3MHXA

Crystal structure of stenotrophomonas maltophilia feoa complexed with zinc: a unique procaryotic sh3 domain protein possibly acting as a bacterial ferrous iron transport activating factor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVGFTRFALRISEAKRVVVDAASQERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport activating factor
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Metal transport
molecule keywords Putative ferrous iron transport protein A
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mhxA00
2K5LA 1G3SA 2QQAA 1BI3A 2K5FA 3HRSA 2QQBA 1BI0A 2K4YA 1BI1A 1FX7A 1FWZA 1BI2A 1G3TA 1G3WA 3E19A 2QQ9A 1P92A 3MHXA 2GCXA 3HRTA 1G3YA 2LX9A 1U8RA 1QW1A 2H3JA 4O6JA 3HRUA 3GLXA 1BYMA 4O5VA 2K5IA 5CVIA 1QVPA
chains in the Genus database with same CATH superfamily
1BCMA 3OYBA 1YJ9T 1O9SA 3VS2A 1BIAA 4J9IA 4PFZA 4LUEA 1GBQA 2AK5A 2LC4A 2LJ0A 2KR3A 2FPDA 3EG9B 2HAXA 1X6OA 1IGQA 4GY5A 5EC7A 2DEQA 2EW3A 2AKKA 2DL8A 2RHUA 1I4K1 1UGSB 2K3BA 3HP9A 4XTWA 4MZMA 4IUPA 1VQNT 3CCSQ 4J7FA 3V7RA 1RAEB 2E1HA 3QZ5B 5IHIA 2D9TA 2Y4XA 1E7OA 1AZEA 3JB9D 1FMKA 1YHQT 2FZGB 3OMCA 4OMFB 2OTJA 1Q7YR 2VV5A 1VQOQ 3QDRB 4M77A 1VQ4A 4JDSA 3EH2A 4MMKA 2F69A 3U23A 5GMKi 3E9GA 2XMFA 2A3LA 2P84A 1M90U 1YITA 5FROA 1YJ9Q 4QQ6A 3CC7Q 2ZPIB 3CEYA 1NJIU 3NFCA 4M77E 1YJNA 3MO8A 4E7LA 4C5IA 3A5ZB 1UGPB 1AZGB 4PLLA 1M30A 2L8DA 4OB0B 2DL3A 3QYHB 1VQLT 3V8KA 1Q86R 3QJYA 2JMAA 2RJDA 2F5KA 1NM7A 1WYXA 1R77A 4M7AG 4JS5A 3SEMA 1WHLA 2KT8A 2HNIA 3QXEB 4M78B 3H6ZA 2H8HA 3MJXA 4M7DB 4LDVA 3JV3A 2KBTA 2D8HA 1U8RA 1VQ6Q 1KHIA 2HEQA 1D3BB 1NPPA 5L23A 1KD1U 1YN8A 5LJ5h 3G6EQ 4JLGA 4Y92A 5GAMe 3I5SA 3GOXA 3A8OB 1M27C 1M1KC 1IHWA 4A4KA 4XTUA 3BY7A 3UT1A 2EJFA 4DQ2A 2FL7A 3EG2A 1WDXA 1V29B 1KQSP 4PJOA 4E7ZA 1VQKA 4IUTA 3EHRA 2L2PA 4XU3A 2KNBB 1X69A 4J83A 2NUPB 1VIEA 2H3EB 3M0PA 1OU9A 1ZBJA 5HK3A 3CCJQ 1T0HA 3RKYA 2L3RA 3MEAA 4OP0A 4QKUA 1WI7A 1YCSB 3MP8A 1RAAB 2KE9A 3QPHA 1X6GA 1OEBA 4DOVA 1VQ9Q 4M78D 1BCOA 1Y71A 5DLOA 4LD6A 4L6V5 4FT4A 4JJNK 4C92G 3WVDB 4F04B 5CQYA 2HQEA 3C95A 4N0AA 1GFDA 2QQRA 5HCKA 1VQ6T 1R0CB 1TG0A 2X4YA 4M7DE 1CKBA 3ER0A 3HRUA 1RI0A 3OS1A 5GAN6 1YJWQ 3G71T 3MEWA 4C8QC 2MCNA 4OVAA 3HRSA 4FYVB 2FEIA 2M02A 1SG5A 3G6EA 3M9QA 3M58A 1K4US 2M16A 4EMKB 3FIFA 3M57A 1QWFA 4C5EA 1YWOA 3BFMA 3CCRT 3JRZA 5AT1B 2RHZA 5FU7B 2EGCA 1BBZA 1GBRA 2CGHA 2VWFA 4F17A 3L2UA 4MDXA 3VKIA 5EG2A 1UGQB 3G1JA 2CP6A 5GAOq 4QT7A 5CK9A 1D0ZA 2KY9A 4Z89A 2F5TX 3JCMb 2JTFA 3NPFA 1VQ8A 1M2VA 5CAIA 4RTWA 2CP7A 1WXBA 4BE2A 2CDTA 1M5Q1 4A4EA 2LX7A 3ASKA 4QVZA 2KRNA 1N9SA 1OU8A 2EQUA 2MYSA 4XTZA 4OMLA 1B07A 1OZ2A 1UGVA 3RDVA 3CCEA 1D1BA 4E7KA 1SF9A 3VYGA 3QYGB 2R58A 4ZTFA 1UDLA 3QUIA 3PT9A 3JCMP 9ATCB 4M78F 2CREA 3OYHA 2BZ8A 5GAOr 4JRKA 4AFZC 5GAMd 2D0QB 4C8QF 3NHNA 2LCCA 2E70A 3GNGA 1PRLC 4AG2C 3JCMX 2ZPHB 2VXFA 1VQ5Q 1IXDA 2B8AA 3RIRA 2ABLA 4BY6C 1Q81C 3GP8A 1NEBA 5IHKA 1ZA1B 1YFNA 1GCQA 2QEXA 1QKXA 1PKTA 4BB7A 3S3OA 1RI9A 4FYXB 1BI1A 2KROA 3CPWA 1Q81R 1Q81U 1S72A 3X28B 4WTOB 4ZGJB 3H8ZA 1M2OA 4D8KA 3BE3A 4E7JA 4HVUA 4RTTA 4C8QA 4MMLA 3VS4A 3JCMW 3CCLT 1SHGA 2EKOA 2NUTB 4A4GA 2ZPEB 3CMEA 2ROLA 1OZ3A 5HKCA 4ELYC 4C0DC 3CD6A 4BUGA 2HQXA 2EQJA 1WJQA 2O9VA 1MMNA 1TU0B 1W2BP 3GLXA 5KYWA 1CSKA 2Z0WA 1N8RC 3JSCA 3OSVA 1TS9A 2QA4T 3P8HA 3H9NA 4P5NA 2CT3A 3QWYA 3I56Q 4PLIA 3OSSC 2FRYA 1RADB 1WHMA 2LT1A 2K79A 4JPBW 1YP5A 4AFQC 4N4IA 4O6JA 1LCKA 1W70A 2O4XA 2KRMA 2PTKA 3R6NA 2KI7A 1VYUA 4A4HA 3PVQA 5KYXB 3RMSA 2JM9A 1WX6A 4BACA 4M4ZA 2E6ZA 1VQOA 2IPOB 3M5AA 3OS5A 2DERA 4NS5A 1VQ7A 2A7YA 1Q86U 2KQWA 2BTTA 2EWNA 2HDAA 4O5VA 1UJYA 3ME9A 1D0XA 1NLOC 2RH2A 5GANg 3MCAB 1NZ9A 1C6VX 1OPLA 2EJGA 5GMKl 3EGXA 4HCZA 1HYOA 1D0YA 3OYLA 4EMGA 1IO6A 5GAOn 3RESA 2QA4A 5I11A 4M7DA 2JOYA 7AT1B 2X9HA 1S1NA 3CCVA 3LLRA 4LE9A 1Q7YC 2KYMA 2K57A 3E9FA 3H0FA 3CXCP 5DLQE 3EFOB 4XU2A 3CCQQ 2D0NA 2DRMA 2C0IA 4BDYA 4J9EA 5L8RE 5GANj 2CZ7B 1K73C 1GRIA 2DVEA 2J6OA 4FU6A 5KE2A 2SRCA 4J7IA 2RO0A 4E7SA 2JMCA 2ZPBB 1D3BA 2NYSA 4F7UB 3LWIA 1SSHA 4OMMA 5FWBA 2EYQA 2JTMA 1QVFP 2DEUA 4M7DC 4RUGA 1T3LA 1ZX6A 3GBQA 4M78C 2XG8D 5FRNA 3CPFA 2O01E 2CP5A 3FDRA 2OJ2A 3EG3A 3H41A 3MEVA 1JXMA 4M7AD 4RTYA 4M78G 1CKAA 5CKBA 1M3CA 4C0ZA 3RUXA 2COWA 4LNPA 5GAMf 3PVLA 4FW2A 4J9GA 1T3SA 1OULA 2RQWA 4OMNA 1K0XA 1G2BA 4JUVA 3F70A 1Y57A 5GAMh 2ENMA 1ZSGA 2NUTA 4FT2A 1MMDA 3CCVQ 1QQJA 3H0HA 4C8QE 2FVUA 2RHYA 4LUDA 2CP3A 4YTLA 2RJCA 1I5LA 2K6DA 3L2RA 4EDUA 4MZPA 2MPXC 1M4ZA 1W4SA 2DXUA 3SFMA 2A37A 1SHFA 3VS1A 1DJ7B 1ZBXA 2V1QA 1PHTA 3CCSA 4C8QG 1J3TA 2F2WA 3A8LB 1K76A 2GFUA 4JJBA 5J39A 4M7DG 2QK0A 3MHXA 4C0DB 3QDFA 2CYZB 1RUWA 2BE7D 4F7UE 1ZSZA 1ZLMA 4J9FA 3CCEQ 2DIGA 3FEOA 1EX4A 4XQ3A 2LNVA 3L42A 2DBMA 1KSWA 3VJPA 5A0LA 1U1SA 2A08A 4PJMA 1JJ2A 3TVTA 2GBQA 3OB9A 5FU6B 1VQ7Q 5CKEA 2GFAA 5GMKe 3M4GA 4BE1A 1K9AA 4RTXA 1N8RU 1N8RR 1H641 3V8JA 4JRPA 2P4TA 3UWNA 3G6ET 1I0CA 4KGXB 2DPPB 4OGCA 3GNFB 1M8MA 2LDMA 4PJOE 3M0RA 2RHIA 4IURA 3OYDA 2DD5A 3CPWP 4BY6B 1X6BA 2LT4A 4E2FB 2FZCB 3FRNA 4F14A 3GF5A 3H0IA 1PG5B 3VV0A 3O5ZA 4XU1A 1AEYA 3EH1A 1WQ7A 1JXOA 2L3QA 1WGSA 3GPLA 3HSBA 1MNEA 4J9CA 1WXTA 2BIVA 5GAN5 2A28A 4GLMA 2JUFA 3G7ZA 2K5IA 1VQPQ 2PU9B 1KQSS 4KUDK 3LWHA 3CMEQ 5IXBA 1TTHB 1Q82U 1N27A 4C92B 1KC8C 1UEBA 3CCUQ 1PM3A 2DF6A 2K9GA 3QO3A 1EFNA 3OS0A 4E47A 3Q1JA 1Y96B 3JAME 2DTIA 5FWCA 3S3MA 3P8BB 1GCPA 1VQKT 3DB3A 2KRSA 1TSFA 4CRIA 1ZUKA 1VQNQ 3VRYA 3ULRB 1LVKA 3JCMf 1H3HA 1NEGA 1M1KU 1K73R 5GAMj 2K3YA 5IAYA 1JRIA 2RQRA 1YJWT 4X34A 2DXTA 2JJ9A 4KT0E 1G3YA 2YHTA 5KCHA 1UG1A 1C0MA 4M7AC 4JS4A 1TWBA 1KQ2A 1H3ZA 3JCMe 3TCJA 5FU7C 1RLPC 4MDWA 4PJOB 1BB9A 2OTLT 1K8AR 4LDXA 1YIJQ 1IRXA 3QWXX 1IZ6A 3M53A 3SDZA 2RPNA 3CC4A 1KJWA 2AT1B 4ZGDB 1VQ9A 1UTIA 4ELZC 1QVGP 3G4SQ 4JRIA 4C8QB 4RCBA 3QJ6A 2JM8A 5D6YA 4D8DA 4N4GA 2HD0A 5A0GA 3CCMQ 3P8DA 5CO7A 5GAOp 4DEYA 3CD6T 1N5ZA 1VQLA 3M55A 4OMPA 5LJ5g 5LJ5f 2KGTA 2JVVA 1X2KA 2LVMA 2G6FX 3OBWA 4M78A 2HBPA 4PK4A 3KXTA 4N0AC 2YUOA 1KFZA 4F7UA 1TOVA 3HHTB 3KFVA 4BI8B 3EFSA 2WSFE 5LJ3d 1TUDA 3VS6A 2PVDB 2EQKA 3LW5E 3CCST 2MK5A 5ECAA 4L59A 2V8KA 4ATOA 2LJ3A 4M75D 2OTJT 2HSPA 1I5OB 3CMAT 3OS2A 2JNGA 2LQNA 2QEXT 1D1AA 2QG9B 2DTOA 2JXBA 2EIFA 5GAN7 5KYXA 3EFOA 1OYXA 4PJOC 