA 5ESTE 2BVSH 3RMMH 4K60A 2XC5A 3A85A 3QTOH 3UQOA 1NT1A 2L74A 2SGFE 3RMNH 1MMJN 2STAE 1K0HA 2Z3EA 1GHAG 2AHME 2G5VA 3FAOA 2ZU2A 4IN2A 2ZIQH 5EJZA 2VWOA 1GI4A 1K1PA 1FN6A 1KIGH 1LPGB 1CT2E 3UR9A 5EODA 1KXAA 2A4GA 1SI5H 1D4PB 3SUDA 2TPIZ 1KDQB 4K2YA 3M37A 1HPGA 1C2KA 1Z71A 5LPRA 2IJD1 3UTUH 5HXFA 4Q7ZA 1DUAA 3DSGA 2QXIA 1O32A 1YPEH 4HZHA 4JYTA 4KGAA 3FP7E 1D6WA 1G9IE 1FNIA 1GHWH 3SJIA 2ZFSA 2FOAA 1S83A 1BTPA 1FI8A 1YF4A 3ODFA 3KN2A 2W7UA 3QN7A 1O3CA 1AHTH 1HAVB 3M35A 4MPUA 3RXKA 1DITH 1EAXA 4NSVA 1P9UA 4FOUC 5E8EH 1TB6H 1YPHC 2HVXA 4B2AA 5GXPA 1PPHE 5GNDA 3JZ1B 2P8OB 1C5QA 1J17T 1GJ8B 3P17H 1TX6A 1EZXC 3SYJA 4WY3A 2FOGA 1NN6A 1XUIA 3OYPA 1ZPCA 2THFB 5T6GA 4Q2KA 3A7ZA 1MTNB 1HAPH 2H9EH 1PQ8A 1O5DH 1VGCC 2HLDD 1UMAH 1W14U 5C2ZA 1GI0A 3KHVA 1HV7A 2ZI2H 3HGNA 1SGDE 4VGCC 1HJ8A 2B8OH 5E2PA 1GPZA 1AVWA 1O3HA 3HK3B 2ZDNA 2C4FH 3BTKE 1BA8B 2FESH 2BB4A 3TH3H 3TLOA 2ZU3A 4B71A 1ID5H 1C2EA 1DS2E 3RMOH 1MTUA 3RXOA 1YPGH 3UB0A 2O8UA 1P03A 3FKSD 3OX7U 1INCA 3LGTA 1L4DA 3PMAB 1BRAA 4Y7BA 4PROA 3MH5A 1H1BA 1C1QA 1TABE 2JETB 2WPKS 1GBTA 2P16A 4CH2B 1SVPA 1C1TA 2AYWA 5DP9A 3VB7A 1SQOA 1X7AC 2Z6BD 4TPIZ 4WXIA 1WU1A 2BOHB 2QF0A 3UR6A 1DFPA 4AB9A 1O2WA 2H5DA 2XC0A 1OS8A 3IG6B 1JXPA 1AQ7A 4YLUA 4X8SH 1C5WB 2FPZA 1SC8U 1ZHRA 2GCTC 3WWBA 2M2AA 3A8CA 2A32A 1ZSKA 4R8TB 4DVAU 4MQAA 3O8DA 1HRTH 1KSNA 1V2PT 1CO7E 2QA9E 2ZA5A 1FQ3A 4Q7XA 1P09A 2NU1E 1SSXA 4WVPE 1GBLA 2FTMA 1HNEE 2FLRH 1C4Y2 3FANA 1ZSLA 3H5CB 4ABAA 4UFGH 2GZ8A 2J94A 4IW4E 3V7TA 5C5OA 1P2KA 1GHAF 3QGJA 4OS6A 3A89A 2V3HH 5T1VA 4NIXA 2VB0A 1ESAA 2TRMA 1HUTH 1C1WH 3SUFA 1C5UA 4AORA 1GHYH 2P95A 1UO6A 6CHAC 1TQ0B 1C2DA 1DSUA 1NFUA 1KXFA 1ZMNA 4DIHH 1DX5M 2TGDA 3LU9B 1BBRK 3GY5A 4H4FA 1MTSA 3OTJE 4UDWH 2PW8H 