3MHXA

Crystal structure of stenotrophomonas maltophilia feoa complexed with zinc: a unique procaryotic sh3 domain protein possibly acting as a bacterial ferrous iron transport activating factor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
b'AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVGFTRFALRISEAKRVVVDAASQERRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferrous iron transport protein A
publication title Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport activating factor
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Metal transport
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mhxA00
1QVPA 1BI0A 1P92A 4O6JA 1G3SA 2K5FA 1G3YA 3HRUA 3GLXA 1QW1A 2K5LA 3HRTA 2H3JA 1FX7A 1G3WA 2K5IA 4O5VA 1U8RA 1G3TA 2QQAA 1BI2A 2QQ9A 2QQBA 3MHXA 5CVIA 2K4YA 2LX9A 1FWZA 3HRSA 1BYMA 3E19A 2GCXA 1BI3A 1BI1A
chains in the Genus database with same CATH superfamily
3CCRQ 4LDUA 1WDXA 4M75C 1HSQA 1M2VB 5KYXA 4J6XA 3L2VA 1VQ4A 2KRSA 2E3HA 1YI2T 3EH1A 1I1JA 2W0ZA 5J39A 2RF0A 4BY6B 2EJFA 2QG9B 1QWFA 4HCCA 3EG9B 4N0AC 5AYFA 3RMSA 4Q5WA 1BBZA 1UJ0A 3KXTA 3E2UA 3OYFA 2HBWA 5KYWB 1WGSA 1XTDA 5KE2A 2M51A 3CCLQ 3VUBA 2O2OA 8AT1B 3CCQQ 3CC4A 1Y7XA 1YJ9T 2EFIA 1D0YA 4HXJA 4J9DA 4LNPA 3X24B 2B8AA 1CKBA 2QAZA 1N27A 4BE0A 1QP2A 4EMHA 2HKQB 3EFRA 3OB9A 1YI2Q 1WXTA 2J06A 3RKXA 2AZSA 4QQDA 1MV0B 1Q82R 1G8XA 3R6OA 1YCSB 2BZ8A 4CRIA 2F2WA 2OAUA 1NLPC 3G6EA 2EGAA 1YFNA 5KCOA 3OYAA 1TUDA 3F70A 2QQSA 1YJ9Q 5CR2A 2DERA 5CKFA 1FWZA 3G4ST 3A5ZB 3EG0A 1M3CA 3NFCA 2AIRB 3MCAB 4LD6A 1RUWA 1KIKA 4MZPA 4DBHA 3RIRA 4XQ3A 5M9OA 3VS4A 3M4GA 1SHGA 2XG8D 1G83A 1K0XA 3C12A 3P8DA 4HCBA 1WFWA 3LLRA 1OPLA 4PJOF 3OW2A 3M0SA 1W70A 1K4US 4OMPA 4BACA 2Z0WA 1NJIC 4HA8A 4OMMA 3META 3E9GA 3FJPA 2JJ9A 4K11A 2EW3A 4BD3A 3QO3A 1BI0A 1JJ2A 1YN8A 1YNZA 3CMAT 2R5AA 1WNLA 3G4SQ 2K5LA 4JZ4A 2JXBA 2DA9A 1SSFA 3M9QA 4RTWA 5CKEA 2DETA 1ZBJA 1SPKA 3WXMB 2RPNA 2DKGA 1Y0MA 5HK0A 1X43A 4VUBA 2QASA 2QEXT 3J81E 3OSSC 4F7UA 3IQLA 1RL2A 3CCET 1N8RR 1MMAA 1VQKA 3PNWC 4RTUA 1G3SA 1VQ9T 2F2XA 3VS5A 3CCVA 1ABQA 1I5OB 1KSWA 2L5QA 1G5VA 3G71A 4L5GA 4M7AE 3CMAQ 4Z89A 2LT4A 1YJWQ 5I2MA 2HZYA 5CQYA 1O75A 1ZSZA 4MMKA 4M7DG 3C4SA 2KEAA 4BUGA 4J8OA 2K6DA 4A4EA 2E5KA 4J9GA 4P5NA 1ZUUA 4FL6A 4FSSA 1M1KU 1X6GA 2QEXQ 2L3QA 3CCEQ 4O5VA 2DJZA 3GOXA 4PJOB 1KQSA 2QQBA 2DD5A 3C94A 4F16A 1J3TA 5FW9A 3A8OB 3SDZA 1VQLT 1GFDA 2A08A 1SRLA 2K3XA 2D8JA 2RQWA 4M7AF 4FT2A 5CK9A 2ZAEA 4M78G 4A4GA 2LCSA 2W10A 2ED0A 3A8GB 4OP0A 3M0RA 1XOVA 5CKHA 1WJQA 1B3QA 1UG1A 2CREA 4XTUA 2LT1A 2BUDA 2KXCA 2LX9A 4KRTA 4NS5A 2FZCB 3JCMX 2HQHA 4M7DD 4XTXA 2NUPB 3CBMA 1K8AC 1QLYA 3JCMf 3JCMP 3CPWA 3VS7A 1EFNA 4M77B 3KUFA 3CCJT 2ABLA 4CC4B 4ANJA 2KDSA 1VQLQ 3EG3A 1VOMA 4C92A 2O4XB 1GL5A 5GAN2 1PKSA 4XU3A 1NZ9A 4GLKA 1RLPC 3A8HB 5GANf 2DAQA 1DJ7B 1M27C 3BE3A 2FYKA 2E64A 2LQWA 3SFMA 3HRSA 1K9AA 1Y71A 3M4YA 3NHNA 2K2MA 4M78D 4WF2A 3DB3A 2EJ9A 1UTIA 5FU6C 2EKHA 3JB9G 3CCJQ 2BE7D 4C8QA 1IHVA 2Y4XA 2X51A 5HY6A 4PJOC 4LDVA 4AMCA 2LQNA 3GIBA 3HSBA 5LJ3h 2CP5A 2RHUA 1VYTA 2KSSA 2A0FB 1RADB 1VQ4T 4KBMB 3MP6A 4C5EA 2NUTA 1UGPB 1D1CA 1YIJQ 3EFSA 2QK0A 2CT3A 3H0IA 5IT9E 4XTYA 5A0LA 2A37A 1D0XA 3CC4T 2CZ7B 2DEUA 1B34A 5IH2A 3HL8A 2VUBA 3DB4A 1NG2A 4ZN3A 3L2ZA 3V7RA 3JB9D 8ATCB 1VQMA 1VQ4Q 4XU1A 1KQ1A 5GMKi 1BB9A 3TU4K 3QSUA 2F5KA 2EYWA 1KD1U 1TUGB 4KGXB 3HRUA 4E2FB 1X2KA 2QGFB 2DMOA 3G6ET 5GAMd 2DTHA 3CC4Q 1IB8A 1K73R 1AWOA 2EBPA 1A0NB 5CCAA 5IN1A 2BE9B 1QVPA 3I5RA 5GANj 1TH7A 4GBQA 3OYBA 5C0MA 1UGSB 2RJEA 3M54A 2LCCA 4HKEA 3X28B 1M2VA 2ZPEB 2MYSA 4M7AC 2D8HA 1K1ZA 1PM3A 2RQRA 4XU0A 1RAEB 3TREA 2DEQA 3GF5A 2JMAA 3MEUA 3G6EQ 3EG9A 2ENMA 1JXMA 2IPOB 3OBYA 4OMFB 2CZ0B 2XMFA 4YTLA 4PLIA 2EQMA 4HVUA 3JCMV 2ZPFB 2CT4A 2RJFA 4M7DE 5D6YA 3CXCA 3TQ7P 4RTXA 3UA7A 3OY9A 1OEBA 2V8IA 4DA4A 5GJVB 4KH1B 2FRWA 2QDLA 1UB4A 2VGMA 4N4GA 4JPBW 3OYNA 2XD0A 2KI7A 5LJ5e 1VQKT 3CBOA 2YRDA 2DILA 3FB9A 4JRIA 1H3ZA 4IIMA 4A63B 2QYZA 3I55A 4A4HA 2HKNA 1K9MR 1Z9QA 3S3NA 4PJMA 1NE8A 2RHZA 3CCVT 4GY5A 4M78E 3G71T 4F17A 3LW5E 2RQTA 2LQKA 4M7DF 3V7CA 2H3EB 2DXTA 4OMOA 2RB6A 5FWBA 5IXFA 1W2BS 5D7UA 1Q86U 4LDWA 7AT1B 3R6NA 2KROA 5L8RE 1VQKQ 5J26A 4DOWA 2CH4A 2YDLA 5LJ5h 4E7SA 2P0QA 4RTZA 2LTOA 3M0PA 1OULA 1UE9A 5C6SA 2JTFA 4IUPA 1WXBA 1U1SA 3CCVQ 5IHNA 4M78F 3G71Q 2HQEA 2GBQA 2C0TA 3SB2A 2DZCA 2FZGB 1NYFA 1B07A 5CKBA 2ED1A 1K9MC 1QVFS 4B6MA 1XNIA 5FU7C 4M75B 1RAAB 1U06A 1W1FA 9ATCB 3H6ZA 3PT9A 2QA4A 2QQRA 5GAMe 2L89A 5LJ5g 4FYXB 3BY7A 1KJWA 2C0OA 3TVTA 3ZBDA 2OTLA 2IG0A 3GNGA 2FPDA 1OX9A 3CXCP 2E12A 5FRMA 3UA6A 2X3XD 1ARKA 3CC2A 2O31A 3JCMW 5DM7R 1LJOA 1X69A 1NYGA 2A28A 3VYHB 2CSIA 4PKCC 1QCNA 3D7SB 2C06A 3JB9F 1T3SA 3OYYA 2K7AA 3VS0A 1OV3A 5GAN8 1YCYA 3HFNA 1FMVA 3RESA 4PJOA 4JS5A 5KE3A 2OTJA 3TCJA 2X9HA 3CQTA 4F14A 2V8KA 2BKDN 1SRMA 3JAME 4X34A 3RKWA 2DF6A 4E7IA 5GAN3 2EQIA 3VYGA 3MPUB 5L23A 4JJNK 4ZGJB 2CZ1B 3OYJA 3GBQA 2JM8A 2KT8A 3SWNC 3QUIA 4BI8B 2GCXA 4JZ3A 2JT4A 2AKLA 2PVDB 3M57A 2G6FX 3V8KA 3OYEA 2NUPA 1XJWB 4ZTJA 4M77A 1G2BA 2KGTA 1QVGS 1KC8U 5GAMg 1T0JA 1WA7A 4BI4A 2O4XA 1VQMT 4QT7A 4F7UG 4BE2A 3OA6A 2LVMA 3MEAA 2K2VA 2RK1A 1WQWA 1MV3A 4M7DC 1JQQA 4PL6A 5CKDA 1ZA1B 5I22A 4OGCA 2PU9B 1QCFA 2E70A 1NJIR 4ZNXA 2JTMA 3P8HA 1T3LA 3CCSA 4J7IA 3QBYA 3MHXA 2LNVA 5GAOm 5GAMf 4KT0E 1N5ZA 4AG2C 1UDLA 4Z8AA 1OX8A 2RI3A 5GAN7 1VQMQ 2C0IA 4KH0B 4JLIA 5KYUB 4M78C 3CCMA 2V8JA 2BZXA 3FDRA 2DFUA 5LJ3d 2H8HA 2VWFA 2CSQA 1AWXA 2EYZA 2RI2A 4BB7A 1N9RA 2ATCB 1LVKA 4FT4A 1K73U 2K5FA 2I0NA 1OQKA 1WHJA 4F04B 3WVEB 1WPYA 1MUZA 3LYIA 2EYQA 2QQAA 2DNUA 1WHMA 1KD1C 2VYTA 1UGQB 3MP1A 2K4YA 4PFPA 2KRNA 1NM7A 4GLMA 5KYNA 1U1TA 2HBPA 3PMTA 3REBB 1Y96B 4OMLA 2J6KA 3I55T 3M56A 4C92G 2COZA 1ZLMA 2F5TX 2JN0A 4HCKA 4PJLA 4QVZA 4NOYA 4EPCA 3JRZA 3EFOB 2DL7A 4CC3A 2F2VA 1FMWA 1WYXA 2X4WA 2WSFE 3INZA 5GMKj 2K3BA 4A4KA 1D0ZA 2XHCA 2DIQA 4FW2A 3PFSA 2JTEA 2RJCA 3QZ9B 4C8QG 1OOTA 3UATA 1VQNA 3I55Q 4PFOA 1K8AR 2PNIA 1C0MA 2GTJA 3ZFJA 5FU6B 5AT1B 3WVDB 2DYBA 2HMAA 2GTOA 2PVOB 4IIOA 4C92D 3PIOA 2DO3A 4A54A 1YWOA 5D6XA 1Q81R 2MPXC 3OYHA 2YT6A 2BTTA 4HVWA 2KXDA 1QP3A 4E7KA 3OMGA 3H41A 2DLPA 4LUEA 1VQOA 1VQ9Q 4KGVB 1MNEA 1UJYA 4IUUA 5HK3A 1OU8A 3DLLA 3CPFA 4OB1B 4A4FA 2QA4T 