3NMZC 3VS0A 2HBWA 3LGLA 4CC4B 1Q82C 2Y4YA 2YUNA 4M77B 1W1FA 2DM1A 4M7AB 4HVVA 1B7TA 2K7AA 3BDLA 2DYIA 2E5QA 5FRMA 2YRDA 2GTJA 1YJ9A 1KD1R 1I1JA 4QVDA 3QBYA 2EKHA 2GF7A 1RLQC 6AT1B 4IUUA 2QDYB 3VS3A 1HSQA 2FPFA 3AT1B 2K3XA 2JTEA 3G71Q 1LOJA 1GXIE 1G3WA 2CT4A 2YUPA 4BDZA 4DOWA 4J6XA 2MAMA 3CMAA 2KXDA 3DLLA 4CC3A 3C4SA 1PRMC 4C92E 3OYYA 2WACA 1BYMA 2CSIA 4PJJA 5IXFA 3EAEA 3UDCA 3JCMJ 1ABOA 2DD4A 2PUKB 5LJ3f 1BI0A 2PVOB 3INZA 3MP6A 1K73U 2A36A 2QGGA 3MEUA 4IIMA 1AOJA 1MUZA 1AWOA 2RN8A 1U06A 2KVQG 1Y96A 2HKNA 4IUVA 3BDUA 4M77D 3UATA 3CCUT 2L5QA 1T0JA 2KDSA 2XDBA 3OYIA 1PWTA 1MNDA 2EFIA 1M1FA 4F7UG 5KYUB 1VQ9T 4PJNA 4KULA 2BKDN 1IREB 3LYIA 3CC4T 4K11A 2H3JA 2OTLA 5FU6C 5GAN4 3L2VA 1TUCA 2D1XA 2VB6A 2X4WA 2CP2A 4PJOF 2GNCA 1R0BG 1Z9ZA 3O8VA 4JLIA 2L0AA 1SRLA 1M1GA 1UGRB 2HSEB 2JS0A 3SWNA 4DA4A 4FYYB 3VUZA 1P92A 5IHNA 1KG1A 1YCYA 1YJWA 3MP1A 1VQOT 2RF0A 4IKFA 3AHUA 2XIDA 2C06A 5A2QE 4Q5WA 2HL3A 3EGXB 4L5GA 1YJNQ 1PD0A 2PVGB 3L1AA 3LH5A 1WNLA 2K5FA 4II1A 4R56A 1NPRA 2SEMA 4M7DF 1AHJB 3QZ9B 3VUBA 3E19A 1QCNA 2QGFB 3RBBB 2OX7A 5GAOm 4FCYA 1N9RA 1X01A 2LX9A 5GANf 1NBEB 4BI4A 4RTZA 1KC8U 3RR6A 3PMTA 2ED1A 4PJLA 2C0TA 5A0DA 4LXCA 1NE8A 4X1VA 1I81A 4KUIA 1WPYA 2EGAA 1GCQC 4RKUE 1AWXA 5CCAA 4EMKA 1FX7A 2DO3A 4FSXA 1BKBA 3NTHA 3TSWA 1I8FA 2XHCA 3THKA 2KSSA 3JCMQ 4J9HA 2HKQB 5KYYB 1M3BA 3PTAA 2EQIA 3EHQA 3VS7A 2X3XD 3FB9A 4C5HA 1WJSA 4LDUA 4AG1C 5HY6A 1ZSZB 2XKOC 2DJZA 1M90R 4OB3B 2QQ9A 1UHFA 2X51A 4DEXA 1UB4A 1KQSA 2FPEA 4RCCA 3OYKA 2QQBA 1IGUA 3CMAQ 1PSEA 3QSUA 2NLUA 5LJ5j 4PNOA 1V76A 1VQKQ 1WHKA 4M7DD 2LP5A 4C5GA 2DL7A 2RJFA 4C0FA 1OPKA 1VYTA 2HZYA 2NUPA 3M0UA 2ROTA 4M7AA 4C92A 2VKNA 2QTVA 1SSFA 2DIQA 4ZN3A 2ZCFB 4QQDA 3OW2P 1K9MC 5J3BA 4EMHA 4J6YA 2QQAA 2CS7A 4J5YA 3ZFJA 2V26A 2RB6A 2RQVA 5GAN3 1K8AU 2LQKA 3PIOA 5IH2A 1H92A 2YLBA 2KEAA 3NTIA 2ZGWA 3CC2T 2M9UA 4HXJA 4FIBA 2VC8A 3REBB 2E5KA 2GQIA 1HK9A 4V2SA 2L3PA 4MZTA 4GLKA 2BZXA 4PL6A 1G8XA 1TXQA 1KIKA 4WF2A 4QVCA 3OYEA 2CUBA 1BI2A 1M9SA 4J8OA 4JRQA 2G3RA 4JJCA 3I55T 3JB9F 2QASA 2VGNA 5CIUA 2X35A 4ME7A 1W6XA 1XJWB 4N4HA 3M0TA 4XTVA 1FYNA 3CCQT 3OYJA 4RG2A 4HVWA 1OX9A 3ZBDA 4VUBA 1UE9A 1B3QA 2RD1A 4JJDA 2LZ6B 1AD5A 1M2VB 1AVZC 5I2MA 3KUFA 3CCRA 2J7IA 2RJEA 3UA6A 1KC8R 3PFSA 4R0KA 3PMIA 1X43A 1I07A 2I2LA 2D6FA 5CVIA 2EVRA 2MOXA 3G71A 1RABB 4BD3A 1NG2A 3M59A 4HCBA 2R57A 1F1BB 2DFUA 2LRQA 2MI6A 1AWJA 2PQWA 1PC0A 4J9DA 3CQTA 2A0FB 1RAGB 4OB2B 2DKGA 4CI0C 3TSZA 2RMOA 3A8HB 3J7AF 3OYAA 3CCVT 3HFNA 4E7HA 2EGEA 5M9OA 5GMKh 2CZ1B 2P0KA 1K1ZA 4C92C 3JB9I 4EIKA 1VOMA 4M78E 1AWWA 3TEEA 5KYUA 2L89A 2MF2A 4BI3A 2COZA 2RI2A 3ZEHA 5KYYA 3BW1A 1O75A 1UHCA 2KT1A 1BIBA 5GJVB 3RNJA 5IT9E 1C1AA 5LJ3j 1VQ7T 1JJ2S 2E41A 3C12A 4Y91A 1TH7A 2IVWA 1Q86C 1LJOA 4Z8AA 2E3HA 3PGGA 5J26A 1GL5A 4A4FA 2F2XA 2DETA 3A8MB 3M0SA 1K9MU 1K8AC 4UC4A 1VQ4Q 2HL5C 3M0QA 4KH0B 4CC2A 2RM4A 2RK1A 1KD1C 1WHHA 5GMKm 5DM7R 3FLGA 3EGUA 1MV3A 2EYWA 1SKUB 2YRVA 2KK4A 3HL8A 2GGRA 2YWWA 5D6XA 2DLPA 4KH1B 1SPKA 4HT9A 4E7IA 1WZOA 1ZHIA 2D8JA 1M1KR 1Y7XA 2HCKA 2QDLA 1QVPA 1VQMQ 1QCOA 2OAUA 2DK3A 3SWNC 2XU8A 2CSQA 3CCJA 2K2MA 2AZVA 5LJ3e 3N5BB 1NJIC 1OV3A 5LL6S 1XOVA 5CR2A 1UUEA 2O2OA 5IN1A 2XDDA 3CMET 3OMGA 1QKWA 2BUDA 2PNIA 3CCLA 4OMQA 1G83A 1VQPT 1VQ4T 1UJ0A 2BE9B 4ESRA 1K9MR 1SRMA 1S72T 1RAHB 3NTKA 2O88A 3I5RA 8ATCB 4C92D 2CH4W 3EG1A 3OW2A 5GMKj 1VQNA 4X9DA 2FRWA 3SD4A 3UA7A 2LTOA 2F1LA 2HMAA 2DL4A 1VQ8Q 2DRKA 1ARKA 5I22A 1OI1A 2V8IA 5CQXA 4DBFA 2AZSA 3S3NA 4DBQA 1U5SA 2E12A 4KGZB 5CKDA 3EGDB 3HTRA 5GANe 2DVJA 4LDWA 2CZ6B 3C94A 4XK8E 5LJ3g 3GIBA 2BZYA 2EQMA 1WA7A 2FYKA 3VU3C 2DE0X 2E65A 2DXCA 1D09B 2P0QA 3UPUA 1ABQA 1PD1A 3JB9J 1LPLA 1U3OA 4KRTA 2DJQA 4ZGEB 2NUZA 3A8GB 2LCSA 1YNZA 1ZA2B 2VYTA 3V7SA 2JS2A 1FWZA 1MV0B 2MIOA 4DBHA 3JB9G 2VGMA 3LGFA 3OBYA 3CCET 2CZ0B 2AKLA 2RI3A 3D7SB 2AIRB 3CBMA 3UF4A 1QVGA 1QMCA 1S72Q 5AYFA 2QEXQ 4PJOG 2GTOA 1Y0MA 3RMQA 4DBRA 1VQ8T 3CCMT 2QI2A 1ACMB 1QP2A 2QA4Q 3HKSA 2ATCB 3CC2Q 4WCIA 2DYBA 1PNJA 4AMCA 2RHXA 2O31A 4ORZA 1Q95G 1WXUA 4PFPA 3EGDA 4NL2A 2R5AA 4XU0A 1RAIB 1WHJA 1LNXA 3IQLA 1YIJT 2DTHA 1M90C 5FW9A 3I56T 3CC7T 5GJWB 4M77F 3OYFA 1D1CA 3OW2S 3PE0A 2ED0A 3I9QA 3MKDA 1EZZB 3QHSA 4D6WA 1GFCA 2GQVA 3S6WA 1X2QA 2B86A 3WXMB 3REAB 5GAOl 2YDLA 1JEGA 2X4JA 1BU1A 3I35A 5HK0A 4QQGA 3C0CA 1YI2A 2CP0A 2LJ1A 2X3WD 2M0YA 2EBPA 2K5LA 1WHGA 1VQMT 2ZAEA 1RACB 2ZPGB 1VQ6A 1JBMA 4OGEA 1AT1B 1ZUUA 2DILA 1QCFA 2YSQA 2CKKA 2ESWA 1JU5C 1QVGS 2FHDA 4HCCA 2XK0A 5LJ5d 2K4YA 4J6WA 4LN2A 2E4HA 3FJPA 1WFWA 2KAFA 3E1SA 1PSFA 2E64A 1U1TA 2K2VA 2KMTA 2DMOA 4PFOA 2FB7A 3RKXA 3OYNA 5KYWB 4A54A 1YWPA 1SEMA 2COYA 1WJRA 3E2UA 2RNAA 1FMWA 2X4XA 1PKSA 4OB1B 4ANJA 1IHVA 3SHWA 3SWNB 1FMVA 1VIFA 1YI2T 4Z88A 5GAN8 2I0NA 1Z9QA 2RQUA 2VVKA 4HT8A 2RQTA 2EYZA 2YUQA 1MGQA 4M75F 4B9XA 2KXCA 1QVFS 1JQQA 3QG1A 2FO0A 4A53A 3X25B 3CC7A 3JCMd 2XI9A 2YRCA 3X26B 1Q7YU 3VYHB 1YIJA 2DNUA 4Y28E 1VQ5A 1YI2Q 3CCQA 4M7AE 1VYVA 2XD0A 2QYZA 4M75G 4XTYA 4C8QD 4IUQA 1PCXA 4RG8A 2DXBA 2WSCE 3RKWA 3CPWS 4Z02A 3OYCA 4R55A 1UECA 1KHCA 2VXEA 1QWEA 4B9WA 3M54A 1G3TA 3TREA 3EFRA 2ZZDA 3JCMc 3DKMA 4JZ3A 1YJNT 5C0MA 4NL3A 1NYFA 4RTUA 3CCRQ 1QW1A 4CC7A 2JN0A 1VA7A 2J6FA 3CC4Q 2QQSA 4OMOA 1YITT 3M4YA 4ZTJA 3CC2A 4AT1B 5D7UA 2E3IA 3OYMA 3L2QA 4ZNXA 4OF1A 3URGA 4FL6A 2DBKA 2OI3A 1JJ2P 5KH6A 1OX8A 2J05A 1E6HA 2E6NA 4TVRA 2EYYA 2LQ8A 2EAYA 1YHQA 3OQ5A 3I55Q 5CKFA 3KBGA 2DA9A 3LX7A 1NYGA 2FZKB 3HFOA 2W10A 4B6MA 3JCMh 2LNHB 1RAFB 4PJOD 2DL5A 4RMOA 1NLPC 2Y90A 3VS5A 4NOYA 1MHNA 4M75B 1FXXA 1TUGB 2JT4A 2GCXA 3PIPA 2F2VA 3J81E 1OOTA 1N6AA 2QTXA 1OQKA 2MWOA 4M77C 3J80E 3VRZA 3LH0A 4J9BA 2LCLA 2CUDA 3CXCA 3HPWA 4XTXA 3EG0A 1E6GA 2V1RA 1VQPA 2XICA 1HJDA 1A0NB 4FW1A 4M77G 4FYWB 5I21A 4EMKC 4LDYA 1RL2A 4AFUC 4KGVB 1M3AA 2IG0A 1VQ5T 3FJ5A 2AHJB 3G4ST 5GAN2 1VQLQ 3ZL7C 3OYGA 1G5VA 1X75C 4XAXB 3CCJT 2PZ1A 2LQWA 1BI3A 3RERA 3TQ7P 2CH4A 2WSEE 1QP3A 2ZPFB 4C0GA 3T9NA 2M0OA 4ZN1A 3DB4A 1YITQ 2YLCA 1B34A 2L3SA 4GBQA 3X20B 3FC3A 1WQWA 1YBYA 5D6WA 1YHQQ 1M8VA 1QVFA 2MMPA 2QAZA 5I2SA 4EPCA 5LJ5e 3QKJA 2EJ9A 2O4XB 2OTJQ 2EYXA 2P4RA 4A63B 4X9CA 1MMAA 4F7UF 4E6RA 4QW2A 3EG9A 3DLMA 3HRTA 3TU4K 2J06A 2NWMA 2ECZA 2QXFA 5GAMg 1Y07A 2MWPA 2YT6A 1XQHA 3A1PA 1G3SA 1XTDA 3META 3SB2A 2RK2A 2RA2A 1Q82R 2JZ2A 1WIEA 4F16A 1NJIR 2LMJA 4HCKA 1IB8A 5KYNA 4HA8A 4M75C 3V8LA 2C0OA 1V1CA 2VASA 3CXCS 2E10A 3QIIA 5DY9A 1VUBA 2KYBA 3A98A 3CBOA 1HD3A 3V7CA 1BK2A 4IIOA 3OA6A 5KCOA 2W0ZA 2DAQA 1X27A 5GANd 4PKCC 1VQMA 3NGPA 1HXDA 2M51A 2P0PA 4HKEA 2M1HA 3M56A 3JB9H 5CKHA 3JCMV 1B34B 2RI5A 4BE0A 2OAWA 4FSSA 3R6OA 1ZSZC 2J6KA 3X24B 2DZ9A 3PNWC 1QLYA 2EPDA 5KE3A 1MMGA 1UFFA 1ZUYA 5GANh 3CCUA 4M7AF 3I56A 2O9SA 1JB0E 3JCMg 2DX1A 3MPUB 4M75A 3CD6Q 5C6SA 1XNIA 2V8JA 1JO8A 1KK7A 4JZ4A 4AFSC 2XDPA 4M75E 1WLPB 8AT1B 2PUOB 2VUBA 3CCMA 3WVEB 2OTLQ 3L2ZA 5FLXE 4FM4B 1K0SA 3G4SA 1EIFA 2IIMA 1R8OB 3CCLQ 1W2BA 2HQHA 2DZCA 3OY9A 1ZQ1A 2YXYA 1H8KA 2JW4A 1W2BS 2FG0A 3L2WA 4LD9K 4C92F 3CBPA 1KQ1A 4RTVA 3I55A 2R5MA 4KBMB 5LJ3h
