3MHXA

Crystal structure of stenotrophomonas maltophilia feoa complexed with zinc: a unique procaryotic sh3 domain protein possibly acting as a bacterial ferrous iron transport activating factor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVGFTRFALRISEAKRVVVDAASQERRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport activating factor
pubmed doi rcsb
source organism Stenotrophomonas maltophilia
molecule tags Metal transport
molecule keywords Putative ferrous iron transport protein A
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mhxA00
2QQBA 1U8RA 1G3TA 1G3YA 2QQAA 2K5IA 3E19A 2H3JA 1BI2A 1QVPA 2K5FA 1BI1A 2GCXA 3GLXA 2K5LA 1FX7A 1P92A 3MHXA 1BI3A 3HRTA 3HRSA 2K4YA 1G3SA 3HRUA 4O6JA 4O5VA 2LX9A 1QW1A 1BYMA 1G3WA 5CVIA 1BI0A 2QQ9A 1FWZA
chains in the Genus database with same CATH superfamily
4RTVA 4XU0A 2K3XA 4JUVA 4C8QF 3WVEB 4KULA 1C0MA 2FO0A 1PCXA 1AEYA 2XD0A 3BDUA 2EIFA 3VS1A 1VQOT 2E64A 3NHNA 2I2LA 4L5GA 3M0SA 2PZ1A 2YRDA 3OYJA 1KQSS 2LX9A 4HKEA 2O2OA 3HPWA 3QPHA 1AHJB 3OSSC 4NS5A 5LJ5e 1KJWA 3RNJA 1RABB 3MCAB 4DEXA 3V7SA 1K0XA 3HHTB 3SHWA 3OYMA 1G5VA 2M02A 1GCQA 1AOJA 4EMKB 1Q7YU 1X43A 5GAOl 3OS2A 2IG0A 1IGUA 3A1PA 2E5QA 2EYZA 3S3MA 3NTHA 1HK9A 2KYMA 2R58A 3PMTA 4MDXA 1Z9QA 1F1BB 2F2WA 4ZGJB 4DOVA 3M0UA 4C92A 4KT0E 3GNGA 1TUCA 1WNLA 1ZX6A 1RAEB 1X27A 2DKGA 4XU2A 1SRMA 3CPFA 4HT9A 3META 3OYBA 2ZPIB 1CSKA 3I55Q 1K9AA 4RKUE 3VS4A 1M4ZA 2IVWA 2RMOA 1TUDA 3EGXB 4BDYA 2NYSA 3QG1A 4CC7A 5A2QE 4ZGDB 1SPKA 3LW5E 2VV5A 5LJ3f 1VQOA 1Y0MA 1CKBA 3THKA 1YITA 3V7CA 1IHWA 1H8KA 5EC7A 2EQUA 4F7UA 2ZPEB 4M7DF 1NYGA 2A08A 4FT4A 3CXCS 5GMKm 4Z8AA 4AFQC 3EGDA 1BCMA 2CT3A 2R5MA 4AG1C 1LVKA 2NUTB 4RTXA 1VUBA 4E7KA 3OYGA 3CBOA 2LCCA 1MNEA 2DEUA 2O9VA 1U3OA 1QCNA 2YRCA 2X9HA 3RBBB 3CC4T 2QA4Q 1AVZC 2AKLA 1VIFA 2VVKA 4M75A 4BE0A 3H6ZA 3P8HA 4LD6A 3FIFA 3AHUA 4XU1A 1RLPC 3MP1A 3UATA 4J9HA 2KE9A 4E2FB 1BBZA 5GAN2 3UT1A 1QCOA 1S72A 3JCMg 3CD6A 3NPFA 2HSEB 3CCJA 1LJOA 2EGCA 1C6VX 2OTLA 4F04B 2LQ8A 3DB4A 2B8AA 4R55A 2DAQA 3QWXX 1Q86R 1WX6A 2K2VA 2NUPA 2W10A 5CIUA 4QQGA 1U8RA 3LWHA 1K73U 1HD3A 2VWFA 4Y92A 5LJ5h 2JW4A 1GXIE 2ED1A 1E7OA 1UGQB 2BZYA 2HQHA 3CMAA 2G6FX 4A4KA 5GAOr 3TSWA 1X6GA 2L2PA 2LX7A 5GAMe 3MP6A 3JV3A 4PLIA 1BK2A 2XIDA 4PJOC 2PTKA 2CZ7B 1X6BA 1YFNA 1D09B 3LH0A 2D8HA 3JCMW 1VQPQ 3MJXA 4J5YA 5I2SA 3M0PA 3ME9A 3VUZA 4J9CA 3NGPA 3UF4A 3OMGA 3GF5A 3ZL7C 4XTUA 3S3OA 4KH1B 2CUBA 4J9FA 1M5Q1 3A8HB 2RB6A 1D1CA 9ATCB 1RAAB 2RA2A 3FJ5A 4F14A 1JXMA 1AT1B 2HD0A 4KH0B 2CP3A 3CC4A 1Q82R 3CCLT 2V8IA 2HCKA 3V8JA 2EFIA 1RLQC 1AWOA 4GY5A 4HA8A 4X34A 1M90U 3REBB 1QVFS 2EKOA 2FPDA 4X1VA 1KQ2A 2EGEA 3MHXA 3UPUA 1VYVA 3KUFA 3CC2T 2ENMA 4M77B 5CVIA 1VQ5T 2DFUA 3NTKA 1PKSA 4II1A 4LUDA 1MMNA 2P0KA 4OMNA 3M55A 1U5SA 1M90C 3M58A 2KXCA 1FMKA 2K9GA 3G4ST 2HAXA 1QQJA 4BY6B 3SB2A 1GBRA 2KY9A 3G4SQ 1ZLMA 1KD1C 4WCIA 2F2VA 2O9SA 3CCET 5GMKh 4LDWA 4M7DA 2MOXA 4HCBA 3CCQQ 4OMPA 2CSIA 2CGHA 1VQNA 1ACMB 1JO8A 1SEMA 3OBYA 1GBQA 1D3BA 2KMTA 4M77F 2DRMA 2LZ6B 2FG0A 3CMAQ 5GANj 4E7JA 2EBPA 3CCUQ 4JZ4A 2DF6A 2KRNA 5CKBA 4M7AF 2E4HA 1B34B 3QBYA 3CCEQ 1I5OB 1E6GA 1W1FA 1BI2A 1OU8A 3EFRA 5FWBA 1BI1A 3BW1A 3GLXA 3NTIA 1N9RA 4HCCA 3M5AA 1FX7A 1YWOA 1H641 2K3BA 3OSVA 5CKHA 1W4SA 4A4FA 4LDYA 3CBPA 3EH1A 3I9QA 2JVVA 2RHYA 4PJNA 3VRYA 3Q1JA 2CP7A 4JS5A 5I22A 2RHZA 4WTOB 4ANJA 1VQLQ 5IH2A 4KBMB 3MEWA 1OPKA 1R77A 1EX4A 1U06A 1TH7A 2HKNA 4LUEA 3EGUA 4DBHA 1ZSZB 5J39A 3M54A 3EGXA 2LTOA 2CP5A 2QI2A 2XMFA 3EG9A 4PFZA 2LP5A 1OU9A 5IHIA 3H0FA 3QIIA 5I2MA 1JRIA 2MPXC 5HKCA 2KROA 1M1FA 4JRPA 4J6WA 2IPOB 3OY9A 5GANd 4C8QA 1JJ2S 2AKKA 3FJPA 4C5GA 2A28A 2A7YA 4J6YA 4BY6C 1PNJA 4M7AE 3CEYA 4KUIA 3KFVA 1RACB 3JB9D 2Z0WA 2LDMA 1VYTA 1QLYA 3UA6A 1XNIA 2EVRA 2RI2A 4LDVA 2KRMA 3CCMT 2OTLQ 2DX1A 4FYXB 2X4JA 4DQ2A 1LOJA 2RJEA 3MO8A 1V29B 2YWWA 2HL5C 2HQEA 2YSQA 3MEUA 3JB9H 2YUOA 1NJIC 3CXCA 3QHSA 3JCMc 3OYHA 1RAGB 3VYGA 4RMOA 4C5EA 4OGCA 1QVFP 1TSFA 5CKEA 5GMKj 1ZHIA 2H3JA 5D6YA 3OYFA 2ESWA 1K9MU 4M7AB 2ZPGB 2BZXA 1VQ6A 4OMQA 2WSFE 3L2UA 4J7IA 2BTTA 1M30A 4JZ3A 1NLOC 3OYLA 4PFPA 1YJWT 5CKDA 3MEAA 2NWMA 3L2WA 4AFUC 1UHFA 2RJFA 2DXTA 2LQKA 2NLUA 2FL7A 1EFNA 3I55A 5AYFA 3M4GA 1H3HA 1K8AU 1BB9A 4L59A 1YJNA 1N27A 3LYIA 1NBEB 1QVGP 2M16A 1S72Q 1Y71A 2O31A 2DVJA 1WZOA 4C8QC 4C92G 2XKOC 5ECAA 1KD1R 4F17A 1MGQA 4M7AA 4LDXA 2DD5A 2EW3A 4ORZA 2GFAA 5FROA 4BI3A 1BI3A 2FRWA 5GANh 4ME7A 2RM4A 4E6RA 2CZ1B 1Q82U 2JUFA 4QVZA 4M78D 2CYZB 2HKQB 2BKDN 2R57A 4RTTA 2EKHA 1WFWA 1SF9A 3OW2S 3M59A 1MNDA 3TU4K 1UFFA 4DBRA 2QA4A 1VQ5Q 1JXOA 4HXJA 4TVRA 1DJ7B 1D0YA 3CC7A 4F7UG 4OMMA 5GAN4 2YLBA 4IUVA 4LNPA 5DY9A 5FU6B 2OTJA 2P0QA 3KXTA 3RIRA 3TCJA 2VXFA 3R6OA 2CP6A 5IT9E 4A4HA 2DM1A 1M1KC 2CP0A 4FIBA 3C0CA 1QKWA 1WHMA 4L6V5 5LJ5d 3A8MB 2RK2A 1VA7A 4OMOA 5KCOA 2V1RA 1WJSA 4E47A 1G3SA 1KD1U 3EFOA 3PGGA 2MI6A 2C06A 3VV0A 3QDRB 4PJOB 3OA6A 2M0OA 3VKIA 5GAMf 1T0HA 4M78G 1ZSZC 1M8VA 3X25B 3H9NA 4DOWA 1GL5A 5CCAA 2GF7A 5HCKA 1FYNA 1N8RC 3RMSA 5DLQE 1R8OB 1VQ4A 1TOVA 4Z89A 2XICA 1D1BA 4M78B 1K4US 1Q86C 2L3RA 5L23A 2F5TX 2Y90A 4M77C 4FW2A 3CMAT 5GMKl 5GAOm 3G71Q 1YITT 3PFSA 4O5VA 3SWNA 5CR2A 3M4YA 2SEMA 2DERA 2QASA 3CC4Q 1T3LA 2QA4T 2GBQA 3A5ZB 5LJ5j 4C92D 2CDTA 3TQ7P 3GPLA 1NPRA 5HY6A 1Q81U 4ZNXA 1VQ9T 2KYBA 3OYNA 1H3ZA 4GLMA 1NEGA 2OTJT 2YDLA 3CBMA 2QTVA 3NFCA 2X4WA 1XOVA 5GANe 4UC4A 2BZ8A 3LX7A 1NLPC 1VQ6T 3BDLA 2D9TA 3N5BB 3OS0A 3FDRA 2PVOB 3CD6Q 1ZQ1A 1Q81C 1UG1A 6AT1B 5DM7R 4R0KA 2DIGA 3EG2A 2DL8A 2VYTA 2F2XA 2K5LA 2GGRA 4MZTA 3E2UA 2ZPBB 5KYYB 3DB3A 2D0NA 2FPFA 1ZA2B 1SHFA 1WLPB 2DL7A 5GANg 1PKTA 4DBFA 2DYBA 3SEMA 1YCSB 1ZSGA 2KGTA 1JBMA 2DILA 1YJWA 1QP3A 3C4SA 1Y96B 2JOYA 5GAN7 4J9BA 2RF0A 2KNBB 2YT6A 3I35A 2M9UA 2O4XA 2RJCA 3I56A 3FC3A 3WVDB 2A3LA 2AT1B 3HKSA 3VU3C 2VGMA 5DLOA 2X4XA 4HVVA 1WJQA 3IQLA 1RAFB 2H8HA 3CCUA 1VQ8T 3JB9J 5GJVB 1NE8A 3CCJQ 4A54A 2K6DA 3G6EA 2RJDA 3QUIA 1OEBA 2DVEA 2RO0A 4WF2A 4XQ3A 1WI7A 2BE7D 2DTHA 2XHCA 3RKYA 2ZCFB 2H3EB 4JJCA 4AFZC 4QQ6A 1M9SA 1MMDA 2YUQA 8AT1B 1YNZA 1VQNQ 1ZBJA 2HMAA 1M27C 4DEYA 2DL5A 2YHTA 3EAEA 3EGDB 1TS9A 2J6KA 1HYOA 4BI4A 2I0NA 1BKBA 2HL3A 2XG8D 3INZA 4AFSC 5L8RE 2KRSA 1OQKA 2SRCA 2P0PA 3EG3A 1OI1A 1W70A 5J26A 2D0QB 5D7UA 