2RQUA 4EMKC 2JS0A 2OTLT 2E10A 2M02A 5LL6S 4Y28E 4C8QD 2KAFA 4CC7A 1M4ZA 1M90C 1I0CA 3L42A 2VV5A 3CC2T 2VC8A 3OW2P 4RTYA 2KT1A 1M5Q1 1D1BA 1Q86C 1S72T 1Q7YR 2LP5A 3VU3C 2GNCA 1PRLC 2O88A 3SEMA 3O8VA 2CUDA 1JJ2P 3CD6A 2FHDA 5D6WA 5LJ3e 3ZEHA 3CEYA 4ZGDB 2QA4Q 2R58A 1FYNA 2CP7A 1Q81C 5IHIA 2OTLQ 1RAGB 2OTJT 2KVQG 2RHIA 3PTAA 1SSHA 4F7UE 1IZ6A 3GNFB 4XTZA 3CC2Q 1RABB 3LX7A 4JJCA 2EIFA 3JCMJ 2M0YA 5LJ5d 2LCLA 2QI2A 3H8ZA 5GAOl 1R0CB 2EGEA 1S72Q 1EZZB 1D09B 4N4HA 5CQXA 5GAOp 1K0SA 4NL3A 2QTVA 2WSEE 2JW4A 1W6XA 2DIGA 4M75A 1SEMA 2FEIA 4WCIA 1SHFA 4M7AB 2D6FA 1Q7YC 3L2WA 2OTJQ 2CH4W 3OS0A 1H3HA 2NWMA 1VQ5A 3OS2A 2VKNA 3S6WA 1M2OA 4Y91A 4N0AA 1HYOA 2QGGA 3PIPA 1KQSP 2DXCA 1K76A 1X01A 3OS1A 3ZL7C 3CBPA 4XTWA 1WJSA 1ZBXA 3KBGA 1PCXA 1I07A 2J05A 3LH5A 4RCBA 2MWOA 2L3RA 3A8LB 2YUPA 5ECAA 3EAEA 1PSFA 1BKBA 2VGNA 2MIOA 1ZUYA 2F1LA 1XQHA 3PVQA 3CCST 4LD9K 2RA2A 1B7TA 2GFAA 1UEBA 2WACA 2FVUA 2P0PA 5LJ3g 1KG1A 1ZA2B 3V7SA 1S1NA 2D0QB 5FWCA 3HPWA 1QKXA 1H641 4JUVA 1H8KA 2DRKA 2J7IA 2M16A 1IO6A 2VB6A 3CPWP 1IHWA 1SF9A 3CCMT 2O9SA 2JM9A 2YRCA 3PMIA 4MDWA 4C92E 2GQVA 3OYCA 1QMCA 4TVRA 1UFFA 2A7YA 2DPPB 3I35A 1OU9A 1TS9A 1BIBA 3A98A 1NJIU 3KFVA 5LJ3f 3CCSQ 1KFZA 4AFQC 2DRMA 3BFMA 4UC4A 1N9SA 3GPLA 1TOVA 2YHTA 4LN2A 3I9QA 2K79A 2MF2A 1CKAA 4OB2B 3O5ZA 1E6HA 1QCOA 2FL7A 4C5GA 3HKSA 4C5IA 4D6WA 2LDMA 1Q82U 1VQ7A 4QQ6A 3CCMQ 2ROTA 4C8QE 1AZEA 4RG8A 2DTOA 2M1HA 1P92A 1YBYA 4J9FA 1V1CA 1W2BA 1YJNA 3LGFA 4JRQA 3EHRA 4XU2A 2KYMA 4ATOA 5FU7B 2MMPA 3TEEA 2HDAA 2CDTA 2PUKB 2RN8A 2LNHB 2E3IA 2HSEB 1VQ6A 3SD4A 4ESRA 5GAOn 3OSVA 2R5MA 1PRMC 4EDUA 1GBQA 4FM4B 4IUVA 1F1BB 2AKKA 3VS2A 1V76A 2JS2A 2DL5A 2DBMA 1YITA 2AZVA 4R0KA 3GLXA 3QXEB 4C8QF 1I81A 4X9DA 1U5SA 2K57A 2V1QA 1PD1A 4LE9A 4AFZC 5KYUA 1VQNT 2L8DA 4LUDA 4ORZA 4PJOG 3H0HA 1QVFA 3OYIA 1TU0B 2YLBA 1RAFB 3CCUA 1X75C 4R55A 2DJQA 1IREB 4J7FA 4PFZA 3M59A 2QTXA 1YJWA 1WLPB 2LMJA 2DVEA 2KBTA 2XIDA 5CO7A 4IKFA 2KY9A 1N8RU 2DM1A 3EG1A 3PE0A 2YUNA 1M1KR 1ACMB 2JOYA 5CVIA 2QEXA 2OAWA 4E7LA 1VQOT 1NPRA 1VQNQ 2YLCA 4MMLA 4EMKA 1Y96A 4E47A 1K8AU 4M77G 1G3YA 2OI3A 3M53A 3SWNB 5LJ3j 3QIIA 4ZN1A 4PJOD 2RI5A 1KQ2A 2EGCA 1ZSZC 4FYYB 3UPUA 4JDSA 3VS3A 3EFOA 3FEOA 3M0TA 2K3YA 1TUCA 4KGZB 1TTHB 1RI9A 2HQXA 2E41A 2LC4A 4J83A 4RTVA 3CD6T 1W2BP 2M9UA 1BK2A 3OYLA 2E4HA 1HK9A 1RLQC 2V1RA 2YWWA 1BI2A 2RH2A 4BI3A 1UGRB 1NBEB 1YWPA 4M7DB 1BYMA 5GJWB 4OMNA 4ELYC 1M1KC 2VVKA 4R56A 2CP2A 2L0AA 2PVGB 1U3OA 3QKJA 4M77D 3JB9J 1VUBA 2J6FA 2RNAA 4PNOA 1OZ2A 4FU6A 2L3PA 2D1XA 2EQJA 2VXEA 2RM4A 2DXUA 2OJ2A 1KK7A 1QVGA 5LJ5f 1Y07A 5GMKh 2D9TA 1UECA 2DTIA 4D8KA 2ZCFB 5FLXE 2QXFA 2Y90A 4M78B 3DKMA 3I56A 1VQ8A 5EG2A 2DZ9A 3QYHB 4LDXA 2CUBA 4DEYA 2GF7A 1VQ5T 1MMNA 2YUOA 1NPPA 3C95A 5I11A 4B9WA 5DLQE 1WI7A 4QKUA 4MDXA 4WTOB 2PTKA 1M8VA 4IUTA 2GQIA 2E6ZA 1YIJA 2HCKA 4OGEA 4LXCA 3CC7A 4C0DC 3TSWA 1ZSGA 4C8QC 2ZPHB 4Z02A 1VQ5Q 1AD5A 3JV3A 2E6NA 2RD1A 4KUDK 2OX7A 4FW1A 4J9HA 1RAHB 3UF4A 1KD1R 4ZTFA 3LWIA 3QDFA 3M0QA 3NMZC 3MO8A 3VJPA 2VASA 2XDPA 2O9VA 1TWBA 4AT1B 1KHCA 1MHNA 4PJNA 4FYWB 2X4XA 2IIMA 3VS6A 3X25B 2X4YA 4DOVA 3PGGA 4EMGA 3HTRA 2EVRA 3NGPA 2FPFA 1Q95G 2PQWA 1WZOA 4M7AA 1RAIB 3FC3A 1OZ3A 2R57A 1X6OA 2EAYA 2LRQA 1WXUA 1VQ7T 1QVGP 2KNBB 3AHUA 3NTIA 1QWEA 1BI1A 4RTTA 1BU1A 4PJOE 1D3BB 1PG5B 5LJ5j 4O6JA 1YHQA 3CMEA 1AT1B 3E1SA 1YJNT 1RACB 5GAOq 1OPKA 1X27A 1IRXA 1IXDA 4KUIA 2XDDA 5I2SA 1VQPA 2EPDA 3M55A 1VQ6T 3RMQA 4OF1A 2X3WD 4EMKB 3JSCA 1PKTA 4BE1A 1M30A 3V8LA 1VQ7Q 1YITT 4C0GA 1VIEA 3QPHA 3JCMe 2ZGWA 3HRTA 2EYXA 1G3WA 2RK2A 2Y4YA 1GRIA 1BCOA 4M77E 5KCHA 2GGRA 2ZZDA 1YJNQ 3MKDA 1PNJA 4BY6C 4ME7A 5HKCA 2B86A 1JXOA 3CCUT 5GANe 2V26A 3QWXX 2YUQA 1VA7A 4C5HA 2L3SA 2KQWA 2KYBA 3EGXB 1YJWT 1VQ6Q 1M90R 1TSFA 1WHHA 1LCKA 2DXBA 1Q82C 4BDYA 2MK5A 1I8FA 1PD0A 1Q86R 3FJ5A 1D1AA 1YITQ 2P0KA 5KH6A 2DE0X 1C1AA 2FO0A 1K9MU 4M75G 3JCMh 4M77F 1PHTA 1T0HA 2E1HA 4LDYA 2DX1A 5GAMj 2BZYA 4E7HA 3OW2S 3CCUQ 2DD4A 1TG0A 3QYGB 5GANh 2D0NA 1ZQ1A 3HFOA 2LJ0A 2RMOA 3VV0A 5KYYB 4E7ZA 1M9SA 1JJ2S 2DL4A 1LNXA 2XU8A 1AOJA 5GAOr 2ECZA 1WHGA 5HCKA 3EGDB 4JS4A 2JZ2A 4DBFA 2P4RA 2E5QA 3M58A 4NL2A 4FSXA 3LGLA 3JCMg 5CAIA 3JCMc 3REAB 2LJ3A 1MGQA 1MMGA 4M75D 5DLOA 1VYVA 2CYZB 2P4TA 2CS7A 4J6YA 2X35A 2AT1B 4E7JA 1N8RC 5GANg 1EIFA 3VS1A 2JNGA 1QW1A 4L6V5 5IXBA 3BDLA 2H3JA 1OI1A 4M4ZA 4DBRA 2EKOA 2CP0A 2NLUA 4PK4A 5IAYA 1LOJA 1M1GA 2CGHA 2DBKA 4JRPA 3UWNA 1Z9ZA 3BDUA 2G3RA 5KYXB 1SG5A 1WHLA 3RDVA 2EJGA 4CC2A 3I56T 1VQ8T 3MEVA 2MI6A 3OYDA 4X9CA 4JJDA 2KR3A 3N5BB 1KQSS 2DK3A 3EGUA 2XDBA 2KRMA 1PWTA 3RNJA 3SWNA 2ZPIB 4J6WA 2COYA 2YSQA 1GCPA 3E19A 1ZX6A 1FXXA 4J9IA 1YIJT 1W4SA 1CSKA 3SHWA 2ROLA 1GFCA 3EHQA 3CC7T 3M5AA 4J9EA 5FRNA 1NLOC 3MEWA 2MOXA 4OVAA 2O01E 4EIKA 2CP3A 3CCRA 3QG1A 4F7UF 1QQJA 2CP6A 3I56Q 1VQ8Q 2MWPA 1E6GA 3DLMA 3I5SA 4E6RA 3BW1A 3RKYA 1KC8R 3CPWS 1M3AA 1VYUA 2JMCA 3NTHA 4M7DA 1NEBA 3ME9A 3QHSA 1GCQC 3L2RA 2ESWA 2PUOB 3EH2A 5IHKA 4J9CA 2A36A 3ER0A 1U8RA 2LZ6B 2XK0A 5EC7A 3CCLA 3CCQA 2PZ1A 3J7AF 2K9GA 1WX6A 3CC7Q 1X6BA 2A3LA 4A53A 1I4K1 3QJYA 4MZTA 1GBRA 1R77A 3FLGA 5GAN5 4DEXA 2FB7A 3G1JA 2CZ6B 3GP8A 2SEMA 2ZPGB 3THKA 4II1A 4M78A 1YI2A 2RHYA 4M77C 3OS5A 1JU5C 4JLGA 2HD0A 3ULRB 1TXQA 3URGA 2VXFA 1JO8A 3JCMb 3NPFA 4CI0C 5DY9A 2DL8A 3V8JA 1BIAA 2NUZA 2I2LA 3JB9I 4ELZC 3OYGA 2LX7A 1YHQT 3CMET 3MJXA 1AWWA 1AHJB 1YJ9A 4DBQA 1KC8C 4HT8A 2AK5A 2JUFA 1WIEA 3HP9A 3RBBB 3QZ5B 2HL5C 2DYIA 1UGVA 2HEQA 3PVLA 1VQPT 4F7UB 1M3BA 4BDZA 3P8BB 1VIFA 4Y92A 3J80E 1E7OA 4JRKA 1AWJA 1PSEA 1MNDA 2P84A 4C92F 4MZMA 4RG2A 4XK8E 4M75E 2FPEA 1R0BG 4OB0B 5GMKm 1RI0A 1UHFA 3RR6A 3VRYA 2IVWA 4QVDA 1YHQQ 3CMEQ 1ZSZB 3RUXA 1FMKA 2XICA 1ZHIA 5GAN4 2J6OA 4D8DA 2NYSA 3FRNA 3RERA 2YXYA 3G4SA 3JB9H 1BI3A 1VQPQ 1ZUKA 4PJJA 4RUGA 4J9BA 4FIBA 5KYWA 3TSZA 5GAN6 3L1AA 2AHJB 1KHIA 3NTKA 3L2QA 3QJ6A 3EG2A 2K5IA 4C0FA 3ASKA 4J5YA 1M1FA 3C0CA 1JBMA 3QDRB 2F69A 2LJ1A 4HCZA 5CIUA 4ZGEB 1IGUA 4M75F 1X2QA 3QWYA 2HL3A 1K73C 1QKWA 2KE9A 3VKIA 4DQ2A 1WJRA 2YRVA 1HXDA 3CMAA 6AT1B 1D3BA 4RKUE 3JCMQ 1N6AA 1PC0A 1H92A 2E65A 3S3OA 2LQ8A 2EQUA 3T9NA 1AVZC 4B9XA 1M90U 2COWA 3A1PA 4QW2A 3CCEA 3X26B 4RCCA 4QQGA 5J3BA 4XAXB 3OYMA 4C92B 3CXCS 2M0OA 1JB0E 2HAXA 3LH0A 3H0FA 2WSCE 1VQ9A 1NEGA 3H9NA 4IURA 4FCYA 1IGQA 1V29B 4OB3B 1G3TA 5I21A 2GFUA 2RQVA 2KMTA 2MAMA 2RHXA 4JJBA 4Z88A 3OMCA 4PLLA 1BCMA 5A0GA 1Q81U 5GMKe 4C0DB 2DVJA 2EWNA 1HJDA 1MMDA 3LWHA 1VQOQ 4KULA 2RJDA 1O9SA 2EYYA 3AT1B 4C8QB 1UUEA 3EGXA 2HSPA 1JEGA 4AFUC 3VRZA 1VQLA 4OMQA 4AFSC 4QVCA 4X1VA 4N4IA 5A2QE 1WHKA 2NUTB 2XI9A 3U23A 4IUQA 3UT1A 3VUZA 3MP8A 2ZPBB 1C6VX 2DL3A 4M7AG 1ABOA 1HD3A 3OQ5A 5FROA 1Q7YU 2QDYB 1EX4A 2FZKB 1GXIE 3JCMd 4L59A 4AG1C 2XKOC 3CD6Q 2KK4A 1R8OB 1S72A 3M0UA 1B34B 5A0DA 1QVFP 3S3MA 4HT9A 2MCNA 1JRIA 2EQKA 1SKUB 5KYYA 4RMOA 3CCJA 1UHCA 3HHTB 5GANd 1LPLA 3E9FA 2L2PA 2FG0A 4C92C 3CCRT 3UDCA 1M8MA 4V2SA 3EGDA 1Y57A 2BIVA 1OYXA 3A8MB 4XTVA 3FIFA 2SRCA 1AZGB 3OBWA 5GAMh 4C0ZA 3G7ZA 1WQ7A 1YP5A 4FYVB 1GCQA 4M7AD 2CKKA 3L2UA 2RO0A 1FX7A 4HVVA 3OYKA 3CCLT 1AEYA 2HNIA 3CCQT 2QQ9A 1I5LA 2X4JA 2JVVA 3X20B 3Q1JA 5GMKl 2FRYA