chains in the Genus database with same CATH topology
2K57A 3RMQA 3E9FA 3OYBA 1YJ9T 1VQ8T 5DLQE 3O8VA 3CCMT 4XU2A 4JLIA 1O9SA 2QI2A 1BIAA 1M1GA 1UGRB 4DA4A 3SWNA 3VUZA 1P92A 1QP2A 3HKSA 1KG1A 1YCYA 1YJWA 3OYEA 4BDYA 3MP1A 2LC4A 5L8RE 5GANj 1VQOT 2CZ7B 1K73C 4IKFA 3AHUA 2DVEA 2RHXA 2XIDA 4FU6A 4Q5WA 5A2QE 2C06A 2HAXA 5KE2A 1X6OA 4L5GA 4NL2A 2R5AA 4XU0A 4GY5A 1LNXA 2DEQA 4J7IA 2PVGB 3L1AA 1YIJT 2DTHA 1I4K1 2RHUA 1M90C 2RO0A 1WNLA 1UGSB 2K5FA 3HP9A 4XTWA 4II1A 4R56A 3I56T 2ZPBB 3CC7T 1D3BA 1NPRA 4MZMA 4IUPA 4F7UB 1VQNT 4J7FA 4M77F 3V7RA 3LWIA 4M7DF 1AHJB 3QZ9B 2E1HA 3QZ5B 2D9TA 2Y4XA 3OYFA 3VUBA 3OW2S 2EYQA 3E19A 3JB9D 1YHQT 2JTMA 4JJNK 3OMCA 4M7DC 3QHSA 4OMFB 5GAOm 2OTJA 4D6WA 2GQVA 1N9RA 1X01A 2LX9A 2VV5A 4M78C 5GANf 3S6WA 4BI4A 2XG8D 3WXMB 5GAOl 1KC8U 3QDRB 4M77A 1VQ4A 2X4JA 5FRNA 4JDSA 3PMTA 5HK0A 3CPFA 4QQGA 5A0DA 1YI2A 1NE8A 2O01E 4MMKA 2F69A 5GMKi 3FDRA 1I81A 3E9GA 2A3LA 3MEVA 2K5LA 4M7AD 4KUIA 1M90U 1WPYA 4M78G 1YITA 5CKBA 5FROA 4C0ZA 4QQ6A 1VQMT 2ZPIB 3CEYA 4RKUE 5CCAA 1NJIU 4EMKA 3RUXA 2ZPGB 1FX7A 1JBMA 3NFCA 4M77E 4OGEA 5GAMf 1VQ6A 1YJNA 2DO3A 3MO8A 4C5IA 4E7LA 3A5ZB 4FSXA 1BKBA 1UGPB 3NTHA 4PLLA 4OB0B 1I8FA 2L8DA 3QYHB 1VQLT 3V8KA 2XHCA 2KSSA 3QJYA 3JCMQ 2CKKA 4JUVA 2RJDA 3PTAA 3F70A 2F5KA 3FB9A 4C5HA 1WJSA 4M7AG 4JS5A 5GAMh 2HNIA 1QVGS 2FHDA 4LDUA 4HCCA 2XK0A 3QXEB 4M78B 3H6ZA 5HY6A 5LJ5d 2XKOC 2K4YA 4FT2A 4J6WA 2DJZA 4M7DB 4C8QE 4OB3B 2FVUA 2QQ9A 2RHYA 3FJPA 4LDVA 4YTLA 2RJCA 1I5LA 2KAFA 3L2RA 3E1SA 4EDUA 1PSFA 4MZPA 1U8RA 2E64A 1U1TA 1UB4A 1KHIA 1M4ZA 2K2VA 2KMTA 1D3BB 1KQSA 2FB7A 3RKXA 1NPPA 3OYNA 1W4SA 4RCCA 2DXUA 3SFMA 1KD1U 1K8AU 5LJ5h 1DJ7B 4JLGA 4A54A 3OYKA 1ZBXA 5GAMe 2QQBA 1PSEA 3GOXA 3A8OB 4C8QG 3CCSA 3QSUA 3A8LB 1WJRA 1M1KC 2NLUA 4A4KA 2GFUA 5LJ5j 4PNOA 4M7DD 4XTUA 3BY7A 4C5GA 5J39A 3UT1A 2EJFA 2X4XA 3MHXA 4OB1B 4C0DB 4DQ2A 2FL7A 2RJFA 4C0FA 4M7DG 2CYZB 3SWNB 1VIFA 1V29B 4PJOA 1YI2T 4M7AA 4F7UE 5GAN8 1VQKA 4IUTA 4C92A 2DIGA 3FEOA 1SSFA 2DIQA 4XQ3A 4ZN3A 4HT8A 2LNVA 3L42A 4XU3A 1MGQA 2ZCFB 4M75F 4QQDA 3VJPA 4B9XA 5A0LA 1U1SA 1K9MC 1JJ2A 1QVFS 5J3BA 3OB9A 4EMHA 5FU6B 4J6YA 2QQAA 2CS7A 4J83A 4J5YA 3QG1A 5CKEA 1VIEA 3ZFJA 2GFAA 5GMKe 3M4GA 4A53A 2RB6A 4BE1A 5HK3A 3X25B 3CC7A 3JCMd 1N8RU 3RKYA 1H641 5GAN3 2L3RA 2XI9A 3MEAA 4OP0A 3V8JA 2LQKA 2P4TA 3X26B 3PIOA 3UWNA 3VYHB 3G6ET 4JRPA 1YIJA 1Q7YU 2YLBA 4Y28E 2DPPB 3NTIA 1VQ5A 4OGCA 3GNFB 2ZGWA 3CCQA 2LDMA 4M7AE 3MP8A 2XD0A 4PJOE 4M75G 4XTYA 2M9UA 4C8QD 3CC2T 4IUQA 3QPHA 4FIBA 4IURA 2RHIA 4RG8A 2VC8A 3OYDA 2DD5A 4DOVA 2DXBA 4BY6B 4M78D 2WSCE 1Y71A 3RKWA 1HK9A 5DLOA 3CPWS 4V2SA 4Z02A 3OYCA 2LT4A 4LD6A 4R55A 4MZTA 4GLKA 4L6V5 4PL6A 3FRNA 4FT4A 4WF2A 1KHCA 3GF5A 2VXEA 4B9WA 3WVDB 4C92G 4QVCA 3M54A 1BI2A 1G3TA 5CQYA 4XU1A 3VV0A 1M9SA 2HQEA 3C95A 3EFRA 4J8OA 4N0AA 2ZZDA 2QQRA 3JCMc 1WQ7A 3DKMA 3TREA 4JRQA 1YJNT 5C0MA 4NL3A 1WGSA 1VQ6T 2G3RA 3I55T 1QW1A 3JB9F 2X4YA 2VGNA 5CIUA 4M7DE 2JN0A 3GPLA 3ER0A 3HSBA 3HRUA 1RI0A 2BIVA 2QQSA 2X35A 4ME7A 1YITT 3OS1A 5GAN5 3M4YA 5GAN6 1Q86C 4N4HA 4XTVA 2JUFA 3G7ZA 4ZTJA 3CC2A 2K5IA 3G71T 3OYMA 3OYJA 3CCQT 3MEWA 4RG2A 4C8QC 3L2QA 4OVAA 3HRSA 4OF1A 2PU9B 1KQSS 3URGA 4KUDK 3LWHA 3G6EA 3M9QA 4FL6A 4VUBA 3M58A 3ZBDA 2RD1A 1Q82U 1N27A 2M16A 4EMKB 5KH6A 4C92B 3FIFA 3M57A 5I2MA 1KC8C 1UEBA 3KUFA 4C5EA 2E6NA 3CCRA 4TVRA 1YHQA 2LQ8A 2EAYA 3QO3A 3OQ5A 2RJEA 3BFMA 3OS0A 3CCRT 5CKFA 3JRZA 2RHZA 3KBGA 3PFSA 4E47A 3Q1JA 1Y96B 3LX7A 3PMIA 2DTIA 5FU7B 3JAME 3S3MA 3P8BB 2I2LA 3HFOA 2CGHA 1VQKT 3DB3A 3JCMh 2D6FA 4CRIA 5CVIA 3G71A 4PJOD 3L2UA 4MDXA 3VKIA 5EG2A 4RMOA 3JCMf 4BD3A 2Y90A 1UGQB 3M59A 4HCBA 2R57A 1M1KU 4NOYA 1MHNA 4M75B 5GAMj 1FXXA 2K3YA 2LRQA 1JRIA 5IAYA 1YJWT 2MI6A 5GAOq 4X34A 2GCXA 2PQWA 3PIPA 2DXTA 4KT0E 5CK9A 2KY9A 1G3YA 3J81E 2YHTA 5KCHA 1N6AA 2DKGA 2QTXA 4OB2B 2F5TX 4CI0C 3JCMb 2JTFA 4M7AC 1VQ8A 4JS4A 2MWOA 5CAIA 4M77C 3J80E 1KQ2A 1H3ZA 3LH0A 3A8HB 4BE2A 3J7AF 1M5Q1 4A4EA 3JCMe 3TCJA 3OYAA 5FU7C 3CCVT 2LCLA 3HFNA 4E7HA 3ASKA 4QVZA 4MDWA 4PJOB 3CXCA 1N9SA 2EQUA 5M9OA 4XTZA 3HPWA 4XTXA 2OTLT 1VQPA 2XICA 4LDXA 1IZ6A 5GMKh 1OZ2A 2CZ1B 2P0KA 3M53A 4M77G 3SDZA 4C92C 5I21A 3JB9I 3CCEA 4EMKC 4LDYA 3CC4A 1RL2A 4E7KA 3VYGA 2IG0A 4ZGDB 1VQ5T 3QYGB 1VQ9A 4M78E 2AHJB 3TEEA 2R58A 4ELZC 2L89A 3G4ST 4ZTFA 3QUIA 2MF2A 5GAN2 4JRIA 4C8QB 4BI3A 2RI2A 3PT9A 3ZEHA 3JCMP 4RCBA 3OYGA 3QJ6A 5D6YA 3BW1A 4N4GA 4M78F 1X75C 4XAXB 1O75A 1G5VA 3CCJT 2HD0A 5A0GA 3OYHA 3P8DA 5CO7A 1BI3A 1BIBA 5GAOp 5GAOr 3CD6T 1VQLA 3RERA 3M55A 5IT9E 5LJ5g 5LJ3j 4JRKA 1VQ7T 5GAMd 1JJ2S 2D0QB 2WSEE 4C8QF 5LJ5f 2E41A 2JVVA 2ZPFB 1QP3A 2E70A 1TH7A 2IVWA 2LCCA 3C12A 3GNGA 1LJOA 3T9NA 2M0OA 4Y91A 4C0GA 4ZN1A 2LVMA 3DB4A 3PGGA 3OBWA 4M78A 5J26A 2HBPA 3JCMX 3KXTA 4N0AC 2ZPHB 2YLCA 1B34A 4A4FA 2VXFA 4F7UA 3HHTB 3A8MB 3X20B 2B8AA 4BI8B 3RIRA 3FC3A 1K9MU 1WQWA 3EFSA 1K8AC 1YBYA 5D6WA 4BY6C 2WSFE 1Q81C 5LJ3d 3GP8A 1QVFA 1M8VA 4UC4A 2PVDB 2EQKA 2MMPA 3LW5E 3CCST 2RM4A 5I2SA 2RK1A 4L59A 4EPCA 5LJ5e 1KD1C 2V8KA 2EJ9A 2O4XB 3QKJA 5GMKm 5DM7R 2QEXA 4M75D 4ATOA 2OTJT 4BB7A 3FLGA 2YRVA 3S3OA 3CMAT 3OS2A 2JNGA 1BI1A 3CPWA 1Q81U 4X9CA 4F7UF 2QEXT 1S72A 4QW2A 3X28B 2DTOA 2KK4A 3DLMA 3HL8A 2EIFA 3HRTA 4ZGJB 3H8ZA 5D6XA 5GAN7 4HT9A 4E7JA 4E7IA 3TU4K 1OYXA 4PJOC 4C8QA 4MMLA 1ZHIA 3LGLA 3JCMW 1Q82C 3CCLT 2Y4YA 1Y7XA 2EKOA 2QXFA 5GAMg 4A4GA 2ZPEB 4M77B 3CMEA 1Y07A 2MWPA 1XQHA 1QVPA 4M7AB 1G3SA 1XTDA 2OAUA 1OZ3A 2DK3A 3META 3SB2A 2RK2A 5HKCA 