3BTTE 3EE0B 3MU1A 3SZEA 2F9OA 2P59A 4DIIH 4ZKNU 1OWEA 4JZEH 1HXEH 3A7WA 1NFWA 4GVUA 1TBZH 5AVDA 2C8WB 1ZJKA 4D9RA 5KECA 3V12A 3I77A 3BTHE 4OS5A 2DUCA 4NFFA 1K21H 3DSOA 3SNEA 5A8ZA 2IN2A 1CA8B 1FPHH 1G3BA 4K8YA 2RA0A 1O3IA 1QB6A 1GGDB 1Y3VA 4OS2A 3LT3A 1YLCA 2PSYA 5EPNA 4UFFH 4ASUD 4BNRA 1FX0B 3PV4A 4XBDA 5K7RA 1DUEA 1GVZA 1V2QT 4H42U 4OS7A 1S82A 3U8TH 3KEEA 4ZHMU 2P3UB 1OX1A 1TE0A 3HATH 1LPKB 2HALA 3AASA 1HYLA 1QTFA 1GHZA 1BUIA 4NWKA 1AFEH 1PQ5A 4LK4A 4KKDA 1A7SA 3BG4C 5T3HA 3BF6H 2BMGB 1UVUH 2Q6DA 3TITA 1CGHA 2ZZUH 1F0SA 3TK9A 4ZROA 3A7TA 3UFAA 3UOPA 4ZXXH 2UUFB 2FX6A 3P8FA 1P01A 3ZZ7A 2JDID 2OC1A 4B2CA 3MU8A 4MPWA 2FOFA 4JCNA 5TCCA 3ZVFA 1MZAA 2J5UA 1IQJA 2G5NA 1RGQA 2ZCLP 1BITA 2RDEA 3QGNB 4X8UH 3S9CA 4ABEA 4JZ1A 1IQKA 2GP9B 3O8CA 1G30B 2FXRA 4NIVA 1NY22 2QF4A 2HVYB 1WUNH 1QB9A 2B0FA 1IQLA 1O30A 3E1XB 2C93B 1FIZA 2G52A 3PROA 5F03A 4DGJA 3N7OA 1O2NA 1EAWA 3LH1A 4CH8B 5EXMA 1TGBA 1J9CH 5IDKA 2GMTB 1RJXB 2ESTE 4B74A 1EP5A 3V13A 1Y8TA 5FPTA 3KQCA 4NZLA 2OXSA 2EI8A 1LHEH 1E38B 1NC6A 2DE8A 1BHXB 1OP2A 1OWHA 3F0PA 1GBFA 2D1JA 3LPRA 4ESTE 2ZDMA 4R0IA 2BDYA 1ZGIA 4I8LA 3M5LA 3BTDE 1B0FA 4FETA 3A86A 3TK6A 4JZDH 1LVYA 1GJ6A 1P57B 5I25A 4QT8C 1FV9A 1GCDA 4B75A 1IQEA 3GCTF 3SV2H 3E6PH 1LKBA 1Z1JA 2PTNA 3KYFA 2P94A 5HM2A 2JH5D 5H4IB 1HDTH 2NU0E 3HK6B 1P05A 2OC0A 7ESTE 1O2RA 1E79D 1GBAA 2PR3A 1TNLA 3ZVBA 5A09A 1WTGH 4Y8YA 3RMLH 1MZDA 1AIXH 4A1XA 3SJ9A 5EG4A 2GTBA 3ZVAA 1DLKB 2A4QA 2ZU5A 4IMQA 5LH8A 3E8LA 1QBVH 1VJ9U 4H6SB 3VB6A 3ZV8A 3RM2H 2VWLA 1O5CB 1UCYE 4A7IB 2ZGCA 1GJ4H 4X1PU 1PPZA 1FPCH 3UPEA 5A2MH 4X1SU 3K65B 1EJAA 3LC5A 1T8NA 4X1RU 4NA9H 3GY8A 1H8ED 2EA3A 2I6QA 4X2WA 3SV9A 1CA0B 3CS7A 1GG6C 3K2UA 2HRVA 3UOUA 2LNCA 5JBAS 1TGTA 2PKSB 