chains in the Genus database with same CATH topology
4LDUA 1WJSA 1ZBXA 4M77F 3KBGA 4M75C 1W2BS 2E1HA 4LDYA 1Q86U 4J6XA 4RCBA 4LDWA 3L2VA 1VQ4A 2MWOA 2L3RA 5GAMj 4E7HA 1YI2T 3A8LB 5J39A 3OW2S 3EAEA 1PSFA 5L8RE 2DD4A 1BKBA 5J26A 4DOWA 2VGNA 4BY6B 2EJFA 1XQHA 3QYGB 5LJ5h 5GANh 3CCST 4HCCA 2RA2A 4LD9K 2P0QA 1ZQ1A 2LTOA 2GFAA 3HFOA 1UEBA 2WACA 2FVUA 2P0PA 4N0AC 5AYFA 3RMSA 4Q5WA 5LJ3g 1KG1A 3V7SA 5C6SA 2JTFA 4IUPA 2D0QB 3VV0A 3KXTA 1U1SA 3HPWA 3OYFA 1WGSA 1M9SA 1JJ2S 1XTDA 5KE2A 1H641 4M78F 2HQEA 3VUBA 3CC4A 4JUVA 1LNXA 1Y7XA 2XU8A 1YJ9T 2EFIA 5GAOr 2M16A 3SB2A 2DZCA 3X24B 3CCMT 1K9MC 4JS4A 2B8AA 2JZ2A 3PMIA 4MDWA 5CKBA 4C92E 2E5QA 3M58A 1N27A 2GQVA 1QP2A 4FSXA 3LGLA 4NL2A 3JCMg 3OYCA 4TVRA 5CAIA 4BE0A 4EMHA 1QVFS 3JCMc 1XNIA 2A7YA 3EFRA 5FU7C 2DPPB 3OB9A 1MGQA 4M75B 4M75D 5DLOA 2CYZB 2P4TA 1BIBA 1NJIU 2CS7A 5LJ3f 3RKXA 3H6ZA 4J6YA 2X35A 4QQDA 3PT9A 2QA4A 4E7JA 2QQRA 3BFMA 5GAMe 3R6OA 1N8RC 2L89A 5LJ5g 5GANg 4UC4A 1EIFA 1N9SA 2JNGA 1QW1A 3BY7A 4L6V5 2YHTA 3BDLA 4CRIA 3ZBDA 2H3JA 1OI1A 3GPLA 2OTLA 2IG0A 2EKOA 2OAUA 3GNGA 3G6EA 2E12A 5FRMA 2MF2A 2NLUA 5IAYA 1LOJA 5KCOA 1M1GA 2CGHA 3OYAA 3F70A 4OB2B 2QQSA 4JRPA 3CC2A 3UWNA 5CR2A 2FL7A 4C5GA 3HKSA 4C5IA 3JCMW 5CKFA 2LDMA 4D6WA 1Q82U 1FWZA 3BDUA 4QQ6A 5DM7R 3G4ST 1VQ7A 3A5ZB 3NFCA 4C8QE 1LJOA 2G3RA 4RG8A 2DTOA 3MCAB 4LD6A 2M1HA 1P92A 4MZPA 3VYHB 1YBYA 2EJGA 3I56T 3RIRA 1VQ8T 4XQ3A 5M9OA 3M4GA 4PKCC 3MEVA 1W2BA 2MI6A 1YJNA 2XG8D 3LGFA 4JRQA 3OYDA 3C12A 4X9CA 3P8DA 4HCBA 4XU2A 2C06A 3JB9F 4ATOA 3LLRA 3N5BB 5GANd 2DK3A 5FU7B 1KQSS 3OYYA 2MMPA 4PJOF 3OW2A 3TEEA 2PUKB 2XDBA 5GAN8 3SWNA 4BACA 1YCYA 2ZPIB 3HFNA 1NJIC 4HA8A 4J6WA 3RESA 1VQ6A 3SD4A 4PJOA 5GAOn 3META 3E19A 4JS5A 3E9GA 3OSVA 2R5MA 3FJPA 3TCJA 5KE3A 2OTJA 4BD3A 4EDUA 2V8KA 1BI0A 2BKDN 3QO3A 1FXXA 1YIJT 1W4SA 1JJ2A 3JAME 4FM4B 4IUVA 4X34A 3CMAT 2R5AA 1WNLA 3RKWA 1YITA 4E7IA 3CC7T 3M5AA 3JCMJ 3GLXA 3QXEB 5GAN3 4C8QF 2K5LA 5FRNA 1I81A 3MEWA 4X9DA 3VYGA 4OVAA 2O01E 2K57A 4JJNK 1SSFA 3M9QA 5CKEA 4ZGJB 3QG1A 2CZ1B 3OYJA 3CCRA 4F7UF 2MWPA 1VQNT 2L8DA 3SWNC 4PJOG 3WXMB 5HK0A 2DKGA 3QUIA 4VUBA 1QVFA 4BI8B 2QEXT 3J81E 3OSSC 4F7UA 3OYIA 1RL2A 2GCXA 3DLMA 2YLBA 3CCET 3BW1A 3RKYA 3CPWS 3CCUA 1X75C 1VQKA 3PNWC 4R55A 3NTHA 4M7DA 3ME9A 2PVDB 1IREB 3M57A 4J7FA 3QHSA 3V8KA 3OYEA 3M59A 2QTXA 1G3SA 1YJWA 3L2RA 4ZTJA 1VQ9T 2PUOB 2DVEA 4M77A 3JCMh 2XIDA 3ER0A 5CO7A 3CCVA 2KY9A 1U8RA 4IKFA 1QVGS 1KC8U 2XK0A 5GAMg 1N8RU 2L5QA 3CCLA 3G71A 1G5VA 5GANf 3CCQA 4L5GA 4M7AE 4BI4A 2O4XA 1VQMT 2LT4A 4F7UG 2JOYA 5CVIA 3J7AF 2QEXA 5I2MA 4BE2A 5CQYA 3OA6A 1O75A 4E7LA 1VQOT 4M7DE 2LVMA 3MEAA 2K2VA 1NPRA 4MMKA 2A3LA 4A53A 4M7DG 1I4K1 2RK1A 3C4SA 3QJYA 1WQWA 4MZTA 4J8OA 4BUGA 4M7DC 4A4EA 2YLCA 4PL6A 3FLGA 4MMLA 4P5NA 1Y96A 2FB7A 4FL6A 4E47A 2CZ6B 4M77G 1G3YA 4EMKA 5CKDA 3GP8A 1K8AU 2ZPGB 4OGCA 1M1KU 4II1A 4M78A 1YI2A 2RHYA 2PU9B 4M77C 3M53A 3SWNB 2E70A 3OS5A 4JLGA 4O5VA 5LJ3j 2HD0A 2DJZA 3GOXA 2JTMA 3P8HA 4PJOB 3QIIA 4ZN1A 3URGA 1KQSA 3CCSA 4J7IA 4PJOD 2QQBA 2RI5A 2VXFA 2DD5A 3JCMb 3C94A 3QBYA 3MHXA 4CI0C 5DY9A 1KQ2A 3V8JA 1BIAA 2LNVA 3A8OB 3SDZA 1VQLT 2I2LA 5GAOm 5GAMf 3JB9I 4KT0E 4ELZC 3OYGA 3UPUA 4JDSA 2K3XA 3FEOA 2K3YA 2RI3A 5GAN7 3CMET 1YHQT 4M7AF 1AHJB 4FT2A 5CK9A 1YJ9A 4M78G 2HQXA 2E41A 2LC4A 4J83A 4A4GA 1KC8C 4JLIA 4HT8A 3CD6T 2JUFA 3HP9A 3A8GB 4M78C 2M9UA 4OP0A 3CCMA 3QZ5B 3OYLA 1HK9A 1XOVA 2V8JA 1VQPT 1BI2A 1WJQA 5CKHA 4F7UB 3FDRA 4BDZA 2RH2A 4XTUA 5LJ3d 2LT1A 4BI3A 2BUDA 3P8BB 2LX9A 1UGRB 4NS5A 1VIFA 3JCMX 3J80E 4M7DB 1BYMA 4M7DD 4JRKA 4XTXA 1PSEA 3CBMA 2RI2A 1K8AC 4ELYC 1M1KC 3JCMf 4BB7A 4R56A 1N9RA 3JCMP 3CPWA 4C92F 2PVGB 4M77B 3QKJA 4M77D 4MZMA 1VUBA 3JB9J 3KUFA 4FT4A 4RG2A 4XK8E 3CCJT 4PNOA 4M75E 1K73U 4OB0B 2K5FA 2KDSA 1OZ2A 3WVEB 5GMKm 1WPYA 4FU6A 4C92A 2O4XB 5GAN2 1RI0A 3LYIA 4XU3A 2EYQA 2IVWA 2EQJA 2QQAA 1NZ9A 2DXUA 2RM4A 2VXEA 4GLKA 3A8HB 4QVDA 3RUXA 1QVGA 1KD1C 2XICA 5LJ5f 1ZHIA 1Y07A 2DAQA 1DJ7B 3SFMA 2VYTA 2FYKA 2E64A 1UGQB 3FRNA 5GMKh 1YITT 3MP1A 2K4YA 3RERA 3HRSA 3G4SA 3JB9H 2D9TA 1U1TA 1BI3A 1Y71A 2HBPA 3M4YA 3PMTA 2DTIA 1Y96B 2ZCFB 3I55T 5FLXE 2QXFA 2Y90A 4FIBA 4M78B 4M78D 3DKMA 3I56A 4WF2A 5GAN6 1VQ8A 3DB3A 2EJ9A 3L1AA 2AHJB 5EG2A 2DZ9A 3M56A 3QYHB 5FU6C 1KHIA 4C92G 3NTKA 4LDXA 3L2QA 3QJ6A 2F5TX 2GF7A 2K5IA 4C0FA 3ASKA 1VQ5T 2JN0A 4J5YA 1M1FA 5CIUA 1JBMA 3QDRB 2F69A 4HCZA 4ZGEB 4QVZA 1NPPA 3JB9G 4NOYA 4EPCA 3JRZA 4M75F 3C95A 4C8QA 2Y4XA 4B9WA 5DLQE 5HY6A 4MDXA 4LDVA 4PJOC 1K73C 3GIBA 3HSBA 1M8VA 5LJ3h 2X4WA 4IUTA 2E6ZA 2WSFE 3VKIA 1YIJA 2RHUA 4DQ2A 1WJRA 2YRVA 2KSSA 3INZA 4OGEA 1HXDA 3CMAA 5GMKj 1VQ4T 1D3BA 4KBMB 3MP6A 4RKUE 4A4KA 4C5EA 3JCMQ 3CC7A 2XHCA 2DIQA 1N6AA 4C0DC 3PFSA 1UGPB 2RJCA 2E65A 3QZ9B 3S3OA 4C8QG 2LQ8A 2EQUA 3EFSA 1VQNA 5IT9E 4C8QC 3T9NA 2ZPHB 4XTYA 5A0LA 4B9XA 1M90U 4Z02A 4QW2A 3CCEA 3ZFJA 5FU6B 3X26B 4RCCA 3WVDB 3CC4T 2E6NA 4QQGA 2RD1A 5J3BA 4XAXB 3OYMA 4C92B 2CZ7B 2PVOB 4C92D 3PIOA 4KUDK 3CXCS 2M0OA 1B34A 1JB0E 2HAXA 3LH0A 3HL8A 2DO3A 2WSCE 1VQ9A 2VUBA 4A54A 3DB4A 4ZTFA 5D6XA 4ZN3A 4IURA 3LWIA 3OYHA 3L2ZA 1V29B 4OB3B 1G3TA 3V7RA 3JB9D 1QP3A 5I21A 4E7KA 3OMGA 2GFUA 3MO8A 3VJPA 1VQMA 4XU1A 2KMTA 1KQ1A 5GMKi 2MAMA 3TU4K 3QSUA 2F5KA 2RHXA 2XDPA 1VQOA 3OMCA 1KHCA 4PLLA 1KD1U 5A0GA 1Q81U 1MHNA 4IUUA 5HK3A 3DLLA 3CPFA 4OB1B 5GMKe 4A4FA 2X4XA 2EWNA 4C0DB 2QA4T 3X25B 2X4YA 4DOVA 3PGGA 4EMGA 3HRUA 