2RA2A 3SWNC 2JZ2A 4ELYC 3BDLA 2E5QA 4C0DC 5FRMA 3CD6A 2XU8A 4BUGA 2HQXA 3CCJA 4HA8A 4M75C 5LJ3e 3N5BB 3V8LA 2EQJA 1YJ9A 1WJQA 1NJIC 3CXCS 4QVDA 2E10A 3QBYA 3QIIA 5LL6S 5DY9A 1VUBA 2GF7A 3CBOA 1XOVA 3GLXA 3V7CA 3OA6A 1N8RC 5CR2A 5KCOA 3JSCA 3OSVA 2DAQA 2QDYB 4IUUA 5GANd 3P8HA 4PKCC 5IN1A 2QA4T 1VQMA 2XDDA 3CMET 3OMGA 1HXDA 4P5NA 2BUDA 2K3XA 3CCLA 2P0PA 4HKEA 4PLIA 2M1HA 3OSSC 3M56A 1VQPT 3JB9H 1LOJA 5CKHA 2LT1A 3JCMV 1B34B 1GXIE 2RI5A 1VQ4T 1G3WA 4BE0A 4BDZA 4DOWA 3R6OA 4J6XA 1S72T 3NTKA 2MAMA 4N4IA 3X24B 3CMAA 4O6JA 2DZ9A 3PNWC 3DLLA 3C4SA 5KE3A 4C92D 2O4XA 4C92E 5GANh 3OYYA 2WACA 3OW2A 5GMKj 1VQNA 3CCUA 4X9DA 1BYMA 4M7AF 3SD4A 4A4HA 2LTOA 3I56A 3EAEA 3UDCA 1JB0E 3RMSA 3JCMg 3JCMJ 4M75A 2DD4A 2PUKB 5LJ3f 1BI0A 1OI1A 2V8IA 1XNIA 5CQXA 2V8JA 5C6SA 2PVOB 3INZA 3MP6A 4BACA 3S3NA 2E12A 5CKDA 1K73U 5GANe 3MEUA 2XDPA 2E6ZA 4LDWA 2CZ6B 3C94A 1VQOA 4XK8E 5LJ3g 3M5AA 3GIBA 3OS5A 2KVQG 1Y96A 4IUVA 2EQMA 2FYKA 4M75E 4NS5A 1VQ7A 2A7YA 3BDUA 4M77D 3CCUT 1Q86U 2KQWA 3VU3C 2E65A 2EWNA 2DXCA 2L5QA 2PUOB 2P0QA 2VUBA 2KDSA 4O5VA 3CCMA 3UPUA 2XDBA 3WVEB 3JB9J 3ME9A 3OYIA 3L2ZA 4ZGEB 5FLXE 3A8GB 2EFIA 2RH2A 1M1FA 4FM4B 5GANg 3MCAB 4F7UG 2VYTA 1NZ9A 3V7SA 3G4SA 1VQ9T 1FWZA 1EIFA 2EJGA 5GMKl 4KULA 2BKDN 1IREB 3LYIA 4HCZA 1R8OB 3JB9G 3CC4T 2VGMA 3LGFA 3OBYA 3OYLA 1W2BA 3CCET 2CZ0B 2DZCA 2RI3A 3OY9A 3CBMA 1QVGA 1ZQ1A 2H3JA 4EMGA 5GAOn 1W2BS 2OTLA 5FU6C 3RESA 3L2WA 5GAN4 4LD9K 4C92F 3L2VA 2QA4A 3CBPA 1KQ1A 4M7DA 5AYFA 2JOYA 3I55A 2R5MA 2X4WA 4PJOF 3CCVA 3LLRA 4PJOG 4KBMB 5LJ3h 1Q7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5L A;  1G3S A;  2QQA A;  1BI3 A;  2K5F A;  3HRS A;  2QQB A;  1BI0 A;  2K4Y A;  1BI1 A;  1FX7 A;  1FWZ A;  1BI2 A;  1G3T A;  1G3W A;  3E19 A;  2QQ9 A;  1P92 A;  3MHX A;  2GCX A;  3HRT A;  1G3Y A;  2LX9 A;  1U8R A;  1QW1 A;  2H3J A;  4O6J A;  3HRU A;  3GLX A;  1BYM A;  4O5V A;  2K5I A;  5CVI A;  1QVP A; 
#chains in the Genus database with same CATH topology
 1BCM A;  3OYB A;  1YJ9 T;  1O9S A;  3VS2 A;  1BIA A;  4J9I A;  4PFZ A;  4LUE A;  1GBQ A;  2AK5 A;  2LC4 A;  2LJ0 A;  2KR3 A;  2FPD A;  3EG9 B;  2HAX A;  1X6O A;  1IGQ A;  4GY5 A;  5EC7 A;  2DEQ A;  2EW3 A;  2AKK A;  2DL8 A;  2RHU A;  1I4K 1;  1UGS B;  2K3B A;  3HP9 A;  4XTW A;  4MZM A;  4IUP A;  1VQN T;  3CCS Q;  4J7F A;  3V7R A;  1RAE B;  2E1H A;  3QZ5 B;  5IHI A;  2D9T A;  2Y4X A;  1E7O A;  1AZE A;  3JB9 D;  1FMK A;  1YHQ T;  2FZG B;  3OMC A;  4OMF B;  2OTJ A;  1Q7Y R;  2VV5 A;  1VQO Q;  3QDR B;  4M77 A;  1VQ4 A;  4JDS A;  3EH2 A;  4MMK A;  2F69 A;  3U23 A;  5GMK i;  3E9G A;  2XMF A;  2A3L A;  2P84 A;  1M90 U;  1YIT A;  5FRO A;  1YJ9 Q;  4QQ6 A;  3CC7 Q;  2ZPI B;  3CEY A;  1NJI U;  3NFC A;  4M77 E;  1YJN A;  3MO8 A;  4E7L A;  4C5I A;  3A5Z B;  1UGP B;  1AZG B;  4PLL A;  1M30 A;  2L8D A;  4OB0 B;  2DL3 A;  3QYH B;  1VQL T;  3V8K A;  1Q86 R;  3QJY A;  2JMA A;  2RJD A;  2F5K A;  1NM7 A;  1WYX A;  1R77 A;  4M7A G;  4JS5 A;  3SEM A;  1WHL A;  2KT8 A;  2HNI A;  3QXE B;  4M78 B;  3H6Z A;  2H8H A;  3MJX A;  4M7D B;  4LDV A;  3JV3 A;  2KBT A;  2D8H A;  1U8R A;  1VQ6 Q;  1KHI A;  2HEQ A;  1D3B B;  1NPP A;  5L23 A;  1KD1 U;  1YN8 A;  5LJ5 h;  3G6E Q;  4JLG A;  4Y92 A;  5GAM e;  3I5S A;  3GOX A;  3A8O B;  1M27 C;  1M1K C;  1IHW A;  4A4K A;  4XTU A;  3BY7 A;  3UT1 A;  2EJF A;  4DQ2 A;  2FL7 A;  3EG2 A;  1WDX A;  1V29 B;  1KQS P;  4PJO A;  4E7Z A;  1VQK A;  4IUT A;  3EHR A;  2L2P A;  4XU3 A;  2KNB B;  1X69 A;  4J83 A;  2NUP B;  1VIE A;  2H3E B;  3M0P A;  1OU9 A;  1ZBJ A;  5HK3 A;  3CCJ Q;  1T0H A;  3RKY A;  2L3R A;  3MEA A;  4OP0 A;  4QKU A;  1WI7 A;  1YCS B;  3MP8 A;  1RAA B;  2KE9 A;  3QPH A;  1X6G A;  1OEB A;  4DOV A;  1VQ9 Q;  4M78 D;  1BCO A;  1Y71 A;  5DLO A;  4LD6 A;  4L6V 5;  4FT4 A;  4JJN K;  4C92 G;  3WVD B;  4F04 B;  5CQY A;  2HQE A;  3C95 A;  4N0A A;  1GFD A;  2QQR A;  5HCK A;  1VQ6 T;  1R0C B;  1TG0 A;  2X4Y A;  4M7D E;  1CKB A;  3ER0 A;  3HRU A;  1RI0 A;  3OS1 A;  5GAN 6;  1YJW Q;  3G71 T;  3MEW A;  4C8Q C;  2MCN A;  4OVA A;  3HRS A;  4FYV B;  2FEI A;  2M02 A;  1SG5 A;  3G6E A;  3M9Q A;  3M58 A;  1K4U S;  2M16 A;  4EMK B;  3FIF A;  3M57 A;  1QWF A;  4C5E A;  1YWO A;  3BFM A;  3CCR T;  3JRZ A;  5AT1 B;  2RHZ A;  5FU7 B;  2EGC A;  1BBZ A;  1GBR A;  2CGH A;  2VWF A;  4F17 A;  3L2U A;  4MDX A;  3VKI A;  5EG2 A;  1UGQ B;  3G1J A;  2CP6 A;  5GAO q;  4QT7 A;  5CK9 A;  1D0Z A;  2KY9 A;  4Z89 A;  2F5T X;  3JCM b;  2JTF A;  3NPF A;  1VQ8 A;  1M2V A;  5CAI A;  4RTW A;  2CP7 A;  1WXB A;  4BE2 A;  2CDT A;  1M5Q 1;  4A4E A;  2LX7 A;  3ASK A;  4QVZ A;  2KRN A;  1N9S A;  1OU8 A;  2EQU A;  2MYS A;  4XTZ A;  4OML A;  1B07 A;  1OZ2 A;  1UGV A;  3RDV A;  3CCE A;  1D1B A;  4E7K A;  1SF9 A;  3VYG A;  3QYG B;  2R58 A;  4ZTF A;  1UDL A;  3QUI A;  3PT9 A;  3JCM P;  9ATC B;  4M78 F;  2CRE A;  3OYH A;  2BZ8 A;  5GAO r;  4JRK A;  4AFZ C;  5GAM d;  2D0Q B;  4C8Q F;  3NHN A;  2LCC A;  2E70 A;  3GNG A;  1PRL C;  4AG2 C;  3JCM X;  2ZPH B;  2VXF A;  1VQ5 Q;  1IXD A;  2B8A A;  3RIR A;  2ABL A;  4BY6 C;  1Q81 C;  3GP8 A;  1NEB A;  5IHK A;  1ZA1 B;  1YFN A;  1GCQ A;  2QEX A;  1QKX A;  1PKT A;  4BB7 A;  3S3O A;  1RI9 A;  4FYX B;  1BI1 A;  2KRO A;  3CPW A;  1Q81 R;  1Q81 U;  1S72 A;  3X28 B;  4WTO B;  4ZGJ B;  3H8Z A;  1M2O A;  4D8K A;  3BE3 A;  4E7J A;  4HVU A;  4RTT A;  4C8Q A;  4MML A;  3VS4 A;  3JCM W;  3CCL T;  1SHG A;  2EKO A;  2NUT B;  4A4G A;  2ZPE B;  3CME A;  2ROL A;  1OZ3 A;  5HKC A;  4ELY C;  4C0D C;  3CD6 A;  4BUG A;  2HQX A;  2EQJ A;  1WJQ A;  2O9V A;  1MMN A;  1TU0 B;  1W2B P;  3GLX A;  5KYW A;  1CSK A;  2Z0W A;  1N8R C;  3JSC A;  3OSV A;  1TS9 A;  2QA4 T;  3P8H A;  3H9N A;  4P5N A;  2CT3 A;  3QWY A;  3I56 Q;  4PLI A;  3OSS C;  2FRY A;  1RAD B;  1WHM A;  2LT1 A;  2K79 A;  4JPB W;  1YP5 A;  4AFQ C;  4N4I A;  4O6J A;  1LCK A;  1W70 A;  2O4X A;  2KRM A;  2PTK A;  3R6N A;  2KI7 A;  1VYU A;  4A4H A;  3PVQ A;  5KYX B;  3RMS A;  2JM9 A;  1WX6 A;  4BAC A;  4M4Z A;  2E6Z A;  1VQO A;  2IPO B;  3M5A A;  3OS5 A;  2DER A;  4NS5 A;  1VQ7 A;  2A7Y A;  1Q86 U;  2KQW A;  2BTT A;  2EWN A;  2HDA A;  4O5V A;  1UJY A;  3ME9 A;  1D0X A;  1NLO C;  2RH2 A;  5GAN g;  