3MHXA

Crystal structure of stenotrophomonas maltophilia feoa complexed with zinc: a unique procaryotic sh3 domain protein possibly acting as a bacterial ferrous iron transport activating factor
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
85
structure length
85
Chain Sequence
b'AMTLSELPLHTSAVVESVQDLHANDAIARRLRELGFVKGEEVRMVAKGPVGGEPLLVQVGFTRFALRISEAKRVVVDAASQERRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferrous iron transport protein A
molecule tags Metal transport
source organism Stenotrophomonas maltophilia
publication title Structure of Stenotrophomonas maltophilia FeoA complexed with zinc: a unique prokaryotic SH3-domain protein that possibly acts as a bacterial ferrous iron-transport activating factor
pubmed doi rcsb
total genus 22
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3mhxA00
2K5IA 1G3TA 1G3WA 1G3SA 1QW1A 2K5LA 2QQ9A 2QQAA 2GCXA 3MHXA 5CVIA 1P92A 2QQBA 1U8RA 3HRTA 2H3JA 1FWZA 1BI0A 1G3YA 3GLXA 3E19A 3HRSA 2LX9A 1BYMA 2K5FA 3HRUA 1BI3A 1FX7A 1BI1A 4O6JA 4O5VA 1QVPA 2K4YA 1BI2A
chains in the Genus database with same CATH superfamily
5GAOr 1G3WA 1GCPA 1M1KR 2QQ9A 4OMFB 1Q95G 2RNAA 1VYVA 2EYZA 4C8QA 1U1SA 1M3BA 2YDLA 2BE7D 2XIDA 2DD5A 4IUTA 2G6FX 2KI7A 3OYJA 5GMKe 2JS2A 3CMAQ 2DO3A 2FO0A 4J83A 4M75E 1YJNT 3QJ6A 1KC8C 1G3TA 1ZBJA 2H3EB 2VKNA 1WHJA 1TTHB 2VV5A 4OMPA 5LJ5g 1YHQT 1HSQA 4PLIA 4RTXA 3CEYA 3QZ9B 1UHCA 2NUTB 2CS7A 4AFZC 1U1TA 2AK5A 2BZYA 3UF4A 3MCAB 2O2OA 2P84A 5IHKA 4E7JA 3C95A 4OMLA 2BKDN 3VYGA 3TCJA 2HAXA 5D6YA 3MHXA 3G4SQ 4J9DA 4C0FA 2FB7A 4P5NA 2CP0A 2IG0A 4M77G 3L1AA 4FCYA 1JBMA 2FZGB 1JO8A 4VUBA 5KE3A 1N8RC 1OOTA 1QVFA 4M78E 2JN0A 2CT4A 3RKYA 2EJFA 3H41A 1BCMA 1EIFA 1UGQB 4BDZA 2YWWA 2AT1B 1NYGA 1BU1A 2DVJA 2J6FA 3FEOA 1AZEA 1VQ6T 1H3HA 3P8BB 4MZMA 2KRNA 5J39A 4RG8A 3CCST 2FVUA 2ZCFB 1RL2A 4LDXA 4NL3A 1K73U 3M56A 5HY6A 4AFSC 1TUDA 4OB1B 1RAFB 1YCYA 5FW9A 2XDDA 2DF6A 1SF9A 5CQXA 4ESRA 2GTOA 3M58A 4PJLA 2A28A 2DRKA 2CDTA 2DTIA 4Y92A 1VQ5A 2RK2A 1VYUA 5I22A 1I1JA 1Y07A 1RI9A 4C5GA 1O75A 3TSZA 2LQKA 2LNVA 3OYNA 1PRLC 4LDUA 1FXXA 3F70A 1DJ7B 2FRYA 1VQ8T 5KYXA 3C0CA 1VQLT 2DXTA 1IO6A 3M0PA 3CMAT 3I56T 1YJNQ 4A53A 2ATCB 4OB0B 1FWZA 1VQ4T 1YNZA 3CCUA 4QQDA 4A4HA 1YHQQ 4E7HA 3HFOA 3PT9A 1W6XA 4C0ZA 2P0PA 1G8XA 4ZTJA 3CC7A 2KY9A 3VS5A 2JOYA 2DL4A 2RHYA 2ZPFB 1Q82R 4LD9K 4YTLA 3TVTA 3KUFA 2F2VA 4L5GA 3EHQA 1GCQC 5GAOl 4X1VA 3GF5A 1N5ZA 2FZKB 1YI2Q 1N8RU 4C92C 1OU9A 2NUPA 3I55T 1UE9A 3FC3A 2XDBA 1QW1A 3A8GB 5GAMd 2LVMA 4A4EA 4MZTA 4AG1C 1K8AU 4LN2A 1Y71A 1RACB 3OB9A 5LJ5e 2X35A 4QVCA 3A8LB 2KSSA 1BB9A 4J6XA 1NEBA 4BY6C 1GCQA 3VS0A 3CC4T 3THKA 4C0DC 3BFMA 2HQEA 2GCXA 4JRKA 3CCVT 3JCMh 2RN8A 4E7KA 1NM7A 2K2MA 1NJIC 2QQSA 2VVKA 2FPDA 3NPFA 2DKGA 4DBQA 2NUZA 3NTHA 3CCRA 3JCMf 2COYA 1FMWA 5GAN7 3OMGA 3EG3A 2MK5A 1AD5A 1WXBA 2BZ8A 4M75F 3I56Q 2J06A 1PD1A 4LE9A 1YJWT 4GY5A 2W0ZA 1LJOA 3E9GA 3EGDA 1VQ4Q 4OMNA 3E2UA 4KGVB 5IAYA 2OTJA 1UEBA 2E3HA 3AHUA 4CC3A 1Q82C 4BE0A 5C6SA 2DE0X 9ATCB 2ED1A 3QZ5B 5A0DA 5CR2A 1RAAB 1ZSZB 2X4JA 3A8HB 1KQ1A 4DBFA 2GFUA 5CKEA 3CD6T 2F5TX 1X6GA 3PIOA 2VGNA 2HQHA 5GAMf 2OI3A 2I2LA 4Y28E 2DBKA 4KBMB 4JJDA 2L2PA 4M75G 4X9DA 1NYFA 2CSQA 4KULA 3JCMX 4FSSA 1T0JA 2PVDB 1UUEA 2HZYA 1RAIB 2V8KA 4UC4A 2DD4A 4E7SA 2BE9B 4PJOA 2ENMA 1GBQA 1YJ9T 1XTDA 3I5RA 1TG0A 2C0OA 1JJ2S 3KXTA 2YUQA 4XU3A 1SRMA 4D6WA 4N4HA 3CC4Q 3JB9I 2D9TA 2GNCA 3JCMP 1MNDA 4JS5A 2PZ1A 2RI3A 3FDRA 1K0XA 2OTJT 1EZZB 2CGHA 4EMKC 1FYNA 2DJQA 3CCVQ 5GJWB 4DOWA 1H3ZA 2CH4W 4NOYA 4RTTA 4M77F 5FROA 1QMCA 4M77C 1BI1A 1UJYA 1OX8A 2J7IA 4F17A 3G1JA 1PKSA 2GQIA 1CSKA 3QDFA 2LCLA 1QVGA 2AKLA 2M0YA 2RI5A 4FL6A 3EGUA 2QGFB 1G3YA 4TVRA 4ZNXA 2JJ9A 2CZ0B 4DA4A 1WI7A 4HVVA 2BIVA 4J7IA 2RM4A 3OW2S 3CCRT 2KRSA 1TUGB 4CC4B 4GBQA 2ESWA 2P0QA 1RLQC 1LOJA 1QP3A 2KVQG 2KYBA 1VQMQ 2LJ3A 3RBBB 4HCKA 1HK9A 4XTWA 1NEGA 2V1QA 3CCVA 1UTIA 4M7AB 4JRPA 1K9MR 3JB9F 4WF2A 3CCQA 3EG9B 2A08A 3EH2A 1VQ7A 1GBRA 1T3SA 1UB4A 1K8AR 4MDWA 4B9WA 1YIJT 3MP1A 3JAME 5KYUA 1R77A 4K11A 2HMAA 5IHNA 2YUPA 1M1KU 3JRZA 2B86A 4IIOA 2MI6A 4XTYA 1N9SA 4M7DA 3QYGB 2EVRA 3JCMg 1JU5C 2LRQA 1YI2A 1NLPC 3L2VA 2AIRB 5LJ3f 1V76A 2CZ6B 4BE2A 4PNOA 3G71T 3LWIA 5FWBA 3DB3A 4M78D 2ZPIB 2XG8D 3JCMW 2P4TA 4O6JA 3SD4A 2JZ2A 3GIBA 2ROLA 2M02A 4F04B 2PQWA 3EGXB 3M54A 2KBTA 1NLOC 3V7RA 4KGXB 3M59A 2CT3A 4C5HA 2OAUA 1X01A 3M53A 4JJBA 4R55A 3L2ZA 4CC7A 2CZ1B 3NTKA 2K2VA 1RABB 2E5KA 1FX7A 3EGXA 2OTJQ 1W2BS 5GAN8 4OVAA 4BI3A 2EIFA 4ANJA 1K73C 1UGVA 1BIAA 3I56A 1Q81R 3H0FA 5GMKh 2ECZA 2EQUA 2FRWA 5KCHA 1X2KA 4M7DF 3NGPA 4ME7A 4N0AC 3EG9A 1WZOA 3TEEA 2QASA 3RIRA 1X43A 3PTAA 1YCSB 1D0YA 1J3TA 3OW2A 3EGDB 1ZHIA 1K76A 4CC2A 3MEWA 2YUOA 4M7DB 4FM4B 3OYFA 3OY9A 2WSCE 2LJ0A 2BUDA 4GLMA 5FU6B 3TU4K 3CC2Q 3CCJT 1VQMT 1Z9QA 4PJNA 5GAN6 1SKUB 2ROTA 3OS1A 3CPWS 1MNEA 4C92F 2R57A 2XKOC 1MMDA 1YIJQ 4PFZA 3OW2P 2K7AA 3RKXA 5GMKm 2CKKA 1Y57A 1VQPT 2XK0A 1VQPA 1VIFA 1U8RA 2DIQA 1WHGA 3QSUA 4AFQC 3HRSA 5LJ5f 4KH1B 4D8KA 1M90C 3G4SA 4MMLA 5DLQE 2Y4XA 4A4GA 3QPHA 1VQMA 2K5IA 3D7SB 2HD0A 3SDZA 4ATOA 4PL6A 2VXEA 2X3XD 2VB6A 4M7AC 4HCCA 1M5Q1 2HDAA 3VRZA 5KYWB 2F69A 2YRDA 1M2VA 2J6KA 2PUKB 2FZCB 1N27A 5A0LA 3EFSA 1IREB 2DYBA 2CP6A 2KMTA 1WQ7A 4XU2A 2LZ6B 2FPFA 4EMHA 3OBYA 1WX6A 1B3QA 1K73R 1K0SA 4RTWA 2A36A 1M2VB 1UDLA 4M7AF 3URGA 2E64A 3X26B 3DKMA 4FU6A 1YJNA 2OTLT 2JMCA 1FMKA 2DMOA 4Q5WA 3RDVA 3OYMA 2JTMA 2LQWA 1I8FA 2KRMA 4V2SA 1OU8A 3G6ET 2JVVA 2Y90A 3M55A 1SHGA 2AZSA 3LGLA 2L8DA 1HYOA 3WVEB 2XHCA 1PSFA 2RQRA 1GXIE 1X27A 3PMIA 4KH0B 5LJ3g 1SG5A 2LQNA 4QQGA 1ZUKA 4OB2B 2YSQA 1QQJA 2L3SA 1D1BA 3OYCA 2B8AA 1PCXA 