4EMKC 3LWHA 4KULA 2OTLT 2RJDA 1O9SA 2E10A 5LL6S 4C8QB 3G6ET 4Y28E 2PQWA 2KAFA 4C8QD 2DTHA 5GAMd 4M7AA 1M4ZA 3FC3A 1OZ3A 1M90C 2R57A 3L42A 2VV5A 3CC2T 1X6OA 2EAYA 2LRQA 2VC8A 1VQ7T 1VQLA 4QVCA 5GAN5 3AHUA 1M5Q1 3NTIA 5CCAA 5IN1A 1Q86C 1S72T 1BI1A 3VU3C 4N4IA 1QVPA 4PJOE 1D3BB 5A2QE 5LJ5j 5GANj 2XI9A 1TH7A 4O6JA 1YHQA 3CMEA 3OYBA 3E1SA 4IUQA 3O8VA 5GAN4 1YJNT 5GAOq 3UT1A 3VUZA 5C0MA 1UGSB 2FHDA 2ZPBB 3MP8A 3CD6A 4M7AG 2RJEA 3M54A 2LCCA 5D6WA 4HKEA 3X28B 5LJ3e 2ZPEB 3OQ5A 4M7AC 4KUIA 5FROA 2QDYB 5I2SA 2XDDA 1VQPA 3ZEHA 1Q7YU 3CEYA 3M55A 4ZGDB 1GXIE 4XU0A 3TREA 3JCMd 2R58A 4L59A 2DEQA 1Q81C 3GF5A 2XKOC 1VQ6T 2KK4A 3MEUA 3RMQA 2OTJT 2KVQG 1R8OB 2RHIA 3PTAA 4OF1A 1S72A 1B34B 5A0DA 3OBYA 4OMFB 4EMKB 3JSCA 2CZ0B 4F7UE 3S3MA 4HT9A 1IZ6A 3GNFB 4XTZA 4YTLA 4BE1A 1JRIA 2EQKA 4RMOA 3LX7A 2EQMA 4PLIA 3HHTB 3V8LA 2EIFA 3JCMV 2ZPFB 3CCJA 2RJFA 4C0GA 1VIEA 3QPHA 2LCLA 2QI2A 3E9FA 3H8ZA 5D6YA 5LJ5d 3JCMe 3CXCA 2ZGWA 3HRTA 5GAOl 3OY9A 1G3WA 2V8IA 4DA4A 2RK2A 4C92C 3CCRT 2Y4YA 5KCHA 4M77E 4N4HA 5CQXA 3UDCA 4V2SA 1UB4A 2ZZDA 2BIVA 5GAOp 1OYXA 3A8MB 4XTVA 2VGMA 4N4GA 3FIFA 4NL3A 3OBWA 5GAMh 2WSEE 4BY6C 4ME7A 4C0ZA 5HKCA 3OYNA 2DIGA 3G7ZA 5GANe 5LJ5e 3CCUT 1VQKT 2XD0A 4M75A 1WQ7A 3CBOA 4C5HA 3FB9A 4JRIA 2KQWA 1H3ZA 4M7AB 2D6FA 4M7AD 1YJWT 3I55A 1Q7YC 2CKKA 4A4HA 3L2UA 3L2WA 3OS0A 3S3NA 2RO0A 1FX7A 1NE8A 2RHZA 2DXBA 3CCVT 1Q82C 4GY5A 3OYKA 1VQ5A 3OS2A 4BDYA 4M78E 3S6WA 3CCLT 3G71T 1I8FA 2HNIA 3LW5E 4Y91A 3CCQT 2QQ9A 1I5LA 4N0AA 2X4JA 2P0KA 2LQKA 3PIPA 5KH6A 2JVVA 4M7DF 3V7CA 2DXCA 3X20B 3Q1JA 1K9MU 2DXTA 1X01A 5GMKl 4M75G 3OS1A 2RB6A 3CBPA 4XTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVP A;  1BI0 A;  1P92 A;  4O6J A;  1G3S A;  2K5F A;  1G3Y A;  3HRU A;  3GLX A;  1QW1 A;  2K5L A;  3HRT A;  2H3J A;  1FX7 A;  1G3W A;  2K5I A;  4O5V A;  1U8R A;  1G3T A;  2QQA A;  1BI2 A;  2QQ9 A;  2QQB A;  3MHX A;  5CVI A;  2K4Y A;  2LX9 A;  1FWZ A;  3HRS A;  1BYM A;  3E19 A;  2GCX A;  1BI3 A;  1BI1 A; 
#chains in the Genus database with same CATH topology
 3CCR Q;  4LDU A;  1WDX A;  4M75 C;  1HSQ A;  1M2V B;  5KYX A;  4J6X A;  3L2V A;  1VQ4 A;  2KRS A;  2E3H A;  1YI2 T;  3EH1 A;  1I1J A;  2W0Z A;  5J39 A;  2RF0 A;  4BY6 B;  2EJF A;  2QG9 B;  1QWF A;  4HCC A;  3EG9 B;  4N0A C;  5AYF A;  3RMS A;  4Q5W A;  1BBZ A;  1UJ0 A;  3KXT A;  3E2U A;  3OYF A;  2HBW A;  5KYW B;  1WGS A;  1XTD A;  5KE2 A;  2M51 A;  3CCL Q;  3VUB A;  2O2O A;  8AT1 B;  3CCQ Q;  3CC4 A;  1Y7X A;  1YJ9 T;  2EFI A;  1D0Y A;  4HXJ A;  4J9D A;  4LNP A;  3X24 B;  2B8A A;  1CKB A;  2QAZ A;  1N27 A;  4BE0 A;  1QP2 A;  4EMH A;  2HKQ B;  3EFR A;  3OB9 A;  1YI2 Q;  1WXT A;  2J06 A;  3RKX A;  2AZS A;  4QQD A;  1MV0 B;  1Q82 R;  1G8X A;  3R6O A;  1YCS B;  2BZ8 A;  4CRI A;  2F2W A;  2OAU A;  1NLP C;  3G6E A;  2EGA A;  1YFN A;  5KCO A;  3OYA A;  1TUD A;  3F70 A;  2QQS A;  1YJ9 Q;  5CR2 A;  2DER A;  5CKF A;  1FWZ A;  3G4S T;  3A5Z B;  3EG0 A;  1M3C A;  3NFC A;  2AIR B;  3MCA B;  4LD6 A;  1RUW A;  1KIK A;  4MZP A;  4DBH A;  3RIR A;  4XQ3 A;  5M9O A;  3VS4 A;  3M4G A;  1SHG A;  2XG8 D;  1G83 A;  1K0X A;  3C12 A;  3P8D A;  4HCB A;  1WFW A;  3LLR A;  1OPL A;  4PJO F;  3OW2 A;  3M0S A;  1W70 A;  1K4U S;  4OMP A;  4BAC A;  2Z0W A;  1NJI C;  4HA8 A;  4OMM A;  3MET A;  3E9G A;  3FJP A;  2JJ9 A;  4K11 A;  2EW3 A;  4BD3 A;  3QO3 A;  1BI0 A;  1JJ2 A;  1YN8 A;  1YNZ A;  3CMA T;  2R5A A;  1WNL A;  3G4S Q;  2K5L A;  4JZ4 A;  2JXB A;  2DA9 A;  1SSF A;  3M9Q A;  4RTW A;  5CKE A;  2DET A;  1ZBJ A;  1SPK A;  3WXM B;  2RPN A;  2DKG A;  1Y0M A;  5HK0 A;  1X43 A;  4VUB A;  2QAS A;  2QEX T;  3J81 E;  3OSS C;  4F7U A;  3IQL A;  1RL2 A;  3CCE T;  1N8R R;  1MMA A;  1VQK A;  3PNW C;  4RTU A;  1G3S A;  1VQ9 T;  2F2X A;  3VS5 A;  3CCV A;  1ABQ A;  1I5O B;  1KSW A;  2L5Q A;  1G5V A;  3G71 A;  4L5G A;  4M7A E;  3CMA Q;  4Z89 A;  2LT4 A;  1YJW Q;  5I2M A;  2HZY A;  5CQY A;  1O75 A;  1ZSZ A;  4MMK A;  4M7D G;  3C4S A;  2KEA A;  4BUG A;  4J8O A;  2K6D A;  4A4E A;  2E5K A;  4J9G A;  4P5N A;  1ZUU A;  4FL6 A;  4FSS A;  1M1K U;  1X6G A;  2QEX Q;  2L3Q A;  3CCE Q;  4O5V A;  2DJZ A;  3GOX A;  4PJO B;  1KQS A;  2QQB A;  2DD5 A;  3C94 A;  4F16 A;  1J3T A;  5FW9 A;  3A8O B;  3SDZ A;  1VQL T;  1GFD A;  2A08 A;  1SRL A;  2K3X A;  2D8J A;  2RQW A;  4M7A F;  4FT2 A;  5CK9 A;  2ZAE A;  4M78 G;  4A4G A;  2LCS A;  2W10 A;  2ED0 A;  3A8G B;  4OP0 A;  3M0R A;  1XOV A;  5CKH A;  1WJQ A;  1B3Q A;  1UG1 A;  2CRE A;  4XTU A;  2LT1 A;  2BUD A;  2KXC A;  2LX9 A;  4KRT A;  4NS5 A;  2FZC B;  3JCM X;  2HQH A;  4M7D D;  4XTX A;  2NUP B;  3CBM A;  1K8A C;  1QLY A;  3JCM f;  3JCM P;  3CPW A;  3VS7 A;  1EFN A;  4M77 B;  3KUF A;  3CCJ T;  2ABL A;  4CC4 B;  4ANJ A;  2KDS A;  1VQL Q;  3EG3 A;  1VOM A;  4C92 A;  2O4X B;  1GL5 A;  5GAN 2;  1PKS A;  4XU3 A;  1NZ9 A;  4GLK A;  1RLP C;  3A8H B;  5GAN f;  2DAQ A;  1DJ7 B;  1M27 C;  3BE3 A;  2FYK A;  2E64 A;  2LQW A;  3SFM A;  3HRS A;  1K9A A;  1Y71 A;  3M4Y A;  3NHN A;  2K2M A;  4M78 D;  4WF2 A;  3DB3 A;  2EJ9 A;  1UTI A;  5FU6 C;  2EKH A;  3JB9 G;  3CCJ Q;  2BE7 D;  4C8Q A;  1IHV A;  2Y4X A;  2X51 A;  5HY6 A;  4PJO C;  4LDV A;  4AMC A;  2LQN A;  3GIB A;  3HSB A;  5LJ3 h;  2CP5 A;  2RHU A;  1VYT A;  2KSS A;  2A0F B;  1RAD B;  1VQ4 T;  4KBM B;  3MP6 A;  4C5E A;  2NUT A;  1UGP B;  1D1C A;  1YIJ Q;  3EFS A;  2QK0 A;  2CT3 A;  3H0I A;  5IT9 E;  4XTY A;  5A0L A;  2A37 A;  1D0X A;  3CC4 T;  2CZ7 B;  2DEU A;  1B34 A;  5IH2 A;  3HL8 A;  2VUB A;  3DB4 A;  1NG2 A;  4ZN3 A;  3L2Z A;  3V7R A;  3JB9 D;  8ATC B;  1VQM A;  1VQ4 Q;  4XU1 A;  1KQ1 A;  5GMK i;  1BB9 A;  3TU4 K;  3QSU A;  2F5K A;  2EYW A;  1KD1 U;  1TUG B;  4KGX B;  3HRU A;  4E2F B;  1X2K A;  2QGF B;  2DMO A;  3G6E T;  5GAM d;  2DTH A;  3CC4 Q;  1IB8 A;  1K73 R;  1AWO A;  2EBP A;  1A0N B;  5CCA A;  5IN1 A;  2BE9 B;  1QVP A;  3I5R A;  5GAN j;  1TH7 A;  4GBQ A;  3OYB A;  5C0M A;  1UGS B;  2RJE A;  3M54 A;  2LCC A;  4HKE A;  3X28 B;  1M2V A;  2ZPE B;  2MYS A;  4M7A C;  2D8H A;  1K1Z A;  1PM3 A;  2RQR A;  4XU0 A;  1RAE B;  3TRE A;  2DEQ A;  3GF5 A;  2JMA A;  3MEU A;  3G6E Q;  3EG9 A;  2ENM A;  1JXM A;  2IPO B;  3OBY A;  4OMF B;  2CZ0 B;  2XMF A;  4YTL