3MCA B;  1NZ9 A;  1C6V X;  1OPL A;  2EJG A;  5GMK l;  3EGX A;  4HCZ A;  1HYO A;  1D0Y A;  3OYL A;  4EMG A;  1IO6 A;  5GAO n;  3RES A;  2QA4 A;  5I11 A;  4M7D A;  2JOY A;  7AT1 B;  2X9H A;  1S1N A;  3CCV A;  3LLR A;  4LE9 A;  1Q7Y C;  2KYM A;  2K57 A;  3E9F A;  3H0F A;  3CXC P;  5DLQ E;  3EFO B;  4XU2 A;  3CCQ Q;  2D0N A;  2DRM A;  2C0I A;  4BDY A;  4J9E A;  5L8R E;  5GAN j;  2CZ7 B;  1K73 C;  1GRI A;  2DVE A;  2J6O A;  4FU6 A;  5KE2 A;  2SRC A;  4J7I A;  2RO0 A;  4E7S A;  2JMC A;  2ZPB B;  1D3B A;  2NYS A;  4F7U B;  3LWI A;  1SSH A;  4OMM A;  5FWB A;  2EYQ A;  2JTM A;  1QVF P;  2DEU A;  4M7D C;  4RUG A;  1T3L A;  1ZX6 A;  3GBQ A;  4M78 C;  2XG8 D;  5FRN A;  3CPF A;  2O01 E;  2CP5 A;  3FDR A;  2OJ2 A;  3EG3 A;  3H41 A;  3MEV A;  1JXM A;  4M7A D;  4RTY A;  4M78 G;  1CKA A;  5CKB A;  1M3C A;  4C0Z A;  3RUX A;  2COW A;  4LNP A;  5GAM f;  3PVL A;  4FW2 A;  4J9G A;  1T3S A;  1OUL A;  2RQW A;  4OMN A;  1K0X A;  1G2B A;  4JUV A;  3F70 A;  1Y57 A;  5GAM h;  2ENM A;  1ZSG A;  2NUT A;  4FT2 A;  1MMD A;  3CCV Q;  1QQJ A;  3H0H A;  4C8Q E;  2FVU A;  2RHY A;  4LUD A;  2CP3 A;  4YTL A;  2RJC A;  1I5L A;  2K6D A;  3L2R A;  4EDU A;  4MZP A;  2MPX C;  1M4Z A;  1W4S A;  2DXU A;  3SFM A;  2A37 A;  1SHF A;  3VS1 A;  1DJ7 B;  1ZBX A;  2V1Q A;  1PHT A;  3CCS A;  4C8Q G;  1J3T A;  2F2W A;  3A8L B;  1K76 A;  2GFU A;  4JJB A;  5J39 A;  4M7D G;  2QK0 A;  3MHX A;  4C0D B;  3QDF A;  2CYZ B;  1RUW A;  2BE7 D;  4F7U E;  1ZSZ A;  1ZLM A;  4J9F A;  3CCE Q;  2DIG A;  3FEO A;  1EX4 A;  4XQ3 A;  2LNV A;  3L42 A;  2DBM A;  1KSW A;  3VJP A;  5A0L A;  1U1S A;  2A08 A;  4PJM A;  1JJ2 A;  3TVT A;  2GBQ A;  3OB9 A;  5FU6 B;  1VQ7 Q;  5CKE A;  2GFA A;  5GMK e;  3M4G A;  4BE1 A;  1K9A A;  4RTX A;  1N8R U;  1N8R R;  1H64 1;  3V8J A;  4JRP A;  2P4T A;  3UWN A;  3G6E T;  1I0C A;  4KGX B;  2DPP B;  4OGC A;  3GNF B;  1M8M A;  2LDM A;  4PJO E;  3M0R A;  2RHI A;  4IUR A;  3OYD A;  2DD5 A;  3CPW P;  4BY6 B;  1X6B A;  2LT4 A;  4E2F B;  2FZC B;  3FRN A;  4F14 A;  3GF5 A;  3H0I A;  1PG5 B;  3VV0 A;  3O5Z A;  4XU1 A;  1AEY A;  3EH1 A;  1WQ7 A;  1JXO A;  2L3Q A;  1WGS A;  3GPL A;  3HSB A;  1MNE A;  4J9C A;  1WXT A;  2BIV A;  5GAN 5;  2A28 A;  4GLM A;  2JUF A;  3G7Z A;  2K5I A;  1VQP Q;  2PU9 B;  1KQS S;  4KUD K;  3LWH A;  3CME Q;  5IXB A;  1TTH B;  1Q82 U;  1N27 A;  4C92 B;  1KC8 C;  1UEB A;  3CCU Q;  1PM3 A;  2DF6 A;  2K9G A;  3QO3 A;  1EFN A;  3OS0 A;  4E47 A;  3Q1J A;  1Y96 B;  3JAM E;  2DTI A;  5FWC A;  3S3M A;  3P8B B;  1GCP A;  1VQK T;  3DB3 A;  2KRS A;  1TSF A;  4CRI A;  1ZUK A;  1VQN Q;  3VRY A;  3ULR B;  1LVK A;  3JCM f;  1H3H A;  1NEG A;  1M1K U;  1K73 R;  5GAM j;  2K3Y A;  5IAY A;  1JRI A;  2RQR A;  1YJW T;  4X34 A;  2DXT A;  2JJ9 A;  4KT0 E;  1G3Y A;  2YHT A;  5KCH A;  1UG1 A;  1C0M A;  4M7A C;  4JS4 A;  1TWB A;  1KQ2 A;  1H3Z A;  3JCM e;  3TCJ A;  5FU7 C;  1RLP C;  4MDW A;  4PJO B;  1BB9 A;  2OTL T;  1K8A R;  4LDX A;  1YIJ Q;  1IRX A;  3QWX X;  1IZ6 A;  3M53 A;  3SDZ A;  2RPN A;  3CC4 A;  1KJW A;  2AT1 B;  4ZGD B;  1VQ9 A;  1UTI A;  4ELZ C;  1QVG P;  3G4S Q;  4JRI A;  4C8Q B;  4RCB A;  3QJ6 A;  2JM8 A;  5D6Y A;  4D8D A;  4N4G A;  2HD0 A;  5A0G A;  3CCM Q;  3P8D A;  5CO7 A;  5GAO p;  4DEY A;  3CD6 T;  1N5Z A;  1VQL A;  3M55 A;  4OMP A;  5LJ5 g;  5LJ5 f;  2KGT A;  2JVV A;  1X2K A;  2LVM A;  2G6F X;  3OBW A;  4M78 A;  2HBP A;  4PK4 A;  3KXT A;  4N0A C;  2YUO A;  1KFZ A;  4F7U A;  1TOV A;  3HHT B;  3KFV A;  4BI8 B;  3EFS A;  2WSF E;  5LJ3 d;  1TUD A;  3VS6 A;  2PVD B;  2EQK A;  3LW5 E;  3CCS T;  2MK5 A;  5ECA A;  4L59 A;  2V8K A;  4ATO A;  2LJ3 A;  4M75 D;  2OTJ T;  2HSP A;  1I5O B;  3CMA T;  3OS2 A;  2JNG A;  2LQN A;  2QEX T;  1D1A A;  2QG9 B;  2DTO A;  2JXB A;  2EIF A;  5GAN 7;  5KYX A;  3EFO A;  1OYX A;  4PJO C;  3NMZ C;  3VS0 A;  2HBW A;  3LGL A;  4CC4 B;  1Q82 C;  2Y4Y A;  2YUN A;  4M77 B;  1W1F A;  2DM1 A;  4M7A B;  4HVV A;  1B7T A;  2K7A A;  3BDL A;  2DYI A;  2E5Q A;  5FRM A;  2YRD A;  2GTJ A;  1YJ9 A;  1KD1 R;  1I1J A;  4QVD A;  3QBY A;  2EKH A;  2GF7 A;  1RLQ C;  6AT1 B;  4IUU A;  2QDY B;  3VS3 A;  1HSQ A;  2FPF A;  3AT1 B;  2K3X A;  2JTE A;  3G71 Q;  1LOJ A;  1GXI E;  1G3W A;  2CT4 A;  2YUP A;  4BDZ A;  4DOW A;  4J6X A;  2MAM A;  3CMA A;  2KXD A;  3DLL A;  4CC3 A;  3C4S A;  1PRM C;  4C92 E;  3OYY A;  2WAC A;  1BYM A;  2CSI A;  4PJJ A;  5IXF A;  3EAE A;  3UDC A;  3JCM J;  1ABO A;  2DD4 A;  2PUK B;  5LJ3 f;  1BI0 A;  2PVO B;  3INZ A;  3MP6 A;  1K73 U;  2A36 A;  2QGG A;  3MEU A;  4IIM A;  1AOJ A;  1MUZ A;  1AWO A;  2RN8 A;  1U06 A;  2KVQ G;  1Y96 A;  2HKN A;  4IUV A;  3BDU A;  4M77 D;  3UAT A;  3CCU T;  2L5Q A;  1T0J A;  2KDS A;  2XDB A;  3OYI A;  1PWT A;  1MND A;  2EFI A;  1M1F A;  4F7U G;  5KYU B;  1VQ9 T;  4PJN A;  4KUL A;  2BKD N;  1IRE B;  3LYI A;  3CC4 T;  4K11 A;  2H3J A;  2OTL A;  5FU6 C;  5GAN 4;  3L2V A;  1TUC A;  2D1X A;  2VB6 A;  2X4W A;  2CP2 A;  4PJO F;  2GNC A;  1R0B G;  1Z9Z A;  3O8V A;  4JLI A;  2L0A A;  1SRL A;  1M1G A;  1UGR B;  2HSE B;  2JS0 A;  3SWN A;  4DA4 A;  4FYY B;  3VUZ A;  1P92 A;  5IHN A;  1KG1 A;  1YCY A;  1YJW A;  3MP1 A;  1VQO T;  2RF0 A;  4IKF A;  3AHU A;  2XID A;  2C06 A;  5A2Q E;  4Q5W A;  2HL3 A;  3EGX B;  4L5G A;  1YJN Q;  1PD0 A;  2PVG B;  3L1A A;  3LH5 A;  1WNL A;  2K5F A;  4II1 A;  4R56 A;  1NPR A;  2SEM A;  4M7D F;  1AHJ B;  3QZ9 B;  3VUB A;  3E19 A;  1QCN A;  2QGF B;  3RBB B;  2OX7 A;  5GAO m;  4FCY A;  1N9R A;  1X01 A;  2LX9 A;  5GAN f;  1NBE B;  4BI4 A;  4RTZ A;  1KC8 U;  3RR6 A;  3PMT A;  2ED1 A;  4PJL A;  2C0T A;  5A0D A;  4LXC A;  1NE8 A;  4X1V A;  1I81 A;  4KUI A;  1WPY A;  2EGA A;  1GCQ C;  4RKU E;  1AWX A;  5CCA A;  4EMK A;  1FX7 A;  2DO3 A;  4FSX A;  1BKB A;  3NTH A;  3TSW A;  1I8F A;  2XHC A;  3THK A;  2KSS A;  3JCM Q;  4J9H A;  2HKQ B;  5KYY B;  1M3B A;  3PTA A;  2EQI A;  3EHQ A;  3VS7 A;  2X3X D;  3FB9 A;  4C5H A;  1WJS A;  4LDU A;  4AG1 C;  5HY6 A;  1ZSZ B;  2XKO C;  2DJZ A;  1M90 R;  4OB3 B;  2QQ9 A;  1UHF A;  2X51 A;  4DEX A;  1UB4 A;  1KQS A;  2FPE A;  4RCC A;  3OYK A;  2QQB A;  1IGU A;  3CMA Q;  1PSE A;  3QSU A;  2NLU A;  5LJ5 j;  4PNO A;  1V76 A;  1VQK Q;  