3M9QA 4OMMA 2O31A 1PNJA 3PVLA 3A8MB 3OYAA 4F7UB 4ZGDB 3M0SA 3G71A 2LT1A 4M75A 4M7AG 2RH2A 2RHXA 3ME9A 4M78A 3JV3A 1PG5B 1XNIA 4M7DE 5GAN3 2G3RA 1M1KC 1S1NA 2J05A 5LJ5d 2EPDA 4C92G 3EHRA 3A1PA 1NBEB 3SWNC 1KJWA 5A2QE 5FU7C 3DLMA 4KUIA 4J8OA 1H641 4M7DC 2CREA 1QVGS 1VQ9A 4IUVA 3JB9H 3VV0A 2D8HA 4HCZA 1Q82U 4FW2A 3QDRB 2EFIA 4BD3A 2DVEA 4HVUA 3CQTA 2R5MA 3L2WA 4KUDK 1G5VA 1T3LA 4A4KA 3SB2A 2VGMA 3H0HA 3CXCA 2WSFE 3V8KA 4C0DB 4JJCA 1E7OA 5GJVB 1Q7YU 1VOMA 1WPYA 2QXFA 1GFDA 2C06A 5HK0A 2JM9A 2QAZA 2KAFA 5HCKA 3FRNA 1LVKA 4ZTFA 1KD1U 3NFCA 2M0OA 3PGGA 3CMET 1Y0MA 4LUEA 3CCEQ 3CCLQ 4HKEA 1VQ7Q 4M75B 4J9FA 5AYFA 3G6EQ 3RR6A 4BDYA 1IRXA 4OGCA 2RA2A 2E10A 3QG1A 3S3NA 2A7YA 1OZ2A 3V8LA 1OEBA 1QKWA 3GBQA 2D1XA 2SEMA 1YJ9A 1D0ZA 2HKNA 2XDPA 3WXMB 1YFNA 1ZA1B 3NTIA 2M51A 4BE1A 2RQWA 2JMAA 1H92A 2HEQA 5GAOn 4QVZA 2X4XA 4ORZA 2KE9A 2FPEA 1M30A 2KEAA 4GLKA 5CVIA 2RO0A 3OS0A 1VIEA 5KCOA 1SEMA 5CO7A 1K9AA 3C94A 3GP8A 1VQ8Q 1MHNA 1OV3A 5KYYA 1N6AA 1XJWB 3H8ZA 5I2SA 4QW2A 3CCQQ 1B7TA 2OX7A 3QHSA 3CCUQ 1QCOA 3VUZA 1WHMA 1K4US 2E5QA 3CCJA 1M1GA 3RESA 4M78G 3S3OA 3L2UA 4FT2A 1RAEB 2RHIA 1Q86U 1UGSB 1ZSZA 1KD1R 3CBOA 2DA9A 3OA6A 4JS4A 2MAMA 3ZFJA 5CK9A 3OYGA 1WIEA 2O4XA 1UGPB 1BI3A 2A3LA 4J9IA 3IQLA 2NLUA 1MMNA 1BBZA 5C0MA 1SRLA 2LX7A 2ZPEB 5GAN4 3E1SA 4OF1A 1Q86C 4M75D 3CCLT 3EAEA 3X20B 1W2BP 2NWMA 2DBMA 1BI0A 4IURA 1WLPB 5GANg 3DB4A 2XI9A 4F7UG 4FYWB 4N4IA 1ABOA 1EX4A 2DERA 2E3IA 1E6HA 2L3RA 1G83A 1SPKA 1NG2A 4A54A 3EH1A 4F7UA 1IHVA 4XQ3A 3UA6A 4M7AA 1C6VX 4N4GA 3OYEA 3ZBDA 5LJ3d 2DZ9A 5I2MA 4OB3B 2RHZA 1QWFA 3VS2A 2DILA 2QGGA 4F16A 4N0AA 3I9QA 4M77E 2LCCA 2QTVA 5CKHA 4DBHA 3LGFA 4M75C 1D09B 5EC7A 1TS9A 2ZPBB 3CPWP 1WGSA 4M7AD 4OMOA 3G7ZA 4PK4A 4EPCA 5CCAA 3OYDA 5GAMh 1OZ3A 3UT1A 4QT7A 4JJNK 3HRTA 2MOXA 2RF0A 2BZXA 1YJWQ 1VQOT 3QWYA 4LD6A 1YIJA 1GRIA 3MEAA 1YWOA 5CIUA 2FHDA 3TSWA 4RTYA 1VQNQ 3CCQT 2E12A 2JXBA 1ZX6A 2EGAA 5GMKi 5GAOp 5LJ5h 3CCUT 3QWXX 1PKTA 1VYTA 2LDMA 1PD0A 1D3BA 1UG1A 4QQ6A 1PC0A 1PRMC 4AFUC 3CMAA 2CP3A 3JB9D 4LXCA 1VQLA 1QVFP 1QKXA 2K57A 1MMAA 1Y96B 3N5BB 3T9NA 2W10A 1BK2A 5FU7B 1YN8A 2XD0A 1ZUUA 1VQ5T 1I0CA 2IVWA 2JT4A 3VUBA 5GANf 1WJRA 2VC8A 4MDXA 1M1FA 3GLXA 2K3YA 2DRMA 3RMQA 2OAWA 1IHWA 3HP9A 3PIPA 3JCMb 2EYXA 3CCSA 1JQQA 1C1AA 1ACMB 1Q7YR 2F1LA 2QYZA 5LJ3h 3MP8A 4J9CA 2QDLA 2K5LA 2QQAA 1B07A 1NPRA 5KH6A 1RLPC 3PVQA 3CCMQ 4DBRA 2P4RA 4OP0A 3OBWA 5CKDA 4M77D 4FSXA 1D1AA 1KIKA 1QCFA 4C8QF 2GGRA 1PSEA 3MP6A 4MMKA 2KYMA 3R6NA 4F7UE 1AWXA 2HBWA 3JB9J 3LW5E 4EIKA 2HSPA 1YITT 2CYZB 4OMQA 3CCRQ 2MYSA 2X4WA 1B34B 2F2WA 4XTXA 1WQWA 2O01E 2KT8A 3QJYA 4B9XA 3VRYA 2LTOA 3M0RA 4C8QB 2EQKA 1ABQA 1VQOQ 2BTTA 5GAMj 4QVDA 1OPLA 3CC7Q 1VQNT 2KXDA 1YHQA 3M4YA 1M90U 2JNGA 5GANh 1TH7A 2AKKA 3HFNA 1YJWA 5D7UA 1OX9A 1IB8A 2L5QA 5GAMe 3CBMA 2KK4A 2PU9B 3E9FA 3CCEA 1D1CA 4II1A 4XTZA 3RKWA 2EJ9A 4BACA 2A37A 5GANd 1AWJA 4J7FA 3QKJA 2P0KA 5GMKl 4C5IA 3VU3C 5IXFA 2PVGB 3G71Q 1VQKA 1PWTA 2SRCA 4E7LA 1U5SA 2O88A 2JM8A 1VQ5Q 2YT6A 1WDXA 2E41A 3PMTA 5IXBA 3WVDB 3S6WA 4KRTA 2DL5A 3LX7A 2JW4A 4BY6B 1WFWA 2EBPA 2PTKA 2HNIA 4E47A 1PHTA 3MEUA 4FW1A 2HBPA 1W2BA 1NJIR 1Y7XA 3V8JA 2VYTA 2RHUA 1U3OA 3ZEHA 4PJJA 3KFVA 3OQ5A 1X2QA 1M8MA 2H3JA 8AT1B 5LL6S 5IN1A 1B34A 2CP5A 1VQ9Q 4RKUE 1KG1A 2MPXC 1JXMA 2IIMA 4CI0C 4PKCC 3RNJA 4J6WA 2DEUA 2RJEA 2XU8A 3EFOB 1X75C 1U06A 1YWPA 2FG0A 3P8DA 2V8JA 5A0GA 1FMVA 2DTOA 3EG2A 2RQUA 4AMCA 2EQMA 2D0NA 3H0IA 5HKCA 1TWBA 3HPWA 2J6OA 2DM1A 4C8QG 1WXUA 2K79A 4X34A 3VS7A 1CKAA 3MKDA 2DETA 1S72A 3LLRA 5DLOA 1V29B 4F14A 1ARKA 3PFSA 3UPUA 3CC2T 1X6OA 4NS5A 3CCJQ 1I5OB 1W70A 2GF7A 2DJZA 2L3QA 5GAN2 3OYBA 3CC7T 4DQ2A 2ZPHB 2RPNA 3OSVA 4M78C 3G6EA 1WXTA 4IUUA 3QUIA 3UDCA 2M16A 2VUBA 2KDSA 3FLGA 1QP2A 2OTLA 1O9SA 3C4SA 1H8KA 3EG1A 1VQPQ 4J9BA 4ZN3A 4E6RA 3GNGA 3HTRA 5IH2A 4RTZA 2X9HA 3M0QA 3GPLA 1WNLA 4Z8AA 2HSEB 2VASA 1VQ8A 2EGCA 1ZBXA 4LDVA 2GTJA 3JCMc 1IGQA 1CKBA 1D0XA 1QCNA 3SEMA 1AWOA 2IPOB 1Z9ZA 3GNFB 4C92E 1WA7A 2EJGA 2HQXA 4M7DG 1K8AC 4Z02A 2KNBB 4M78B 1X69A 3TREA 1W1FA 1R8OB 4EMKB 2I0NA 3G4ST 3EFRA 1KHIA 4F7UF 2CUBA 1VQ6A 3M4GA 2COZA 3M0UA 4PFOA 1VQKQ 2E1HA 4PJOE 2K4YA 1KK7A 4HT9A 2LNHB 3JSCA 1HXDA 2EYYA 2D6FA 4DEYA 3CCMA 1ZLMA 3QBYA 1ZUYA 2PNIA 1WHLA 1JB0E 1QVFS 2WACA 2RQVA 4MZPA 2RJFA 3CCSQ 2C0TA 4J9HA 1LCKA 1NZ9A 4IUQA 4JLGA 5GAMg 5L23A 3NHNA 2DLPA 4ELYC 2NUTA 3CC2A 1RUWA 5J3BA 1AOJA 1KQSS 4PJOC 3OYLA 4C8QE 2XICA 4HCBA 1S72T 2LX9A 2RD1A 1AEYA 2EGEA 4KGZB 3ZL7C 2JTEA 3X25B 3HRUA 3CXCP 2DTHA 4M77B 3J80E 2DK3A 4RCCA 4IUPA 1GFCA 1UHFA 2GBQA 2KR3A 2PVOB 4RG2A 2RQTA 1G2BA 3BW1A 1VQLQ 3QO3A 2M9UA 1KC8U 2MWOA 4M77A 3VJPA 4J5YA 4C8QD 4XTVA 5AT1B 2RJDA 2WSEE 3EG0A 2XMFA 2DEQA 3QXEB 3J7AF 2NUPB 8ATCB 2KQWA 2NYSA 2L89A 3FIFA 2DFUA 2CP2A 4BI4A 1G3SA 4D8DA 6AT1B 1E6GA 3VS6A 4LNPA 3UA7A 2DYIA 5FU6C 5D6WA 2RB6A 3FJ5A 5I11A 2YUNA 1Q81U 1VUBA 3MJXA 3OS5A 5IHIA 2EYQA 4RTVA 4C5EA 1K1ZA 1K9MC 5GMKj 2DPPB 3U23A 3GOXA 2LP5A 3VKIA 2RMOA 1YI2T 3EFOA 4HT8A 2DXBA 1WHHA 2QA4A 2O9VA 3Q1JA 1VQKT 4QKUA 4BB7A 2X3WD 3I55Q 5GANj 3I5SA 2ZGWA 3L2RA 3OS2A 2YLBA 3CMEQ 3CCET 3BDLA 2Y4YA 1VQ7T 5KYXB 3LWHA 2ED0A 1SSHA 2OJ2A 3CBPA 5GAOm 1KSWA 3NMZC 1RI0A 1R0BG 1N8RR 1WYXA 2R5AA 4BI8B 2F5KA 2CP7A 4EMGA 1MV0B 1P92A 3VS4A 3ULRB 4X9CA 1VQNA 4M4ZA 3C12A 4FIBA 4B6MA 2LCSA 3A5ZB 4OGEA 4WCIA 3JCMe 2E6NA 2COWA 4PJOD 3PE0A 2Z0WA 1JJ2A 2K3BA 4R56A 1IGUA 3M5AA 1S72Q 3MO8A 1UJ0A 3MEVA 2O4XB 3QYHB 1BI2A 3M57A 1YITA 1XQHA 2LQ8A 3LH5A 2K9GA 1AVZC 2AHJB 2E65A 2GQVA 2QI2A 3S3MA 4PJMA 5GAOq 1OULA 1BYMA 2ZZDA 1M9SA 2F2XA 3JCMV 2DL8A 1OYXA 4ELZC 5FRNA 5CQYA 7AT1B 2DXCA 2E4HA 2MIOA 5DY9A 2D0QB 2QG9B 2DZCA 