1K73C 4EMGA 1VQKA 2KBTA 1UTIA 5FU7C 1NYFA 2PNIA 4ZN3A 2ZPHB 3TREA 2BE9B 1UGRB 2JNGA 2P4RA 3H41A 2LJ0A 1AZEA 3LGFA 4M75E 2J7IA 4IKFA 2COZA 2G3RA 4IUUA 1TG0A 1WIEA 4OB0B 4BE2A 4ATOA 3EG1A 2WSCE 4LXCA 2E3IA 4XU3A 2DBKA 3GP8A 1KQ1A 4PFOA 5HK0A 1SKUB 3L1AA 1VQ9Q 4FSXA 3M0TA 4RTUA 1VQ8Q 3CCST 1WJRA 4A4GA 5IHKA 1Y7XA 1V1CA 2C0IA 4M77E 3HFNA 5KYUB 1VQPT 4PJOG 5CAIA 1EZZB 3JCMV 3P8DA 4N4GA 2LJ3A 2HBPA 3O8VA 1AWJA 2AZVA 2F69A 2FEIA 3VJPA 2XDPA 2DLPA 1IHVA 1PRMC 4PL6A 2HEQA 1VIEA 2JTEA 3RKXA 3CCRT 1VQOQ 1RI9A 2QQBA 2EJGA 4ZTFA 2CZ6B 2PUOB 4KUDK 2DZ9A 4BACA 1KC8R 1QVFA 2BIVA 2VASA 1M2VB 2EYWA 3M56A 1OOTA 1I8FA 4OF1A 1B3QA 4PKCC 2EPDA 3QSUA 1UEBA 2X3WD 3UA7A 1RL2A 4EDUA 2DETA 4M7AC 4DBQA 1S1NA 1YN8A 2QEXA 3JCMf 2KK4A 2FVUA 1QMCA 2MIOA 4M78A 1M1GA 4JRKA 2RN8A 4BD3A 1I07A 2EJFA 4E7LA 2DMOA 1WHKA 2JS2A 4RTYA 3T9NA 1W2BS 3BY7A 1RI0A 1OULA 1WGSA 1RAHB 3TEEA 4QT7A 3GBQA 4BB7A 1QVGA 3ZEHA 3ZFJA 3J81E 4C5HA 1N9SA 1UECA 2D6FA 2KSSA 2LJ1A 1AZGB 4NL2A 1BIAA 3D7SB 5A0GA 3CCSQ 1KC8U 4D8KA 3JCMP 2QEXQ 1NPPA 2DRKA 1I5LA 3QJ6A 1G83A 1ZBXA 3H0IA 3RDVA 1M2OA 4M75F 1T0JA 2M0YA 1NJIR 2PVDB 2EQJA 2F5KA 4IUQA 2ED0A 5KCHA 4V2SA 5GMKe 2AHJB 2HBWA 3VUBA 1KFZA 3VS6A 2VC8A 4EPCA 4PJOF 2JXBA 2XK0A 4FSSA 2XU8A 3PT9A 4D8DA 2MCNA 2X35A 1PSFA 4RG2A 3OYAA 3I55T 4B9WA 1SSFA 5CQXA 4ZTJA 1VQ8A 4M78E 5GAMg 2DTIA 3L2RA 1G2BA 2XDDA 5KE2A 2E6NA 1UHCA 3M0RA 3C95A 4VUBA 1WDXA 4Z88A 1PSEA 2EYYA 2LCSA 4Y91A 1VQ6Q 2YUNA 1Q86U 3JRZA 4EMKC 2KAFA 2RHUA 4C8QD 3S3NA 2MK5A 3VRZA 3QJYA 4M75D 1GFCA 3PIOA 3SD4A 5I11A 1PC0A 1FXXA 2M51A 4E7ZA 1YJ9Q 2RQWA 4OGEA 3V8KA 1M1KU 2GQIA 1N6AA 3ULRB 2KXDA 2BUDA 2A36A 3PE0A 1QWFA 1VQMA 3A98A 2QEXT 2EQKA 3OMCA 2DXBA 1X01A 5KYWB 3OYCA 1ABQA 1YIJA 2ZAEA 1UGSB 4JRIA 1M2VA 3TVTA 1G3TA 3VS3A 1K76A 1C1AA 5FWCA 4Y28E 4J9IA 2V26A 2MAMA 3JCMd 1GFDA 2E12A 2RI5A 1UUEA 2CZ0B 4XK8E 1K9MR 1X6OA 1VQNT 4M75B 1K8AC 1XJWB 1W6XA 2RQUA 5GAOn 2A37A 3SFMA 1KHCA 4OB2B 2E3HA 1WHHA 4M75G 5M9OA 4HCKA 3I56Q 2MWOA 3HL8A 4LN2A 1VQLT 3CC7T 2C0OA 2IIMA 5KYNA 2LMJA 3CCQA 4HVWA 4MDWA 2RH2A 3MP8A 5KYXB 1M1KR 5J3BA 3L2ZA 3A8LB 2QTXA 2NUPB 4EMKA 1ZUUA 2RNAA 1VQ4T 5D6WA 4MMKA 4M77G 1WA7A 4RTWA 3CC2Q 4LE9A 2RPNA 4E7SA 4M7DE 1PWTA 2DIQA 2HDAA 4XTZA 4ELZC 1JU5C 1QCFA 5GAN8 4MZPA 1ZSZA 2JTMA 3CCLA 3CCRQ 2E41A 1Q82C 5HK3A 3VYHB 2KVQG 1BCOA 3HP9A 1KSWA 1MUZA 1YJNT 1IB8A 3EG0A 1LNXA 2RQVA 2ZZDA 4C92C 4YTLA 2K7AA 1QVGS 2AIRB 2LNVA 1D1AA 3VS0A 1WXTA 2LC4A 1QW1A 1BYMA 3LWIA 1UJYA 4FYVB 1G8XA 4DA4A 3QKJA 3PVQA 3G4SA 1UE9A 1NEBA 2E10A 3QYGB 4F7UB 2EAYA 1QVPA 4JLGA 2HZYA 3QWYA 1MMAA 4FCYA 1YI2Q 1P92A 2QAZA 1VQ7Q 2CUDA 7AT1B 3VS5A 3CMEQ 4IUPA 1M3AA 4N4HA 2J05A 1QP2A 2D1XA 4AT1B 1YJWQ 3A8GB 1D3BB 2DXCA 1Q7YC 3I5SA 2FZGB 4OMFB 4FM4B 1YHQQ 2C0TA 3DLLA 1VQ5A 4B9XA 1WYXA 3EHRA 1X2QA 1WQWA 1JB0E 2GTJA 1KK7A 1HJDA 5LJ3h 4EMHA 2VGNA 3HTRA 4C92B 2DE0X 5GAOp 1KQSA 4XTXA 3S6WA 4OP0A 1ZUKA 2RQRA 1I0CA 2EQIA 2JN0A 1VQMT 1Q7YR 3G1JA 1NJIU 2P84A 4QKUA 2L3SA 3JCMe 1MHNA 1QWEA 1X2KA 2WSEE 3OYIA 2OAWA 3U23A 3WXMB 1TTHB 2EWNA 3HRUA 4CC2A 3HSBA 5GAN5 4MZMA 4GBQA 4RCBA 5KYYA 3OBWA 1PD1A 2RHIA 2CT4A 2QQ9A 1O75A 2CSQA 2KI7A 3EH2A 3CCUT 2LVMA 4RUGA 3E19A 4KGXB 4JJBA 3RR6A 2ROLA 5FU7B 1X69A 1FMVA 4N0AC 1FMWA 3CCQT 2LNHB 1I4K1 4FL6A 2L3QA 3H0HA 3E9FA 4K11A 4A4EA 2COYA 4A53A 2DBMA 2CH4A 3QDFA 4XTVA 3CD6T 3MEVA 4D6WA 1UJ0A 5FRMA 4R56A 2OX7A 4J7FA 3CCRA 2X3XD 3LH5A 4E7IA 2GNCA 4CC3A 3QYHB 2Y4XA 1MV3A 1TXQA 4AMCA 1D0XA 2LT1A 3LGLA 2DNUA 4M77D 1RAIB 1VYUA 5CQYA 2LQNA 3AT1B 3CCLQ 3LLRA 4C0FA 5FU6C 4C0DC 1Z9ZA 3P8BB 1ZUYA 3X28B 2KR3A 2EYXA 1IRXA 3OW2A 2LRQA 4IUTA 2EQMA 1ARKA 3SDZA 4PJJA 2DTOA 2QDLA 1IZ6A 2DL4A 4B6MA 2HSPA 5GAMh 3M57A 3FB9A 4MMLA 5FW9A 1K0SA 1V76A 3X24B 1VOMA 5IN1A 2MF2A 2V1QA 1BU1A 1RUWA 4LDUA 3G71T 1YITQ 1Y07A 1U1SA 1K73R 5LJ3e 3ASKA 3JB9I 4QVDA 2RI3A 5C0MA 3JCMb 1H92A 2HQXA 1AWXA 3NMZC 2GFUA 4BE1A 2CREA 2FB7A 2DPPB 4HCZA 3OYDA 1UGVA 2J6FA 1NG2A 3JCMh 3EFSA 2LT4A 2JT4A 2CP2A 1YHQT 4M7AG 4N0AA 4FT2A 1CKAA 2K4YA 1Y57A 3OYKA 1IXDA 3CQTA 5IAYA 1UB4A 1TUGB 2PQWA 3OS5A 4JLIA 2ROTA 2CKKA 2QGGA 5LJ5f 1Q95G 3M0QA 2YLCA 5FRNA 4X9DA 1OV3A 1LCKA 1UDLA 2OAUA 5GAN3 2OTJQ 2GTOA 3OW2P 2PU9B 2QDYB 2K2MA 5GAMj 1M3BA 4M7DG 4M78F 1M8MA 1BI0A 4FW1A 1YCYA 3JAME 4QW2A 1M90R 2KDSA 2VKNA 1J3TA 3MPUB 3JCMX 2Y4YA 1YJNQ 1OPLA 2X4YA 3L42A 1SRLA 3F70A 1ABOA 1WHJA 4JJNK 1ZA1B 2AK5A 2XI9A 2GQVA 1FWZA 3G6EQ 1YI2A 2DD4A 2AZSA 3JCMJ 5LJ5g 2DZCA 1MV0B 4NL3A 1VQ4Q 3CCJT 4E7HA 4KGVB 1GCPA 1YI2T 3PNWC 1YIJQ 3QO3A 5LJ3g 2J6OA 4GLKA 2JZ2A 2ATCB 3JSCA 1YJ9T 3X26B 2KQWA 1R0BG 1Q81R 5IXFA 2E5KA 2MWPA 2L89A 2JJ9A 3PIPA 3CCMQ 1YJ9A 2COWA 3L2VA 5GMKi 2DA9A 4C92E 4J9DA 4QQDA 1D0ZA 3MKDA 1XQHA 4JS4A 3SWNC 5KYXA 4N4IA 3RMQA 3FEOA 4IIMA 2JM8A 2R5AA 3QZ9B 2YUPA 3TSZA 4C0GA 8ATCB 4OMLA 1N8RR 1G3YA 1OZ2A 1NZ9A 3E9GA 1N5ZA 4JPBW 1NM7A 2FHDA 3CMEA 2QK0A 1VQPA 2K3YA 2DL3A 2FRYA 2OJ2A 3CCEA 2DJQA 2O01E 2NUTA 5GAN6 1PRLC 1GRIA 3CCVQ 1E6HA 3C12A 4PNOA 3M53A 4C8QE 1SHGA 4F7UE 1TU0B 1AD5A 1IREB 4C0DB 4C8QB 1UGPB 3E1SA 4BDZA 2J06A 1VQ9A 2V8KA 2K5FA 3R6NA 1IGQA 2NUZA 1PHTA 1IO6A 3UDCA 1YP5A 2RD1A 2E70A 3V8LA 2L0AA 5AT1B 5GAOq 2RK1A 3G7ZA 4AG2C 2MYSA 3G71A 1Y96A 2QQRA 2EYQA 2K57A 5GJWB 4CRIA 3PTAA 3OYYA 3X20B 4M75C 2GCXA 1N8RU 1XTDA 1VQ7A 5D6XA 2YXYA 4Z02A 4NOYA 3HFOA 3H8ZA 3V7RA 3CPWA 2L3PA 2M1HA 3RESA 4KGZB 4J8OA 1U1TA 1YHQA 4ZN1A 4PJLA 5GANf 4KRTA 2QXFA 1WPYA 2JMAA 5KH6A 2PUKB 1OX8A 2E1HA 1B34A 3CCMA 4ESRA 4PK4A 1I81A 4J9EA 2WACA 1A0NB 3C94A 4M7DC 4ZGEB 3JCMQ 2ABLA 3I56T 2DJZA 3RKWA 1TWBA 1JJ2P 1O9SA 5A0DA 2VUBA 3EG9B 2O4XB 2DYIA 1EIFA 2V8JA 2EGAA 2X51A 4HT8A 3PVLA 4RCCA 2F1LA 3CCVA 1B7TA 2JMCA 3M9QA 3G6ET 1KIKA 2K79A 2DEQA 3PMIA 1QKXA 4J83A 5KYWA 4O6JA 1PM3A 3REAB 3I5RA 4BI8B 3QXEB 5CK9A 3CCVT 4JRQA 5KE3A 1G3WA 4X9CA 4FYYB 5GAMd 2CH4W 5I21A 4C0ZA 4C8QG 4PLLA 1SSHA 1KQSP 1VQKQ 3DLMA 3GOXA 3OB9A 2A0FB 2FPEA 3ZBDA 3RUXA 4IIOA 1PG5B 5EG2A 1K8AR 4OB3B 4RG8A 3FLGA 2B86A 1WQ7A 1OZ3A 4PJOD 2DXUA 5C6SA 2KEAA 5CO7A 4M77A 3HRSA 1WXUA 2QG9B 5LJ3j 2VB6A 3BE3A 1M3CA 1KHIA 1SG5A 2E65A 1W2BP 3O5ZA 1PD0A 2VXEA 3CPWP 2QYZA 3VS7A 3BFMA 3UWNA 3OS1A 4F16A 2QGFB 2DO3A 4HVUA 3L2QA 4PJOA 2KT1A 4EIKA 3OYEA 1OX9A 5IHNA 4M7DB 2O88A 1YBYA 4FU6A 1KG1A 1B07A 1X75C 4OB1B 2L5QA 3J80E 3SWNB 1WHGA 1JJ2A 2W0ZA 1OYXA 3CMET 1WHLA 3EHQA 3QZ5B 3JB9G 2QQAA 1VQLA 2ECZA 1HSQA 2D8JA 2OI3A 4ELYC 1AWWA 1VQMQ 1I1JA 4LD9K 4C5IA 4CI0C 1T3SA 5IXBA 3FRNA 2XDBA 2YRVA 5CKFA 5FLXE 1HXDA 2HNIA 4JDSA 3RERA 1KC8C 3KBGA 4J9GA 2CS7A 4FYWB 2P4TA 4J6XA 2RHXA 2ZPFB 4QVCA 5A0LA 4F7UF 1YIJT 2PVGB 3J7AF 5LJ3d 4XTWA 1GCQC 2KT8A 2LCLA 3GNFB 3OQ5A 1VQKT 1RADB 3HRTA 1R0CB 2JS0A 3DKMA 2FYKA 3CPWS 1WXBA 3GIBA 1JQQA 4M78C 2ZGWA 3EFOB 2DK3A 4P5NA 4OVAA 1W2BA 2FZKB 4Q5WA 3ER0A 5KYUA 2JM9A 4M7AD 3URGA 2E6ZA 4A63B 1S72T 1VQ7T 1MMGA 4BUGA 4XAXB 3VS2A 4C92F 1LPLA 4CC4B 4M4ZA 2RQTA 1K1ZA 2JTFA 2MMPA 3CC7Q 4RTZA 2L8DA 3CCSA 2LQWA 5LL6S 1BIBA 2K5IA 3A8OB 1K9MC 4PJOE 3JB9F 4IURA 2QQSA 1YWPA 2OTLT 3CXCP 4PJMA 2FZCB 4XTYA 3CC2A 4JJDA 4M7DD 1JEGA 2EJ9A