1WHK A;  4M7D D;  2LP5 A;  4C5G A;  2DL7 A;  2RJF A;  4C0F A;  1OPK A;  1VYT A;  2HZY A;  2NUP A;  3M0U A;  2ROT A;  4M7A A;  4C92 A;  2VKN A;  2QTV A;  1SSF A;  2DIQ A;  4ZN3 A;  2ZCF B;  4QQD A;  3OW2 P;  1K9M C;  5J3B A;  4EMH A;  4J6Y A;  2QQA A;  2CS7 A;  4J5Y A;  3ZFJ A;  2V26 A;  2RB6 A;  2RQV A;  5GAN 3;  1K8A U;  2LQK A;  3PIO A;  5IH2 A;  1H92 A;  2YLB A;  2KEA A;  3NTI A;  2ZGW A;  3CC2 T;  2M9U A;  4HXJ A;  4FIB A;  2VC8 A;  3REB B;  2E5K A;  2GQI A;  1HK9 A;  4V2S A;  2L3P A;  4MZT A;  4GLK A;  2BZX A;  4PL6 A;  1G8X A;  1TXQ A;  1KIK A;  4WF2 A;  4QVC A;  3OYE A;  2CUB A;  1BI2 A;  1M9S A;  4J8O A;  4JRQ A;  2G3R A;  4JJC A;  3I55 T;  3JB9 F;  2QAS A;  2VGN A;  5CIU A;  2X35 A;  4ME7 A;  1W6X A;  1XJW B;  4N4H A;  3M0T A;  4XTV A;  1FYN A;  3CCQ T;  3OYJ A;  4RG2 A;  4HVW A;  1OX9 A;  3ZBD A;  4VUB A;  1UE9 A;  1B3Q A;  2RD1 A;  4JJD A;  2LZ6 B;  1AD5 A;  1M2V B;  1AVZ C;  5I2M A;  3KUF A;  3CCR A;  2J7I A;  2RJE A;  3UA6 A;  1KC8 R;  3PFS A;  4R0K A;  3PMI A;  1X43 A;  1I07 A;  2I2L A;  2D6F A;  5CVI A;  2EVR A;  2MOX A;  3G71 A;  1RAB B;  4BD3 A;  1NG2 A;  3M59 A;  4HCB A;  2R57 A;  1F1B B;  2DFU A;  2LRQ A;  2MI6 A;  1AWJ A;  2PQW A;  1PC0 A;  4J9D A;  3CQT A;  2A0F B;  1RAG B;  4OB2 B;  2DKG A;  4CI0 C;  3TSZ A;  2RMO A;  3A8H B;  3J7A F;  3OYA A;  3CCV T;  3HFN A;  4E7H A;  2EGE A;  5M9O A;  5GMK h;  2CZ1 B;  2P0K A;  1K1Z A;  4C92 C;  3JB9 I;  4EIK A;  1VOM A;  4M78 E;  1AWW A;  3TEE A;  5KYU A;  2L89 A;  2MF2 A;  4BI3 A;  2COZ A;  2RI2 A;  3ZEH A;  5KYY A;  3BW1 A;  1O75 A;  1UHC A;  2KT1 A;  1BIB A;  5GJV B;  3RNJ A;  5IT9 E;  1C1A A;  5LJ3 j;  1VQ7 T;  1JJ2 S;  2E41 A;  3C12 A;  4Y91 A;  1TH7 A;  2IVW A;  1Q86 C;  1LJO A;  4Z8A A;  2E3H A;  3PGG A;  5J26 A;  1GL5 A;  4A4F A;  2F2X A;  2DET A;  3A8M B;  3M0S A;  1K9M U;  1K8A C;  4UC4 A;  1VQ4 Q;  2HL5 C;  3M0Q A;  4KH0 B;  4CC2 A;  2RM4 A;  2RK1 A;  1KD1 C;  1WHH A;  5GMK m;  5DM7 R;  3FLG A;  3EGU A;  1MV3 A;  2EYW A;  1SKU B;  2YRV A;  2KK4 A;  3HL8 A;  2GGR A;  2YWW A;  5D6X A;  2DLP A;  4KH1 B;  1SPK A;  4HT9 A;  4E7I A;  1WZO A;  1ZHI A;  2D8J A;  1M1K R;  1Y7X A;  2HCK A;  2QDL A;  1QVP A;  1VQM Q;  1QCO A;  2OAU A;  2DK3 A;  3SWN C;  2XU8 A;  2CSQ A;  3CCJ A;  2K2M A;  2AZV A;  5LJ3 e;  3N5B B;  1NJI C;  1OV3 A;  5LL6 S;  1XOV A;  5CR2 A;  1UUE A;  2O2O A;  5IN1 A;  2XDD A;  3CME T;  3OMG A;  1QKW A;  2BUD A;  2PNI A;  3CCL A;  4OMQ A;  1G83 A;  1VQP T;  1VQ4 T;  1UJ0 A;  2BE9 B;  4ESR A;  1K9M R;  1SRM A;  1S72 T;  1RAH B;  3NTK A;  2O88 A;  3I5R A;  8ATC B;  4C92 D;  2CH4 W;  3EG1 A;  3OW2 A;  5GMK j;  1VQN A;  4X9D A;  2FRW A;  3SD4 A;  3UA7 A;  2LTO A;  2F1L A;  2HMA A;  2DL4 A;  1VQ8 Q;  2DRK A;  1ARK A;  5I22 A;  1OI1 A;  2V8I A;  5CQX A;  4DBF A;  2AZS A;  3S3N A;  4DBQ A;  1U5S A;  2E12 A;  4KGZ B;  5CKD A;  3EGD B;  3HTR A;  5GAN e;  2DVJ A;  4LDW A;  2CZ6 B;  3C94 A;  4XK8 E;  5LJ3 g;  3GIB A;  2BZY A;  2EQM A;  1WA7 A;  2FYK A;  3VU3 C;  2DE0 X;  2E65 A;  2DXC A;  1D09 B;  2P0Q A;  3UPU A;  1ABQ A;  1PD1 A;  3JB9 J;  1LPL A;  1U3O A;  4KRT A;  2DJQ A;  4ZGE B;  2NUZ A;  3A8G B;  2LCS A;  1YNZ A;  1ZA2 B;  2VYT A;  3V7S A;  2JS2 A;  1FWZ A;  1MV0 B;  2MIO A;  4DBH A;  3JB9 G;  2VGM A;  3LGF A;  3OBY A;  3CCE T;  2CZ0 B;  2AKL A;  2RI3 A;  3D7S B;  2AIR B;  3CBM A;  3UF4 A;  1QVG A;  1QMC A;  1S72 Q;  5AYF A;  2QEX Q;  4PJO G;  2GTO A;  1Y0M A;  3RMQ A;  4DBR A;  1VQ8 T;  3CCM T;  2QI2 A;  1ACM B;  1QP2 A;  2QA4 Q;  3HKS A;  2ATC B;  3CC2 Q;  4WCI A;  2DYB A;  1PNJ A;  4AMC A;  2RHX A;  2O31 A;  4ORZ A;  1Q95 G;  1WXU A;  4PFP A;  3EGD A;  4NL2 A;  2R5A A;  4XU0 A;  1RAI B;  1WHJ A;  1LNX A;  3IQL A;  1YIJ T;  2DTH A;  1M90 C;  5FW9 A;  3I56 T;  3CC7 T;  5GJW B;  4M77 F;  3OYF A;  1D1C A;  3OW2 S;  3PE0 A;  2ED0 A;  3I9Q A;  3MKD A;  1EZZ B;  3QHS A;  4D6W A;  1GFC A;  2GQV A;  3S6W A;  1X2Q A;  2B86 A;  3WXM B;  3REA B;  5GAO l;  2YDL A;  1JEG A;  2X4J A;  1BU1 A;  3I35 A;  5HK0 A;  4QQG A;  3C0C A;  1YI2 A;  2CP0 A;  2LJ1 A;  2X3W D;  2M0Y A;  2EBP A;  2K5L A;  1WHG A;  1VQM T;  2ZAE A;  1RAC B;  2ZPG B;  1VQ6 A;  1JBM A;  4OGE A;  1AT1 B;  1ZUU A;  2DIL A;  1QCF A;  2YSQ A;  2CKK A;  2ESW A;  1JU5 C;  1QVG S;  2FHD A;  4HCC A;  2XK0 A;  5LJ5 d;  2K4Y A;  4J6W A;  4LN2 A;  2E4H A;  3FJP A;  1WFW A;  2KAF A;  3E1S A;  1PSF A;  2E64 A;  1U1T A;  2K2V A;  2KMT A;  2DMO A;  4PFO A;  2FB7 A;  3RKX A;  3OYN A;  5KYW B;  4A54 A;  1YWP A;  1SEM A;  2COY A;  1WJR A;  3E2U A;  2RNA A;  1FMW A;  2X4X A;  1PKS A;  4OB1 B;  4ANJ A;  1IHV A;  3SHW A;  3SWN B;  1FMV A;  1VIF A;  1YI2 T;  4Z88 A;  5GAN 8;  2I0N A;  1Z9Q A;  2RQU A;  2VVK A;  4HT8 A;  2RQT A;  2EYZ A;  2YUQ A;  1MGQ A;  4M75 F;  4B9X A;  2KXC A;  1QVF S;  1JQQ A;  3QG1 A;  2FO0 A;  4A53 A;  3X25 B;  3CC7 A;  3JCM d;  2XI9 A;  2YRC A;  3X26 B;  1Q7Y U;  3VYH B;  1YIJ A;  2DNU A;  4Y28 E;  1VQ5 A;  1YI2 Q;  3CCQ A;  4M7A E;  1VYV A;  2XD0 A;  2QYZ A;  4M75 G;  4XTY A;  4C8Q D;  4IUQ A;  1PCX A;  4RG8 A;  2DXB A;  2WSC E;  3RKW A;  3CPW S;  4Z02 A;  3OYC A;  4R55 A;  1UEC A;  1KHC A;  2VXE A;  1QWE A;  4B9W A;  3M54 A;  1G3T A;  3TRE A;  3EFR A;  2ZZD A;  3JCM c;  3DKM A;  4JZ3 A;  1YJN T;  5C0M A;  4NL3 A;  1NYF A;  4RTU A;  3CCR Q;  1QW1 A;  4CC7 A;  2JN0 A;  1VA7 A;  2J6F A;  3CC4 Q;  2QQS A;  4OMO A;  1YIT T;  3M4Y A;  4ZTJ A;  3CC2 A;  4AT1 B;  5D7U A;  2E3I A;  3OYM A;  3L2Q A;  4ZNX A;  4OF1 A;  3URG A;  4FL6 A;  2DBK A;  2OI3 A;  1JJ2 P;  5KH6 A;  1OX8 A;  2J05 A;  1E6H A;  2E6N A;  4TVR A;  2EYY A;  2LQ8 A;  2EAY A;  1YHQ A;  3OQ5 A;  3I55 Q;  5CKF A;  3KBG A;  2DA9 A;  3LX7 A;  1NYG A;  2FZK B;  3HFO A;  2W10 A;  4B6M A;  3JCM h;  2LNH B;  1RAF B;  4PJO D;  2DL5 A;  4RMO A;  1NLP C;  2Y90 A;  3VS5 A;  4NOY A;  1MHN A;  4M75 B;  1FXX A;  1TUG B;  2JT4 A;  2GCX A;  3PIP A;  2F2V A;  3J81 E;  1OOT A;  1N6A A;  2QTX A;  1OQK A;  2MWO A;  4M77 C;  3J80 E;  3VRZ A;  3LH0 A;  4J9B A;  2LCL A;  2CUD A;  3CXC A;  3HPW A;  4XTX A;  3EG0 A;  1E6G A;  2V1R A;  1VQP A;  2XIC A;  1HJD A;  1A0N B;  4FW1 A;  4M77 G;  4FYW B;  5I21 A;  4EMK C;  4LDY