2ZPSA 1NRSH 4GCHG 4NIYA 3C1KA 1UTQA 1E1QD 5C5NA 4E7NA 2RCEA 1IHSH 4YLQH 1TLDA 3V3MA 5EW2H 2OTVA 1OWDA 4WF8A 1BTUA 1K1NA 1V2RT 1EATA 1P06A 2J98B 3F9FA 1CE5A 3GY3A 2R3UA 2VH0A 1SGIB 1A0HB 1GI9B 1ZGVA 2OK5A 3U98H 4U30A 3T26A 3ZVDA 3A82A 2A45B 5B6OA 1OOKB 4RN6A 4D9QA 3SGAE 4E05H 1SGFA 4NIWA 3MI4A 1P2NA 4ZMAH 4H6TA 3SGBE 4Y79A 1ARBA 2FOMB 1ESBA 1SFIA 1MKXH 2ZQ1A 1B0EA 1C5MD 2BY6X 5K0HA 2KCYA 1RTFB 1XVMA 3ATLA 1FIWA 1C5TA 4O3UA 1MCTA 1SGCA 2F9PA 3K9XB 4YESB 1SQRA 1ETRH 2F83A 1JBUH 1H4WA 1QJ6B 2BM2A 4CRDA 4SGAE 4ZKRU 1GBIA 1NRNH 1P04A 1NESE 4ZKSU 3UWJH 1MABB 1UK2A 1YLNA 4YM9A 1F7ZA 2WHXA 2FI3E 3KIDU 4OGYA 3RXPA 2VIVA 4BTUB 1WQSA 4XSKU 2AERH 2IPQX 1DDJA 4NWLA 1XXFA 3U9AH 5HKKD 2PWXA 1N1LA 3SUEA 2PFEA 4X2YA 2W26A 2WV4A 1S0RA 2CF8H 1PPBH 3A7VA 2ZNKH 1AE5A 1ANBA 3BTFE 2A7HA 2OQ5A 1IQGA 5DSFA 1O3OA 2XBYA 3QK1A 1LHDH 3ELAH 4FU7A 1C5PA 4DCDA 2KM0A 4FU8A 2A0QB 2A5KA 3DA9B 2O8LA 4I86A 1AMHA 3LDXH 1K1IA 2KX4A 2BD2A 1ZMJA 3GDVA 4TT3D 4CHAC 1C1UH 1QRWA 3TK5A 1G36A 1BHXF 4I8JA 2ODYB 5B6LA 1TALA 3Q3KA 2BQWB 1Y3UA 3E0NB 3LIWA 3L3TA 3AVZA 4X6NA 5DP4A 4KP0A 3SQHE 1QHRB 1XKBC 5IK2D 1P9SA 1BQYA 2BX3A 3NRLA 1NRPH 3ZIAD 3FZZA 1A0LA 2GKVE 2ZHQH 1HJAC 2BY8X 1OYQA 1ZTKA 2XBXA 2J34A 2BXTH 2PKAB 1EZQA 2WPJS 5EW1H 1RTLA 2QF5A 3PLPA 5EIYA 2QCYA 1CU1A 1SGNE 1P2OA 4X6MA 2GGVB 4ZHAA 3PTNA 4X2VA 1ELAA 3N99A 4BANB 1BB0B 5EU8A 1QBNA 3ATIA 3UREA 3D49H 2GX4A 1K9OE 5GCHF 3N7EA 4ABGA 5FPYA 1TPAE 3FN8A 4Y6DA 2ODQA 4MVNA 4CR5A 1BOQA 4UONA 1W12U 4KELA 1O2XA 1WV7H 1QIXB 1DWBH 1Y3WA 1CBWC 2H2ZA 9ESTA 4HFPB 4ISHH 3S9BA 4MNYA 3BV9B 3RDZA 1H9LB 3PV2A 4AB8A 1OP0A 1A4WH 3RM0H 2C8YB 1F0TA 4GHTA 1AVXA 1PQ7A 1G3DA 4B6FA 2B7DH 2JJ1D 3SU6A 1Y5BT 5HGGA 2UUYA 5DP7A 3MMGA 3SN8A 1MD7A 1QURH 4HTCH 