chains in the Genus database with same CATH topology
5CKDA 3MEAA 4XU0A 1QVGA 2GFUA 4BE1A 2K3XA 3ZEHA 2FB7A 3ZFJA 4JUVA 4C8QF 3WVEB 4KULA 3J81E 2DPPB 4C5HA 4HCZA 3L2WA 3OYDA 1N9SA 2RJFA 2XD0A 3BDUA 2D6FA 2DXTA 2KSSA 2LQKA 2EIFA 3JCMh 3EFSA 2NLUA 1VQOT 2E64A 2LT4A 2FL7A 2I2LA 3I55A 1YHQT 4M7AG 4NL2A 3AHUA 4L5GA 4N0AA 1BIAA 3M4GA 5AYFA 5A0GA 4FT2A 2K4YA 1KC8U 3OYJA 3OYKA 1K8AU 1KQSS 3JCMP 2LX9A 4HKEA 4L59A 1YJNA 5IAYA 1N27A 3HPWA 3LYIA 3QPHA 1UB4A 1AHJB 2M16A 3OSSC 1NPPA 4NS5A 1Y71A 2PQWA 3OS5A 4JLIA 5LJ5e 1I5LA 3QJ6A 2CKKA 1ZBXA 3MCAB 5LJ5f 3V7SA 3HHTB 3OYMA 2YLCA 5FRNA 1G5VA 4C8QC 4C92G 2XKOC 4M75F 4X9DA 4EMKB 1MGQA 4M7AA 1Q7YU 2PVDB 5GAOl 2OAUA 3OS2A 4LDXA 5GAN3 2DD5A 2IG0A 2EQJA 2GFAA 5FROA 2F5KA 1BI3A 2E5QA 4IUQA 4BI3A 5KCHA 5GANh 4V2SA 4ME7A 2RM4A 5GMKe 2CZ1B 3S3MA 2PU9B 2QDYB 2AHJB 5GAMj 1Q82U 2JUFA 4M7DG 3NTHA 4M78F 4QVZA 1HK9A 1BI0A 2R58A 3VUBA 3PMTA 2VC8A 1YCYA 4EPCA 4M78D 3JAME 4QW2A 4MDXA 2CYZB 4PJOF 4ZGJB 4DOVA 2KDSA 2XK0A 2BKDN 2R57A 2XU8A 3GNGA 1WNLA 4KT0E 4C92A 3PT9A 3OW2S 3M59A 2Y4YA 3JCMX 2DKGA 3TU4K 2X4YA 2X35A 4XU2A 1PSFA 3CPFA 3L42A 4RG2A 3OYAA 1VQ6T 4HT9A 2QA4A 3F70A 3META 3OYBA 2ZPIB 4B9WA 3I55T 1SSFA 5CQXA 4RKUE 4ZTJA 4TVRA 1DJ7B 1VQ8A 4M78E 5GAMg 1M4ZA 4F7UG 3CC7A 4JJNK 2DTIA 2IVWA 5GAN4 2XI9A 2GQVA 2YLBA 3L2RA 4IUVA 2XDDA 1FWZA 4BDYA 3QG1A 5KE2A 2E6NA 5DY9A 5FU6B 2OTJA 5A2QE 2P0QA 4ZGDB 3KXTA 3RIRA 3TCJA 2DD4A 2VXFA 3R6OA 5IT9E 1YI2A 4A4HA 3LW5E 3JCMJ 2VV5A 1M1KC 3C95A 5LJ5g 4FIBA 4VUBA 5LJ3f 1VQOA 2DZCA 4L6V5 5LJ5d 1PSEA 3A8MB 2RK2A 4Y91A 4NL3A 3V7CA 1YITA 1Q86U 3CCJT 5KCOA 3JRZA 2EQUA 4E7HA 4EMKC 2KAFA 1WJSA 3PNWC 4E47A 2RHUA 2ZPEB 4F7UA 1YI2T 4M7DF 4C8QD 1G3SA 3QO3A 5LJ3g 3S3NA 1KD1U 3QJYA 4FT4A 4GLKA 5GMKm 3CXCS 2JZ2A 3PGGA 3JSCA 1YJ9T 2MI6A 4M75D 3X26B 2R5MA 4QVCA 2KQWA 3PIOA 2C06A 3SD4A 3VV0A 3QDRB 4PJOB 1VUBA 1FXXA 4E7KA 3OYGA 3CBOA 3OA6A 2LCCA 2M0OA 3VKIA 2MWPA 5GAMf 2L89A 4M78G 3PIPA 4OGEA 1YJ9A 3V8KA 3L2VA 1M1KU 5GMKi 1N6AA 4C92E 3CC4T 4QQDA 1M8VA 2BUDA 1VIFA 4M75A 3X25B 3H6ZA 3P8HA 4BE0A 1VQMA 4LD6A 4DOWA 5CCAA 1XQHA 2GF7A 3FIFA 2QEXT 4JS4A 2EQKA 1N8RC 3RMSA 3OMCA 2DXBA 4XU1A 3SWNC 1X01A 4N4IA 3RMQA 5DLQE 3FEOA 3MP1A 3OYCA 1R8OB 2R5AA 3QZ9B 1YIJA 1UGSB 4JRIA 1VQ4A 5GAN2 4C0GA 3UT1A 2QA4T 1G3TA 1S72A 1G3YA 1OZ2A 2XICA 1NZ9A 3E9GA 4M78B 2FHDA 1Q86C 2L3RA 4Y28E 3JCMg 3CMEA 2F5TX 1VQPA 2Y90A 4M77C 3CD6A 2MAMA 3CMAT 2K3YA 5GMKl 3CCEA 5GAOm 1YITT 3JCMd 3CCJA 2E12A 2O01E 1LJOA 2RI5A 3PFSA 5GAN6 2OTLA 2LQ8A 4O5VA 3DB4A 2CZ0B 2B8AA 3SWNA 4R55A 4XK8E 3M4YA 5CR2A 2DAQA 1VQNT 1X6OA 3C12A 4M75B 4PNOA 1K8AC 3M53A 4C8QE 4F7UE 5GAOn 2K2VA 1IREB 4C0DB 3SFMA 1KHCA 1UGPB 4OB2B 3E1SA 4QQGA 5CIUA 4C8QB 3A5ZB 3LWHA 4BDZA 1U8RA 5LJ5j 1K73U 4M75G 4C92D 5M9OA 5LJ5h 1VQ9A 1GXIE 2MWOA 2V8KA 3HL8A 3GPLA 1VQLT 3CC7T 1NPRA 5HY6A 3CCET 2K5FA 1Q81U 1UGQB 3CCQA 1VQ9T 3OYNA 4MDWA 3CMAA 2RH2A 1H3ZA 4A4KA 3MP8A 3UDCA 5GAOr 2OTJT 3CBMA 2RD1A 5J3BA 2E70A 3L2ZA 5GAMe 3NFCA 2X4WA 3A8LB 2QTXA 3MP6A 4PLIA 3V8LA 2XIDA 1XOVA 5GANe 4UC4A 4PJOC 4EMKA 3LX7A 5GAOq 2CZ7B 2RK1A 3G7ZA 3G71A 5D6WA 3BDLA 1Y96A 1VQ4T 2QQRA 2D9TA 3LH0A 2EYQA 3N5BB 3FDRA 2PVOB 4MMKA 3OS0A 4M77G 1ZQ1A 3JCMW 1Q81C 2K57A 4CRIA 4J5YA 5DM7R 3PTAA 2DIGA 5I2SA 3ME9A 3OYYA 3X20B 2VYTA 4M75C 3VUZA 2GCXA 4M7DE 1N8RU 1XTDA 2K5LA 2DIQA 4MZTA 1VQ7A 4ELZC 4XTZA 5D6XA 3OMGA 3GF5A 2ZPBB 4XTUA 3DB3A 3S3OA 4NOYA 4Z02A 1M5Q1 3HFOA 5GAN8 3A8HB 4MZPA 2RB6A 5GANg 3H8ZA 3V7RA 3CPWA 2M1HA 2RA2A 2JTMA 3CCLA 3RESA 2E41A 4J8OA 1U1TA 1Q82C 5HK3A 1YHQA 3VYHB 2KVQG 4ZN1A 2HD0A 5GANf 3CC4A 3CCLT 1JBMA 2V8IA 2QXFA 3HP9A 3V8JA 1WPYA 1YJWA 5KH6A 2EFIA 1QP3A 3C4SA 2PUKB 1YJNT 1Y96B 2E1HA 2JOYA 4GY5A 4HA8A 5GAN7 1LNXA 1B34A 4X34A 3CCMA 1M90U 1QVFS 2EKOA 1I81A 2WACA 3C94A 1KQ2A 2ZZDA 4C92C 4YTLA 4M7DC 4ZGEB 3JCMQ 3MHXA 3I56T 3UPUA 1QVGS 2LNVA 2M9UA 2DJZA 3KUFA 3CC2T 2O4XA 3RKWA 2LC4A 4M77B 1QW1A 1BYMA 3LWIA 2RJCA 5CVIA 1O9SA 5A0DA 1VQ5T 3I56A 3FC3A 2VUBA 3WVDB 3NTKA 2A3LA 3HKSA 3VU3C 2O4XB 2VGMA 4II1A 1EIFA 5DLOA 2P0KA 4DA4A 2X4XA 3QKJA 2V8JA 1WJQA 3M55A 3G4SA 1M90C 2E10A 3M58A 3QYGB 4RCCA 4F7UB 4HT8A 2EAYA 3CCVA 3CCUA 1QVPA 4JLGA 1VQ8T 3M9QA 3G6ET 3JB9J 3G4ST 2HAXA 1NE8A 4A54A 2DEQA 3PMIA 1P92A 4J83A 4BY6B 4O6JA 3SB2A 3G6EA 2RJDA 3QUIA 4IUPA 4N4HA 4BI8B 3QXEB 1QP2A 5CK9A 3CCVT 4JRQA 2KY9A 5KE3A 1G3WA 2DVEA 2RO0A 4X9CA 4WF2A 5GAMd 1KD1C 3A8GB 5I21A 4XQ3A 4C0ZA 4PLLA 2DTHA 2XHCA 1D3BB 4C8QG 3RKYA 3DLMA 2DXCA 4LDWA 5GMKh 3OB9A 3GOXA 1Q7YC 4M7DA 4OMFB 4FM4B 3DLLA 2ZCFB 4HCBA 3ZBDA 1VQ5A 4QQ6A 4B9XA 3RUXA 1M9SA 2CGHA 1VQNA 5EG2A 1WQWA 1JB0E 4OB3B 3OBYA 1D3BA 5HKCA 2KMTA 4M77F 4RG8A 3FLGA 1WQ7A 5LJ3h 1OZ3A 4PJOD 2DXUA 5C6SA 5CO7A 4EMHA 4M77A 2YHTA 3HRSA 3EAEA 5GANj 4E7JA 2VGNA 5LJ3j 4C92B 1KQSA 5GAOp 4XTXA 3S6WA 4OP0A 4BI4A 1KHIA 2E65A 5CKBA 1VQMT 2JN0A 4M7AF 1NJIU 1BKBA 1B34B 2VXEA 3QBYA 3JCMe 1MHNA 3BFMA 2XG8D 3INZA 3UWNA 3OS1A 2WSEE 5L8RE 3OYIA 1BI2A 2P0PA 3EFRA 1OI1A 2DO3A 5J26A 1BI1A 2D0QB 3BW1A 3WXMB 3GLXA 3NTIA 1K73C 1N9RA 4EMGA 4HCCA 1VQKA 3M5AA 1FX7A 5FU7C 3L2QA 4PJOA 1H641 3OSVA 3OYEA 2EWNA 3HRUA 5CKHA 4ZN3A 1W4SA 5GAN5 3HSBA 2ZPHB 3TREA 4MZMA 4RCBA 4A4FA 4M7DB 1YBYA 4FU6A 1UGRB 4LDYA 1KG1A 1X75C 3OBWA 2RHIA 3CBPA 2QQ9A 4OB1B 2JNGA 2L5QA 2JVVA 2RHYA 1O75A 3J80E 3SWNB 3Q1JA 1JJ2A 1OYXA 3CMET 3LGFA 4M75E 4JS5A 3QZ5B 2LVMA 2QQAA 3CCUT 2RHZA 3JB9G 1VQLA 3E19A 4IKFA 2G3RA 4IUUA 4OB0B 5FU7B 4BE2A 4ATOA 4KBMB 3MEWA 4ELYC 