3REBB 2X4YA 3MPUB 5ECAA 1Q86R 4FYXB 1BCOA 2EW3A 4FYYB 2KXCA 4JPBW 3HL8A 1M3AA 3CD6Q 2D8JA 2QEXT 1IXDA 5CKBA 1MUZA 1BIBA 1D3BB 1ZQ1A 3VS3A 5KYYB 2X51A 4RMOA 1YP5A 1V1CA 1VA7A 3CD6A 1OQKA 3E19A 5FLXE 1KD1C 4LDYA 1Y96A 2CSIA 1M27C 4PLLA 1RAGB 5FRMA 1QVPA 3LYIA 4ZN1A 4J9GA 1YJ9Q 2O9SA 4RTUA 5FWCA 2EAYA 2VXFA 1WJQA 2DAQA 4A63B 4NL2A 2YXYA 3VYHB 2K6DA 4C0GA 3J81E 4Z88A 3SFMA 4J6YA 3KBGA 2FEIA 1WJSA 5HK3A 4LUDA 1NJIU 4C8QC 4C92B 3ER0A 1YBYA 1AZGB 1VQOA 1BKBA 3HSBA 1OPKA 3A8OB 1RADB 1ZA2B 4AG2C 3P8HA 4XU1A 2CZ7B 2ZAEA 2DL3A 2R58A 3UWNA 4JRIA 1KHCA 4E7ZA 1TSFA 2M1HA 2LT4A 1IZ6A 2A0FB 4JRQA 4XU0A 1Q81C 3OSSC 1X6BA 2L0AA 2EQJA 2V26A 1HD3A 3CC4A 2DX1A 5KYNA 2JUFA 1ZSZC 1UGRB 4LDWA 1T0HA 3INZA 1SSFA 4PJOB 3OYHA 2GFAA 4KT0E 1KQSA 1MGQA 2FYKA 1RAHB 2K3XA 2PUOB 2V1RA 1PM3A 3I55A 3CCLA 1KC8R 1JRIA 2QEXQ 1WHKA 3RERA 2MF2A 1EFNA 3ASKA 3SHWA 3L2QA 4FYVB 3R6OA 1QVGP 1SHFA 5GAN5 3REAB 2LMJA 2CUDA 5KYWA 1KQSP 3SWNB 4JLIA 2QTXA 2VWFA 3CPFA 3FJPA 1AWWA 4Z89A 5DM7R 5L8RE 5I21A 3JCMd 5IT9E 2YHTA 1KFZA 4AT1B 2HKQB 4ZGJB 3SWNA 1UFFA 1MV3A 2C0IA 1ZSGA 2DXUA 3O5ZA 1VQ4A 1A0NB 4XAXB 1MMGA 4L59A 2MMPA 4E7IA 2DL7A 2KT1A 2QDYB 3I35A 1JEGA 3FB9A 1I81A 1LNXA 1LPLA 1TUCA 3CCMT 2FL7A 1R0CB 4WTOB 3PNWC 5D6XA 2YRVA 4Y91A 2HL3A 3OYYA 5KYUB 4IKFA 2RK1A 2ZPGB 3QIIA 4ZGEB 1JJ2P 1NE8A 3BE3A 5CKFA 2RI2A 2QA4Q 3OYIA 1F1BB 4IIMA 2JTFA 5CAIA 2E70A 1QLYA 2H8HA 4EDUA 4DEXA 1YITQ 3BY7A 5J26A 2QEXA 2RJCA 3UATA 4RUGA 3O8VA 3A98A 2JS0A 1M2OA 2AZVA 3RUXA 4R0KA 5GANe 2MCNA 1AT1B 1TXQA 2EQIA 2HCKA 3X24B 2MWPA 5KE2A 3TQ7P 4L6V5 3CPWA 1M90R 1XOVA 3BDUA 3OYKA 1C0MA 2QK0A 2CH4A 4XTUA 3CMEA 1N9RA 1NPPA 2KROA 2LC4A 4JUVA 3V7CA 3HKSA 4E2FB 1JXOA 2V8IA 1GL5A 4DOVA 3DLLA 1Q7YC 1QWEA 2EYWA 3JB9G 2YLCA 1HJDA 2DNUA 1OI1A 1UECA 5LJ3e 4BUGA 4JZ3A 4O5VA 4PJOG 5EG2A 1M4ZA 2HL5C 4HVWA 2L3PA 4C92A 3VS1A 3META 1M8VA 3OMCA 5M9OA 1VQ9T 2QQBA 2E6ZA 4M7DD 3RMSA 1W4SA 5LJ3j 4EMKA 2YRCA 2DIGA 2KGTA 1M3CA 4HA8A 2LJ1A 2OTLQ 2QQRA 2K5FA 4FT4A 3JCMJ 2ABLA 4PJOF 4CRIA 4JZ4A 1I4K1 4JDSA 3LH0A 3M0TA 4M7AE 2QA4T 1KQ2A 3H6ZA 1AHJB 4J9EA 4XK8E 1VQ6Q 3V7SA 3CXCS 2EWNA 2EKHA 4RCBA 3X28B 1TU0B 3H9NA 2EKOA 4HXJA 4C92D 1K9MU 4A4FA 5LJ5j 1TOVA 1I07A 3HHTB 3L42A 3AT1B 1I5LA 4PFPA 4M78F 3JCMQ
chains in the Genus database with same CATH topology
2DXBA 5GAOr 1G3WA 2PQWA 2QA4A 3M54A 3G7ZA 3Q1JA 1VQKT 4EPCA 2QQ9A 3V7RA 4BB7A 4OMFB 5CCAA 3M59A 3OYDA 4C5HA 5GAMh 5GANj 1KD1C 2OAUA 1OZ3A 3UT1A 4JJNK 1X01A 3HRTA 3M53A 2ZGWA 4R55A 3L2ZA 4C8QA 1U1SA 2CZ1B 1VQOT 3NTKA 2K2VA 4LD6A 3OS2A 2YLBA 3L2RA 1YIJA 2XIDA 3BDLA 3CCET 2DD5A 4IUTA 2Y4YA 3MEAA 5CIUA 2FHDA 3OYJA 1VQ7T 5GMKe 1FX7A 3CCQT 2E12A 5GMKi 3LWHA 5GAOp 2DO3A 5LJ5h 5GAN8 4J83A 1W2BS 3CCUT 4OVAA 4BI3A 4M75E 3CBPA 2EIFA 5GAOm 1YJNT 1RI0A 2LDMA 3QJ6A 1KC8C 1G3TA 1K73C 1D3BA 2R5AA 1BIAA 4BI8B 4QQ6A 2F5KA 3I56A 5GMKh 4EMGA 2VV5A 2EQUA 1P92A 5LJ5g 3CMAA 5KCHA 3JB9D 1YHQT 4M7DF 4X9CA 4ME7A 1VQNA 4N0AC 1VQLA 4PLIA 3C12A 2K57A 3CEYA 4FIBA 3QZ9B 3TEEA 3A5ZB 3RIRA 2CS7A 4OGEA 1U1TA 1Y96B 3JCMe 3PTAA 2E6NA 3N5BB 4PJOD 3T9NA 1JJ2A 4R56A 3OW2A 3M5AA 3MCAB 3MO8A 4E7JA 1ZHIA 3MEVA 5FU7B 3C95A 2O4XB 3QYHB 1BI2A 2BKDN 3VYGA 2XD0A 1VQ5T 3M57A 3MEWA 4M7DB 1YITA 2IVWA 4FM4B 3OYFA 3TCJA 1XQHA 2HAXA 5D6YA 3OY9A 3MHXA 2WSCE 2LQ8A 3VUBA 5GANf 2BUDA 4C0FA 1WJRA 2FB7A 2VC8A 4MDXA 5FU6B 3TU4K 1M1FA 3CCJT 4P5NA 1VQMT 2AHJB 2E65A 3GLXA 5GAN6 2K3YA 2GQVA 2QI2A 2IG0A 3RMQA 4M77G 3L1AA 3OS1A 3CPWS 3S3MA 3HP9A 3PIPA 4C92F 5GAOq 3JCMb 1BYMA 2R57A 2XKOC 1JBMA 2ZZDA 3CCSA 4VUBA 1M9SA 5KE3A 1N8RC 1QVFA 3JCMV 4M78E 1OYXA 2JN0A 3RKXA 5GMKm 3RKYA 3MP8A 5LJ3h 2CKKA 4ELZC 2EJFA 2K5LA 1VQPT 2QQAA 5FRNA 1EIFA 1NPRA 1UGQB 5CQYA 5KH6A 2XK0A 4BDZA 1VQPA 1VIFA 1U8RA 2DXCA 5DY9A 2D0QB 3FEOA 2DZCA 2DIQA 4OP0A 3OBWA 2X4YA 5CKDA 1VQ6T 4M77D 3QSUA 4FSXA 3P8BB 3HRSA 4MZMA 5LJ5f 5J39A 4RG8A 4C8QF 3CCST 2FVUA 1PSEA 2ZCFB 1M90C 3G4SA 3MP6A 4MMLA 5DLQE 1RL2A 3HL8A 4NL3A 4LDXA 1K73U 3M56A 4MMKA 5HY6A 4OB1B 4F7UE 2Y4XA 4A4GA 2QEXT 1YCYA 3QPHA 5CKBA 2XDDA 1VQMA 2K5IA 3SDZA 2HD0A 1BIBA 3LW5E 5CQXA 1D3BB 4PL6A 3JB9J 3M58A 4ATOA 2VXEA 1ZQ1A 4M7AC 2DTIA 4HCCA 4RMOA 1YITT 1M5Q1 1VQ5A 2CYZB 2RK2A 4C92B 2X4WA 1B34B 2F69A 3CD6A 3E19A 1Y07A 4XTXA 2PUKB 5FLXE 1WQWA 4LDYA 1Y96A 1N27A 2O01E 3QJYA 4C5GA 1O75A 4B9XA 5A0LA 3EFSA 1IREB 2LTOA 4C8QB 2LQKA 2LNVA 2KMTA 3OYNA 1WQ7A 2EQKA 4XU2A 4LDUA 1FXXA 3F70A 1DJ7B 4PLLA 5GAMj 4EMHA 4QVDA 1VQ8T 3OBYA 5FRMA 1QVPA 3LYIA 4ZN1A 1VQLT 1VQNT 2DXTA 1YHQA 3CMAT 3M4YA 2EAYA 1M90U 2VXFA 1WJQA 4M7AF 3I56T 3URGA 2DAQA 2JNGA 5GANh 2E64A 4NL2A 3VYHB 3X26B 4OB0B 4A53A 1FWZA 4C0GA 3J81E 3DKMA 4FU6A 1TH7A 1YJNA 3HFNA 2OTLT 1YJWA 3SFMA 1VQ4T 4J6YA 3KBGA 3CCUA 4Q5WA 4QQDA 4A4HA 3OYMA 2JTMA 1WJSA 5HK3A 4E7HA 1I8FA 2L5QA 3HFOA 3PT9A 3CBMA 4C8QC 5GAMe 2JVVA 2KK4A 3ER0A 4C0ZA 2P0PA 2PU9B 1YBYA 2Y90A 3E9FA 3M55A 3CC7A 3CCEA 4II1A 3LGLA 1BKBA 2KY9A 2L8DA 3WVEB 1VQOA 4XTZA 3RKWA 2JOYA 3HSBA 2XHCA 3A8OB 1PSFA 2EJ9A 4BACA 2RHYA 2ZPFB 5GANd 1GXIE 4LD9K 4J7FA 3QKJA 2P0KA 4YTLA 5GMKl 3P8HA 4XU1A 2CZ7B 3PMIA 3VU3C 4C5IA 2PVGB 5LJ3g 1VQKA 4QQGA 3KUFA 2R58A 4E7LA 4L5GA 4OB2B 3UWNA 4JRIA 2E41A 3PMTA 5GAOl 1KHCA 3OYCA 2B8AA 3WVDB 3M9QA 2M1HA 3S6WA 2LT4A 3LX7A 4BY6B 3GF5A 1IZ6A 3A8MB 1N8RU 3OYAA 4F7UB 4JRQA 4ZGDB 2HNIA 4C92C 4E47A 4XU0A 1Q81C 3MEUA 3G71A 3OSSC 2LT1A 2HBPA 4M75A 3I55T 1W2BA 3FC3A 4M7AG 1Y7XA 2RH2A 2RHXA 3V8JA 3ME9A 4M78A 2EQJA 2VYTA 2XDBA 1QW1A 2RHUA 3A8GB 5GAMd 4ZTJA 2LVMA 3ZEHA 4V2SA 4A4EA 4MZTA 1XNIA 3G6ET 4M7DE 5GAN3 2G3RA 3OQ5A 1K8AU 1M1KC 3CC4A 2H3JA 1Y71A 5LL6S 2JUFA 1UGRB 3OB9A 5LJ5d 4LDWA 5IN1A 1B34A 3INZA 1SSFA 4PJOB 4RKUE 4C92G 