2AGIX 2PLXA 3P70B 1UCYH 3PTBA 1L1JA 1U6QA 4Y7AA 1GCTC 1YKTA 4NA7A 5E0HA 1BCUH 3VFEA 2FODA 3M7UA 3A8AA 5F8TA 2KAIA 3D23A 3BIVH 2GZ9A 1GI8B 2OUAA 3H7OA 5JYIA 3SU0A 2VVCA 4K1EA 3SU2A 1O38A 2ZHEH 4FU9A 4UFDH 1V2VT 5FL7D 3VB3A 3KQDA 1W2KH 1RD3B 7GCHG 2ZU1A 3PWCA 4RI0A 1TNJA 1VGCB 6ESTA 2BY9X 1AN1E 2VH6A 4MNWA 5C1XA 3C27B 4VGCB 3H09A 1THSH 2OP9A 2VIWA 4UEHH 4XD7D 1AUJA 3MTYA 1V2LT 1YPMH 3RLYH 1Z8IB 4IMZA 1BRCE 1MUEB 4NZQA 4A1TA 5EOKA 1GI3A 3KF2A 2EI6A 1K1MA 3M5OA 1C2JA 1CT4E 2HNTC 2W6JD 2OLGA 6LPRA 1BMNH 2J38A 2TGTA 4J1YA 2ZCKP 1SKYE 2Y80A 2A7CA 2R9PA 1F5LA 3EA9A 3MQKC 4AOQA 4WMFA 5AFZH 3E0PB 2VWMA 1LMWB 4ISOA 4AC9A 4X6OA 3D62A 1O2JA 4B6EA 4JYUH 1O5AB 1MH0A 3JZ2B 5T6DA 2FZZA 3P6ZB 3RXDA 1AO5A 1KLJH 3OAAD 2BVXH 1UVPA 1IQIA 1GBEA 4SGBE 2JIZD 1MBQA
chains in the Genus database with same CATH topology
1UTNA 2XWAA 3AAVA 1LTOA 2H6MA 4UFEH 3H7TA 2AMDA 2Y5HA 5JB9S 3D65E 2ZTXA 2CMYA 2PTCE 3RXMA 1EB2A 4D76A 1MQ6A 2FOHA 2UUKB 3LONA 3SZNA 1BJVA 1YCPK 4ZHLU 1O3GA 2GCTB 4X8VH 2AS9A 1WQVH 1DWDH 4YOGA 3A81A 1C1RA 1GJ5H 1C1VH 1QB1A 1QCPA 1TMUH 3A7XA 3RP2A 1ELTA 1GJBB 4LZ4B 1O0DH 2O8WA 1YPKH 1TA2A 2AH4X 4NFEA 4O3TA 1UHBA 3VPKA 5EQSA 3URCA 1GMHF 2O9QA 2H9HA 2PGBB 5EXLA 3AW1A 1OWKA 3RUOA 2SNWA 5F8XA 5BRRE 1EQ9A 1P2QA 1FY5A 1OPHB 3PO1C 1Y3XA 4YOJA 1UTPA 1JRTA 2SGEE 1MU6B 3BTQE 1W8BH 3SJ8A 4CRGA 1IQNA 1G3CA 3OU0A 1EPTA 1WAYB 4UD9H 5L2YH 1D3TB 1PJPA 1S5SA 4TWWA 3UWIA 1ESTA 3IITA 4AGKA 1C5NH 1ANDA 4XDEA 1GJDB 2EI7A 3SU5A 6CHAB 3QZRA 3A8DA 1MD8A 5GIBA 1O2TA 1XM1A 5F6MA 1TOMH 1GBHA 1KXBA 3M61U 3ZZ3A 2ZFFH 1TNHA 1MTWA 2WPIS 5FCKA 5FBEA 2WYJA 3SO3A 2VIOA 3F68H 4IC5A 1DXWA 1V2MT 1HFDA 4TY6A 1P10A 2ZKSA 2ZHDA 3PB1E 3VB5A 4KTUA 1YPLH 3HGPA 2R0LA 3GOVB 4GUXA 3ZYEA 3G01A 