4LD9K 2WSCE 4C5IA 1TH7A 4N0AC 4CI0C 4XU3A 5J39A 3M54A 3GP8A 3CCQT 3FRNA 2XDBA 1KQ1A 2LTOA 2YRVA 2QI2A 1I4K1 5CKFA 5FLXE 5HK0A 3L1AA 1HXDA 2HNIA 4FL6A 4FSXA 4JDSA 3RERA 1KC8C 3KBGA 3CCST 1WJRA 3QIIA 2CS7A 3E9FA 5I2MA 4A4EA 4A4GA 1JRIA 2P4TA 4J6XA 1Y7XA 2RHXA 2ZPFB 4M77E 4A53A 4F7UF 3HFNA 5A0LA 4XTVA 4PJOG 1YIJT 5CAIA 2PVGB 1VQPT 3CD6T 1M1FA 4JRPA 3J7AF 5LJ3d 3MEVA 4D6WA 4J6WA 3OY9A 3JCMV 3P8DA 4XTWA 5GANd 4C8QA 4R56A 1JJ2S 5FRMA 4N4GA 2HBPA 2LCLA 3GNFB 3FJPA 3O8VA 4C5GA 2F69A 4J7FA 3OQ5A 2A7YA 3VJPA 4J6YA 2XDPA 3HRTA 3CCRA 1VQKT 4BY6C 4E7IA 3DKMA 2FYKA 3CEYA 4KUIA 3CPWS 3QYHB 2Y4XA 4M7AE 4PL6A 3GIBA 1VIEA 2LT1A 3LGLA 3JB9D 3CCRT 3RKXA 4M77D 2QQBA 5CQYA 2EJGA 4M78C 2LDMA 2ZGWA 2DK3A 4P5NA 4ZTFA 2CZ6B 2PUOB 4OVAA 4KUDK 2DZ9A 1XNIA 3LLRA 1W2BA 4C0FA 2RI2A 5FU6C 4LDVA 4Q5WA 4C0DC 4BACA 3CCMT 1QVFA 2BIVA 3ER0A 3P8BB 3X28B 3M56A 4M7AD 3URGA 2E6ZA 2X4JA 4DQ2A 1LOJA 2RJEA 3MO8A 3OW2A 1I8FA 1S72T 1VQ7T 4OF1A 1V29B 2LRQA 2HQEA 4PKCC 4IUTA 4BUGA 2EQMA 3MEUA 3JB9H 4XAXB 4C92F 3QSUA 1UEBA 1NJIC 3CXCA 4EDUA 1RL2A 3QHSA 3SDZA 2JTFA 2DTOA 2MMPA 4BB7A 4M7AC 3JCMc 2QEXA 1IZ6A 2KK4A 3JCMf 3OYHA 2FVUA 3VYGA 4RMOA 2L8DA 4M78A 4OGCA 4C5EA 5GAMh 3CCSA 3M57A 5LL6S 1M1GA 1BIBA 3FB9A 4JRKA 4MMLA 2K5IA 3A8OB 5CKEA 5GMKj 1K9MC 1ZHIA 3JB9F 4PJOE 2H3JA 3X24B 5D6YA 2EJFA 4IURA 2QQSA 2MF2A 5IN1A 4BD3A 3OYFA 4E7LA 1K9MU 2OTLT 4M7AB 3T9NA 4LDUA 1W2BS 2ZPGB 3BY7A 3G71T 1VQ6A 2WSFE 1RI0A 3L2UA 4XTYA 4J7IA 1Y07A 3CC2A 1U1SA 4M7DD 5LJ3e 1WGSA 3ASKA 3JB9I 2EJ9A 3TEEA 4QVDA 2RI3A 3OYLA 5C0MA 3JCMb 2HQXA 1YJWT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQB A;  1U8R A;  1G3T A;  1G3Y A;  2QQA A;  2K5I A;  3E19 A;  2H3J A;  1BI2 A;  1QVP A;  2K5F A;  1BI1 A;  2GCX A;  3GLX A;  2K5L A;  1FX7 A;  1P92 A;  3MHX A;  1BI3 A;  3HRT A;  3HRS A;  2K4Y A;  1G3S A;  3HRU A;  4O6J A;  4O5V A;  2LX9 A;  1QW1 A;  1BYM A;  1G3W A;  5CVI A;  1BI0 A;  2QQ9 A;  1FWZ A; 
#chains in the Genus database with same CATH topology
 4RTV A;  4XU0 A;  2K3X A;  4JUV A;  4C8Q F;  3WVE B;  4KUL A;  1C0M A;  2FO0 A;  1PCX A;  1AEY A;  2XD0 A;  3BDU A;  2EIF A;  3VS1 A;  1VQO T;  2E64 A;  3NHN A;  2I2L A;  4L5G A;  3M0S A;  2PZ1 A;  2YRD A;  3OYJ A;  1KQS S;  2LX9 A;  4HKE A;  2O2O A;  3HPW A;  3QPH A;  1AHJ B;  3OSS C;  4NS5 A;  5LJ5 e;  1KJW A;  3RNJ A;  1RAB B;  3MCA B;  4DEX A;  3V7S A;  1K0X A;  3HHT B;  3SHW A;  3OYM A;  1G5V A;  2M02 A;  1GCQ A;  1AOJ A;  4EMK B;  1Q7Y U;  1X43 A;  5GAO l;  3OS2 A;  2IG0 A;  1IGU A;  3A1P A;  2E5Q A;  2EYZ A;  3S3M A;  3NTH A;  1HK9 A;  2KYM A;  2R58 A;  3PMT A;  4MDX A;  1Z9Q A;  1F1B B;  2F2W A;  4ZGJ B;  4DOV A;  3M0U A;  4C92 A;  4KT0 E;  3GNG A;  1TUC A;  1WNL A;  1ZX6 A;  1RAE B;  1X27 A;  2DKG A;  4XU2 A;  1SRM A;  3CPF A;  4HT9 A;  3MET A;  3OYB A;  2ZPI B;  1CSK A;  3I55 Q;  1K9A A;  4RKU E;  3VS4 A;  1M4Z A;  2IVW A;  2RMO A;  1TUD A;  3EGX B;  4BDY A;  2NYS A;  3QG1 A;  4CC7 A;  5A2Q E;  4ZGD B;  1SPK A;  3LW5 E;  2VV5 A;  5LJ3 f;  1VQO A;  1Y0M A;  1CKB A;  3THK A;  1YIT A;  3V7C A;  1IHW A;  1H8K A;  5EC7 A;  2EQU A;  4F7U A;  2ZPE B;  4M7D F;  1NYG A;  2A08 A;  4FT4 A;  3CXC S;  5GMK m;  4Z8A A;  4AFQ C;  3EGD A;  1BCM A;  2CT3 A;  2R5M A;  4AG1 C;  1LVK A;  2NUT B;  4RTX A;  1VUB A;  4E7K A;  3OYG A;  3CBO A;  2LCC A;  1MNE A;  2DEU A;  2O9V A;  1U3O A;  1QCN A;  2YRC A;  2X9H A;  3RBB B;  3CC4 T;  2QA4 Q;  1AVZ C;  2AKL A;  1VIF A;  2VVK A;  4M75 A;  4BE0 A;  3H6Z A;  3P8H A;  4LD6 A;  3FIF A;  3AHU A;  4XU1 A;  1RLP C;  3MP1 A;  3UAT A;  4J9H A;  2KE9 A;  4E2F B;  1BBZ A;  5GAN 2;  3UT1 A;  1QCO A;  1S72 A;  3JCM g;  3CD6 A;  3NPF A;  2HSE B;  3CCJ A;  1LJO A;  2EGC A;  1C6V X;  2OTL A;  4F04 B;  2LQ8 A;  3DB4 A;  2B8A A;  4R55 A;  2DAQ A;  3QWX X;  1Q86 R;  1WX6 A;  2K2V A;  2NUP A;  2W10 A;  5CIU A;  4QQG A;  1U8R A;  3LWH A;  1K73 U;  1HD3 A;  2VWF A;  4Y92 A;  5LJ5 h;  2JW4 A;  1GXI E;  2ED1 A;  1E7O A;  1UGQ B;  2BZY A;  2HQH A;  3CMA A;  2G6F X;  4A4K A;  5GAO r;  3TSW A;  1X6G A;  2L2P A;  2LX7 A;  5GAM e;  3MP6 A;  3JV3 A;  4PLI A;  1BK2 A;  2XID A;  4PJO C;  2PTK A;  2CZ7 B;  1X6B A;  1YFN A;  1D09 B;  3LH0 A;  2D8H A;  3JCM W;  1VQP Q;  3MJX A;  4J5Y A;  5I2S A;  3M0P A;  3ME9 A;  3VUZ A;  4J9C A;  3NGP A;  3UF4 A;  3OMG A;  3GF5 A;  3ZL7 C;  4XTU A;  3S3O A;  4KH1 B;  2CUB A;  4J9F A;  1M5Q 1;  3A8H B;  2RB6 A;  1D1C A;  9ATC B;  1RAA B;  2RA2 A;  3FJ5 A;  4F14 A;  1JXM A;  1AT1 B;  2HD0 A;  4KH0 B;  2CP3 A;  3CC4 A;  1Q82 R;  3CCL T;  2V8I A;  2HCK A;  3V8J A;  2EFI A;  1RLQ C;  1AWO A;  4GY5 A;  4HA8 A;  4X34 A;  1M90 U;  3REB B;  1QVF S;  2EKO A;  2FPD A;  4X1V A;  1KQ2 A;  2EGE A;  3MHX A;  3UPU A;  1VYV A;  3KUF A;  3CC2 T;  2ENM A;  4M77 B;  5CVI A;  1VQ5 T;  2DFU A;  3NTK A;  1PKS A;  4II1 A;  4LUD A;  1MMN A;  2P0K A;  4OMN A;  3M55 A;  1U5S A;  1M90 C;  3M58 A;  2KXC A;  1FMK A;  2K9G A;  3G4S T;  2HAX A;  1QQJ A;  4BY6 B;  3SB2 A;  1GBR A;  2KY9 A;  3G4S Q;  1ZLM A;  1KD1 C;  4WCI A;  2F2V A;  2O9S A;  3CCE T;  5GMK h;  4LDW A;  4M7D A;  2MOX A;  4HCB A;  3CCQ Q;  4OMP A;  2CSI A;  2CGH A;  1VQN A;  1ACM B;  1JO8 A;  1SEM A;  3OBY A;  1GBQ A;  1D3B A;  2KMT A;  4M77 F;  2DRM A;  2LZ6 B;  2FG0 A;  3CMA Q;  5GAN j;  4E7J A;  2EBP A;  3CCU Q;  4JZ4 A;  2DF6 A;  2KRN A;  5CKB A;  4M7A F;  2E4H A;  1B34 B;  3QBY A;  3CCE Q;  1I5O B;  1E6G A;  1W1F A;  1BI2 A;  1OU8 A;  3EFR A;  5FWB A;  1BI1 A;  3BW1 A;  3GLX A;  3NTI A;  1N9R A;  4HCC A;  3M5A A;  1FX7 A;  1YWO A;  1H64 1;  2K3B A;  3OSV A;  5CKH A;  1W4S A;  4A4F A;  4LDY A;  3CBP A;  3EH1 A;  3I9Q A;  2JVV A;  2RHY A;  4PJN A;  3VRY A;  3Q1J A;  2CP7 A;  4JS5 A;  5I22 A;  2RHZ A;  4WTO B;  4ANJ A;  1VQL Q;  5IH2 A;  4KBM B;  3MEW A;  1OPK A;  1R77 A;  1EX4 A;  1U06 A;  1TH7 A;  2HKN A;  4LUE A;  3EGU A;  4DBH A;  1ZSZ B;  5J39 A;  3M54 A;  3EGX A;  2LTO A;  2CP5 A;  2QI2 A;  2XMF A;  3EG9 A;  4PFZ A;  2LP5 A;  1OU9 A;  5IHI A;  3H0F A;  3QII A;  5I2M A;  1JRI A;  2MPX C;  5HKC A;  2KRO A;  1M1F A;  4JRP A;  4J6W A;  2IPO B;  3OY9 A;  5GAN d;  4C8Q A;  1JJ2 S;  2AKK A;  3FJP A;  4C5G A;  2A28 A;  2A7Y A;  4J6Y A;  4BY6 C;  