A;  4PLI A;  2EQM A;  4HVU A;  3JCM V;  2ZPF B;  2CT4 A;  2RJF A;  4M7D E;  5D6Y A;  3CXC A;  3TQ7 P;  4RTX A;  3UA7 A;  3OY9 A;  1OEB A;  2V8I A;  4DA4 A;  5GJV B;  4KH1 B;  2FRW A;  2QDL A;  1UB4 A;  2VGM A;  4N4G A;  4JPB W;  3OYN A;  2XD0 A;  2KI7 A;  5LJ5 e;  1VQK T;  3CBO A;  2YRD A;  2DIL A;  3FB9 A;  4JRI A;  1H3Z A;  4IIM A;  4A63 B;  2QYZ A;  3I55 A;  4A4H A;  2HKN A;  1K9M R;  1Z9Q A;  3S3N A;  4PJM A;  1NE8 A;  2RHZ A;  3CCV T;  4GY5 A;  4M78 E;  3G71 T;  4F17 A;  3LW5 E;  2RQT A;  2LQK A;  4M7D F;  3V7C A;  2H3E B;  2DXT A;  4OMO A;  2RB6 A;  5FWB A;  5IXF A;  1W2B S;  5D7U A;  1Q86 U;  4LDW A;  7AT1 B;  3R6N A;  2KRO A;  5L8R E;  1VQK Q;  5J26 A;  4DOW A;  2CH4 A;  2YDL A;  5LJ5 h;  4E7S A;  2P0Q A;  4RTZ A;  2LTO A;  3M0P A;  1OUL A;  1UE9 A;  5C6S A;  2JTF A;  4IUP A;  1WXB A;  1U1S A;  3CCV Q;  5IHN A;  4M78 F;  3G71 Q;  2HQE A;  2GBQ A;  2C0T A;  3SB2 A;  2DZC A;  2FZG B;  1NYF A;  1B07 A;  5CKB A;  2ED1 A;  1K9M C;  1QVF S;  4B6M A;  1XNI A;  5FU7 C;  4M75 B;  1RAA B;  1U06 A;  1W1F A;  9ATC B;  3H6Z A;  3PT9 A;  2QA4 A;  2QQR A;  5GAM e;  2L89 A;  5LJ5 g;  4FYX B;  3BY7 A;  1KJW A;  2C0O A;  3TVT A;  3ZBD A;  2OTL A;  2IG0 A;  3GNG A;  2FPD A;  1OX9 A;  3CXC P;  2E12 A;  5FRM A;  3UA6 A;  2X3X D;  1ARK A;  3CC2 A;  2O31 A;  3JCM W;  5DM7 R;  1LJO A;  1X69 A;  1NYG A;  2A28 A;  3VYH B;  2CSI A;  4PKC C;  1QCN A;  3D7S B;  2C06 A;  3JB9 F;  1T3S A;  3OYY A;  2K7A A;  3VS0 A;  1OV3 A;  5GAN 8;  1YCY A;  3HFN A;  1FMV A;  3RES A;  4PJO A;  4JS5 A;  5KE3 A;  2OTJ A;  3TCJ A;  2X9H A;  3CQT A;  4F14 A;  2V8K A;  2BKD N;  1SRM A;  3JAM E;  4X34 A;  3RKW A;  2DF6 A;  4E7I A;  5GAN 3;  2EQI A;  3VYG A;  3MPU B;  5L23 A;  4JJN K;  4ZGJ B;  2CZ1 B;  3OYJ A;  3GBQ A;  2JM8 A;  2KT8 A;  3SWN C;  3QUI A;  4BI8 B;  2GCX A;  4JZ3 A;  2JT4 A;  2AKL A;  2PVD B;  3M57 A;  2G6F X;  3V8K A;  3OYE A;  2NUP A;  1XJW B;  4ZTJ A;  4M77 A;  1G2B A;  2KGT A;  1QVG S;  1KC8 U;  5GAM g;  1T0J A;  1WA7 A;  4BI4 A;  2O4X A;  1VQM T;  4QT7 A;  4F7U G;  4BE2 A;  3OA6 A;  2LVM A;  3MEA A;  2K2V A;  2RK1 A;  1WQW A;  1MV3 A;  4M7D C;  1JQQ A;  4PL6 A;  5CKD A;  1ZA1 B;  5I22 A;  4OGC A;  2PU9 B;  1QCF A;  2E70 A;  1NJI R;  4ZNX A;  2JTM A;  3P8H A;  1T3L A;  3CCS A;  4J7I A;  3QBY A;  3MHX A;  2LNV A;  5GAO m;  5GAM f;  4KT0 E;  1N5Z A;  4AG2 C;  1UDL A;  4Z8A A;  1OX8 A;  2RI3 A;  5GAN 7;  1VQM Q;  2C0I A;  4KH0 B;  4JLI A;  5KYU B;  4M78 C;  3CCM A;  2V8J A;  2BZX A;  3FDR A;  2DFU A;  5LJ3 d;  2H8H A;  2VWF A;  2CSQ A;  1AWX A;  2EYZ A;  2RI2 A;  4BB7 A;  1N9R A;  2ATC B;  1LVK A;  4FT4 A;  1K73 U;  2K5F A;  2I0N A;  1OQK A;  1WHJ A;  4F04 B;  3WVE B;  1WPY A;  1MUZ A;  3LYI A;  2EYQ A;  2QQA A;  2DNU A;  1WHM A;  1KD1 C;  2VYT A;  1UGQ B;  3MP1 A;  2K4Y A;  4PFP A;  2KRN A;  1NM7 A;  4GLM A;  5KYN A;  1U1T A;  2HBP A;  3PMT A;  3REB B;  1Y96 B;  4OML A;  2J6K A;  3I55 T;  3M56 A;  4C92 G;  2COZ A;  1ZLM A;  2F5T X;  2JN0 A;  4HCK A;  4PJL A;  4QVZ A;  4NOY A;  4EPC A;  3JRZ A;  3EFO B;  2DL7 A;  4CC3 A;  2F2V A;  1FMW A;  1WYX A;  2X4W A;  2WSF E;  3INZ A;  5GMK j;  2K3B A;  4A4K A;  1D0Z A;  2XHC A;  2DIQ A;  4FW2 A;  3PFS A;  2JTE A;  2RJC A;  3QZ9 B;  4C8Q G;  1OOT A;  3UAT A;  1VQN A;  3I55 Q;  4PFO A;  1K8A R;  2PNI A;  1C0M A;  2GTJ A;  3ZFJ A;  5FU6 B;  5AT1 B;  3WVD B;  2DYB A;  2HMA A;  2GTO A;  2PVO B;  4IIO A;  4C92 D;  3PIO A;  2DO3 A;  4A54 A;  1YWO A;  5D6X A;  1Q81 R;  2MPX C;  3OYH A;  2YT6 A;  2BTT A;  4HVW A;  2KXD A;  1QP3 A;  4E7K A;  3OMG A;  3H41 A;  2DLP A;  4LUE A;  1VQO A;  1VQ9 Q;  4KGV B;  1MNE A;  1UJY A;  4IUU A;  5HK3 A;  1OU8 A;  3DLL A;  3CPF A;  4OB1 B;  4A4F A;  2QA4 T;  2RQU A;  4EMK C;  2JS0 A;  2OTL T;  2E10 A;  2M02 A;  5LL6 S;  4Y28 E;  4C8Q D;  2KAF A;  4CC7 A;  1M4Z A;  1M90 C;  1I0C A;  3L42 A;  2VV5 A;  3CC2 T;  2VC8 A;  3OW2 P;  4RTY A;  2KT1 A;  1M5Q 1;  1D1B A;  1Q86 C;  1S72 T;  1Q7Y R;  2LP5 A;  3VU3 C;  2GNC A;  1PRL C;  2O88 A;  3SEM A;  3O8V A;  2CUD A;  1JJ2 P;  3CD6 A;  2FHD A;  5D6W A;  5LJ3 e;  3ZEH A;  3CEY A;  4ZGD B;  2QA4 Q;  2R58 A;  1FYN A;  2CP7 A;  1Q81 C;  5IHI A;  2OTL Q;  1RAG B;  2OTJ T;  2KVQ G;  2RHI A;  3PTA A;  1SSH A;  4F7U E;  1IZ6 A;  3GNF B;  4XTZ A;  3CC2 Q;  1RAB B;  3LX7 A;  4JJC A;  2EIF A;  3JCM J;  2M0Y A;  5LJ5 d;  2LCL A;  2QI2 A;  3H8Z A;  5GAO l;  1R0C B;  2EGE A;  1S72 Q;  1EZZ B;  1D09 B;  4N4H A;  5CQX A;  5GAO p;  1K0S A;  4NL3 A;  2QTV A;  2WSE E;  2JW4 A;  1W6X A;  2DIG A;  4M75 A;  1SEM A;  2FEI A;  4WCI A;  1SHF A;  4M7A B;  2D6F A;  1Q7Y C;  3L2W A;  2OTJ Q;  2CH4 W;  3OS0 A;  1H3H A;  2NWM A;  1VQ5 A;  3OS2 A;  2VKN A;  3S6W A;  1M2O A;  4Y91 A;  4N0A A;  1HYO A;  2QGG A;  3PIP A;  1KQS P;  2DXC A;  1K76 A;  1X01 A;  3OS1 A;  3ZL7 C;  3CBP A;  4XTW A;  1WJS A;  1ZBX A;  3KBG A;  1PCX A;  1I07 A;  2J05 A;  3LH5 A;  4RCB A;  2MWO A;  2L3R A;  3A8L B;  2YUP A;  5ECA A;  3EAE A;  1PSF A;  1BKB A;  2VGN A;  2MIO A;  1ZUY A;  2F1L A;  1XQH A;  3PVQ A;  3CCS T;  4LD9 K;  2RA2 A;  1B7T A;  2GFA A;  1UEB A;  2WAC A;  2FVU A;  2P0P A;  5LJ3 g;  1KG1 A;  1ZA2 B;  3V7S A;  1S1N A;  2D0Q B;  5FWC A;  3HPW A;  1QKX A;  1H64 1;  4JUV A;  1H8K A;  2DRK A;  2J7I A;  2M16 A;  1IO6 A;  2VB6 A;  3CPW P;  1IHW A;  1SF9 A;  3CCM T;  2O9S A;  2JM9 A;  2YRC A;  3PMI A;  4MDW A;  4C92 E;  2GQV A;  3OYC A;  1QMC A;  4TVR A;  1UFF A;  2A7Y A;  2DPP B;  3I35 A;  1OU9 A;  1TS9 A;  1BIB A;  3A98 A;  1NJI U;  3KFV A;  5LJ3 f;  3CCS Q;  1KFZ A;  4AFQ C;  2DRM A;  3BFM A;  4UC4 A;  1N9S A;  3GPL A;  1TOV A;  2YHT A;  4LN2 A;  3I9Q A;  2K79 A;  2MF2 A;  1CKA A;  4OB2 B;  3O5Z A;  1E6H A;  1QCO A;  2FL7 A;  4C5G A;  3HKS A;  4C5I A;  4D6W A;  2LDM A;  1Q82 U;  1VQ7 A;  4QQ6 A;  3CCM Q;  2ROT A;  4C8Q E;  1AZE A;  4RG8 A;  2DTO A;  2M1H A;  1P92 A;  1YBY A;  4J9F A;  1V1C A;  1W2B A;  1YJN A;  3LGF A;  4JRQ A;  3EHR A;  4XU2 A;  2KYM A;  4ATO A;  5FU7 B;  2MMP A;  3TEE A;  2HDA A;  2CDT A;  2PUK B;  2RN8 A;  2LNH B;  2E3I A;  2HSE B;  1VQ6 A;  3SD4 A;  4ESR A;  5GAO n;  3OSV A;  2R5M A;  1PRM C;  4EDU A;  1GBQ A;  4FM4 B;  4IUV A;  1F1B B;  