3OYHA 5LJ5e 2X35A 1KG1A 4QVCA 3A8LB 2GFAA 4KT0E 4CI0C 1KQSA 2KSSA 4J6XA 4BY6C 4PKCC 3SWNC 1MGQA 4J6WA 2RJEA 3CC4T 2XU8A 5A2QE 1X75C 5FU7C 3DLMA 2FYKA 2K3XA 2PUOB 4KUIA 4J8OA 1H641 4M7DC 3P8DA 4C0DC 2V8JA 3BFMA 5A0GA 1QVGS 2HQEA 1VQ9A 2DTOA 2GCXA 4JRKA 3I55A 3CCVT 2EQMA 4IUVA 1JRIA 3CCLA 3RERA 2MF2A 5HKCA 3JB9H 3JCMh 3HPWA 3ASKA 4E7KA 3VV0A 3L2QA 1NJIC 4HCZA 1Q82U 3R6OA 3QDRB 2EFIA 4BD3A 2QQSA 2DVEA 4C8QG 5GAN5 4X34A 2R5MA 2DKGA 3L2WA 3NTHA 3CCRA 4KUDK 3SWNB 1G5VA 3JCMf 4JLIA 1S72A 2QTXA 3LLRA 3CPFA 3FJPA 4A4KA 5DLOA 3SB2A 1V29B 2VGMA 5DM7R 5L8RE 5GAN7 3CXCA 3OMGA 5I21A 3JCMd 2WSFE 3PFSA 3V8KA 3UPUA 5IT9E 4C0DB 3CC2T 4M7DG 1X6OA 4NS5A 1Q7YU 2YHTA 2GF7A 2DJZA 1WPYA 2QXFA 5GAN2 3OYBA 4DQ2A 2C06A 5HK0A 3CC7T 2ZPHB 3OSVA 4M78C 4ZGJB 3G6EA 3SWNA 4IUUA 4M75F 3QUIA 2KAFA 3UDCA 2M16A 2VUBA 2KDSA 3FLGA 3FRNA 4ZTFA 1KD1U 1QP2A 1VQ4A 2DXUA 1YJWT 4GY5A 3NFCA 2OTLA 4XAXB 1LJOA 2M0OA 3E9GA 3PGGA 4L59A 1O9SA 3C4SA 3CMET 2MMPA 4E7IA 2QDYB 4HKEA 4ZN3A 4M75B 3GNGA 1UEBA 5IAYA 2OTJA 3AHUA 3FB9A 5AYFA 1Q82C 1I81A 1LNXA 4BE0A 3CCMT 2FL7A 1WNLA 3GPLA 4BDYA 5C6SA 4OGCA 2RA2A 2E10A 3PNWC 3QZ5B 5D6XA 3QG1A 3S3NA 5A0DA 1VQ8A 2YRVA 2A7YA 1OZ2A 4Y91A 3V8LA 1ZBXA 5CR2A 3OYYA 2X4JA 3A8HB 1KQ1A 4LDVA 4IKFA 2RK1A 2ZPGB 3QIIA 3JCMc 4ZGEB 1NE8A 1YJ9A 2XDPA 5CKFA 3WXMB 2GFUA 2RI2A 5CKEA 3CD6T 2F5TX 3PIOA 3NTIA 3OYIA 2VGNA 4BE1A 2JTFA 5GAMf 3GNFB 4C92E 5CAIA 2E70A 2EJGA 5GAOn 2I2LA 4EDUA 4M7AD 4HCBA 4QVZA 2X4XA 1S72T 4Y28E 2HQXA 4KBMB 4GLKA 3BY7A 2RO0A 5CVIA 5J26A 1VIEA 5KCOA 3OS0A 2QEXA 4Z02A 1K8AC 4M78B 4M75G 5CO7A 3TREA 4X9DA 1R8OB 4EMKB 2RJCA 4KULA 3G4ST 3JCMX 3EFRA 2PVDB 1KHIA 4F7UF 3C94A 2V8KA 3O8VA 4UC4A 2DD4A 3GP8A 1VQ6A 3M4GA 4PJOA 1MHNA 2E1HA 3RUXA 1YJ9T 4PJOE 1XTDA 5GANe 2K4YA 1JJ2S 3KXTA 4XU3A 4D6WA 3X24B 4N4HA 3JCMP 3JB9I 2D9TA 1NJIU 3JSCA 1HXDA 2MWPA 4HT9A 5KE2A 2D6FA 4L6V5 1N6AA 4JS5A 3CPWA 3CCMA 3H8ZA 2RI3A 3FDRA 1XOVA 3QBYA 3BDUA 5I2SA 4QW2A 3OYKA 2OTJT 2CGHA 4EMKC 3QHSA 4XTUA 1H3ZA 4DOWA 3VUZA 3CMEA 1N9RA 1NPPA 4NOYA 2LC4A 1JB0E 4M77F 5FROA 4M77C 2E5QA 4JUVA 3V7CA 2WACA 1BI1A 3HKSA 4MZPA 2RJFA 1QVFS 3CCJA 1M1GA 2V8IA 3RESA 4M78G 1NZ9A 4IUQA 4DOVA 4JLGA 5GAMg 3DLLA 3S3OA 1Q7YC 3L2UA 4FT2A 3JB9G 2RHIA 2YLCA 2LCLA 4ELYC 1UGSB 1Q86U 1QVGA 2RI5A 3CC2A 4FL6A 5J3BA 1KQSS 1G3YA 3CBOA 4TVRA 3OYLA 4PJOC 2CZ0B 4DA4A 4C8QE 2XICA 3OA6A 2BIVA 4J7IA 1OI1A 2RM4A 5LJ3e 4JS4A 2LX9A 2MAMA 4BUGA 3ZFJA 2RD1A 5CK9A 3OW2S 3CCRT 3X25B 3OYGA 2O4XA 1UGPB 3HRUA 1BI3A 2A3LA 2DTHA 4M77B 4O5VA 3J80E 2DK3A 4RCCA 1M4ZA 5EG2A 4IUPA 4PJOG 2NLUA 2P0QA 4C92A 1LOJA 1QP3A 2KVQG 2PVOB 3META 5C0MA 4RG2A 2ZPEB 1M8VA 5GAN4 3E1SA 1HK9A 4OF1A 4XTWA 1Q86C 4M75D 3CCLT 3CCVA 3EAEA 3BW1A 3OMCA 3X20B 5M9OA 3QO3A 4M7AB 2QQBA 4JRPA 1VQ9T 2M9UA 2E6ZA 3JB9F 4M7DD 4WF2A 1KC8U 3RMSA 1BI0A 4IURA 1W4SA 2MWOA 4M77A 3VJPA 4EMKA 4J5YA 5LJ3j 2DIGA 5GANg 3CCQA 3DB4A 1VQ7A 1UB4A 2XI9A 4C8QD 4XTVA 4F7UG 2RJDA 4MDWA 4N4IA 4B9WA 1YIJT 2WSEE 3MP1A 4HA8A 2DEQA 2QQRA 2K5FA 2L3RA 3QXEB 4FT4A 4PJOF 3JAME 4CRIA 3JCMJ 3J7AF 2KQWA 4A54A 2L89A 3FIFA 1M1KU 3JRZA 4F7UA 4XQ3A 4M7AA 1I4K1 4JDSA 3LH0A 4N4GA 3OYEA 2MI6A 4BI4A 4M7AE 2QA4T 1KQ2A 1G3SA 3H6ZA 4XTYA 1N9SA 4M7DA 3QYGB 3JCMg 1AHJB 3ZBDA 2LRQA 4XK8E 2DZ9A 5LJ3d 3V7SA 1YI2A 3L2VA 3CXCS 2EWNA 5I2MA 4OB3B 2RHZA 4RCBA 3X28B 5LJ3f 5FU6C 2EKOA 5D6WA 2CZ6B 2RB6A 4N0AA 4BE2A 4HT8A 4PNOA 3G71T 3LWIA 4M77E 4C92D 3DB3A 4M78D 2LCCA 1K9MU 2ZPIB 1Q81U 1VUBA 3OS5A 2XG8D 4A4FA 5CKHA 5LJ5j 3JCMW 2P4TA 3HHTB 4O6JA 3L42A 2EYQA 3SD4A 2JZ2A 4C5EA 1I5LA 1K9MC 3GIBA 3LGFA 2DPPB 5GMKj 4M75C 3GOXA 3VKIA 2ZPBB 1YI2T 1WGSA 4M78F 3JCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5I A;  1G3T A;  1G3W A;  1G3S A;  1QW1 A;  2K5L A;  2QQ9 A;  2QQA A;  2GCX A;  3MHX A;  5CVI A;  1P92 A;  2QQB A;  1U8R A;  3HRT A;  2H3J A;  1FWZ A;  1BI0 A;  1G3Y A;  3GLX A;  3E19 A;  3HRS A;  2LX9 A;  1BYM A;  2K5F A;  3HRU A;  1BI3 A;  1FX7 A;  1BI1 A;  4O6J A;  4O5V A;  1QVP A;  2K4Y A;  1BI2 A; 
#chains in the Genus database with same CATH topology
 5GAO r;  1G3W A;  1GCP A;  1M1K R;  2QQ9 A;  4OMF B;  1Q95 G;  2RNA A;  1VYV A;  2EYZ A;  4C8Q A;  1U1S A;  1M3B A;  2YDL A;  2BE7 D;  2XID A;  2DD5 A;  4IUT A;  2G6F X;  2KI7 A;  3OYJ A;  5GMK e;  2JS2 A;  3CMA Q;  2DO3 A;  2FO0 A;  4J83 A;  4M75 E;  1YJN T;  3QJ6 A;  1KC8 C;  1G3T A;  1ZBJ A;  2H3E B;  2VKN A;  1WHJ A;  1TTH B;  2VV5 A;  4OMP A;  5LJ5 g;  1YHQ T;  1HSQ A;  4PLI A;  4RTX A;  3CEY A;  3QZ9 B;  1UHC A;  2NUT B;  2CS7 A;  4AFZ C;  1U1T A;  2AK5 A;  2BZY A;  3UF4 A;  3MCA B;  2O2O A;  2P84 A;  5IHK A;  4E7J A;  3C95 A;  4OML A;  2BKD N;  3VYG A;  3TCJ A;  2HAX A;  5D6Y A;  3MHX A;  3G4S Q;  4J9D A;  4C0F A;  2FB7 A;  4P5N A;  2CP0 A;  2IG0 A;  4M77 G;  3L1A A;  4FCY A;  1JBM A;  2FZG B;  1JO8 A;  4VUB A;  5KE3 A;  1N8R C;  1OOT A;  1QVF A;  4M78 E;  2JN0 A;  2CT4 A;  3RKY A;  2EJF A;  3H41 A;  1BCM A;  1EIF A;  1UGQ B;  4BDZ A;  2YWW A;  2AT1 B;  1NYG A;  1BU1 A;  2DVJ A;  2J6F A;  3FEO A;  1AZE A;  1VQ6 T;  1H3H A;  3P8B B;  4MZM A;  2KRN A;  5J39 A;  4RG8 A;  3CCS T;  2FVU A;  2ZCF B;  1RL2 A;  4LDX A;  4NL3 A;  1K73 U;  3M56 A;  5HY6 A;  4AFS C;  1TUD A;  4OB1 B;  1RAF B;  1YCY A;  5FW9 A;  2XDD A;  2DF6 A;  1SF9 A;  5CQX A;  4ESR A;  2GTO A;  3M58 A;  4PJL A;  2A28 A;  2DRK A;  2CDT A;  2DTI A;  4Y92 A;  1VQ5 A;  2RK2 A;  1VYU A;  5I22 A;  1I1J A;  1Y07 A;  1RI9 A;  4C5G A;  1O75 A;  3TSZ A;  2LQK A;  2LNV A;  3OYN A;  1PRL C;  4LDU A;  1FXX A;  3F70 A;  1DJ7 B;  2FRY A;  1VQ8 T;  5KYX A;  3C0C A;  1VQL T;  2DXT A;  1IO6 A;  3M0P A;  3CMA T;  3I56 T;  