1PNJ A;  4M7A E;  3CEY A;  4KUI A;  3KFV A;  1RAC B;  3JB9 D;  2Z0W A;  2LDM A;  1VYT A;  1QLY A;  3UA6 A;  1XNI A;  2EVR A;  2RI2 A;  4LDV A;  2KRM A;  3CCM T;  2OTL Q;  2DX1 A;  4FYX B;  2X4J A;  4DQ2 A;  1LOJ A;  2RJE A;  3MO8 A;  1V29 B;  2YWW A;  2HL5 C;  2HQE A;  2YSQ A;  3MEU A;  3JB9 H;  2YUO A;  1NJI C;  3CXC A;  3QHS A;  3JCM c;  3OYH A;  1RAG B;  3VYG A;  4RMO A;  4C5E A;  4OGC A;  1QVF P;  1TSF A;  5CKE A;  5GMK j;  1ZHI A;  2H3J A;  5D6Y A;  3OYF A;  2ESW A;  1K9M U;  4M7A B;  2ZPG B;  2BZX A;  1VQ6 A;  4OMQ A;  2WSF E;  3L2U A;  4J7I A;  2BTT A;  1M30 A;  4JZ3 A;  1NLO C;  3OYL A;  4PFP A;  1YJW T;  5CKD A;  3MEA A;  2NWM A;  3L2W A;  4AFU C;  1UHF A;  2RJF A;  2DXT A;  2LQK A;  2NLU A;  2FL7 A;  1EFN A;  3I55 A;  5AYF A;  3M4G A;  1H3H A;  1K8A U;  1BB9 A;  4L59 A;  1YJN A;  1N27 A;  3LYI A;  1NBE B;  1QVG P;  2M16 A;  1S72 Q;  1Y71 A;  2O31 A;  2DVJ A;  1WZO A;  4C8Q C;  4C92 G;  2XKO C;  5ECA A;  1KD1 R;  4F17 A;  1MGQ A;  4M7A A;  4LDX A;  2DD5 A;  2EW3 A;  4ORZ A;  2GFA A;  5FRO A;  4BI3 A;  1BI3 A;  2FRW A;  5GAN h;  4ME7 A;  2RM4 A;  4E6R A;  2CZ1 B;  1Q82 U;  2JUF A;  4QVZ A;  4M78 D;  2CYZ B;  2HKQ B;  2BKD N;  2R57 A;  4RTT A;  2EKH A;  1WFW A;  1SF9 A;  3OW2 S;  3M59 A;  1MND A;  3TU4 K;  1UFF A;  4DBR A;  2QA4 A;  1VQ5 Q;  1JXO A;  4HXJ A;  4TVR A;  1DJ7 B;  1D0Y A;  3CC7 A;  4F7U G;  4OMM A;  5GAN 4;  2YLB A;  4IUV A;  4LNP A;  5DY9 A;  5FU6 B;  2OTJ A;  2P0Q A;  3KXT A;  3RIR A;  3TCJ A;  2VXF A;  3R6O A;  2CP6 A;  5IT9 E;  4A4H A;  2DM1 A;  1M1K C;  2CP0 A;  4FIB A;  3C0C A;  1QKW A;  1WHM A;  4L6V 5;  5LJ5 d;  3A8M B;  2RK2 A;  1VA7 A;  4OMO A;  5KCO A;  2V1R A;  1WJS A;  4E47 A;  1G3S A;  1KD1 U;  3EFO A;  3PGG A;  2MI6 A;  2C06 A;  3VV0 A;  3QDR B;  4PJO B;  3OA6 A;  2M0O A;  3VKI A;  5GAM f;  1T0H A;  4M78 G;  1ZSZ C;  1M8V A;  3X25 B;  3H9N A;  4DOW A;  1GL5 A;  5CCA A;  2GF7 A;  5HCK A;  1FYN A;  1N8R C;  3RMS A;  5DLQ E;  1R8O B;  1VQ4 A;  1TOV A;  4Z89 A;  2XIC A;  1D1B A;  4M78 B;  1K4U S;  1Q86 C;  2L3R A;  5L23 A;  2F5T X;  2Y90 A;  4M77 C;  4FW2 A;  3CMA T;  5GMK l;  5GAO m;  3G71 Q;  1YIT T;  3PFS A;  4O5V A;  3SWN A;  5CR2 A;  3M4Y A;  2SEM A;  2DER A;  2QAS A;  3CC4 Q;  1T3L A;  2QA4 T;  2GBQ A;  3A5Z B;  5LJ5 j;  4C92 D;  2CDT A;  3TQ7 P;  3GPL A;  1NPR A;  5HY6 A;  1Q81 U;  4ZNX A;  1VQ9 T;  2KYB A;  3OYN A;  1H3Z A;  4GLM A;  1NEG A;  2OTJ T;  2YDL A;  3CBM A;  2QTV A;  3NFC A;  2X4W A;  1XOV A;  5GAN e;  4UC4 A;  2BZ8 A;  3LX7 A;  1NLP C;  1VQ6 T;  3BDL A;  2D9T A;  3N5B B;  3OS0 A;  3FDR A;  2PVO B;  3CD6 Q;  1ZQ1 A;  1Q81 C;  1UG1 A;  6AT1 B;  5DM7 R;  4R0K A;  2DIG A;  3EG2 A;  2DL8 A;  2VYT A;  2F2X A;  2K5L A;  2GGR A;  4MZT A;  3E2U A;  2ZPB B;  5KYY B;  3DB3 A;  2D0N A;  2FPF A;  1ZA2 B;  1SHF A;  1WLP B;  2DL7 A;  5GAN g;  1PKT A;  4DBF A;  2DYB A;  3SEM A;  1YCS B;  1ZSG A;  2KGT A;  1JBM A;  2DIL A;  1YJW A;  1QP3 A;  3C4S A;  1Y96 B;  2JOY A;  5GAN 7;  4J9B A;  2RF0 A;  2KNB B;  2YT6 A;  3I35 A;  2M9U A;  2O4X A;  2RJC A;  3I56 A;  3FC3 A;  3WVD B;  2A3L A;  2AT1 B;  3HKS A;  3VU3 C;  2VGM A;  5DLO A;  2X4X A;  4HVV A;  1WJQ A;  3IQL A;  1RAF B;  2H8H A;  3CCU A;  1VQ8 T;  3JB9 J;  5GJV B;  1NE8 A;  3CCJ Q;  4A54 A;  2K6D A;  3G6E A;  2RJD A;  3QUI A;  1OEB A;  2DVE A;  2RO0 A;  4WF2 A;  4XQ3 A;  1WI7 A;  2BE7 D;  2DTH A;  2XHC A;  3RKY A;  2ZCF B;  2H3E B;  4JJC A;  4AFZ C;  4QQ6 A;  1M9S A;  1MMD A;  2YUQ A;  8AT1 B;  1YNZ A;  1VQN Q;  1ZBJ A;  2HMA A;  1M27 C;  4DEY A;  2DL5 A;  2YHT A;  3EAE A;  3EGD B;  1TS9 A;  2J6K A;  1HYO A;  4BI4 A;  2I0N A;  1BKB A;  2HL3 A;  2XG8 D;  3INZ A;  4AFS C;  5L8R E;  2KRS A;  1OQK A;  2SRC A;  2P0P A;  3EG3 A;  1OI1 A;  1W70 A;  5J26 A;  2D0Q B;  5D7U A;  1K73 C;  4EMG A;  1VQK A;  2KBT A;  1UTI A;  5FU7 C;  1NYF A;  2PNI A;  4ZN3 A;  2ZPH B;  3TRE A;  2BE9 B;  1UGR B;  2JNG A;  2P4R A;  3H41 A;  2LJ0 A;  1AZE A;  3LGF A;  4M75 E;  2J7I A;  4IKF A;  2COZ A;  2G3R A;  4IUU A;  1TG0 A;  1WIE A;  4OB0 B;  4BE2 A;  4ATO A;  3EG1 A;  2WSC E;  4LXC A;  2E3I A;  4XU3 A;  2DBK A;  3GP8 A;  1KQ1 A;  4PFO A;  5HK0 A;  1SKU B;  3L1A A;  1VQ9 Q;  4FSX A;  3M0T A;  4RTU A;  1VQ8 Q;  3CCS T;  1WJR A;  4A4G A;  5IHK A;  1Y7X A;  1V1C A;  2C0I A;  4M77 E;  3HFN A;  5KYU B;  1VQP T;  4PJO G;  5CAI A;  1EZZ B;  3JCM V;  3P8D A;  4N4G A;  2LJ3 A;  2HBP A;  3O8V A;  1AWJ A;  2AZV A;  2F69 A;  2FEI A;  3VJP A;  2XDP A;  2DLP A;  1IHV A;  1PRM C;  4PL6 A;  2HEQ A;  1VIE A;  2JTE A;  3RKX A;  3CCR T;  1VQO Q;  1RI9 A;  2QQB A;  2EJG A;  4ZTF A;  2CZ6 B;  2PUO B;  4KUD K;  2DZ9 A;  4BAC A;  1KC8 R;  1QVF A;  2BIV A;  2VAS A;  1M2V B;  2EYW A;  3M56 A;  1OOT A;  1I8F A;  4OF1 A;  1B3Q A;  4PKC C;  2EPD A;  3QSU A;  1UEB A;  2X3W D;  3UA7 A;  1RL2 A;  4EDU A;  2DET A;  4M7A C;  4DBQ A;  1S1N A;  1YN8 A;  2QEX A;  3JCM f;  2KK4 A;  2FVU A;  1QMC A;  2MIO A;  4M78 A;  1M1G A;  4JRK A;  2RN8 A;  4BD3 A;  1I07 A;  2EJF A;  4E7L A;  2DMO A;  1WHK A;  2JS2 A;  4RTY A;  3T9N A;  1W2B S;  3BY7 A;  1RI0 A;  1OUL A;  1WGS A;  1RAH B;  3TEE A;  4QT7 A;  3GBQ A;  4BB7 A;  1QVG A;  3ZEH A;  3ZFJ A;  3J81 E;  4C5H A;  1N9S A;  1UEC A;  2D6F A;  2KSS A;  2LJ1 A;  1AZG B;  4NL2 A;  1BIA A;  3D7S B;  5A0G A;  3CCS Q;  1KC8 U;  4D8K A;  3JCM P;  2QEX Q;  1NPP A;  2DRK A;  1I5L A;  3QJ6 A;  1G83 A;  1ZBX A;  3H0I A;  3RDV A;  1M2O A;  4M75 F;  1T0J A;  2M0Y A;  1NJI R;  2PVD B;  2EQJ A;  2F5K A;  4IUQ A;  2ED0 A;  5KCH A;  4V2S A;  5GMK e;  2AHJ B;  2HBW A;  3VUB A;  1KFZ A;  3VS6 A;  2VC8 A;  4EPC A;  4PJO F;  2JXB A;  2XK0 A;  4FSS A;  2XU8 A;  3PT9 A;  4D8D A;  2MCN A;  2X35 A;  1PSF A;  4RG2 A;  3OYA A;  3I55 T;  4B9W A;  1SSF A;  5CQX A;  4ZTJ A;  1VQ8 A;  4M78 E;  5GAM g;  2DTI A;  3L2R A;  1G2B A;  2XDD A;  5KE2 A;  2E6N A;  1UHC A;  3M0R A;  3C95 A;  4VUB A;  1WDX A;  4Z88 A;  1PSE A;  2EYY A;  2LCS A;  4Y91 A;  1VQ6 Q;  2YUN A;  1Q86 U;  3JRZ A;  4EMK C;  2KAF A;  2RHU A;  4C8Q D;  3S3N A;  2MK5 A;  3VRZ A;  3QJY A;  4M75 D;  1GFC A;  3PIO A;  3SD4 A;  5I11 A;  1PC0 A;  1FXX A;  2M51 A;  4E7Z A;  1YJ9 Q;  2RQW A;  4OGE