A;  1RL2 A;  4AFU C;  4KGV B;  1M3A A;  2IG0 A;  1VQ5 T;  3FJ5 A;  2AHJ B;  3G4S T;  5GAN 2;  1VQL Q;  3ZL7 C;  3OYG A;  1G5V A;  1X75 C;  4XAX B;  3CCJ T;  2PZ1 A;  2LQW A;  1BI3 A;  3RER A;  3TQ7 P;  2CH4 A;  2WSE E;  1QP3 A;  2ZPF B;  4C0G A;  3T9N A;  2M0O A;  4ZN1 A;  3DB4 A;  1YIT Q;  2YLC A;  1B34 A;  2L3S A;  4GBQ A;  3X20 B;  3FC3 A;  1WQW A;  1YBY A;  5D6W A;  1YHQ Q;  1M8V A;  1QVF A;  2MMP A;  2QAZ A;  5I2S A;  4EPC A;  5LJ5 e;  3QKJ A;  2EJ9 A;  2O4X B;  2OTJ Q;  2EYX A;  2P4R A;  4A63 B;  4X9C A;  1MMA A;  4F7U F;  4E6R A;  4QW2 A;  3EG9 A;  3DLM A;  3HRT A;  3TU4 K;  2J06 A;  2NWM A;  2ECZ A;  2QXF A;  5GAM g;  1Y07 A;  2MWP A;  2YT6 A;  1XQH A;  3A1P A;  1G3S A;  1XTD A;  3MET A;  3SB2 A;  2RK2 A;  2RA2 A;  1Q82 R;  2JZ2 A;  1WIE A;  4F16 A;  1NJI R;  2LMJ A;  4HCK A;  1IB8 A;  5KYN A;  4HA8 A;  4M75 C;  3V8L A;  2C0O A;  1V1C A;  2VAS A;  3CXC S;  2E10 A;  3QII A;  5DY9 A;  1VUB A;  2KYB A;  3A98 A;  3CBO A;  1HD3 A;  3V7C A;  1BK2 A;  4IIO A;  3OA6 A;  5KCO A;  2W0Z A;  2DAQ A;  1X27 A;  5GAN d;  4PKC C;  1VQM A;  3NGP A;  1HXD A;  2M51 A;  2P0P A;  4HKE A;  2M1H A;  3M56 A;  3JB9 H;  5CKH A;  3JCM V;  1B34 B;  2RI5 A;  4BE0 A;  2OAW A;  4FSS A;  3R6O A;  1ZSZ C;  2J6K A;  3X24 B;  2DZ9 A;  3PNW C;  1QLY A;  2EPD A;  5KE3 A;  1MMG A;  1UFF A;  1ZUY A;  5GAN h;  3CCU A;  4M7A F;  3I56 A;  2O9S A;  1JB0 E;  3JCM g;  2DX1 A;  3MPU B;  4M75 A;  3CD6 Q;  5C6S A;  1XNI A;  2V8J A;  1JO8 A;  1KK7 A;  4JZ4 A;  4AFS C;  2XDP A;  4M75 E;  1WLP B;  8AT1 B;  2PUO B;  2VUB A;  3CCM A;  3WVE B;  2OTL Q;  3L2Z A;  5FLX E;  4FM4 B;  1K0S A;  3G4S A;  1EIF A;  2IIM A;  1R8O B;  3CCL Q;  1W2B A;  2HQH A;  2DZC A;  3OY9 A;  1ZQ1 A;  2YXY A;  1H8K A;  2JW4 A;  1W2B S;  2FG0 A;  3L2W A;  4LD9 K;  4C92 F;  3CBP A;  1KQ1 A;  4RTV A;  3I55 A;  2R5M A;  4KBM B;  5LJ3 h; 
#chains in the Genus database with same CATH homology
 2K57 A;  3RMQ A;  3E9F A;  3OYB A;  1YJ9 T;  1VQ8 T;  5DLQ E;  3O8V A;  3CCM T;  4XU2 A;  4JLI A;  1O9S A;  2QI2 A;  1BIA A;  1M1G A;  1UGR B;  4DA4 A;  3SWN A;  3VUZ A;  1P92 A;  1QP2 A;  3HKS A;  1KG1 A;  1YCY A;  1YJW A;  3OYE A;  4BDY A;  3MP1 A;  2LC4 A;  5L8R E;  5GAN j;  1VQO T;  2CZ7 B;  1K73 C;  4IKF A;  3AHU A;  2DVE A;  2RHX A;  2XID A;  4FU6 A;  4Q5W A;  5A2Q E;  2C06 A;  2HAX A;  5KE2 A;  1X6O A;  4L5G A;  4NL2 A;  2R5A A;  4XU0 A;  4GY5 A;  1LNX A;  2DEQ A;  4J7I A;  2PVG B;  3L1A A;  1YIJ T;  2DTH A;  1I4K 1;  2RHU A;  1M90 C;  2RO0 A;  1WNL A;  1UGS B;  2K5F A;  3HP9 A;  4XTW A;  4II1 A;  4R56 A;  3I56 T;  2ZPB B;  3CC7 T;  1D3B A;  1NPR A;  4MZM A;  4IUP A;  4F7U B;  1VQN T;  4J7F A;  4M77 F;  3V7R A;  3LWI A;  4M7D F;  1AHJ B;  3QZ9 B;  2E1H A;  3QZ5 B;  2D9T A;  2Y4X A;  3OYF A;  3VUB A;  3OW2 S;  2EYQ A;  3E19 A;  3JB9 D;  1YHQ T;  2JTM A;  4JJN K;  3OMC A;  4M7D C;  3QHS A;  4OMF B;  5GAO m;  2OTJ A;  4D6W A;  2GQV A;  1N9R A;  1X01 A;  2LX9 A;  2VV5 A;  4M78 C;  5GAN f;  3S6W A;  4BI4 A;  2XG8 D;  3WXM B;  5GAO l;  1KC8 U;  3QDR B;  4M77 A;  1VQ4 A;  2X4J A;  5FRN A;  4JDS A;  3PMT A;  5HK0 A;  3CPF A;  4QQG A;  5A0D A;  1YI2 A;  1NE8 A;  2O01 E;  4MMK A;  2F69 A;  5GMK i;  3FDR A;  1I81 A;  3E9G A;  2A3L A;  3MEV A;  2K5L A;  4M7A D;  4KUI A;  1M90 U;  1WPY A;  4M78 G;  1YIT A;  5CKB A;  5FRO A;  4C0Z A;  4QQ6 A;  1VQM T;  2ZPI B;  3CEY A;  4RKU E;  5CCA A;  1NJI U;  4EMK A;  3RUX A;  2ZPG B;  1FX7 A;  1JBM A;  3NFC A;  4M77 E;  4OGE A;  5GAM f;  1VQ6 A;  1YJN A;  2DO3 A;  3MO8 A;  4C5I A;  4E7L A;  3A5Z B;  4FSX A;  1BKB A;  1UGP B;  3NTH A;  4PLL A;  4OB0 B;  1I8F A;  2L8D A;  3QYH B;  1VQL T;  3V8K A;  2XHC A;  2KSS A;  3QJY A;  3JCM Q;  2CKK A;  4JUV A;  2RJD A;  3PTA A;  3F70 A;  2F5K A;  3FB9 A;  4C5H A;  1WJS A;  4M7A G;  4JS5 A;  5GAM h;  2HNI A;  1QVG S;  2FHD A;  4LDU A;  4HCC A;  2XK0 A;  3QXE B;  4M78 B;  3H6Z A;  5HY6 A;  5LJ5 d;  2XKO C;  2K4Y A;  4FT2 A;  4J6W A;  2DJZ A;  4M7D B;  4C8Q E;  4OB3 B;  2FVU A;  2QQ9 A;  2RHY A;  3FJP A;  4LDV A;  4YTL A;  2RJC A;  1I5L A;  2KAF A;  3L2R A;  3E1S A;  4EDU A;  1PSF A;  4MZP A;  1U8R A;  2E64 A;  1U1T A;  1UB4 A;  1KHI A;  1M4Z A;  2K2V A;  2KMT A;  1D3B B;  1KQS A;  2FB7 A;  3RKX A;  1NPP A;  3OYN A;  1W4S A;  4RCC A;  2DXU A;  3SFM A;  1KD1 U;  1K8A U;  5LJ5 h;  1DJ7 B;  4JLG A;  4A54 A;  3OYK A;  1ZBX A;  5GAM e;  2QQB A;  1PSE A;  3GOX A;  3A8O B;  4C8Q G;  3CCS A;  3QSU A;  3A8L B;  1WJR A;  1M1K C;  2NLU A;  4A4K A;  2GFU A;  5LJ5 j;  4PNO A;  4M7D D;  4XTU A;  3BY7 A;  4C5G A;  5J39 A;  3UT1 A;  2EJF A;  2X4X A;  3MHX A;  4OB1 B;  4C0D B;  4DQ2 A;  2FL7 A;  2RJF A;  4C0F A;  4M7D G;  2CYZ B;  3SWN B;  1VIF A;  1V29 B;  4PJO A;  1YI2 T;  4M7A A;  4F7U E;  5GAN 8;  1VQK A;  4IUT A;  4C92 A;  2DIG A;  3FEO A;  1SSF A;  2DIQ A;  4XQ3 A;  4ZN3 A;  4HT8 A;  2LNV A;  3L42 A;  4XU3 A;  1MGQ A;  2ZCF B;  4M75 F;  4QQD A;  3VJP A;  4B9X A;  5A0L A;  1U1S A;  1K9M C;  1JJ2 A;  1QVF S;  5J3B A;  3OB9 A;  4EMH A;  5FU6 B;  4J6Y A;  2QQA A;  2CS7 A;  4J83 A;  4J5Y A;  3QG1 A;  5CKE A;  1VIE A;  3ZFJ A;  2GFA A;  5GMK e;  3M4G A;  4A53 A;  2RB6 A;  4BE1 A;  5HK3 A;  3X25 B;  3CC7 A;  3JCM d;  1N8R U;  3RKY A;  1H64 1;  5GAN 3;  2L3R A;  2XI9 A;  3MEA A;  4OP0 A;  3V8J A;  2LQK A;  2P4T A;  3X26 B;  3PIO A;  3UWN A;  3VYH B;  3G6E T;  4JRP A;  1YIJ A;  1Q7Y U;  2YLB A;  4Y28 E;  2DPP B;  3NTI A;  1VQ5 A;  4OGC A;  3GNF B;  2ZGW A;  3CCQ A;  2LDM A;  4M7A E;  3MP8 A;  2XD0 A;  4PJO E;  4M75 G;  4XTY A;  2M9U A;  4C8Q D;  3CC2 T;  4IUQ A;  3QPH A;  4FIB A;  4IUR A;  2RHI A;  4RG8 A;  2VC8 A;  3OYD A;  2DD5 A;  4DOV A;  2DXB A;  4BY6 B;  4M78 D;  2WSC E;  1Y71 A;  3RKW A;  1HK9 A;  5DLO A;  3CPW S;  4V2S A;  4Z02 A;  3OYC A;  2LT4 A;  4LD6 A;  4R55 A;  4MZT A;  4GLK A;  4L6V 5;  4PL6 A;  3FRN A;  4FT4 A;  4WF2 A;  1KHC A;  3GF5 A;  2VXE A;  4B9W A;  3WVD B;  4C92 G;  4QVC A;  3M54 A;  1BI2 A;  1G3T A;  5CQY A;  4XU1 A;  3VV0 A;  1M9S A;  2HQE A;  3C95 A;  3EFR A;  4J8O A;  4N0A A;  2ZZD A;  2QQR A;  3JCM c;  1WQ7 A;  3DKM A;  3TRE A;  4JRQ A;  1YJN T;  5C0M A;  4NL3 A;  1WGS A;  1VQ6 T;  2G3R