2AKK A;  3VS2 A;  1V76 A;  2JS2 A;  2DL5 A;  2DBM A;  1YIT A;  2AZV A;  4R0K A;  3GLX A;  3QXE B;  4C8Q F;  1I81 A;  4X9D A;  1U5S A;  2K57 A;  2V1Q A;  1PD1 A;  4LE9 A;  4AFZ C;  5KYU A;  1VQN T;  2L8D A;  4LUD A;  4ORZ A;  4PJO G;  3H0H A;  1QVF A;  3OYI A;  1TU0 B;  2YLB A;  1RAF B;  3CCU A;  1X75 C;  4R55 A;  2DJQ A;  1IRE B;  4J7F A;  4PFZ A;  3M59 A;  2QTX A;  1YJW A;  1WLP B;  2LMJ A;  2DVE A;  2KBT A;  2XID A;  5CO7 A;  4IKF A;  2KY9 A;  1N8R U;  2DM1 A;  3EG1 A;  3PE0 A;  2YUN A;  1M1K R;  1ACM B;  2JOY A;  5CVI A;  2QEX A;  2OAW A;  4E7L A;  1VQO T;  1NPR A;  1VQN Q;  2YLC A;  4MML A;  4EMK A;  1Y96 A;  4E47 A;  1K8A U;  4M77 G;  1G3Y A;  2OI3 A;  3M53 A;  3SWN B;  5LJ3 j;  3QII A;  4ZN1 A;  4PJO D;  2RI5 A;  1KQ2 A;  2EGC A;  1ZSZ C;  4FYY B;  3UPU A;  4JDS A;  3VS3 A;  3EFO A;  3FEO A;  3M0T A;  2K3Y A;  1TUC A;  4KGZ B;  1TTH B;  1RI9 A;  2HQX A;  2E41 A;  2LC4 A;  4J83 A;  4RTV A;  3CD6 T;  1W2B P;  2M9U A;  1BK2 A;  3OYL A;  2E4H A;  1HK9 A;  1RLQ C;  2V1R A;  2YWW A;  1BI2 A;  2RH2 A;  4BI3 A;  1UGR B;  1NBE B;  1YWP A;  4M7D B;  1BYM A;  5GJW B;  4OMN A;  4ELY C;  1M1K C;  2VVK A;  4R56 A;  2CP2 A;  2L0A A;  2PVG B;  1U3O A;  3QKJ A;  4M77 D;  3JB9 J;  1VUB A;  2J6F A;  2RNA A;  4PNO A;  1OZ2 A;  4FU6 A;  2L3P A;  2D1X A;  2EQJ A;  2VXE A;  2RM4 A;  2DXU A;  2OJ2 A;  1KK7 A;  1QVG A;  5LJ5 f;  1Y07 A;  5GMK h;  2D9T A;  1UEC A;  2DTI A;  4D8K A;  2ZCF B;  5FLX E;  2QXF A;  2Y90 A;  4M78 B;  3DKM A;  3I56 A;  1VQ8 A;  5EG2 A;  2DZ9 A;  3QYH B;  4LDX A;  2CUB A;  4DEY A;  2GF7 A;  1VQ5 T;  1MMN A;  2YUO A;  1NPP A;  3C95 A;  5I11 A;  4B9W A;  5DLQ E;  1WI7 A;  4QKU A;  4MDX A;  4WTO B;  2PTK A;  1M8V A;  4IUT A;  2GQI A;  2E6Z A;  1YIJ A;  2HCK A;  4OGE A;  4LXC A;  3CC7 A;  4C0D C;  3TSW A;  1ZSG A;  4C8Q C;  2ZPH B;  4Z02 A;  1VQ5 Q;  1AD5 A;  3JV3 A;  2E6N A;  2RD1 A;  4KUD K;  2OX7 A;  4FW1 A;  4J9H A;  1RAH B;  3UF4 A;  1KD1 R;  4ZTF A;  3LWI A;  3QDF A;  3M0Q A;  3NMZ C;  3MO8 A;  3VJP A;  2VAS A;  2XDP A;  2O9V A;  1TWB A;  4AT1 B;  1KHC A;  1MHN A;  4PJN A;  4FYW B;  2X4X A;  2IIM A;  3VS6 A;  3X25 B;  2X4Y A;  4DOV A;  3PGG A;  4EMG A;  3HTR A;  2EVR A;  3NGP A;  2FPF A;  1Q95 G;  2PQW A;  1WZO A;  4M7A A;  1RAI B;  3FC3 A;  1OZ3 A;  2R57 A;  1X6O A;  2EAY A;  2LRQ A;  1WXU A;  1VQ7 T;  1QVG P;  2KNB B;  3AHU A;  3NTI A;  1QWE A;  1BI1 A;  4RTT A;  1BU1 A;  4PJO E;  1D3B B;  1PG5 B;  5LJ5 j;  4O6J A;  1YHQ A;  3CME A;  1AT1 B;  3E1S A;  1YJN T;  1RAC B;  5GAO q;  1OPK A;  1X27 A;  1IRX A;  1IXD A;  4KUI A;  2XDD A;  5I2S A;  1VQP A;  2EPD A;  3M55 A;  1VQ6 T;  3RMQ A;  4OF1 A;  2X3W D;  4EMK B;  3JSC A;  1PKT A;  4BE1 A;  1M30 A;  3V8L A;  1VQ7 Q;  1YIT T;  4C0G A;  1VIE A;  3QPH A;  3JCM e;  2ZGW A;  3HRT A;  2EYX A;  1G3W A;  2RK2 A;  2Y4Y A;  1GRI A;  1BCO A;  4M77 E;  5KCH A;  2GGR A;  2ZZD A;  1YJN Q;  3MKD A;  1PNJ A;  4BY6 C;  4ME7 A;  5HKC A;  2B86 A;  1JXO A;  3CCU T;  5GAN e;  2V26 A;  3QWX X;  2YUQ A;  1VA7 A;  4C5H A;  2L3S A;  2KQW A;  2KYB A;  3EGX B;  1YJW T;  1VQ6 Q;  1M90 R;  1TSF A;  1WHH A;  1LCK A;  2DXB A;  1Q82 C;  4BDY A;  2MK5 A;  1I8F A;  1PD0 A;  1Q86 R;  3FJ5 A;  1D1A A;  1YIT Q;  2P0K A;  5KH6 A;  2DE0 X;  1C1A A;  2FO0 A;  1K9M U;  4M75 G;  3JCM h;  4M77 F;  1PHT A;  1T0H A;  2E1H A;  4LDY A;  2DX1 A;  5GAM j;  2BZY A;  4E7H A;  3OW2 S;  3CCU Q;  2DD4 A;  1TG0 A;  3QYG B;  5GAN h;  2D0N A;  1ZQ1 A;  3HFO A;  2LJ0 A;  2RMO A;  3VV0 A;  5KYY B;  4E7Z A;  1M9S A;  1JJ2 S;  2DL4 A;  1LNX A;  2XU8 A;  1AOJ A;  5GAO r;  2ECZ A;  1WHG A;  5HCK A;  3EGD B;  4JS4 A;  2JZ2 A;  4DBF A;  2P4R A;  2E5Q A;  3M58 A;  4NL2 A;  4FSX A;  3LGL A;  3JCM g;  5CAI A;  3JCM c;  3REA B;  2LJ3 A;  1MGQ A;  1MMG A;  4M75 D;  5DLO A;  1VYV A;  2CYZ B;  2P4T A;  2CS7 A;  4J6Y A;  2X35 A;  2AT1 B;  4E7J A;  1N8R C;  5GAN g;  1EIF A;  3VS1 A;  2JNG A;  1QW1 A;  4L6V 5;  5IXB A;  3BDL A;  2H3J A;  1OI1 A;  4M4Z A;  4DBR A;  2EKO A;  2CP0 A;  2NLU A;  4PK4 A;  5IAY A;  1LOJ A;  1M1G A;  2CGH A;  2DBK A;  4JRP A;  3UWN A;  1Z9Z A;  3BDU A;  2G3R A;  5KYX B;  1SG5 A;  1WHL A;  3RDV A;  2EJG A;  4CC2 A;  3I56 T;  1VQ8 T;  3MEV A;  2MI6 A;  3OYD A;  4X9C A;  4JJD A;  2KR3 A;  3N5B B;  1KQS S;  2DK3 A;  3EGU A;  2XDB A;  2KRM A;  1PWT A;  3RNJ A;  3SWN A;  2ZPI B;  4J6W A;  2COY A;  2YSQ A;  1GCP A;  3E19 A;  1ZX6 A;  1FXX A;  4J9I A;  1YIJ T;  1W4S A;  1CSK A;  3SHW A;  2ROL A;  1GFC A;  3EHQ A;  3CC7 T;  3M5A A;  4J9E A;  5FRN A;  1NLO C;  3MEW A;  2MOX A;  4OVA A;  2O01 E;  4EIK A;  2CP3 A;  3CCR A;  3QG1 A;  4F7U F;  1QQJ A;  2CP6 A;  3I56 Q;  1VQ8 Q;  2MWP A;  1E6G A;  3DLM A;  3I5S A;  4E6R A;  3BW1 A;  3RKY A;  1KC8 R;  3CPW S;  1M3A A;  1VYU A;  2JMC A;  3NTH A;  4M7D A;  1NEB A;  3ME9 A;  3QHS A;  1GCQ C;  3L2R A;  2ESW A;  2PUO B;  3EH2 A;  5IHK A;  4J9C A;  2A36 A;  3ER0 A;  1U8R A;  2LZ6 B;  2XK0 A;  5EC7 A;  3CCL A;  3CCQ A;  2PZ1 A;  3J7A F;  2K9G A;  1WX6 A;  3CC7 Q;  1X6B A;  2A3L A;  4A53 A;  1I4K 1;  3QJY A;  4MZT A;  1GBR A;  1R77 A;  3FLG A;  5GAN 5;  4DEX A;  2FB7 A;  3G1J A;  2CZ6 B;  3GP8 A;  2SEM A;  2ZPG B;  3THK A;  4II1 A;  4M78 A;  1YI2 A;  2RHY A;  4M77 C;  3OS5 A;  1JU5 C;  4JLG A;  2HD0 A;  3ULR B;  1TXQ A;  3URG A;  2VXF A;  1JO8 A;  3JCM b;  3NPF A;  4CI0 C;  5DY9 A;  2DL8 A;  3V8J A;  1BIA A;  2NUZ A;  2I2L A;  3JB9 I;  4ELZ C;  3OYG A;  2LX7 A;  1YHQ T;  3CME T;  3MJX A;  1AWW A;  1AHJ B;  1YJ9 A;  4DBQ A;  1KC8 C;  4HT8 A;  2AK5 A;  2JUF A;  1WIE A;  3HP9 A;  3RBB B;  3QZ5 B;  2HL5 C;  2DYI A;  1UGV A;  2HEQ A;  3PVL A;  1VQP T;  4F7U B;  1M3B A;  4BDZ A;  3P8B B;  1VIF A;  4Y92 A;  3J80 E;  1E7O A;  4JRK A;  1AWJ A;  1PSE A;  1MND A;  2P84 A;  4C92 F;  4MZM A;  4RG2 A;  4XK8 E;  4M75 E;  2FPE A;  1R0B G;  4OB0 B;  5GMK m;  1RI0 A;  1UHF A;  3RR6 A;  3VRY A;  2IVW A;  4QVD A;  1YHQ Q;  3CME Q;  1ZSZ B;  3RUX A;  1FMK A;  2XIC A;  1ZHI A;  5GAN 4;  2J6O A;  4D8D A;  2NYS A;  3FRN A;  3RER A;  2YXY A;  3G4S A;  3JB9 H;  1BI3 A;  1VQP Q;  1ZUK A;  4PJJ A;  4RUG A;  4J9B A;  4FIB A;  5KYW A;  3TSZ A;  5GAN 6;  3L1A A;  2AHJ B;  1KHI A;  3NTK