A;  3V8K A;  1M1K U;  2GQI A;  1N6A A;  3ULR B;  2KXD A;  2BUD A;  2A36 A;  3PE0 A;  1QWF A;  1VQM A;  3A98 A;  2QEX T;  2EQK A;  3OMC A;  2DXB A;  1X01 A;  5KYW B;  3OYC A;  1ABQ A;  1YIJ A;  2ZAE A;  1UGS B;  4JRI A;  1M2V A;  3TVT A;  1G3T A;  3VS3 A;  1K76 A;  1C1A A;  5FWC A;  4Y28 E;  4J9I A;  2V26 A;  2MAM A;  3JCM d;  1GFD A;  2E12 A;  2RI5 A;  1UUE A;  2CZ0 B;  4XK8 E;  1K9M R;  1X6O A;  1VQN T;  4M75 B;  1K8A C;  1XJW B;  1W6X A;  2RQU A;  5GAO n;  2A37 A;  3SFM A;  1KHC A;  4OB2 B;  2E3H A;  1WHH A;  4M75 G;  5M9O A;  4HCK A;  3I56 Q;  2MWO A;  3HL8 A;  4LN2 A;  1VQL T;  3CC7 T;  2C0O A;  2IIM A;  5KYN A;  2LMJ A;  3CCQ A;  4HVW A;  4MDW A;  2RH2 A;  3MP8 A;  5KYX B;  1M1K R;  5J3B A;  3L2Z A;  3A8L B;  2QTX A;  2NUP B;  4EMK A;  1ZUU A;  2RNA A;  1VQ4 T;  5D6W A;  4MMK A;  4M77 G;  1WA7 A;  4RTW A;  3CC2 Q;  4LE9 A;  2RPN A;  4E7S A;  4M7D E;  1PWT A;  2DIQ A;  2HDA A;  4XTZ A;  4ELZ C;  1JU5 C;  1QCF A;  5GAN 8;  4MZP A;  1ZSZ A;  2JTM A;  3CCL A;  3CCR Q;  2E41 A;  1Q82 C;  5HK3 A;  3VYH B;  2KVQ G;  1BCO A;  3HP9 A;  1KSW A;  1MUZ A;  1YJN T;  1IB8 A;  3EG0 A;  1LNX A;  2RQV A;  2ZZD A;  4C92 C;  4YTL A;  2K7A A;  1QVG S;  2AIR B;  2LNV A;  1D1A A;  3VS0 A;  1WXT A;  2LC4 A;  1QW1 A;  1BYM A;  3LWI A;  1UJY A;  4FYV B;  1G8X A;  4DA4 A;  3QKJ A;  3PVQ A;  3G4S A;  1UE9 A;  1NEB A;  2E10 A;  3QYG B;  4F7U B;  2EAY A;  1QVP A;  4JLG A;  2HZY A;  3QWY A;  1MMA A;  4FCY A;  1YI2 Q;  1P92 A;  2QAZ A;  1VQ7 Q;  2CUD A;  7AT1 B;  3VS5 A;  3CME Q;  4IUP A;  1M3A A;  4N4H A;  2J05 A;  1QP2 A;  2D1X A;  4AT1 B;  1YJW Q;  3A8G B;  1D3B B;  2DXC A;  1Q7Y C;  3I5S A;  2FZG B;  4OMF B;  4FM4 B;  1YHQ Q;  2C0T A;  3DLL A;  1VQ5 A;  4B9X A;  1WYX A;  3EHR A;  1X2Q A;  1WQW A;  1JB0 E;  2GTJ A;  1KK7 A;  1HJD A;  5LJ3 h;  4EMH A;  2VGN A;  3HTR A;  4C92 B;  2DE0 X;  5GAO p;  1KQS A;  4XTX A;  3S6W A;  4OP0 A;  1ZUK A;  2RQR A;  1I0C A;  2EQI A;  2JN0 A;  1VQM T;  1Q7Y R;  3G1J A;  1NJI U;  2P84 A;  4QKU A;  2L3S A;  3JCM e;  1MHN A;  1QWE A;  1X2K A;  2WSE E;  3OYI A;  2OAW A;  3U23 A;  3WXM B;  1TTH B;  2EWN A;  3HRU A;  4CC2 A;  3HSB A;  5GAN 5;  4MZM A;  4GBQ A;  4RCB A;  5KYY A;  3OBW A;  1PD1 A;  2RHI A;  2CT4 A;  2QQ9 A;  1O75 A;  2CSQ A;  2KI7 A;  3EH2 A;  3CCU T;  2LVM A;  4RUG A;  3E19 A;  4KGX B;  4JJB A;  3RR6 A;  2ROL A;  5FU7 B;  1X69 A;  1FMV A;  4N0A C;  1FMW A;  3CCQ T;  2LNH B;  1I4K 1;  4FL6 A;  2L3Q A;  3H0H A;  3E9F A;  4K11 A;  4A4E A;  2COY A;  4A53 A;  2DBM A;  2CH4 A;  3QDF A;  4XTV A;  3CD6 T;  3MEV A;  4D6W A;  1UJ0 A;  5FRM A;  4R56 A;  2OX7 A;  4J7F A;  3CCR A;  2X3X D;  3LH5 A;  4E7I A;  2GNC A;  4CC3 A;  3QYH B;  2Y4X A;  1MV3 A;  1TXQ A;  4AMC A;  1D0X A;  2LT1 A;  3LGL A;  2DNU A;  4M77 D;  1RAI B;  1VYU A;  5CQY A;  2LQN A;  3AT1 B;  3CCL Q;  3LLR A;  4C0F A;  5FU6 C;  4C0D C;  1Z9Z A;  3P8B B;  1ZUY A;  3X28 B;  2KR3 A;  2EYX A;  1IRX A;  3OW2 A;  2LRQ A;  4IUT A;  2EQM A;  1ARK A;  3SDZ A;  4PJJ A;  2DTO A;  2QDL A;  1IZ6 A;  2DL4 A;  4B6M A;  2HSP A;  5GAM h;  3M57 A;  3FB9 A;  4MML A;  5FW9 A;  1K0S A;  1V76 A;  3X24 B;  1VOM A;  5IN1 A;  2MF2 A;  2V1Q A;  1BU1 A;  1RUW A;  4LDU A;  3G71 T;  1YIT Q;  1Y07 A;  1U1S A;  1K73 R;  5LJ3 e;  3ASK A;  3JB9 I;  4QVD A;  2RI3 A;  5C0M A;  3JCM b;  1H92 A;  2HQX A;  1AWX A;  3NMZ C;  2GFU A;  4BE1 A;  2CRE A;  2FB7 A;  2DPP B;  4HCZ A;  3OYD A;  1UGV A;  2J6F A;  1NG2 A;  3JCM h;  3EFS A;  2LT4 A;  2JT4 A;  2CP2 A;  1YHQ T;  4M7A G;  4N0A A;  4FT2 A;  1CKA A;  2K4Y A;  1Y57 A;  3OYK A;  1IXD A;  3CQT A;  5IAY A;  1UB4 A;  1TUG B;  2PQW A;  3OS5 A;  4JLI A;  2ROT A;  2CKK A;  2QGG A;  5LJ5 f;  1Q95 G;  3M0Q A;  2YLC A;  5FRN A;  4X9D A;  1OV3 A;  1LCK A;  1UDL A;  2OAU A;  5GAN 3;  2OTJ Q;  2GTO A;  3OW2 P;  2PU9 B;  2QDY B;  2K2M A;  5GAM j;  1M3B A;  4M7D G;  4M78 F;  1M8M A;  1BI0 A;  4FW1 A;  1YCY A;  3JAM E;  4QW2 A;  1M90 R;  2KDS A;  2VKN A;  1J3T A;  3MPU B;  3JCM X;  2Y4Y A;  1YJN Q;  1OPL A;  2X4Y A;  3L42 A;  1SRL A;  3F70 A;  1ABO A;  1WHJ A;  4JJN K;  1ZA1 B;  2AK5 A;  2XI9 A;  2GQV A;  1FWZ A;  3G6E Q;  1YI2 A;  2DD4 A;  2AZS A;  3JCM J;  5LJ5 g;  2DZC A;  1MV0 B;  4NL3 A;  1VQ4 Q;  3CCJ T;  4E7H A;  4KGV B;  1GCP A;  1YI2 T;  3PNW C;  1YIJ Q;  3QO3 A;  5LJ3 g;  2J6O A;  4GLK A;  2JZ2 A;  2ATC B;  3JSC A;  1YJ9 T;  3X26 B;  2KQW A;  1R0B G;  1Q81 R;  5IXF A;  2E5K A;  2MWP A;  2L89 A;  2JJ9 A;  3PIP A;  3CCM Q;  1YJ9 A;  2COW A;  3L2V A;  5GMK i;  2DA9 A;  4C92 E;  4J9D A;  4QQD A;  1D0Z A;  3MKD A;  1XQH A;  4JS4 A;  3SWN C;  5KYX A;  4N4I A;  3RMQ A;  3FEO A;  4IIM A;  2JM8 A;  2R5A A;  3QZ9 B;  2YUP A;  3TSZ A;  4C0G A;  8ATC B;  4OML A;  1N8R R;  1G3Y A;  1OZ2 A;  1NZ9 A;  3E9G A;  1N5Z A;  4JPB W;  1NM7 A;  2FHD A;  3CME A;  2QK0 A;  1VQP A;  2K3Y A;  2DL3 A;  2FRY A;  2OJ2 A;  3CCE A;  2DJQ A;  2O01 E;  2NUT A;  5GAN 6;  1PRL C;  1GRI A;  3CCV Q;  1E6H A;  3C12 A;  4PNO A;  3M53 A;  4C8Q E;  1SHG A;  4F7U E;  1TU0 B;  1AD5 A;  1IRE B;  4C0D B;  4C8Q B;  1UGP B;  3E1S A;  4BDZ A;  2J06 A;  1VQ9 A;  2V8K A;  2K5F A;  3R6N A;  1IGQ A;  2NUZ A;  1PHT A;  1IO6 A;  3UDC A;  1YP5 A;  2RD1 A;  2E70 A;  3V8L A;  2L0A A;  5AT1 B;  5GAO q;  2RK1 A;  3G7Z A;  4AG2 C;  2MYS A;  3G71 A;  1Y96 A;  2QQR A;  2EYQ A;  2K57 A;  5GJW B;  4CRI A;  3PTA A;  3OYY A;  3X20 B;  4M75 C;  2GCX A;  1N8R U;  1XTD A;  1VQ7 A;  5D6X A;  2YXY A;  4Z02 A;  4NOY A;  3HFO A;  3H8Z A;  3V7R A;  3CPW A;  2L3P A;  2M1H A;  3RES A;  4KGZ B;  4J8O A;  1U1T A;  1YHQ A;  4ZN1 A;  4PJL A;  5GAN f;  4KRT A;  2QXF A;  1WPY A;  2JMA A;  5KH6 A;  2PUK B;  1OX8 A;  2E1H A;  1B34 A;  3CCM A;  4ESR A;  4PK4 A;  1I81 A;  4J9E A;  2WAC A;  1A0N B;  3C94 A;  4M7D C;  4ZGE B;  3JCM Q;  2ABL A;  3I56 T;  2DJZ A;  3RKW A;  1TWB A;  1JJ2 P;  1O9S A;  5A0D A;  2VUB A;  3EG9 B;  2O4X B;  2DYI A;  1EIF A;  2V8J A;  2EGA A;  2X51 A;  4HT8 A;  3PVL A;  4RCC A;  2F1L A;  3CCV A;  1B7T A;  2JMC A;  3M9Q A;  3G6E T;  1KIK A;  2K79 A;  2DEQ A;  3PMI A;  1QKX A;  4J83 A;  5KYW A;  4O6J A;  1PM3 A;  3REA B;  3I5R A;  4BI8 B;  3QXE B;  5CK9 A;  3CCV T;  