1YJN Q;  4A53 A;  2ATC B;  4OB0 B;  1FWZ A;  1VQ4 T;  1YNZ A;  3CCU A;  4QQD A;  4A4H A;  1YHQ Q;  4E7H A;  3HFO A;  3PT9 A;  1W6X A;  4C0Z A;  2P0P A;  1G8X A;  4ZTJ A;  3CC7 A;  2KY9 A;  3VS5 A;  2JOY A;  2DL4 A;  2RHY A;  2ZPF B;  1Q82 R;  4LD9 K;  4YTL A;  3TVT A;  3KUF A;  2F2V A;  4L5G A;  3EHQ A;  1GCQ C;  5GAO l;  4X1V A;  3GF5 A;  1N5Z A;  2FZK B;  1YI2 Q;  1N8R U;  4C92 C;  1OU9 A;  2NUP A;  3I55 T;  1UE9 A;  3FC3 A;  2XDB A;  1QW1 A;  3A8G B;  5GAM d;  2LVM A;  4A4E A;  4MZT A;  4AG1 C;  1K8A U;  4LN2 A;  1Y71 A;  1RAC B;  3OB9 A;  5LJ5 e;  2X35 A;  4QVC A;  3A8L B;  2KSS A;  1BB9 A;  4J6X A;  1NEB A;  4BY6 C;  1GCQ A;  3VS0 A;  3CC4 T;  3THK A;  4C0D C;  3BFM A;  2HQE A;  2GCX A;  4JRK A;  3CCV T;  3JCM h;  2RN8 A;  4E7K A;  1NM7 A;  2K2M A;  1NJI C;  2QQS A;  2VVK A;  2FPD A;  3NPF A;  2DKG A;  4DBQ A;  2NUZ A;  3NTH A;  3CCR A;  3JCM f;  2COY A;  1FMW A;  5GAN 7;  3OMG A;  3EG3 A;  2MK5 A;  1AD5 A;  1WXB A;  2BZ8 A;  4M75 F;  3I56 Q;  2J06 A;  1PD1 A;  4LE9 A;  1YJW T;  4GY5 A;  2W0Z A;  1LJO A;  3E9G A;  3EGD A;  1VQ4 Q;  4OMN A;  3E2U A;  4KGV B;  5IAY A;  2OTJ A;  1UEB A;  2E3H A;  3AHU A;  4CC3 A;  1Q82 C;  4BE0 A;  5C6S A;  2DE0 X;  9ATC B;  2ED1 A;  3QZ5 B;  5A0D A;  5CR2 A;  1RAA B;  1ZSZ B;  2X4J A;  3A8H B;  1KQ1 A;  4DBF A;  2GFU A;  5CKE A;  3CD6 T;  2F5T X;  1X6G A;  3PIO A;  2VGN A;  2HQH A;  5GAM f;  2OI3 A;  2I2L A;  4Y28 E;  2DBK A;  4KBM B;  4JJD A;  2L2P A;  4M75 G;  4X9D A;  1NYF A;  2CSQ A;  4KUL A;  3JCM X;  4FSS A;  1T0J A;  2PVD B;  1UUE A;  2HZY A;  1RAI B;  2V8K A;  4UC4 A;  2DD4 A;  4E7S A;  2BE9 B;  4PJO A;  2ENM A;  1GBQ A;  1YJ9 T;  1XTD A;  3I5R A;  1TG0 A;  2C0O A;  1JJ2 S;  3KXT A;  2YUQ A;  4XU3 A;  1SRM A;  4D6W A;  4N4H A;  3CC4 Q;  3JB9 I;  2D9T A;  2GNC A;  3JCM P;  1MND A;  4JS5 A;  2PZ1 A;  2RI3 A;  3FDR A;  1K0X A;  2OTJ T;  1EZZ B;  2CGH A;  4EMK C;  1FYN A;  2DJQ A;  3CCV Q;  5GJW B;  4DOW A;  1H3Z A;  2CH4 W;  4NOY A;  4RTT A;  4M77 F;  5FRO A;  1QMC A;  4M77 C;  1BI1 A;  1UJY A;  1OX8 A;  2J7I A;  4F17 A;  3G1J A;  1PKS A;  2GQI A;  1CSK A;  3QDF A;  2LCL A;  1QVG A;  2AKL A;  2M0Y A;  2RI5 A;  4FL6 A;  3EGU A;  2QGF B;  1G3Y A;  4TVR A;  4ZNX A;  2JJ9 A;  2CZ0 B;  4DA4 A;  1WI7 A;  4HVV A;  2BIV A;  4J7I A;  2RM4 A;  3OW2 S;  3CCR T;  2KRS A;  1TUG B;  4CC4 B;  4GBQ A;  2ESW A;  2P0Q A;  1RLQ C;  1LOJ A;  1QP3 A;  2KVQ G;  2KYB A;  1VQM Q;  2LJ3 A;  3RBB B;  4HCK A;  1HK9 A;  4XTW A;  1NEG A;  2V1Q A;  3CCV A;  1UTI A;  4M7A B;  4JRP A;  1K9M R;  3JB9 F;  4WF2 A;  3CCQ A;  3EG9 B;  2A08 A;  3EH2 A;  1VQ7 A;  1GBR A;  1T3S A;  1UB4 A;  1K8A R;  4MDW A;  4B9W A;  1YIJ T;  3MP1 A;  3JAM E;  5KYU A;  1R77 A;  4K11 A;  2HMA A;  5IHN A;  2YUP A;  1M1K U;  3JRZ A;  2B86 A;  4IIO A;  2MI6 A;  4XTY A;  1N9S A;  4M7D A;  3QYG B;  2EVR A;  3JCM g;  1JU5 C;  2LRQ A;  1YI2 A;  1NLP C;  3L2V A;  2AIR B;  5LJ3 f;  1V76 A;  2CZ6 B;  4BE2 A;  4PNO A;  3G71 T;  3LWI A;  5FWB A;  3DB3 A;  4M78 D;  2ZPI B;  2XG8 D;  3JCM W;  2P4T A;  4O6J A;  3SD4 A;  2JZ2 A;  3GIB A;  2ROL A;  2M02 A;  4F04 B;  2PQW A;  3EGX B;  3M54 A;  2KBT A;  1NLO C;  3V7R A;  4KGX B;  3M59 A;  2CT3 A;  4C5H A;  2OAU A;  1X01 A;  3M53 A;  4JJB A;  4R55 A;  3L2Z A;  4CC7 A;  2CZ1 B;  3NTK A;  2K2V A;  1RAB B;  2E5K A;  1FX7 A;  3EGX A;  2OTJ Q;  1W2B S;  5GAN 8;  4OVA A;  4BI3 A;  2EIF A;  4ANJ A;  1K73 C;  1UGV A;  1BIA A;  3I56 A;  1Q81 R;  3H0F A;  5GMK h;  2ECZ A;  2EQU A;  2FRW A;  5KCH A;  1X2K A;  4M7D F;  3NGP A;  4ME7 A;  4N0A C;  3EG9 A;  1WZO A;  3TEE A;  2QAS A;  3RIR A;  1X43 A;  3PTA A;  1YCS B;  1D0Y A;  1J3T A;  3OW2 A;  3EGD B;  1ZHI A;  1K76 A;  4CC2 A;  3MEW A;  2YUO A;  4M7D B;  4FM4 B;  3OYF A;  3OY9 A;  2WSC E;  2LJ0 A;  2BUD A;  4GLM A;  5FU6 B;  3TU4 K;  3CC2 Q;  3CCJ T;  1VQM T;  1Z9Q A;  4PJN A;  5GAN 6;  1SKU B;  2ROT A;  3OS1 A;  3CPW S;  1MNE A;  4C92 F;  2R57 A;  2XKO C;  1MMD A;  1YIJ Q;  4PFZ A;  3OW2 P;  2K7A A;  3RKX A;  5GMK m;  2CKK A;  1Y57 A;  1VQP T;  2XK0 A;  1VQP A;  1VIF A;  1U8R A;  2DIQ A;  1WHG A;  3QSU A;  4AFQ C;  3HRS A;  5LJ5 f;  4KH1 B;  4D8K A;  1M90 C;  3G4S A;  4MML A;  5DLQ E;  2Y4X A;  4A4G A;  3QPH A;  1VQM A;  2K5I A;  3D7S B;  2HD0 A;  3SDZ A;  4ATO A;  4PL6 A;  2VXE A;  2X3X D;  2VB6 A;  4M7A C;  4HCC A;  1M5Q 1;  2HDA A;  3VRZ A;  5KYW B;  2F69 A;  2YRD A;  1M2V A;  2J6K A;  2PUK B;  2FZC B;  1N27 A;  5A0L A;  3EFS A;  1IRE B;  2DYB A;  2CP6 A;  2KMT A;  1WQ7 A;  4XU2 A;  2LZ6 B;  2FPF A;  4EMH A;  3OBY A;  1WX6 A;  1B3Q A;  1K73 R;  1K0S A;  4RTW A;  2A36 A;  1M2V B;  1UDL A;  4M7A F;  3URG A;  2E64 A;  3X26 B;  3DKM A;  4FU6 A;  1YJN A;  2OTL T;  2JMC A;  1FMK A;  2DMO A;  4Q5W A;  3RDV A;  3OYM A;  2JTM A;  2LQW A;  1I8F A;  2KRM A;  4V2S A;  1OU8 A;  3G6E T;  2JVV A;  2Y90 A;  3M55 A;  1SHG A;  2AZS A;  3LGL A;  2L8D A;  1HYO A;  3WVE B;  2XHC A;  1PSF A;  2RQR A;  1GXI E;  1X27 A;  3PMI A;  4KH0 B;  5LJ3 g;  1SG5 A;  2LQN A;  4QQG A;  1ZUK A;  4OB2 B;  2YSQ A;  1QQJ A;  2L3S A;  1D1B A;  3OYC A;  2B8A A;  1PCX A;  3M9Q A;  4OMM A;  2O31 A;  1PNJ A;  3PVL A;  3A8M B;  3OYA A;  4F7U B;  4ZGD B;  3M0S A;  3G71 A;  2LT1 A;  4M75 A;  4M7A G;  2RH2 A;  2RHX A;  3ME9 A;  4M78 A;  3JV3 A;  1PG5 B;  1XNI A;  4M7D E;  5GAN 3;  2G3R A;  1M1K C;  1S1N A;  2J05 A;  5LJ5 d;  2EPD A;  4C92 G;  3EHR A;  3A1P A;  1NBE B;  3SWN C;  1KJW A;  5A2Q E;  5FU7 C;  3DLM A;  4KUI A;  4J8O A;  1H64 1;  4M7D C;  2CRE A;  1QVG S;  1VQ9 A;  4IUV A;  3JB9 H;  3VV0 A;  2D8H A;  4HCZ A;  1Q82 