A;  3I55 T;  1QW1 A;  3JB9 F;  2X4Y A;  2VGN A;  5CIU A;  4M7D E;  2JN0 A;  3GPL A;  3ER0 A;  3HSB A;  3HRU A;  1RI0 A;  2BIV A;  2QQS A;  2X35 A;  4ME7 A;  1YIT T;  3OS1 A;  5GAN 5;  3M4Y A;  5GAN 6;  1Q86 C;  4N4H A;  4XTV A;  2JUF A;  3G7Z A;  4ZTJ A;  3CC2 A;  2K5I A;  3G71 T;  3OYM A;  3OYJ A;  3CCQ T;  3MEW A;  4RG2 A;  4C8Q C;  3L2Q A;  4OVA A;  3HRS A;  4OF1 A;  2PU9 B;  1KQS S;  3URG A;  4KUD K;  3LWH A;  3G6E A;  3M9Q A;  4FL6 A;  4VUB A;  3M58 A;  3ZBD A;  2RD1 A;  1Q82 U;  1N27 A;  2M16 A;  4EMK B;  5KH6 A;  4C92 B;  3FIF A;  3M57 A;  5I2M A;  1KC8 C;  1UEB A;  3KUF A;  4C5E A;  2E6N A;  3CCR A;  4TVR A;  1YHQ A;  2LQ8 A;  2EAY A;  3QO3 A;  3OQ5 A;  2RJE A;  3BFM A;  3OS0 A;  3CCR T;  5CKF A;  3JRZ A;  2RHZ A;  3KBG A;  3PFS A;  4E47 A;  3Q1J A;  1Y96 B;  3LX7 A;  3PMI A;  2DTI A;  5FU7 B;  3JAM E;  3S3M A;  3P8B B;  2I2L A;  3HFO A;  2CGH A;  1VQK T;  3DB3 A;  3JCM h;  2D6F A;  4CRI A;  5CVI A;  3G71 A;  4PJO D;  3L2U A;  4MDX A;  3VKI A;  5EG2 A;  4RMO A;  3JCM f;  4BD3 A;  2Y90 A;  1UGQ B;  3M59 A;  4HCB A;  2R57 A;  1M1K U;  4NOY A;  1MHN A;  4M75 B;  5GAM j;  1FXX A;  2K3Y A;  2LRQ A;  1JRI A;  5IAY A;  1YJW T;  2MI6 A;  5GAO q;  4X34 A;  2GCX A;  2PQW A;  3PIP A;  2DXT A;  4KT0 E;  5CK9 A;  2KY9 A;  1G3Y A;  3J81 E;  2YHT A;  5KCH A;  1N6A A;  2DKG A;  2QTX A;  4OB2 B;  2F5T X;  4CI0 C;  3JCM b;  2JTF A;  4M7A C;  1VQ8 A;  4JS4 A;  2MWO A;  5CAI A;  4M77 C;  3J80 E;  1KQ2 A;  1H3Z A;  3LH0 A;  3A8H B;  4BE2 A;  3J7A F;  1M5Q 1;  4A4E A;  3JCM e;  3TCJ A;  3OYA A;  5FU7 C;  3CCV T;  2LCL A;  3HFN A;  4E7H A;  3ASK A;  4QVZ A;  4MDW A;  4PJO B;  3CXC A;  1N9S A;  2EQU A;  5M9O A;  4XTZ A;  3HPW A;  4XTX A;  2OTL T;  1VQP A;  2XIC A;  4LDX A;  1IZ6 A;  5GMK h;  1OZ2 A;  2CZ1 B;  2P0K A;  3M53 A;  4M77 G;  3SDZ A;  4C92 C;  5I21 A;  3JB9 I;  3CCE A;  4EMK C;  4LDY A;  3CC4 A;  1RL2 A;  4E7K A;  3VYG A;  2IG0 A;  4ZGD B;  1VQ5 T;  3QYG B;  1VQ9 A;  4M78 E;  2AHJ B;  3TEE A;  2R58 A;  4ELZ C;  2L89 A;  3G4S T;  4ZTF A;  3QUI A;  2MF2 A;  5GAN 2;  4JRI A;  4C8Q B;  4BI3 A;  2RI2 A;  3PT9 A;  3ZEH A;  3JCM P;  4RCB A;  3OYG A;  3QJ6 A;  5D6Y A;  3BW1 A;  4N4G A;  4M78 F;  1X75 C;  4XAX B;  1O75 A;  1G5V A;  3CCJ T;  2HD0 A;  5A0G A;  3OYH A;  3P8D A;  5CO7 A;  1BI3 A;  1BIB A;  5GAO p;  5GAO r;  3CD6 T;  1VQL A;  3RER A;  3M55 A;  5IT9 E;  5LJ5 g;  5LJ3 j;  4JRK A;  1VQ7 T;  5GAM d;  1JJ2 S;  2D0Q B;  2WSE E;  4C8Q F;  5LJ5 f;  2E41 A;  2JVV A;  2ZPF B;  1QP3 A;  2E70 A;  1TH7 A;  2IVW A;  2LCC A;  3C12 A;  3GNG A;  1LJO A;  3T9N A;  2M0O A;  4Y91 A;  4C0G A;  4ZN1 A;  2LVM A;  3DB4 A;  3PGG A;  3OBW A;  4M78 A;  5J26 A;  2HBP A;  3JCM X;  3KXT A;  4N0A C;  2ZPH B;  2YLC A;  1B34 A;  4A4F A;  2VXF A;  4F7U A;  3HHT B;  3A8M B;  3X20 B;  2B8A A;  4BI8 B;  3RIR A;  3FC3 A;  1K9M U;  1WQW A;  3EFS A;  1K8A C;  1YBY A;  5D6W A;  4BY6 C;  2WSF E;  1Q81 C;  5LJ3 d;  3GP8 A;  1QVF A;  1M8V A;  4UC4 A;  2PVD B;  2EQK A;  2MMP A;  3LW5 E;  3CCS T;  2RM4 A;  5I2S A;  2RK1 A;  4L59 A;  4EPC A;  5LJ5 e;  1KD1 C;  2V8K A;  2EJ9 A;  2O4X B;  3QKJ A;  5GMK m;  5DM7 R;  2QEX A;  4M75 D;  4ATO A;  2OTJ T;  4BB7 A;  3FLG A;  2YRV A;  3S3O A;  3CMA T;  3OS2 A;  2JNG A;  1BI1 A;  3CPW A;  1Q81 U;  4X9C A;  4F7U F;  2QEX T;  1S72 A;  4QW2 A;  3X28 B;  2DTO A;  2KK4 A;  3DLM A;  3HL8 A;  2EIF A;  3HRT A;  4ZGJ B;  3H8Z A;  5D6X A;  5GAN 7;  4HT9 A;  4E7J A;  4E7I A;  3TU4 K;  1OYX A;  4PJO C;  4C8Q A;  4MML A;  1ZHI A;  3LGL A;  3JCM W;  1Q82 C;  3CCL T;  2Y4Y A;  1Y7X A;  2EKO A;  2QXF A;  5GAM g;  4A4G A;  2ZPE B;  4M77 B;  3CME A;  1Y07 A;  2MWP A;  1XQH A;  1QVP A;  4M7A B;  1G3S A;  1XTD A;  2OAU A;  1OZ3 A;  2DK3 A;  3MET A;  3SB2 A;  2RK2 A;  5HKC A;  2RA2 A;  3SWN C;  2JZ2 A;  4ELY C;  3BDL A;  2E5Q A;  4C0D C;  5FRM A;  3CD6 A;  2XU8 A;  4BUG A;  2HQX A;  3CCJ A;  4HA8 A;  4M75 C;  5LJ3 e;  3N5B B;  3V8L A;  2EQJ A;  1YJ9 A;  1WJQ A;  1NJI C;  3CXC S;  4QVD A;  2E10 A;  3QBY A;  3QII A;  5LL6 S;  5DY9 A;  1VUB A;  2GF7 A;  3CBO A;  1XOV A;  3GLX A;  3V7C A;  3OA6 A;  1N8R C;  5CR2 A;  5KCO A;  3JSC A;  3OSV A;  2DAQ A;  2QDY B;  4IUU A;  5GAN d;  3P8H A;  4PKC C;  5IN1 A;  2QA4 T;  1VQM A;  2XDD A;  3CME T;  3OMG A;  1HXD A;  4P5N A;  2BUD A;  2K3X A;  3CCL A;  2P0P A;  4HKE A;  4PLI A;  2M1H A;  3OSS C;  3M56 A;  1VQP T;  3JB9 H;  1LOJ A;  5CKH A;  2LT1 A;  3JCM V;  1B34 B;  1GXI E;  2RI5 A;  1VQ4 T;  1G3W A;  4BE0 A;  4BDZ A;  4DOW A;  3R6O A;  4J6X A;  1S72 T;  3NTK A;  2MAM A;  4N4I A;  3X24 B;  3CMA A;  4O6J A;  2DZ9 A;  3PNW C;  3DLL A;  3C4S A;  5KE3 A;  4C92 D;  2O4X A;  4C92 E;  5GAN h;  3OYY A;  2WAC A;  3OW2 A;  5GMK j;  1VQN A;  3CCU A;  4X9D A;  1BYM A;  4M7A F;  3SD4 A;  4A4H A;  2LTO A;  3I56 A;  3EAE A;  3UDC A;  1JB0 E;  3RMS A;  3JCM g;  3JCM J;  4M75 A;  2DD4 A;  2PUK B;  5LJ3 f;  1BI0 A;  1OI1 A;  2V8I A;  1XNI A;  5CQX A;  2V8J A;  5C6S A;  2PVO B;  3INZ A;  3MP6 A;  4BAC A;  3S3N A;  2E12 A;  5CKD A;  1K73 U;  5GAN e;  3MEU A;  2XDP A;  2E6Z A;  4LDW A;  2CZ6 B;  3C94 A;  1VQO A;  4XK8 E;  5LJ3 g;  3M5A A;  3GIB A;  3OS5 A;  2KVQ G;  1Y96 A;  4IUV A;  2EQM A;  2FYK A;  4M75 E;  4NS5 A;  1VQ7 A;  2A7Y A;  3BDU A;  4M77 D;  3CCU T;  1Q86 U;  2KQW A;  3VU3 C;  2E65 A;  2EWN A;  2DXC A;  2L5Q A;  2PUO B;  2P0Q A;  2VUB A;  2KDS A;  4O5V A;  3CCM A;  3UPU A;  2XDB A;  3WVE B;  3JB9 J;  3ME9 A;  3OYI A;  3L2Z A;  4ZGE B;  5FLX E;  3A8G B;  2EFI A;  2RH2 A;  1M1F A;  4FM4 B;  5GAN g;  3MCA B;  4F7U G;  2VYT A;  1NZ9 A;  3V7S A;  3G4S A;  1VQ9 T;  1FWZ A;  1EIF A;  2EJG A;  5GMK l;  4KUL A;  2BKD N;  1IRE B;  3LYI A;  4HCZ A;  1R8O B;  3JB9 G;  3CC4 T;  2VGM A;  3LGF A;  3OBY A;  3OYL A;  1W2B A;  3CCE T;  2CZ0 B;  2DZC A;  2RI3 A;  3OY9 A;  3CBM A;  1QVG A;  1ZQ1 A;  2H3J A;  4EMG A;  5GAO n;  1W2B S;  2OTL A;  5FU6 C;  3RES A;  3L2W A;  5GAN 4;  4LD9 K;  4C92 F;  3L2V A;  2QA4 A;  3CBP A;  1KQ1 A;  4M7D A;  5AYF A;  2JOY A;  3I55 A;  2R5M A;  2X4W A;  4PJO F;  3CCV A;  3LLR A;  4PJO G;  4KBM B;  5LJ3 h;  1Q7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...