4JRQ A;  5KE3 A;  1G3W A;  4X9C A;  4FYY B;  5GAM d;  2CH4 W;  5I21 A;  4C0Z A;  4C8Q G;  4PLL A;  1SSH A;  1KQS P;  1VQK Q;  3DLM A;  3GOX A;  3OB9 A;  2A0F B;  2FPE A;  3ZBD A;  3RUX A;  4IIO A;  1PG5 B;  5EG2 A;  1K8A R;  4OB3 B;  4RG8 A;  3FLG A;  2B86 A;  1WQ7 A;  1OZ3 A;  4PJO D;  2DXU A;  5C6S A;  2KEA A;  5CO7 A;  4M77 A;  3HRS A;  1WXU A;  2QG9 B;  5LJ3 j;  2VB6 A;  3BE3 A;  1M3C A;  1KHI A;  1SG5 A;  2E65 A;  1W2B P;  3O5Z A;  1PD0 A;  2VXE A;  3CPW P;  2QYZ A;  3VS7 A;  3BFM A;  3UWN A;  3OS1 A;  4F16 A;  2QGF B;  2DO3 A;  4HVU A;  3L2Q A;  4PJO A;  2KT1 A;  4EIK A;  3OYE A;  1OX9 A;  5IHN A;  4M7D B;  2O88 A;  1YBY A;  4FU6 A;  1KG1 A;  1B07 A;  1X75 C;  4OB1 B;  2L5Q A;  3J80 E;  3SWN B;  1WHG A;  1JJ2 A;  2W0Z A;  1OYX A;  3CME T;  1WHL A;  3EHQ A;  3QZ5 B;  3JB9 G;  2QQA A;  1VQL A;  2ECZ A;  1HSQ A;  2D8J A;  2OI3 A;  4ELY C;  1AWW A;  1VQM Q;  1I1J A;  4LD9 K;  4C5I A;  4CI0 C;  1T3S A;  5IXB A;  3FRN A;  2XDB A;  2YRV A;  5CKF A;  5FLX E;  1HXD A;  2HNI A;  4JDS A;  3RER A;  1KC8 C;  3KBG A;  4J9G A;  2CS7 A;  4FYW B;  2P4T A;  4J6X A;  2RHX A;  2ZPF B;  4QVC A;  5A0L A;  4F7U F;  1YIJ T;  2PVG B;  3J7A F;  5LJ3 d;  4XTW A;  1GCQ C;  2KT8 A;  2LCL A;  3GNF B;  3OQ5 A;  1VQK T;  1RAD B;  3HRT A;  1R0C B;  2JS0 A;  3DKM A;  2FYK A;  3CPW S;  1WXB A;  3GIB A;  1JQQ A;  4M78 C;  2ZGW A;  3EFO B;  2DK3 A;  4P5N A;  4OVA A;  1W2B A;  2FZK B;  4Q5W A;  3ER0 A;  5KYU A;  2JM9 A;  4M7A D;  3URG A;  2E6Z A;  4A63 B;  1S72 T;  1VQ7 T;  1MMG A;  4BUG A;  4XAX B;  3VS2 A;  4C92 F;  1LPL A;  4CC4 B;  4M4Z A;  2RQT A;  1K1Z A;  2JTF A;  2MMP A;  3CC7 Q;  4RTZ A;  2L8D A;  3CCS A;  2LQW A;  5LL6 S;  1BIB A;  2K5I A;  3A8O B;  1K9M C;  4PJO E;  3JB9 F;  4IUR A;  2QQS A;  1YWP A;  2OTL T;  3CXC P;  4PJM A;  2FZC B;  4XTY A;  3CC2 A;  4JJD A;  4M7D D;  1JEG A;  2EJ9 A; 
#chains in the Genus database with same CATH homology
 5CKD A;  3MEA A;  4XU0 A;  1QVG A;  2GFU A;  4BE1 A;  2K3X A;  3ZEH A;  2FB7 A;  3ZFJ A;  4JUV A;  4C8Q F;  3WVE B;  4KUL A;  3J81 E;  2DPP B;  4C5H A;  4HCZ A;  3L2W A;  3OYD A;  1N9S A;  2RJF A;  2XD0 A;  3BDU A;  2D6F A;  2DXT A;  2KSS A;  2LQK A;  2EIF A;  3JCM h;  3EFS A;  2NLU A;  1VQO T;  2E64 A;  2LT4 A;  2FL7 A;  2I2L A;  3I55 A;  1YHQ T;  4M7A G;  4NL2 A;  3AHU A;  4L5G A;  4N0A A;  1BIA A;  3M4G A;  5AYF A;  5A0G A;  4FT2 A;  2K4Y A;  1KC8 U;  3OYJ A;  3OYK A;  1K8A U;  1KQS S;  3JCM P;  2LX9 A;  4HKE A;  4L59 A;  1YJN A;  5IAY A;  1N27 A;  3HPW A;  3LYI A;  3QPH A;  1UB4 A;  1AHJ B;  2M16 A;  3OSS C;  1NPP A;  4NS5 A;  1Y71 A;  2PQW A;  3OS5 A;  4JLI A;  5LJ5 e;  1I5L A;  3QJ6 A;  2CKK A;  1ZBX A;  3MCA B;  5LJ5 f;  3V7S A;  3HHT B;  3OYM A;  2YLC A;  5FRN A;  1G5V A;  4C8Q C;  4C92 G;  2XKO C;  4M75 F;  4X9D A;  4EMK B;  1MGQ A;  4M7A A;  1Q7Y U;  2PVD B;  5GAO l;  2OAU A;  3OS2 A;  4LDX A;  5GAN 3;  2DD5 A;  2IG0 A;  2EQJ A;  2GFA A;  5FRO A;  2F5K A;  1BI3 A;  2E5Q A;  4IUQ A;  4BI3 A;  5KCH A;  5GAN h;  4V2S A;  4ME7 A;  2RM4 A;  5GMK e;  2CZ1 B;  3S3M A;  2PU9 B;  2QDY B;  2AHJ B;  5GAM j;  1Q82 U;  2JUF A;  4M7D G;  3NTH A;  4M78 F;  4QVZ A;  1HK9 A;  1BI0 A;  2R58 A;  3VUB A;  3PMT A;  2VC8 A;  1YCY A;  4EPC A;  4M78 D;  3JAM E;  4QW2 A;  4MDX A;  2CYZ B;  4PJO F;  4ZGJ B;  4DOV A;  2KDS A;  2XK0 A;  2BKD N;  2R57 A;  2XU8 A;  3GNG A;  1WNL A;  4KT0 E;  4C92 A;  3PT9 A;  3OW2 S;  3M59 A;  2Y4Y A;  3JCM X;  2DKG A;  3TU4 K;  2X4Y A;  2X35 A;  4XU2 A;  1PSF A;  3CPF A;  3L42 A;  4RG2 A;  3OYA A;  1VQ6 T;  4HT9 A;  2QA4 A;  3F70 A;  3MET A;  3OYB A;  2ZPI B;  4B9W A;  3I55 T;  1SSF A;  5CQX A;  4RKU E;  4ZTJ A;  4TVR A;  1DJ7 B;  1VQ8 A;  4M78 E;  5GAM g;  1M4Z A;  4F7U G;  3CC7 A;  4JJN K;  2DTI A;  2IVW A;  5GAN 4;  2XI9 A;  2GQV A;  2YLB A;  3L2R A;  4IUV A;  2XDD A;  1FWZ A;  4BDY A;  3QG1 A;  5KE2 A;  2E6N A;  5DY9 A;  5FU6 B;  2OTJ A;  5A2Q E;  2P0Q A;  4ZGD B;  3KXT A;  3RIR A;  3TCJ A;  2DD4 A;  2VXF A;  3R6O A;  5IT9 E;  1YI2 A;  4A4H A;  3LW5 E;  3JCM J;  2VV5 A;  1M1K C;  3C95 A;  5LJ5 g;  4FIB A;  4VUB A;  5LJ3 f;  1VQO A;  2DZC A;  4L6V 5;  5LJ5 d;  1PSE A;  3A8M B;  2RK2 A;  4Y91 A;  4NL3 A;  3V7C A;  1YIT A;  1Q86 U;  3CCJ T;  5KCO A;  3JRZ A;  2EQU A;  4E7H A;  4EMK C;  2KAF A;  1WJS A;  3PNW C;  4E47 A;  2RHU A;  2ZPE B;  4F7U A;  1YI2 T;  4M7D F;  4C8Q D;  1G3S A;  3QO3 A;  5LJ3 g;  3S3N A;  1KD1 U;  3QJY A;  4FT4 A;  4GLK A;  5GMK m;  3CXC S;  2JZ2 A;  3PGG A;  3JSC A;  1YJ9 T;  2MI6 A;  4M75 D;  3X26 B;  2R5M A;  4QVC A;  2KQW A;  3PIO A;  2C06 A;  3SD4 A;  3VV0 A;  3QDR B;  4PJO B;  1VUB A;  1FXX A;  4E7K A;  3OYG A;  3CBO A;  3OA6 A;  2LCC A;  2M0O A;  3VKI A;  2MWP A;  5GAM f;  2L89 A;  4M78 G;  3PIP A;  4OGE A;  1YJ9 A;  3V8K A;  3L2V A;  1M1K U;  5GMK i;  1N6A A;  4C92 E;  3CC4 T;  4QQD A;  1M8V A;  2BUD A;  1VIF A;  4M75 A;  3X25 B;  3H6Z A;  3P8H A;  4BE0 A;  1VQM A;  4LD6 A;  4DOW A;  5CCA A;  1XQH A;  2GF7 A;  3FIF A;  2QEX T;  4JS4 A;  2EQK A;  1N8R C;  3RMS A;  3OMC A;  2DXB A;  4XU1 A;  3SWN C;  1X01 A;  4N4I A;  3RMQ A;  5DLQ E;  3FEO A;  3MP1 A;  3OYC A;  1R8O B;  2R5A A;  3QZ9 B;  1YIJ A;  1UGS B;  4JRI A;  1VQ4 A;  5GAN 2;  4C0G A;  3UT1 A;  2QA4 T;  1G3T A;  1S72 A;  1G3Y A;  1OZ2 A;  2XIC A;  1NZ9 A;  3E9G A;  4M78 B;  2FHD A;  1Q86 C;  2L3R A;  4Y28 E;  3JCM g;  3CME A;  2F5T X;  1VQP A;  2Y90 A;  4M77 C;  3CD6 A;  2MAM A;  3CMA T;  2K3Y A;  5GMK l;  3CCE A;  5GAO m;  1YIT T;  3JCM d;  3CCJ A;  2E12 A;  2O01 E;  1LJO A;  2RI5 A;  3PFS A;  5GAN 6;  2OTL A;  2LQ8 A;  4O5V A;  3DB4 A;  2CZ0 B;  2B8A A;  3SWN A;  4R55 A;  4XK8 E;  3M4Y A;  5CR2 A;  2DAQ A;  1VQN T;  1X6O A;  3C12 A;  4M75 B;  4PNO A;  1K8A C;  3M53 A;  4C8Q E;  4F7U E;  5GAO n;  2K2V A;  1IRE B;  4C0D B;  3SFM A;  1KHC A;  1UGP B;  4OB2 B;  3E1S A;  4QQG A;  5CIU A;  4C8Q B;  3A5Z B;  3LWH A;  4BDZ A;  1U8R A;  5LJ5 j;  1K73 U;  4M75 G;  4C92 D;  5M9O A;  5LJ5 h;  1VQ9 A;  1GXI E;  2MWO A;  2V8K A;  3HL8 A;  3GPL A;  1VQL T;  3CC7 T;  1NPR A;  5HY6 A;  3CCE T;  2K5F A;  1Q81 U;  1UGQ B;  3CCQ A;  1VQ9 T;  3OYN A;  4MDW A;  3CMA A;  2RH2 A;  1H3Z