U;  4FW2 A;  3QDR B;  2EFI A;  4BD3 A;  2DVE A;  4HVU A;  3CQT A;  2R5M A;  3L2W A;  4KUD K;  1G5V A;  1T3L A;  4A4K A;  3SB2 A;  2VGM A;  3H0H A;  3CXC A;  2WSF E;  3V8K A;  4C0D B;  4JJC A;  1E7O A;  5GJV B;  1Q7Y U;  1VOM A;  1WPY A;  2QXF A;  1GFD A;  2C06 A;  5HK0 A;  2JM9 A;  2QAZ A;  2KAF A;  5HCK A;  3FRN A;  1LVK A;  4ZTF A;  1KD1 U;  3NFC A;  2M0O A;  3PGG A;  3CME T;  1Y0M A;  4LUE A;  3CCE Q;  3CCL Q;  4HKE A;  1VQ7 Q;  4M75 B;  4J9F A;  5AYF A;  3G6E Q;  3RR6 A;  4BDY A;  1IRX A;  4OGC A;  2RA2 A;  2E10 A;  3QG1 A;  3S3N A;  2A7Y A;  1OZ2 A;  3V8L A;  1OEB A;  1QKW A;  3GBQ A;  2D1X A;  2SEM A;  1YJ9 A;  1D0Z A;  2HKN A;  2XDP A;  3WXM B;  1YFN A;  1ZA1 B;  3NTI A;  2M51 A;  4BE1 A;  2RQW A;  2JMA A;  1H92 A;  2HEQ A;  5GAO n;  4QVZ A;  2X4X A;  4ORZ A;  2KE9 A;  2FPE A;  1M30 A;  2KEA A;  4GLK A;  5CVI A;  2RO0 A;  3OS0 A;  1VIE A;  5KCO A;  1SEM A;  5CO7 A;  1K9A A;  3C94 A;  3GP8 A;  1VQ8 Q;  1MHN A;  1OV3 A;  5KYY A;  1N6A A;  1XJW B;  3H8Z A;  5I2S A;  4QW2 A;  3CCQ Q;  1B7T A;  2OX7 A;  3QHS A;  3CCU Q;  1QCO A;  3VUZ A;  1WHM A;  1K4U S;  2E5Q A;  3CCJ A;  1M1G A;  3RES A;  4M78 G;  3S3O A;  3L2U A;  4FT2 A;  1RAE B;  2RHI A;  1Q86 U;  1UGS B;  1ZSZ A;  1KD1 R;  3CBO A;  2DA9 A;  3OA6 A;  4JS4 A;  2MAM A;  3ZFJ A;  5CK9 A;  3OYG A;  1WIE A;  2O4X A;  1UGP B;  1BI3 A;  2A3L A;  4J9I A;  3IQL A;  2NLU A;  1MMN A;  1BBZ A;  5C0M A;  1SRL A;  2LX7 A;  2ZPE B;  5GAN 4;  3E1S A;  4OF1 A;  1Q86 C;  4M75 D;  3CCL T;  3EAE A;  3X20 B;  1W2B P;  2NWM A;  2DBM A;  1BI0 A;  4IUR A;  1WLP B;  5GAN g;  3DB4 A;  2XI9 A;  4F7U G;  4FYW B;  4N4I A;  1ABO A;  1EX4 A;  2DER A;  2E3I A;  1E6H A;  2L3R A;  1G83 A;  1SPK A;  1NG2 A;  4A54 A;  3EH1 A;  4F7U A;  1IHV A;  4XQ3 A;  3UA6 A;  4M7A A;  1C6V X;  4N4G A;  3OYE A;  3ZBD A;  5LJ3 d;  2DZ9 A;  5I2M A;  4OB3 B;  2RHZ A;  1QWF A;  3VS2 A;  2DIL A;  2QGG A;  4F16 A;  4N0A A;  3I9Q A;  4M77 E;  2LCC A;  2QTV A;  5CKH A;  4DBH A;  3LGF A;  4M75 C;  1D09 B;  5EC7 A;  1TS9 A;  2ZPB B;  3CPW P;  1WGS A;  4M7A D;  4OMO A;  3G7Z A;  4PK4 A;  4EPC A;  5CCA A;  3OYD A;  5GAM h;  1OZ3 A;  3UT1 A;  4QT7 A;  4JJN K;  3HRT A;  2MOX A;  2RF0 A;  2BZX A;  1YJW Q;  1VQO T;  3QWY A;  4LD6 A;  1YIJ A;  1GRI A;  3MEA A;  1YWO A;  5CIU A;  2FHD A;  3TSW A;  4RTY A;  1VQN Q;  3CCQ T;  2E12 A;  2JXB A;  1ZX6 A;  2EGA A;  5GMK i;  5GAO p;  5LJ5 h;  3CCU T;  3QWX X;  1PKT A;  1VYT A;  2LDM A;  1PD0 A;  1D3B A;  1UG1 A;  4QQ6 A;  1PC0 A;  1PRM C;  4AFU C;  3CMA A;  2CP3 A;  3JB9 D;  4LXC A;  1VQL A;  1QVF P;  1QKX A;  2K57 A;  1MMA A;  1Y96 B;  3N5B B;  3T9N A;  2W10 A;  1BK2 A;  5FU7 B;  1YN8 A;  2XD0 A;  1ZUU A;  1VQ5 T;  1I0C A;  2IVW A;  2JT4 A;  3VUB A;  5GAN f;  1WJR A;  2VC8 A;  4MDX A;  1M1F A;  3GLX A;  2K3Y A;  2DRM A;  3RMQ A;  2OAW A;  1IHW A;  3HP9 A;  3PIP A;  3JCM b;  2EYX A;  3CCS A;  1JQQ A;  1C1A A;  1ACM B;  1Q7Y R;  2F1L A;  2QYZ A;  5LJ3 h;  3MP8 A;  4J9C A;  2QDL A;  2K5L A;  2QQA A;  1B07 A;  1NPR A;  5KH6 A;  1RLP C;  3PVQ A;  3CCM Q;  4DBR A;  2P4R A;  4OP0 A;  3OBW A;  5CKD A;  4M77 D;  4FSX A;  1D1A A;  1KIK A;  1QCF A;  4C8Q F;  2GGR A;  1PSE A;  3MP6 A;  4MMK A;  2KYM A;  3R6N A;  4F7U E;  1AWX A;  2HBW A;  3JB9 J;  3LW5 E;  4EIK A;  2HSP A;  1YIT T;  2CYZ B;  4OMQ A;  3CCR Q;  2MYS A;  2X4W A;  1B34 B;  2F2W A;  4XTX A;  1WQW A;  2O01 E;  2KT8 A;  3QJY A;  4B9X A;  3VRY A;  2LTO A;  3M0R A;  4C8Q B;  2EQK A;  1ABQ A;  1VQO Q;  2BTT A;  5GAM j;  4QVD A;  1OPL A;  3CC7 Q;  1VQN T;  2KXD A;  1YHQ A;  3M4Y A;  1M90 U;  2JNG A;  5GAN h;  1TH7 A;  2AKK A;  3HFN A;  1YJW A;  5D7U A;  1OX9 A;  1IB8 A;  2L5Q A;  5GAM e;  3CBM A;  2KK4 A;  2PU9 B;  3E9F A;  3CCE A;  1D1C A;  4II1 A;  4XTZ A;  3RKW A;  2EJ9 A;  4BAC A;  2A37 A;  5GAN d;  1AWJ A;  4J7F A;  3QKJ A;  2P0K A;  5GMK l;  4C5I A;  3VU3 C;  5IXF A;  2PVG B;  3G71 Q;  1VQK A;  1PWT A;  2SRC A;  4E7L A;  1U5S A;  2O88 A;  2JM8 A;  1VQ5 Q;  2YT6 A;  1WDX A;  2E41 A;  3PMT A;  5IXB A;  3WVD B;  3S6W A;  4KRT A;  2DL5 A;  3LX7 A;  2JW4 A;  4BY6 B;  1WFW A;  2EBP A;  2PTK A;  2HNI A;  4E47 A;  1PHT A;  3MEU A;  4FW1 A;  2HBP A;  1W2B A;  1NJI R;  1Y7X A;  3V8J A;  2VYT A;  2RHU A;  1U3O A;  3ZEH A;  4PJJ A;  3KFV A;  3OQ5 A;  1X2Q A;  1M8M A;  2H3J A;  8AT1 B;  5LL6 S;  5IN1 A;  1B34 A;  2CP5 A;  1VQ9 Q;  4RKU E;  1KG1 A;  2MPX C;  1JXM A;  2IIM A;  4CI0 C;  4PKC C;  3RNJ A;  4J6W A;  2DEU A;  2RJE A;  2XU8 A;  3EFO B;  1X75 C;  1U06 A;  1YWP A;  2FG0 A;  3P8D A;  2V8J A;  5A0G A;  1FMV A;  2DTO A;  3EG2 A;  2RQU A;  4AMC A;  2EQM A;  2D0N A;  3H0I A;  5HKC A;  1TWB A;  3HPW A;  2J6O A;  2DM1 A;  4C8Q G;  1WXU A;  2K79 A;  4X34 A;  3VS7 A;  1CKA A;  3MKD A;  2DET A;  1S72 A;  3LLR A;  5DLO A;  1V29 B;  4F14 A;  1ARK A;  3PFS A;  3UPU A;  3CC2 T;  1X6O A;  4NS5 A;  3CCJ Q;  1I5O B;  1W70 A;  2GF7 A;  2DJZ A;  2L3Q A;  5GAN 2;  3OYB A;  3CC7 T;  4DQ2 A;  2ZPH B;  2RPN A;  3OSV A;  4M78 C;  3G6E A;  1WXT A;  4IUU A;  3QUI A;  3UDC A;  2M16 A;  2VUB A;  2KDS A;  3FLG A;  1QP2 A;  2OTL A;  1O9S A;  3C4S A;  1H8K A;  3EG1 A;  1VQP Q;  4J9B A;  4ZN3 A;  4E6R A;  3GNG A;  3HTR A;  5IH2 A;  4RTZ A;  2X9H A;  3M0Q A;  3GPL A;  1WNL A;  4Z8A A;  2HSE B;  2VAS A;  1VQ8 A;  2EGC A;  1ZBX A;  4LDV A;  2GTJ A;  3JCM c;  1IGQ A;  1CKB A;  1D0X A;  1QCN A;  3SEM A;  1AWO A;  2IPO B;  1Z9Z A;  3GNF B;  4C92 E;  1WA7 A;  2EJG A;  2HQX A;  4M7D G;  1K8A C;  4Z02 A;  2KNB B;  4M78 B;  1X69 A;  3TRE A;  1W1F A;  1R8O B;  4EMK B;  2I0N A;  3G4S T;  3EFR A;  1KHI