4DY7B 3TU7H 1HB0B 1ZR0A 4BXSA 4AYVB 5FX6A 2Y5FA 4CR9A 1NRRH 1N6XA 4U2WA 2WPLS 3UNQA 1AZZA 1HGTH 1UJ1A 1O3MA 2O8TA 2W3IA 5FX5A 7GCHF 2AMQA 3MNSA 2V3OH 1XUKA 1SHYA 1AKSB 4K69A 1O2PA 3RXRA 2DE9A 8ESTE 1AGJA 3RXBA 1EXFA 2EEKA 1MKXK 2QXHA 2ALVA 1O3DA 1E35B 2ANKH 2WINI 4WH6A 1YCPM 1CSOE 1DWCH 2RG3A 1DSTA 1O3PB 1YBWA 4J2YB 1OYTH 2SGAA 7LPRA 1A0JA 2BDCA 2H5CA 3SU4A 1YYY1 1KDQA 2ZGHA 3TIUA 4XBCA 3MU0A 1BBRE 1BIOA 1LVMA 3NZIA 4I33A 3P95A 2SFAA 2BQ6B 1AB9C 5HM9A 2ANMH 3LGVA 1C5ZB 2ZCHP 2ZPQA 3LGUA 3BG4B 5FBIA 1YM0A 1YPJH 1KXDA 1MCVA 2FO9A 3RXIA 1BTHH 2ZG0H 1THPB 1HAVA 1T8OA 5C1YA 1HIAB 1ZTJA 2AIPA 2SNVA 1RFNA 2BD4A 2ZFQH 2GDEH 1UTJA 4INLA 1VZQH 4NG9H 4DG4A 1TNKA 4CREA 3NUMA 2Q6GA 3SQEE 3TH2H 3UQVA 4ISNA 1GL0E 1HAOH 1D3QB 1RTKA 4AFUA 1NRQH 5JDUB 1NPMA 1FJSA 3OY6U 1LKAA 1RIWC 2UWLA 2XTTB 1JIRA 1C4V2 2JH6D 3BN9A 4BOHA 1ZRKA 2Z94A 1O33A 2BZ6H 2CHAC 4RSPA 3ZZ8A 3T5FH 2BDIA 4ZKOU 1FN8A 4ZAEA 1GHVH 3PMBB 2ZP0H 1TX8A 1GBJA 2UUJB 3RXFA 1FAXA 1MAYA 4Y0YE 3NPSA 3RXAA 1D6RA 1ZRBA 4Z6AH 1IAUA 3S69A 1ACBE 3Q76A 2BLVA 1QJ7B 1QNJA 4FUDA 5C3NA 4U32A 3BTME 4ZUHA 3ZZ6A 2WUBA 1ELFA 2BX4A 4WWYA 4HI3A 1HXFH 1A5IA 1TPOA 3MH4A 3LJJA 1OXGA 1GJCB 2VVVA 3NKKA 3MO9A 1AWFH 1FONA 3LKWA 2PSXA 1L1GA 3NCLA 4INKA 1HAXB 2R2WU 1D3DB 4Y8XA 1LDTT 1NO9H 3EQ0H 3LGWA 2TGAA 4Q7YA 1EJNA 2H9TH 2RA3A 4FUFA 2ZDVH 4XFQA 2ZDAH 2QGRA 2A2QH 1K2I1 1ZJDA 3ZZAA 3T27A 2ZF0H 3QZQA 1EP6A 3B23B 1QL8A 2ZHFH 2ANYA 2AMPA 2SGQE 1A3EH 1HBTH 4DOQA 4FVDA 1ELDE 1S0QA 1DVAH 4Y11E 1O34A 2BD8A 1TONA 4ZXYH 4BTTB 3SU3A 1DE7H 1SG8B 5ETXA 2FTLE 1K1OA 2NU3E 2VGCC 5EQRA 4ABHA 2FDAA 2ASUB 3RXSA 4XOJA 1ZHMA 1A2CH 1F5KU 1NU7B 1YP9A 3A7YA 1E37B 3S9AA 3SNAA 1EJMA 1OKXA 1O3FA 1HLTH 1JMOH 1UTMA 2GZ7A 2QC2A 2V6NA 2BD7A 3EDXB 