A;  3L2Q A;  3QJ6 A;  3EG2 A;  2K5I A;  4C0F A;  3ASK A;  4J5Y A;  1M1F A;  3C0C A;  1JBM A;  3QDR B;  2F69 A;  2LJ1 A;  4HCZ A;  5CIU A;  4ZGE B;  1IGU A;  4M75 F;  1X2Q A;  3QWY A;  2HL3 A;  1K73 C;  1QKW A;  2KE9 A;  3VKI A;  4DQ2 A;  1WJR A;  2YRV A;  1HXD A;  3CMA A;  6AT1 B;  1D3B A;  4RKU E;  3JCM Q;  1N6A A;  1PC0 A;  1H92 A;  2E65 A;  3S3O A;  2LQ8 A;  2EQU A;  3T9N A;  1AVZ C;  4B9X A;  1M90 U;  2COW A;  3A1P A;  4QW2 A;  3CCE A;  3X26 B;  4RCC A;  4QQG A;  5J3B A;  4XAX B;  3OYM A;  4C92 B;  3CXC S;  2M0O A;  1JB0 E;  2HAX A;  3LH0 A;  3H0F A;  2WSC E;  1VQ9 A;  1NEG A;  3H9N A;  4IUR A;  4FCY A;  1IGQ A;  1V29 B;  4OB3 B;  1G3T A;  5I21 A;  2GFU A;  2RQV A;  2KMT A;  2MAM A;  2RHX A;  4JJB A;  4Z88 A;  3OMC A;  4PLL A;  1BCM A;  5A0G A;  1Q81 U;  5GMK e;  4C0D B;  2DVJ A;  2EWN A;  1HJD A;  1MMD A;  3LWH A;  1VQO Q;  4KUL A;  2RJD A;  1O9S A;  2EYY A;  3AT1 B;  4C8Q B;  1UUE A;  3EGX A;  2HSP A;  1JEG A;  4AFU C;  3VRZ A;  1VQL A;  4OMQ A;  4AFS C;  4QVC A;  4X1V A;  4N4I A;  5A2Q E;  1WHK A;  2NUT B;  2XI9 A;  3U23 A;  4IUQ A;  3UT1 A;  3VUZ A;  3MP8 A;  2ZPB B;  1C6V X;  2DL3 A;  4M7A G;  1ABO A;  1HD3 A;  3OQ5 A;  5FRO A;  1Q7Y U;  2QDY B;  1EX4 A;  2FZK B;  1GXI E;  3JCM d;  4L59 A;  4AG1 C;  2XKO C;  3CD6 Q;  2KK4 A;  1R8O B;  1S72 A;  3M0U A;  1B34 B;  5A0D A;  1QVF P;  3S3M A;  4HT9 A;  2MCN A;  1JRI A;  2EQK A;  1SKU B;  5KYY A;  4RMO A;  3CCJ A;  1UHC A;  3HHT B;  5GAN d;  1LPL A;  3E9F A;  2L2P A;  2FG0 A;  4C92 C;  3CCR T;  3UDC A;  1M8M A;  4V2S A;  3EGD A;  1Y57 A;  2BIV A;  1OYX A;  3A8M B;  4XTV A;  3FIF A;  2SRC A;  1AZG B;  3OBW A;  5GAM h;  4C0Z A;  3G7Z A;  1WQ7 A;  1YP5 A;  4FYV B;  1GCQ A;  4M7A D;  2CKK A;  3L2U A;  2RO0 A;  1FX7 A;  4HVV A;  3OYK A;  3CCL T;  1AEY A;  2HNI A;  3CCQ T;  2QQ9 A;  1I5L A;  2X4J A;  2JVV A;  3X20 B;  3Q1J A;  5GMK l;  2FRY A; 
#chains in the Genus database with same CATH homology
 4LDU A;  1WJS A;  1ZBX A;  4M77 F;  3KBG A;  4M75 C;  1W2B S;  2E1H A;  4LDY A;  1Q86 U;  4J6X A;  4RCB A;  4LDW A;  3L2V A;  1VQ4 A;  2MWO A;  2L3R A;  5GAM j;  4E7H A;  1YI2 T;  3A8L B;  5J39 A;  3OW2 S;  3EAE A;  1PSF A;  5L8R E;  2DD4 A;  1BKB A;  5J26 A;  4DOW A;  2VGN A;  4BY6 B;  2EJF A;  1XQH A;  3QYG B;  5LJ5 h;  5GAN h;  3CCS T;  4HCC A;  2RA2 A;  4LD9 K;  2P0Q A;  1ZQ1 A;  2LTO A;  2GFA A;  3HFO A;  1UEB A;  2WAC A;  2FVU A;  2P0P A;  4N0A C;  5AYF A;  3RMS A;  4Q5W A;  5LJ3 g;  1KG1 A;  3V7S A;  5C6S A;  2JTF A;  4IUP A;  2D0Q B;  3VV0 A;  3KXT A;  1U1S A;  3HPW A;  3OYF A;  1WGS A;  1M9S A;  1JJ2 S;  1XTD A;  5KE2 A;  1H64 1;  4M78 F;  2HQE A;  3VUB A;  3CC4 A;  4JUV A;  1LNX A;  1Y7X A;  2XU8 A;  1YJ9 T;  2EFI A;  5GAO r;  2M16 A;  3SB2 A;  2DZC A;  3X24 B;  3CCM T;  1K9M C;  4JS4 A;  2B8A A;  2JZ2 A;  3PMI A;  4MDW A;  5CKB A;  4C92 E;  2E5Q A;  3M58 A;  1N27 A;  2GQV A;  1QP2 A;  4FSX A;  3LGL A;  4NL2 A;  3JCM g;  3OYC A;  4TVR A;  5CAI A;  4BE0 A;  4EMH A;  1QVF S;  3JCM c;  1XNI A;  2A7Y A;  3EFR A;  5FU7 C;  2DPP B;  3OB9 A;  1MGQ A;  4M75 B;  4M75 D;  5DLO A;  2CYZ B;  2P4T A;  1BIB A;  1NJI U;  2CS7 A;  5LJ3 f;  3RKX A;  3H6Z A;  4J6Y A;  2X35 A;  4QQD A;  3PT9 A;  2QA4 A;  4E7J A;  2QQR A;  3BFM A;  5GAM e;  3R6O A;  1N8R C;  2L89 A;  5LJ5 g;  5GAN g;  4UC4 A;  1EIF A;  1N9S A;  2JNG A;  1QW1 A;  3BY7 A;  4L6V 5;  2YHT A;  3BDL A;  4CRI A;  3ZBD A;  2H3J A;  1OI1 A;  3GPL A;  2OTL A;  2IG0 A;  2EKO A;  2OAU A;  3GNG A;  3G6E A;  2E12 A;  5FRM A;  2MF2 A;  2NLU A;  5IAY A;  1LOJ A;  5KCO A;  1M1G A;  2CGH A;  3OYA A;  3F70 A;  4OB2 B;  2QQS A;  4JRP A;  3CC2 A;  3UWN A;  5CR2 A;  2FL7 A;  4C5G A;  3HKS A;  4C5I A;  3JCM W;  5CKF A;  2LDM A;  4D6W A;  1Q82 U;  1FWZ A;  3BDU A;  4QQ6 A;  5DM7 R;  3G4S T;  1VQ7 A;  3A5Z B;  3NFC A;  4C8Q E;  1LJO A;  2G3R A;  4RG8 A;  2DTO A;  3MCA B;  4LD6 A;  2M1H A;  1P92 A;  4MZP A;  3VYH B;  1YBY A;  2EJG A;  3I56 T;  3RIR A;  1VQ8 T;  4XQ3 A;  5M9O A;  3M4G A;  4PKC C;  3MEV A;  1W2B A;  2MI6 A;  1YJN A;  2XG8 D;  3LGF A;  4JRQ A;  3OYD A;  3C12 A;  4X9C A;  3P8D A;  4HCB A;  4XU2 A;  2C06 A;  3JB9 F;  4ATO A;  3LLR A;  3N5B B;  5GAN d;  2DK3 A;  5FU7 B;  1KQS S;  3OYY A;  2MMP A;  4PJO F;  3OW2 A;  3TEE A;  2PUK B;  2XDB A;  5GAN 8;  3SWN A;  4BAC A;  1YCY A;  2ZPI B;  3HFN A;  1NJI C;  4HA8 A;  4J6W A;  3RES A;  1VQ6 A;  3SD4 A;  4PJO A;  5GAO n;  3MET A;  3E19 A;  4JS5 A;  3E9G A;  3OSV A;  2R5M A;  3FJP A;  3TCJ A;  5KE3 A;  2OTJ A;  4BD3 A;  4EDU A;  2V8K A;  1BI0 A;  2BKD N;  3QO3 A;  1FXX A;  1YIJ T;  1W4S A;  1JJ2 A;  3JAM E;  4FM4 B;  4IUV A;  4X34 A;  3CMA T;  2R5A A;  1WNL A;  3RKW A;  1YIT A;  4E7I A;  3CC7 T;  3M5A A;  3JCM J;  3GLX A;  3QXE B;  5GAN 3;  4C8Q F;  2K5L A;  5FRN A;  1I81 A;  3MEW A;  4X9D A;  3VYG A;  4OVA A;  2O01 E;  2K57 A;  4JJN K;  1SSF A;  3M9Q A;  5CKE A;  4ZGJ B;  3QG1 A;  2CZ1 B;  3OYJ A;  3CCR A;  4F7U F;  2MWP A;  1VQN T;  2L8D A;  3SWN C;  4PJO G;  3WXM B;  5HK0 A;  2DKG A;  3QUI A;  4VUB A;  1QVF A;  4BI8 B;  2QEX T;  3J81 E;  3OSS C;  4F7U A;  3OYI A;  1RL2 A;  2GCX A;  3DLM A;  2YLB A;  3CCE T;  3BW1 A;  3RKY A;  3CPW S;  3CCU A;  1X75 C;  1VQK A;  3PNW C;  4R55 A;  3NTH A;  4M7D A;  3ME9 A;  2PVD B;  1IRE B;  3M57 A;  4J7F A;  3QHS A;  3V8K A;  3OYE A;  3M59 A;  2QTX A;  1G3S A;  1YJW A;  3L2R A;  4ZTJ A;  1VQ9 T;  2PUO B;  2DVE A;  4M77 A;  3JCM h;  2XID A;  3ER0 A;  5CO7 A;  3CCV A;  2KY9 A;  1U8R A;  4IKF A;  1QVG S;  1KC8 U;  2XK0 A;  5GAM g;  1N8R U;  2L5Q A;  3CCL A;  3G71 A;  1G5V A;  5GAN f;  3CCQ A;  4L5G A;  4M7A E;  4BI4 A;  2O4X A;  1VQM T;  2LT4 A;  4F7U G;  2JOY A;  5CVI A;  3J7A F;  2QEX A;  5I2M A;  4BE2 A;  5CQY A;  3OA6 A;  1O75 A;  4E7L A;  1VQO T;  4M7D E;  2LVM A;  3MEA A;  2K2V A;  1NPR A;  4MMK A;  2A3L A;  4A53 A;  4M7D G;  1I4K 1;  2RK1 A;  3C4S A;  3QJY A;  1WQW A;  4MZT A;  4J8O A;  4BUG A;  4M7D C;  4A4E A;  2YLC A;  4PL6 A;  3FLG A;  4MML A;  4P5N A;  1Y96 A;  2FB7 A;  4FL6 A;  4E47 A;  2CZ6 B;  4M77 G;  1G3Y A;  4EMK A;  5CKD A;  3GP8 A;  1K8A U;  2ZPG B;  4OGC A;  1M1K U;  4II1 A;  4M78 A;  1YI2 A;  2RHY A;  2PU9 B;  