A;  4F7U F;  2CUB A;  1VQ6 A;  3M4G A;  2COZ A;  3M0U A;  4PFO A;  1VQK Q;  2E1H A;  4PJO E;  2K4Y A;  1KK7 A;  4HT9 A;  2LNH B;  3JSC A;  1HXD A;  2EYY A;  2D6F A;  4DEY A;  3CCM A;  1ZLM A;  3QBY A;  1ZUY A;  2PNI A;  1WHL A;  1JB0 E;  1QVF S;  2WAC A;  2RQV A;  4MZP A;  2RJF A;  3CCS Q;  2C0T A;  4J9H A;  1LCK A;  1NZ9 A;  4IUQ A;  4JLG A;  5GAM g;  5L23 A;  3NHN A;  2DLP A;  4ELY C;  2NUT A;  3CC2 A;  1RUW A;  5J3B A;  1AOJ A;  1KQS S;  4PJO C;  3OYL A;  4C8Q E;  2XIC A;  4HCB A;  1S72 T;  2LX9 A;  2RD1 A;  1AEY A;  2EGE A;  4KGZ B;  3ZL7 C;  2JTE A;  3X25 B;  3HRU A;  3CXC P;  2DTH A;  4M77 B;  3J80 E;  2DK3 A;  4RCC A;  4IUP A;  1GFC A;  1UHF A;  2GBQ A;  2KR3 A;  2PVO B;  4RG2 A;  2RQT A;  1G2B A;  3BW1 A;  1VQL Q;  3QO3 A;  2M9U A;  1KC8 U;  2MWO A;  4M77 A;  3VJP A;  4J5Y A;  4C8Q D;  4XTV A;  5AT1 B;  2RJD A;  2WSE E;  3EG0 A;  2XMF A;  2DEQ A;  3QXE B;  3J7A F;  2NUP B;  8ATC B;  2KQW A;  2NYS A;  2L89 A;  3FIF A;  2DFU A;  2CP2 A;  4BI4 A;  1G3S A;  4D8D A;  6AT1 B;  1E6G A;  3VS6 A;  4LNP A;  3UA7 A;  2DYI A;  5FU6 C;  5D6W A;  2RB6 A;  3FJ5 A;  5I11 A;  2YUN A;  1Q81 U;  1VUB A;  3MJX A;  3OS5 A;  5IHI A;  2EYQ A;  4RTV A;  4C5E A;  1K1Z A;  1K9M C;  5GMK j;  2DPP B;  3U23 A;  3GOX A;  2LP5 A;  3VKI A;  2RMO A;  1YI2 T;  3EFO A;  4HT8 A;  2DXB A;  1WHH A;  2QA4 A;  2O9V A;  3Q1J A;  1VQK T;  4QKU A;  4BB7 A;  2X3W D;  3I55 Q;  5GAN j;  3I5S A;  2ZGW A;  3L2R A;  3OS2 A;  2YLB A;  3CME Q;  3CCE T;  3BDL A;  2Y4Y A;  1VQ7 T;  5KYX B;  3LWH A;  2ED0 A;  1SSH A;  2OJ2 A;  3CBP A;  5GAO m;  1KSW A;  3NMZ C;  1RI0 A;  1R0B G;  1N8R R;  1WYX A;  2R5A A;  4BI8 B;  2F5K A;  2CP7 A;  4EMG A;  1MV0 B;  1P92 A;  3VS4 A;  3ULR B;  4X9C A;  1VQN A;  4M4Z A;  3C12 A;  4FIB A;  4B6M A;  2LCS A;  3A5Z B;  4OGE A;  4WCI A;  3JCM e;  2E6N A;  2COW A;  4PJO D;  3PE0 A;  2Z0W A;  1JJ2 A;  2K3B A;  4R56 A;  1IGU A;  3M5A A;  1S72 Q;  3MO8 A;  1UJ0 A;  3MEV A;  2O4X B;  3QYH B;  1BI2 A;  3M57 A;  1YIT A;  1XQH A;  2LQ8 A;  3LH5 A;  2K9G A;  1AVZ C;  2AHJ B;  2E65 A;  2GQV A;  2QI2 A;  3S3M A;  4PJM A;  5GAO q;  1OUL A;  1BYM A;  2ZZD A;  1M9S A;  2F2X A;  3JCM V;  2DL8 A;  1OYX A;  4ELZ C;  5FRN A;  5CQY A;  7AT1 B;  2DXC A;  2E4H A;  2MIO A;  5DY9 A;  2D0Q B;  2QG9 B;  2DZC A;  3REB B;  2X4Y A;  3MPU B;  5ECA A;  1Q86 R;  4FYX B;  1BCO A;  2EW3 A;  4FYY B;  2KXC A;  4JPB W;  3HL8 A;  1M3A A;  3CD6 Q;  2D8J A;  2QEX T;  1IXD A;  5CKB A;  1MUZ A;  1BIB A;  1D3B B;  1ZQ1 A;  3VS3 A;  5KYY B;  2X51 A;  4RMO A;  1YP5 A;  1V1C A;  1VA7 A;  3CD6 A;  1OQK A;  3E19 A;  5FLX E;  1KD1 C;  4LDY A;  1Y96 A;  2CSI A;  1M27 C;  4PLL A;  1RAG B;  5FRM A;  1QVP A;  3LYI A;  4ZN1 A;  4J9G A;  1YJ9 Q;  2O9S A;  4RTU A;  5FWC A;  2EAY A;  2VXF A;  1WJQ A;  2DAQ A;  4A63 B;  4NL2 A;  2YXY A;  3VYH B;  2K6D A;  4C0G A;  3J81 E;  4Z88 A;  3SFM A;  4J6Y A;  3KBG A;  2FEI A;  1WJS A;  5HK3 A;  4LUD A;  1NJI U;  4C8Q C;  4C92 B;  3ER0 A;  1YBY A;  1AZG B;  1VQO A;  1BKB A;  3HSB A;  1OPK A;  3A8O B;  1RAD B;  1ZA2 B;  4AG2 C;  3P8H A;  4XU1 A;  2CZ7 B;  2ZAE A;  2DL3 A;  2R58 A;  3UWN A;  4JRI A;  1KHC A;  4E7Z A;  1TSF A;  2M1H A;  2LT4 A;  1IZ6 A;  2A0F B;  4JRQ A;  4XU0 A;  1Q81 C;  3OSS C;  1X6B A;  2L0A A;  2EQJ A;  2V26 A;  1HD3 A;  3CC4 A;  2DX1 A;  5KYN A;  2JUF A;  1ZSZ C;  1UGR B;  4LDW A;  1T0H A;  3INZ A;  1SSF A;  4PJO B;  3OYH A;  2GFA A;  4KT0 E;  1KQS A;  1MGQ A;  2FYK A;  1RAH B;  2K3X A;  2PUO B;  2V1R A;  1PM3 A;  3I55 A;  3CCL A;  1KC8 R;  1JRI A;  2QEX Q;  1WHK A;  3RER A;  2MF2 A;  1EFN A;  3ASK A;  3SHW A;  3L2Q A;  4FYV B;  3R6O A;  1QVG P;  1SHF A;  5GAN 5;  3REA B;  2LMJ A;  2CUD A;  5KYW A;  1KQS P;  3SWN B;  4JLI A;  2QTX A;  2VWF A;  3CPF A;  3FJP A;  1AWW A;  4Z89 A;  5DM7 R;  5L8R E;  5I21 A;  3JCM d;  5IT9 E;  2YHT A;  1KFZ A;  4AT1 B;  2HKQ B;  4ZGJ B;  3SWN A;  1UFF A;  1MV3 A;  2C0I A;  1ZSG A;  2DXU A;  3O5Z A;  1VQ4 A;  1A0N B;  4XAX B;  1MMG A;  4L59 A;  2MMP A;  4E7I A;  2DL7 A;  2KT1 A;  2QDY B;  3I35 A;  1JEG A;  3FB9 A;  1I81 A;  1LNX A;  1LPL A;  1TUC A;  3CCM T;  2FL7 A;  1R0C B;  4WTO B;  3PNW C;  5D6X A;  2YRV A;  4Y91 A;  2HL3 A;  3OYY A;  5KYU B;  4IKF A;  2RK1 A;  2ZPG B;  3QII A;  4ZGE B;  1JJ2 P;  1NE8 A;  3BE3 A;  5CKF A;  2RI2 A;  2QA4 Q;  3OYI A;  1F1B B;  4IIM A;  2JTF A;  5CAI A;  2E70 A;  1QLY A;  2H8H A;  4EDU A;  4DEX A;  1YIT Q;  3BY7 A;  5J26 A;  2QEX A;  2RJC A;  3UAT A;  4RUG A;  3O8V A;  3A98 A;  2JS0 A;  1M2O A;  2AZV A;  3RUX A;  4R0K A;  5GAN e;  2MCN A;  1AT1 B;  1TXQ A;  2EQI A;  2HCK A;  3X24 B;  2MWP A;  5KE2 A;  3TQ7 P;  4L6V 5;  3CPW A;  1M90 R;  1XOV A;  3BDU A;  3OYK A;  1C0M A;  2QK0 A;  2CH4 A;  4XTU A;  3CME A;  1N9R A;  1NPP A;  2KRO A;  2LC4 A;  4JUV A;  3V7C A;  3HKS A;  4E2F B;  1JXO A;  2V8I A;  1GL5 A;  4DOV A;  3DLL A;  1Q7Y C;  1QWE A;  2EYW A;  3JB9 G;  2YLC A;  1HJD A;  2DNU A;  1OI1 A;  1UEC A;  5LJ3 e;  4BUG A;  4JZ3 A;  4O5V A;  4PJO G;  5EG2 A;  1M4Z A;  2HL5 C;  4HVW A;  2L3P A;  4C92 A;  3VS1 A;  3MET A;  1M8V A;  3OMC A;  5M9O A;  1VQ9 T;  2QQB A;  2E6Z A;  4M7D D;  3RMS A;  1W4S A;  5LJ3 j;  4EMK A;  2YRC A;  2DIG A;  2KGT A;  1M3C A;  4HA8 A;  2LJ1 A;  2OTL Q;  2QQR A;  2K5F A;  4FT4 A;  3JCM J;  2ABL A;  4PJO F;  4CRI A;  4JZ4 A;  1I4K 1;  4JDS A;  3LH0 A;  3M0T A;  4M7A E;  2QA4 T;  1KQ2 A;  3H6Z A;  1AHJ B;  4J9E A;  4XK8 E;  1VQ6 Q;  3V7S A;  3CXC S;  2EWN A;  2EKH A;  4RCB A;  3X28 B;  1TU0 B;  3H9N A;  2EKO A;  4HXJ A;  4C92 D;  1K9M U;  4A4F A;  5LJ5 j;  1TOV A;  1I07 A;  3HHT B;  3L42 A;  3AT1 B;  1I5L A;  4PFP A;  4M78 F;  3JCM Q; 