2VNTA 1H9IE 3L33A 1BZXE 4K1TA 1KXEA 1XUGA 1GG6B 3ZZ9A 5AF9H 2VU8E 4WMDA 1ZSJA 3U8RH 4YO9A 2OBQA 2Z9JA 2BYAX 2YNBA 1SL3A 2Z3CA 3T28A 4TPYA 1ANEA 1GJ7B 3KL6A 1W7XH 2A5IA 1T8MA 1TMBH 1P2JA 1L4ZA 1YC0A 3ATWA 1C9PA 5A0AE 3R3GB 1IOEA 3SV6A 1VCPA 3RXJA 3F9EA 1LVOA 3UY9A 4AFZA 2XC4A 2Y81A 2R0KA 4BXWA 1SGEE 2BLWA 4X6PA 1VITG 2UWPA 1AWHB 2QY0B 1V2NT 4GLYA 2FMJA 2TGPZ 2FI4E 1LO6A 2RDLA 1EOJA 1P2MA 1C2HA 3VGCC 3MO3A 2G55A 1WCZA 4XE4A 4AGJA 1MKWH 1P2IA 1F2SE 3P8NA 1IQHA 5JPMH 2KAIB 5JBTA 1UVSH 2PV9B 1P0SH 5GPIB 3MNCA 1O2MA 3SW2B 3ZYDA 2G8TA 3S0NA 2VVUA 1W7GH 2BXUH 1SGTA 2ZPRA 1CVWH 1S6FA 1ZOMA 1BBRH 1XUFA 5AFYH 1J15A 1P11E 1TGCA 2CJIA 5CHAC 2ILNA 1RRKA 4I32A 4E06H 2BY5X 2Y7XA 1C9TA 3E90B 3RXLA 4GPGA 1VJAU 2SGDE 1YGCH 1CHOG 1Z1IA 4JMYA 1F0UA 1L2EA 1AE8H 1O2LA 1BMLA 5FXLA 6GCHG 1O2OA 3LOXA 1JWTA 4INHA 2J95A 3SNCA 2BD5A 4THNH 1W10U 1MU8B 4TYDA 3FZDA 4DJZB 3MHWU 1TBRH 4WXVA 5LGOA 1BRUP 2ZHWH 1LPZB 3FP8E 1VITH 4I31A 3E91A 1O2YA 3O8BA 2M5TA 2GT8A 3ATKA 3GCOA 1FY3A 3BEFB 3RC5A 1ZPZA 2FOBA 5T6FA 3PLKA 1QRXA 4Y10E 1PQAA 1J16A 2BD9A 5JB8S 5C1UA 3ATMA 1DANH 3PMJA 1LCYA 1ZLRA 2W3KA 1QJ1B 1Z6JH 4CHAB 1G37A 2J9NA 2G00A 2NWNA 1EKBB 1QQ4A 1TMTH 3KCGH 1GDUA 4FUHA 4JZFH 1SOTA 2ZO3H 3L6PA 1O2GH 1C1SA 1PPFE 2I6SA 3A84A 1ANCA 3F6UH 1HJAB 1J14A 5DPAA 4CBNA 1F0RA 1FAKH 3SNDA 5EQQA 4Y0ZE 1GI5A 3SJKA 1NTPA 1PYTD 1UVOA 1KLTA 2FI5E 2BVRH 4D7FA 1VCWA 4ZH8A 2VIPA 3GCNA 1CQQA 5TCAA 4ABIA 2Z9GA 2XYAA 3UUZA 5JBCS 4JK5A 2HNTE 3TNTA 5PTPA 4LZ1H 2R2MB 4A92A 1P12E 2Q1JA 2FLBH 3MNXA 3STIA 1CBWB 2OINA 1A1RA 1N6YA 3PM3A 4GCHF 3HKIB 4JK6A 3S7HB 1H9HE 3PYHA 3TGKE 2XWBI 1DT2A 1HAIH 3MH6A 1DOJA 1EPTC 2BY7X 1F5RA 2A4RA 3SV7A 1JOUB 1BDAA 1VITF 1DY9A 1TNGA 1IQFA 1FUJA 2W7SA 3CP7A 2F9BH 4YZUA 