A;  4A4K A;  3MP8 A;  3UDC A;  5GAO r;  2OTJ T;  3CBM A;  2RD1 A;  5J3B A;  2E70 A;  3L2Z A;  5GAM e;  3NFC A;  2X4W A;  3A8L B;  2QTX A;  3MP6 A;  4PLI A;  3V8L A;  2XID A;  1XOV A;  5GAN e;  4UC4 A;  4PJO C;  4EMK A;  3LX7 A;  5GAO q;  2CZ7 B;  2RK1 A;  3G7Z A;  3G71 A;  5D6W A;  3BDL A;  1Y96 A;  1VQ4 T;  2QQR A;  2D9T A;  3LH0 A;  2EYQ A;  3N5B B;  3FDR A;  2PVO B;  4MMK A;  3OS0 A;  4M77 G;  1ZQ1 A;  3JCM W;  1Q81 C;  2K57 A;  4CRI A;  4J5Y A;  5DM7 R;  3PTA A;  2DIG A;  5I2S A;  3ME9 A;  3OYY A;  3X20 B;  2VYT A;  4M75 C;  3VUZ A;  2GCX A;  4M7D E;  1N8R U;  1XTD A;  2K5L A;  2DIQ A;  4MZT A;  1VQ7 A;  4ELZ C;  4XTZ A;  5D6X A;  3OMG A;  3GF5 A;  2ZPB B;  4XTU A;  3DB3 A;  3S3O A;  4NOY A;  4Z02 A;  1M5Q 1;  3HFO A;  5GAN 8;  3A8H B;  4MZP A;  2RB6 A;  5GAN g;  3H8Z A;  3V7R A;  3CPW A;  2M1H A;  2RA2 A;  2JTM A;  3CCL A;  3RES A;  2E41 A;  4J8O A;  1U1T A;  1Q82 C;  5HK3 A;  1YHQ A;  3VYH B;  2KVQ G;  4ZN1 A;  2HD0 A;  5GAN f;  3CC4 A;  3CCL T;  1JBM A;  2V8I A;  2QXF A;  3HP9 A;  3V8J A;  1WPY A;  1YJW A;  5KH6 A;  2EFI A;  1QP3 A;  3C4S A;  2PUK B;  1YJN T;  1Y96 B;  2E1H A;  2JOY A;  4GY5 A;  4HA8 A;  5GAN 7;  1LNX A;  1B34 A;  4X34 A;  3CCM A;  1M90 U;  1QVF S;  2EKO A;  1I81 A;  2WAC A;  3C94 A;  1KQ2 A;  2ZZD A;  4C92 C;  4YTL A;  4M7D C;  4ZGE B;  3JCM Q;  3MHX A;  3I56 T;  3UPU A;  1QVG S;  2LNV A;  2M9U A;  2DJZ A;  3KUF A;  3CC2 T;  2O4X A;  3RKW A;  2LC4 A;  4M77 B;  1QW1 A;  1BYM A;  3LWI A;  2RJC A;  5CVI A;  1O9S A;  5A0D A;  1VQ5 T;  3I56 A;  3FC3 A;  2VUB A;  3WVD B;  3NTK A;  2A3L A;  3HKS A;  3VU3 C;  2O4X B;  2VGM A;  4II1 A;  1EIF A;  5DLO A;  2P0K A;  4DA4 A;  2X4X A;  3QKJ A;  2V8J A;  1WJQ A;  3M55 A;  3G4S A;  1M90 C;  2E10 A;  3M58 A;  3QYG B;  4RCC A;  4F7U B;  4HT8 A;  2EAY A;  3CCV A;  3CCU A;  1QVP A;  4JLG A;  1VQ8 T;  3M9Q A;  3G6E T;  3JB9 J;  3G4S T;  2HAX A;  1NE8 A;  4A54 A;  2DEQ A;  3PMI A;  1P92 A;  4J83 A;  4BY6 B;  4O6J A;  3SB2 A;  3G6E A;  2RJD A;  3QUI A;  4IUP A;  4N4H A;  4BI8 B;  3QXE B;  1QP2 A;  5CK9 A;  3CCV T;  4JRQ A;  2KY9 A;  5KE3 A;  1G3W A;  2DVE A;  2RO0 A;  4X9C A;  4WF2 A;  5GAM d;  1KD1 C;  3A8G B;  5I21 A;  4XQ3 A;  4C0Z A;  4PLL A;  2DTH A;  2XHC A;  1D3B B;  4C8Q G;  3RKY A;  3DLM A;  2DXC A;  4LDW A;  5GMK h;  3OB9 A;  3GOX A;  1Q7Y C;  4M7D A;  4OMF B;  4FM4 B;  3DLL A;  2ZCF B;  4HCB A;  3ZBD A;  1VQ5 A;  4QQ6 A;  4B9X A;  3RUX A;  1M9S A;  2CGH A;  1VQN A;  5EG2 A;  1WQW A;  1JB0 E;  4OB3 B;  3OBY A;  1D3B A;  5HKC A;  2KMT A;  4M77 F;  4RG8 A;  3FLG A;  1WQ7 A;  5LJ3 h;  1OZ3 A;  4PJO D;  2DXU A;  5C6S A;  5CO7 A;  4EMH A;  4M77 A;  2YHT A;  3HRS A;  3EAE A;  5GAN j;  4E7J A;  2VGN A;  5LJ3 j;  4C92 B;  1KQS A;  5GAO p;  4XTX A;  3S6W A;  4OP0 A;  4BI4 A;  1KHI A;  2E65 A;  5CKB A;  1VQM T;  2JN0 A;  4M7A F;  1NJI U;  1BKB A;  1B34 B;  2VXE A;  3QBY A;  3JCM e;  1MHN A;  3BFM A;  2XG8 D;  3INZ A;  3UWN A;  3OS1 A;  2WSE E;  5L8R E;  3OYI A;  1BI2 A;  2P0P A;  3EFR A;  1OI1 A;  2DO3 A;  5J26 A;  1BI1 A;  2D0Q B;  3BW1 A;  3WXM B;  3GLX A;  3NTI A;  1K73 C;  1N9R A;  4EMG A;  4HCC A;  1VQK A;  3M5A A;  1FX7 A;  5FU7 C;  3L2Q A;  4PJO A;  1H64 1;  3OSV A;  3OYE A;  2EWN A;  3HRU A;  5CKH A;  4ZN3 A;  1W4S A;  5GAN 5;  3HSB A;  2ZPH B;  3TRE A;  4MZM A;  4RCB A;  4A4F A;  4M7D B;  1YBY A;  4FU6 A;  1UGR B;  4LDY A;  1KG1 A;  1X75 C;  3OBW A;  2RHI A;  3CBP A;  2QQ9 A;  4OB1 B;  2JNG A;  2L5Q A;  2JVV A;  2RHY A;  1O75 A;  3J80 E;  3SWN B;  3Q1J A;  1JJ2 A;  1OYX A;  3CME T;  3LGF A;  4M75 E;  4JS5 A;  3QZ5 B;  2LVM A;  2QQA A;  3CCU T;  2RHZ A;  3JB9 G;  1VQL A;  3E19 A;  4IKF A;  2G3R A;  4IUU A;  4OB0 B;  5FU7 B;  4BE2 A;  4ATO A;  4KBM B;  3MEW A;  4ELY C;  4LD9 K;  2WSC E;  4C5I A;  1TH7 A;  4N0A C;  4CI0 C;  4XU3 A;  5J39 A;  3M54 A;  3GP8 A;  3CCQ T;  3FRN A;  2XDB A;  1KQ1 A;  2LTO A;  2YRV A;  2QI2 A;  1I4K 1;  5CKF A;  5FLX E;  5HK0 A;  3L1A A;  1HXD A;  2HNI A;  4FL6 A;  4FSX A;  4JDS A;  3RER A;  1KC8 C;  3KBG A;  3CCS T;  1WJR A;  3QII A;  2CS7 A;  3E9F A;  5I2M A;  4A4E A;  4A4G A;  1JRI A;  2P4T A;  4J6X A;  1Y7X A;  2RHX A;  2ZPF B;  4M77 E;  4A53 A;  4F7U F;  3HFN A;  5A0L A;  4XTV A;  4PJO G;  1YIJ T;  5CAI A;  2PVG B;  1VQP T;  3CD6 T;  1M1F A;  4JRP A;  3J7A F;  5LJ3 d;  3MEV A;  4D6W A;  4J6W A;  3OY9 A;  3JCM V;  3P8D A;  4XTW A;  5GAN d;  4C8Q A;  4R56 A;  1JJ2 S;  5FRM A;  4N4G A;  2HBP A;  2LCL A;  3GNF B;  3FJP A;  3O8V A;  4C5G A;  2F69 A;  4J7F A;  3OQ5 A;  2A7Y A;  3VJP A;  4J6Y A;  2XDP A;  3HRT A;  3CCR A;  1VQK T;  4BY6 C;  4E7I A;  3DKM A;  2FYK A;  3CEY A;  4KUI A;  3CPW S;  3QYH B;  2Y4X A;  4M7A E;  4PL6 A;  3GIB A;  1VIE A;  2LT1 A;  3LGL A;  3JB9 D;  3CCR T;  3RKX A;  4M77 D;  2QQB A;  5CQY A;  2EJG A;  4M78 C;  2LDM A;  2ZGW A;  2DK3 A;  4P5N A;  4ZTF A;  2CZ6 B;  2PUO B;  4OVA A;  4KUD K;  2DZ9 A;  1XNI A;  3LLR A;  1W2B A;  4C0F A;  2RI2 A;  5FU6 C;  4LDV A;  4Q5W A;  4C0D C;  4BAC A;  3CCM T;  1QVF A;  2BIV A;  3ER0 A;  3P8B B;  3X28 B;  3M56 A;  4M7A D;  3URG A;  2E6Z A;  2X4J A;  4DQ2 A;  1LOJ A;  2RJE A;  3MO8 A;  3OW2 A;  1I8F A;  1S72 T;  1VQ7 T;  4OF1 A;  1V29 B;  2LRQ A;  2HQE A;  4PKC C;  4IUT A;  4BUG A;  2EQM A;  3MEU A;  3JB9 H;  4XAX B;  4C92 F;  3QSU A;  1UEB A;  1NJI C;  3CXC A;  4EDU A;  1RL2 A;  3QHS A;  3SDZ A;  2JTF A;  2DTO A;  2MMP A;  4BB7 A;  4M7A C;  3JCM c;  2QEX A;  1IZ6 A;  2KK4 A;  3JCM f;  3OYH A;  2FVU A;  3VYG A;  4RMO A;  2L8D A;  4M78 A;  4OGC A;  4C5E A;  5GAM h;  3CCS A;  3M57 A;  5LL6 S;  1M1G A;  1BIB A;  3FB9 A;  4JRK A;  4MML A;  2K5I A;  3A8O B;  5CKE A;  5GMK j;  1K9M C;  1ZHI A;  3JB9 F;  4PJO E;  2H3J A;  3X24 B;  5D6Y A;  2EJF A;  4IUR A;  2QQS A;  2MF2 A;  5IN1 A;  4BD3 A;  3OYF A;  4E7L A;  1K9M U;  2OTL T;  4M7A B;  3T9N A;  4LDU A;  1W2B S;  2ZPG B;  3BY7 A;  3G71 T;  1VQ6 A;  2WSF E;  1RI0 A;  3L2U A;  4XTY A;  4J7I A;  1Y07 A;  3CC2 A;  1U1S A;  4M7D D;  5LJ3 e;  1WGS A;  3ASK A;  3JB9 I;  2EJ9 A;  3TEE A;  4QVD A;  2RI3 A;  3OYL A;  5C0M A;  3JCM b;  2HQX A;  1YJW T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...