4M77 C;  3M53 A;  3SWN B;  2E70 A;  3OS5 A;  4JLG A;  4O5V A;  5LJ3 j;  2HD0 A;  2DJZ A;  3GOX A;  2JTM A;  3P8H A;  4PJO B;  3QII A;  4ZN1 A;  3URG A;  1KQS A;  3CCS A;  4J7I A;  4PJO D;  2QQB A;  2RI5 A;  2VXF A;  2DD5 A;  3JCM b;  3C94 A;  3QBY A;  3MHX A;  4CI0 C;  5DY9 A;  1KQ2 A;  3V8J A;  1BIA A;  2LNV A;  3A8O B;  3SDZ A;  1VQL T;  2I2L A;  5GAO m;  5GAM f;  3JB9 I;  4KT0 E;  4ELZ C;  3OYG A;  3UPU A;  4JDS A;  2K3X A;  3FEO A;  2K3Y A;  2RI3 A;  5GAN 7;  3CME T;  1YHQ T;  4M7A F;  1AHJ B;  4FT2 A;  5CK9 A;  1YJ9 A;  4M78 G;  2HQX A;  2E41 A;  2LC4 A;  4J83 A;  4A4G A;  1KC8 C;  4JLI A;  4HT8 A;  3CD6 T;  2JUF A;  3HP9 A;  3A8G B;  4M78 C;  2M9U A;  4OP0 A;  3CCM A;  3QZ5 B;  3OYL A;  1HK9 A;  1XOV A;  2V8J A;  1VQP T;  1BI2 A;  1WJQ A;  5CKH A;  4F7U B;  3FDR A;  4BDZ A;  2RH2 A;  4XTU A;  5LJ3 d;  2LT1 A;  4BI3 A;  2BUD A;  3P8B B;  2LX9 A;  1UGR B;  4NS5 A;  1VIF A;  3JCM X;  3J80 E;  4M7D B;  1BYM A;  4M7D D;  4JRK A;  4XTX A;  1PSE A;  3CBM A;  2RI2 A;  1K8A C;  4ELY C;  1M1K C;  3JCM f;  4BB7 A;  4R56 A;  1N9R A;  3JCM P;  3CPW A;  4C92 F;  2PVG B;  4M77 B;  3QKJ A;  4M77 D;  4MZM A;  1VUB A;  3JB9 J;  3KUF A;  4FT4 A;  4RG2 A;  4XK8 E;  3CCJ T;  4PNO A;  4M75 E;  1K73 U;  4OB0 B;  2K5F A;  2KDS A;  1OZ2 A;  3WVE B;  5GMK m;  1WPY A;  4FU6 A;  4C92 A;  2O4X B;  5GAN 2;  1RI0 A;  3LYI A;  4XU3 A;  2EYQ A;  2IVW A;  2EQJ A;  2QQA A;  1NZ9 A;  2DXU A;  2RM4 A;  2VXE A;  4GLK A;  3A8H B;  4QVD A;  3RUX A;  1QVG A;  1KD1 C;  2XIC A;  5LJ5 f;  1ZHI A;  1Y07 A;  2DAQ A;  1DJ7 B;  3SFM A;  2VYT A;  2FYK A;  2E64 A;  1UGQ B;  3FRN A;  5GMK h;  1YIT T;  3MP1 A;  2K4Y A;  3RER A;  3HRS A;  3G4S A;  3JB9 H;  2D9T A;  1U1T A;  1BI3 A;  1Y71 A;  2HBP A;  3M4Y A;  3PMT A;  2DTI A;  1Y96 B;  2ZCF B;  3I55 T;  5FLX E;  2QXF A;  2Y90 A;  4FIB A;  4M78 B;  4M78 D;  3DKM A;  3I56 A;  4WF2 A;  5GAN 6;  1VQ8 A;  3DB3 A;  2EJ9 A;  3L1A A;  2AHJ B;  5EG2 A;  2DZ9 A;  3M56 A;  3QYH B;  5FU6 C;  1KHI A;  4C92 G;  3NTK A;  4LDX A;  3L2Q A;  3QJ6 A;  2F5T X;  2GF7 A;  2K5I A;  4C0F A;  3ASK A;  1VQ5 T;  2JN0 A;  4J5Y A;  1M1F A;  5CIU A;  1JBM A;  3QDR B;  2F69 A;  4HCZ A;  4ZGE B;  4QVZ A;  1NPP A;  3JB9 G;  4NOY A;  4EPC A;  3JRZ A;  4M75 F;  3C95 A;  4C8Q A;  2Y4X A;  4B9W A;  5DLQ E;  5HY6 A;  4MDX A;  4LDV A;  4PJO C;  1K73 C;  3GIB A;  3HSB A;  1M8V A;  5LJ3 h;  2X4W A;  4IUT A;  2E6Z A;  2WSF E;  3VKI A;  1YIJ A;  2RHU A;  4DQ2 A;  1WJR A;  2YRV A;  2KSS A;  3INZ A;  4OGE A;  1HXD A;  3CMA A;  5GMK j;  1VQ4 T;  1D3B A;  4KBM B;  3MP6 A;  4RKU E;  4A4K A;  4C5E A;  3JCM Q;  3CC7 A;  2XHC A;  2DIQ A;  1N6A A;  4C0D C;  3PFS A;  1UGP B;  2RJC A;  2E65 A;  3QZ9 B;  3S3O A;  4C8Q G;  2LQ8 A;  2EQU A;  3EFS A;  1VQN A;  5IT9 E;  4C8Q C;  3T9N A;  2ZPH B;  4XTY A;  5A0L A;  4B9X A;  1M90 U;  4Z02 A;  4QW2 A;  3CCE A;  3ZFJ A;  5FU6 B;  3X26 B;  4RCC A;  3WVD B;  3CC4 T;  2E6N A;  4QQG A;  2RD1 A;  5J3B A;  4XAX B;  3OYM A;  4C92 B;  2CZ7 B;  2PVO B;  4C92 D;  3PIO A;  4KUD K;  3CXC S;  2M0O A;  1B34 A;  1JB0 E;  2HAX A;  3LH0 A;  3HL8 A;  2DO3 A;  2WSC E;  1VQ9 A;  2VUB A;  4A54 A;  3DB4 A;  4ZTF A;  5D6X A;  4ZN3 A;  4IUR A;  3LWI A;  3OYH A;  3L2Z A;  1V29 B;  4OB3 B;  1G3T A;  3V7R A;  3JB9 D;  1QP3 A;  5I21 A;  4E7K A;  3OMG A;  2GFU A;  3MO8 A;  3VJP A;  1VQM A;  4XU1 A;  2KMT A;  1KQ1 A;  5GMK i;  2MAM A;  3TU4 K;  3QSU A;  2F5K A;  2RHX A;  2XDP A;  1VQO A;  3OMC A;  1KHC A;  4PLL A;  1KD1 U;  5A0G A;  1Q81 U;  1MHN A;  4IUU A;  5HK3 A;  3DLL A;  3CPF A;  4OB1 B;  5GMK e;  4A4F A;  2X4X A;  2EWN A;  4C0D B;  2QA4 T;  3X25 B;  2X4Y A;  4DOV A;  3PGG A;  4EMG A;  3HRU A;  4EMK C;  3LWH A;  4KUL A;  2OTL T;  2RJD A;  1O9S A;  2E10 A;  5LL6 S;  4C8Q B;  3G6E T;  4Y28 E;  2PQW A;  2KAF A;  4C8Q D;  2DTH A;  5GAM d;  4M7A A;  1M4Z A;  3FC3 A;  1OZ3 A;  1M90 C;  2R57 A;  3L42 A;  2VV5 A;  3CC2 T;  1X6O A;  2EAY A;  2LRQ A;  2VC8 A;  1VQ7 T;  1VQL A;  4QVC A;  5GAN 5;  3AHU A;  1M5Q 1;  3NTI A;  5CCA A;  5IN1 A;  1Q86 C;  1S72 T;  1BI1 A;  3VU3 C;  4N4I A;  1QVP A;  4PJO E;  1D3B B;  5A2Q E;  5LJ5 j;  5GAN j;  2XI9 A;  1TH7 A;  4O6J A;  1YHQ A;  3CME A;  3OYB A;  3E1S A;  4IUQ A;  3O8V A;  5GAN 4;  1YJN T;  5GAO q;  3UT1 A;  3VUZ A;  5C0M A;  1UGS B;  2FHD A;  2ZPB B;  3MP8 A;  3CD6 A;  4M7A G;  2RJE A;  3M54 A;  2LCC A;  5D6W A;  4HKE A;  3X28 B;  5LJ3 e;  2ZPE B;  3OQ5 A;  4M7A C;  4KUI A;  5FRO A;  2QDY B;  5I2S A;  2XDD A;  1VQP A;  3ZEH A;  1Q7Y U;  3CEY A;  3M55 A;  4ZGD B;  1GXI E;  4XU0 A;  3TRE A;  3JCM d;  2R58 A;  4L59 A;  2DEQ A;  1Q81 C;  3GF5 A;  2XKO C;  1VQ6 T;  2KK4 A;  3MEU A;  3RMQ A;  2OTJ T;  2KVQ G;  1R8O B;  2RHI A;  3PTA A;  4OF1 A;  1S72 A;  1B34 B;  5A0D A;  3OBY A;  4OMF B;  4EMK B;  3JSC A;  2CZ0 B;  4F7U E;  3S3M A;  4HT9 A;  1IZ6 A;  3GNF B;  4XTZ A;  4YTL A;  4BE1 A;  1JRI A;  2EQK A;  4RMO A;  3LX7 A;  2EQM A;  4PLI A;  3HHT B;  3V8L A;  2EIF A;  3JCM V;  2ZPF B;  3CCJ A;  2RJF A;  4C0G A;  1VIE A;  3QPH A;  2LCL A;  2QI2 A;  3E9F A;  3H8Z A;  5D6Y A;  5LJ5 d;  3JCM e;  3CXC A;  2ZGW A;  3HRT A;  5GAO l;  3OY9 A;  1G3W A;  2V8I A;  4DA4 A;  2RK2 A;  4C92 C;  3CCR T;  2Y4Y A;  5KCH A;  4M77 E;  4N4H A;  5CQX A;  3UDC A;  4V2S A;  1UB4 A;  2ZZD A;  2BIV A;  5GAO p;  1OYX A;  3A8M B;  4XTV A;  2VGM A;  4N4G A;  3FIF A;  4NL3 A;  3OBW A;  5GAM h;  2WSE E;  4BY6 C;  4ME7 A;  4C0Z A;  5HKC A;  3OYN A;  2DIG A;  3G7Z A;  5GAN e;  5LJ5 e;  3CCU T;  1VQK T;  2XD0 A;  4M75 A;  1WQ7 A;  3CBO A;  4C5H A;  3FB9 A;  4JRI A;  2KQW A;  1H3Z A;  4M7A B;  2D6F A;  4M7A D;  1YJW T;  3I55 A;  1Q7Y C;  2CKK A;  4A4H A;  3L2U A;  3L2W A;  3OS0 A;  3S3N A;  2RO0 A;  1FX7 A;  1NE8 A;  2RHZ A;  2DXB A;  3CCV T;  1Q82 C;  4GY5 A;  3OYK A;  1VQ5 A;  3OS2 A;  4BDY A;  4M78 E;  3S6W A;  3CCL T;  3G71 T;  1I8F A;  2HNI A;  3LW5 E;  4Y91 A;  3CCQ T;  2QQ9 A;  1I5L A;  4N0A A;  2X4J A;  2P0K A;  2LQK A;  3PIP A;  5KH6 A;  2JVV A;  4M7D F;  3V7C A;  2DXC A;  3X20 B;  3Q1J A;  1K9M U;  2DXT A;  1X01 A;  5GMK l;  4M75 G;  3OS1 A;  2RB6 A;  3CBP A;  4XTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...