1SBWA 2V35A 2O8MA 3RXEA 3DD2H 2C90B 5HMAA 2BDGA 2HLCA 2VINA 3KQBA 5TJXA 1UK3A 1MTVA 4AX9H 1KLIH 1GCTB 5JBBS 4D8NA 1FY8E 1HCGA 4ABDA 1BT7A 3GCHC 1HAZB 3VXFH 4MG3A 2GDDA 1PFXC 2BOKA 3M3VA 3SGQE 3EAJA 3SNBA 3ZZDA 4KTSA 1G2MA 1ETSH 4MNVA 1C1OA 2ZTYA 2Y5GA 3MU4A 4IC6A 2FYRA 2QIQA 5EPYA 3U1IB 4IGDA 3A80A 3TJNA 1EZUC 1N8OB 2ZGXH 3RLWH 1ZYOA 8KME2 1BMAA 3ZVEA 1CHOF 5I46H 6GCHF 4AN7A 3KQEA 3VXEH 3CENA 1UVTH 1N8OC 3M7QA 1O2IA 2CXVA 3SV8A 1GJ9B 1TBQH 4GAWA 1ZZZA 2C8XB 1BTXA 1FZZA 5DG6A 3CS0A 4CRFA 3NK8A 1RXPA 3ZZ4A 3Q3YA 5L30H 3RC6A 2BTCE 2WV5A 1O3AA 1TA6A 3SOSA 1O5BB 5SGAE 2ZDKA 1GHBG 1ABIH 2BHGA 1TIOA 2Q6FA 4ABBA 3S7KB 2ZC9H 1TX7A 1P8VC 3FVFB 1HAGE 4YOIA 3GY7A 1C5YB 1XMNB 3A87A 4CRBA 1P02A 3GY6A 2P8OC 5DP6A 3OSYA 1LHCH 4B2BA 1XX9A 3U69H 2CV3A 2GVFA 3TNSA 4FUGA 4FVBA 1GBKA 4YT6H 1IQMA 1ZHPA 2GD4B 1MTNC 2GCHG 4YT7H 3SUGA 5E0JA 4BAOB 2XXLA 1FDPA 4FUJA 1H8IH 2IJOB 3UNSA 4IBLH 3RXCA 1EAUA 1OP8A 2UWOA 1BJUA 4F49A 3DUXH 2OBOA 4DT7B 1GBDA 1S84A 2W5EA 3RXQA 4D7GA 4NGAH 2BZAA 1AU8A 4K5ZA 3M5MA 2FYQA 4AYYB 4TWYA 3PO1B 1YLDA 3BIUH 3MO6A 3KNXA 2P3FH 3MWIU 2FS8A 1V6DA 3M3TA 4DURA 1V2OT 1C5OH 3ENSB 2HWLB 1T8LA 5DO4H 1DLEA 2JETC 1QFKH 1Z8GA 2V0BA 1VR1H 1KTTB 3LGYA 4WJG2 1HAHH 1FY4A 3T25A 1CGIE 2WUCA 1AFQB 2FM2A 5DGJA 1KYNA 2AFQB 1C2LA 2OCVB 8GCHG 4WH8A 2EC9H 2NU2E 3I29A 1MQ5A 1G32B 2ZWLH 1G2LA 2LPRA 1SGYE 1V2KT 2CN0H 1E34B 1JIMA 4MNXA 1AFQC 1K22H 4B76A 2XCFA 2XCNA 1QGFA 2BDBA 5DJ7A 1QA7A 2PKAA 1O5EH 3Q00A 4Q80A 2JH0D 1VCQA 1D3PB 1ELGA 1CT0E 1QBOA 1TWXB 2HPPH 5J4QA 1KXCA 4FUEA 4LXBH 4NSYA 2FWWA 2FS9A 1SGQE 2YNAA 1C1MA 5FCRA 3RXTA 1C1NA 3QX5H 2B9LA 2XRCA 1MKWK 4X2XA 3SI3H 3LJOA 1FLEE 2Y82A 3BEIB 1SB1H 3HKJB 4Y71A 1TNIA 2VJ1A 2D8WA 4AG1A 1K1JA 1EASA 2TBSA 5FHTA 1WTHD 1V2JT 2ULLA 1DXPA 4A5TS 3ODDA 5DKMA 5A8XA 2ZFRH 3GCTG 1NFYA 1S85A 4ISLA 3AW0A 1O3LA 5LPEA 2ZECA 3GISB 1ZTLA 4MPXA 1KY9A 1SOZA 1B5GH 1T31A 1C2MA 3GDSA 2CF9H 4OS1A 8LPRA 2XBVA 3TGJE 1WYKA 2WPMS 2Y6TA 1GHXH 3TH4H 4AZ2B 4CRAA 1AB9B 3QO6A 4MTBA 1S81A 1O37A 1P3EA 3GICB 1PPEE 5A0BA 1GMCG 4GSOA 1V2TT 2QYIA 1GHBF 3MU5A 1PYTC 4O9VA 1ARCA 5C67A 1Y5UT 4I7YH 4JZIA 5F8ZA 3ZVGA 5GJ4B 1LVBA 2A31A 3PMHB 4FUCA 4X8TH 1TPSA 1DM4B 1H8DH 3P8GA 7KMEH 3B9FH 1DY8A 3F9GA 1L1NA 3HPTB 5EXNA 2GT7A 2FOEA 1GGDC 5FPSA 5ESBA 4I8GA 4CRCA 1UTKA 3E3TA 2FEQH 3U8OH 3ESTA 3ZZBA 5CMXH 1RIWB 2ZDLA 1C5RA 2ZQ2A 3T2NA 5J4SA 1AZ8A 2GCHF 2CHAB 3T62A 2FP7B 2Z7FE 5G4BA 2OQUA 2F9VA 4MPVA 1XXDA 2J92A 1WBGB 1SPJA 1GI6A 5L2ZH 3UNRA 2A4OA 2QF3A 4BAKB 2HPQH 2SGPE 2HNTF 2PHBA 1MBMA 1O31A 1O2SA 3NWUA 1DICA 2D2DA 1TOCB 2VWNA 1GL1A 3SHCH 5DK1A 4KTCA 1GJAB 1Z8JB 2F91A 3SBKA 2BLOA 2XNIA 3QWCH 5DP5A 3ZZ5A 1W0ZU 1S6HA 2TIOA 1SLUB 3MOCA 4RKOB 1EOLA 5DP3A 3O8RA 3GDUA 2AGEX 4O97A 3E16B 1MAXA 1K1LA 1WOFA 2XBWA 3B8JA 3BG8A 2K1QA 1SGFG 1QRZA 4ISIH 3AAUA 1V2WT 1C2GA 8GCHF 1L0ZA 3ZVCA 1T7CA 1TYNA 1O2HA 1UTLM 2C8ZB 3GY2A 4OS4A 1G3EA 1SLXB 2GV6A 5GDSH 1GVLA 3MNBA 3A88A 2OD3B 3LC3A 3SHAH 1XKAC 3RU4T 2ZFTA 1OSSA 5IYTA 1O2ZA 3EA8A 1J8AA 4E7RG 2QV1A 9LPRA 2FIRH 1GDNA 1TGSZ 5A0CA 3ZZCA 3ZV9A 1BTWA 2GMTC 3W95A 4UE7H 1TRNA 3TJOA 1F92A 3WY8A 2VIQA 1W11U 4JYVH 1TAWA 4B1TA 2AIQA 2PUXB 3F1SB 4ASHA 3T29A 5E2OA 1O3KA 2VGCB 3R0FA 1Z8RA 3EA7A 3KGPA 1GI2A 1ABJH 2Z3DA 1E36B 3BEUA 1UCYK 4HGCA 4MLFB 5C20A 2FOCA 3V0XA 1D9IA 4AFSA 1SGRE 1O2QA 1T4VH 1SLVB 1B7XB 4Y8ZA 1FY1A 2QXGA 2CGAA 1YCPH 1XUJA 3M5NA 2ZGBH 2H1UA 1AUTC 1EX3A 2G81E 1JRSA 1EB1H 2F9NA 2ANWA 2G51A 1GMCF 3LH3A 4ABJA 4Y76A 4K3JA 2ALPA 3A8BA 2WPHS 3VB4A 2IPHA