#chains in the Genus database with same CATH homology
 2DXB A;  5GAO r;  1G3W A;  2PQW A;  2QA4 A;  3M54 A;  3G7Z A;  3Q1J A;  1VQK T;  4EPC A;  2QQ9 A;  3V7R A;  4BB7 A;  4OMF B;  5CCA A;  3M59 A;  3OYD A;  4C5H A;  5GAM h;  5GAN j;  1KD1 C;  2OAU A;  1OZ3 A;  3UT1 A;  4JJN K;  1X01 A;  3HRT A;  3M53 A;  2ZGW A;  4R55 A;  3L2Z A;  4C8Q A;  1U1S A;  2CZ1 B;  1VQO T;  3NTK A;  2K2V A;  4LD6 A;  3OS2 A;  2YLB A;  3L2R A;  1YIJ A;  2XID A;  3BDL A;  3CCE T;  2DD5 A;  4IUT A;  2Y4Y A;  3MEA A;  5CIU A;  2FHD A;  3OYJ A;  1VQ7 T;  5GMK e;  1FX7 A;  3CCQ T;  2E12 A;  5GMK i;  3LWH A;  5GAO p;  2DO3 A;  5LJ5 h;  5GAN 8;  4J83 A;  1W2B S;  3CCU T;  4OVA A;  4BI3 A;  4M75 E;  3CBP A;  2EIF A;  5GAO m;  1YJN T;  1RI0 A;  2LDM A;  3QJ6 A;  1KC8 C;  1G3T A;  1K73 C;  1D3B A;  2R5A A;  1BIA A;  4BI8 B;  4QQ6 A;  2F5K A;  3I56 A;  5GMK h;  4EMG A;  2VV5 A;  2EQU A;  1P92 A;  5LJ5 g;  3CMA A;  5KCH A;  3JB9 D;  1YHQ T;  4M7D F;  4X9C A;  4ME7 A;  1VQN A;  4N0A C;  1VQL A;  4PLI A;  3C12 A;  2K57 A;  3CEY A;  4FIB A;  3QZ9 B;  3TEE A;  3A5Z B;  3RIR A;  2CS7 A;  4OGE A;  1U1T A;  1Y96 B;  3JCM e;  3PTA A;  2E6N A;  3N5B B;  4PJO D;  3T9N A;  1JJ2 A;  4R56 A;  3OW2 A;  3M5A A;  3MCA B;  3MO8 A;  4E7J A;  1ZHI A;  3MEV A;  5FU7 B;  3C95 A;  2O4X B;  3QYH B;  1BI2 A;  2BKD N;  3VYG A;  2XD0 A;  1VQ5 T;  3M57 A;  3MEW A;  4M7D B;  1YIT A;  2IVW A;  4FM4 B;  3OYF A;  3TCJ A;  1XQH A;  2HAX A;  5D6Y A;  3OY9 A;  3MHX A;  2WSC E;  2LQ8 A;  3VUB A;  5GAN f;  2BUD A;  4C0F A;  1WJR A;  2FB7 A;  2VC8 A;  4MDX A;  5FU6 B;  3TU4 K;  1M1F A;  3CCJ T;  4P5N A;  1VQM T;  2AHJ B;  2E65 A;  3GLX A;  5GAN 6;  2K3Y A;  2GQV A;  2QI2 A;  2IG0 A;  3RMQ A;  4M77 G;  3L1A A;  3OS1 A;  3CPW S;  3S3M A;  3HP9 A;  3PIP A;  4C92 F;  5GAO q;  3JCM b;  1BYM A;  2R57 A;  2XKO C;  1JBM A;  2ZZD A;  3CCS A;  4VUB A;  1M9S A;  5KE3 A;  1N8R C;  1QVF A;  3JCM V;  4M78 E;  1OYX A;  2JN0 A;  3RKX A;  5GMK m;  3RKY A;  3MP8 A;  5LJ3 h;  2CKK A;  4ELZ C;  2EJF A;  2K5L A;  1VQP T;  2QQA A;  5FRN A;  1EIF A;  1NPR A;  1UGQ B;  5CQY A;  5KH6 A;  2XK0 A;  4BDZ A;  1VQP A;  1VIF A;  1U8R A;  2DXC A;  5DY9 A;  2D0Q B;  3FEO A;  2DZC A;  2DIQ A;  4OP0 A;  3OBW A;  2X4Y A;  5CKD A;  1VQ6 T;  4M77 D;  3QSU A;  4FSX A;  3P8B B;  3HRS A;  4MZM A;  5LJ5 f;  5J39 A;  4RG8 A;  4C8Q F;  3CCS T;  2FVU A;  1PSE A;  2ZCF B;  1M90 C;  3G4S A;  3MP6 A;  4MML A;  5DLQ E;  1RL2 A;  3HL8 A;  4NL3 A;  4LDX A;  1K73 U;  3M56 A;  4MMK A;  5HY6 A;  4OB1 B;  4F7U E;  2Y4X A;  4A4G A;  2QEX T;  1YCY A;  3QPH A;  5CKB A;  2XDD A;  1VQM A;  2K5I A;  3SDZ A;  2HD0 A;  1BIB A;  3LW5 E;  5CQX A;  1D3B B;  4PL6 A;  3JB9 J;  3M58 A;  4ATO A;  2VXE A;  1ZQ1 A;  4M7A C;  2DTI A;  4HCC A;  4RMO A;  1YIT T;  1M5Q 1;  1VQ5 A;  2CYZ B;  2RK2 A;  4C92 B;  2X4W A;  1B34 B;  2F69 A;  3CD6 A;  3E19 A;  1Y07 A;  4XTX A;  2PUK B;  5FLX E;  1WQW A;  4LDY A;  1Y96 A;  1N27 A;  2O01 E;  3QJY A;  4C5G A;  1O75 A;  4B9X A;  5A0L A;  3EFS A;  1IRE B;  2LTO A;  4C8Q B;  2LQK A;  2LNV A;  2KMT A;  3OYN A;  1WQ7 A;  2EQK A;  4XU2 A;  4LDU A;  1FXX A;  3F70 A;  1DJ7 B;  4PLL A;  5GAM j;  4EMH A;  4QVD A;  1VQ8 T;  3OBY A;  5FRM A;  1QVP A;  3LYI A;  4ZN1 A;  1VQL T;  1VQN T;  2DXT A;  1YHQ A;  3CMA T;  3M4Y A;  2EAY A;  1M90 U;  2VXF A;  1WJQ A;  4M7A F;  3I56 T;  3URG A;  2DAQ A;  2JNG A;  5GAN h;  2E64 A;  4NL2 A;  3VYH B;  3X26 B;  4OB0 B;  4A53 A;  1FWZ A;  4C0G A;  3J81 E;  3DKM A;  4FU6 A;  1TH7 A;  1YJN A;  3HFN A;  2OTL T;  1YJW A;  3SFM A;  1VQ4 T;  4J6Y A;  3KBG A;  3CCU A;  4Q5W A;  4QQD A;  4A4H A;  3OYM A;  2JTM A;  1WJS A;  5HK3 A;  4E7H A;  1I8F A;  2L5Q A;  3HFO A;  3PT9 A;  3CBM A;  4C8Q C;  5GAM e;  2JVV A;  2KK4 A;  3ER0 A;  4C0Z A;  2P0P A;  2PU9 B;  1YBY A;  2Y90 A;  3E9F A;  3M55 A;  3CC7 A;  3CCE A;  4II1 A;  3LGL A;  1BKB A;  2KY9 A;  2L8D A;  3WVE B;  1VQO A;  4XTZ A;  3RKW A;  2JOY A;  3HSB A;  2XHC A;  3A8O B;  1PSF A;  2EJ9 A;  4BAC A;  2RHY A;  2ZPF B;  5GAN d;  1GXI E;  4LD9 K;  4J7F A;  3QKJ A;  2P0K A;  4YTL A;  5GMK l;  3P8H A;  4XU1 A;  2CZ7 B;  3PMI A;  3VU3 C;  4C5I A;  2PVG B;  5LJ3 g;  1VQK A;  4QQG A;  3KUF A;  2R58 A;  4E7L A;  4L5G A;  4OB2 B;  3UWN A;  4JRI A;  2E41 A;  3PMT A;  5GAO l;  1KHC A;  3OYC A;  2B8A A;  3WVD B;  3M9Q A;  2M1H A;  3S6W A;  2LT4 A;  3LX7 A;  4BY6 B;  3GF5 A;  1IZ6 A;  3A8M B;  1N8R U;  3OYA A;  4F7U B;  4JRQ A;  4ZGD B;  2HNI A;  4C92 C;  4E47 A;  4XU0 A;  1Q81 C;  3MEU A;  3G71 A;  3OSS C;  2LT1 A;  2HBP A;  4M75 A;  3I55 T;  1W2B A;  3FC3 A;  4M7A G;  1Y7X A;  2RH2 A;  2RHX A;  3V8J A;  3ME9 A;  4M78 A;  2EQJ A;  2VYT A;  2XDB A;  1QW1 A;  2RHU A;  3A8G B;  5GAM d;  4ZTJ A;  2LVM A;  3ZEH A;  4V2S A;  4A4E A;  4MZT A;  1XNI A;  3G6E T;  4M7D E;  5GAN 3;  2G3R A;  3OQ5 A;  1K8A U;  1M1K C;  3CC4 A;  2H3J A;  1Y71 A;  5LL6 S;  2JUF A;  1UGR B;  3OB9 A;  5LJ5 d;  4LDW A;  5IN1 A;  1B34 A;  3INZ A;  1SSF A;  4PJO B;  4RKU E;  4C92 G;  3OYH A;  5LJ5 e;  2X35 A;  1KG1 A;  4QVC A;  3A8L B;  2GFA A;  4KT0 E;  4CI0 C;  1KQS A;  2KSS A;  4J6X A;  4BY6 C;  4PKC C;  3SWN C;  1MGQ A;  4J6W A;  2RJE A;  3CC4 T;  2XU8 A;  5A2Q E;  1X75 C;  5FU7 C;  3DLM A;  2FYK A;  2K3X A;  2PUO B;  4KUI A;  4J8O A;  1H64 1;  4M7D C;  3P8D A;  4C0D C;  2V8J A;  3BFM A;  5A0G A;  1QVG S;  2HQE A;  1VQ9 A;  2DTO A;  2GCX A;  4JRK A;  3I55 A;  3CCV T;  2EQM A;  4IUV A;  1JRI A;  3CCL A;  3RER A;  2MF2 A;  5HKC A;  3JB9 H;  3JCM h;  3HPW A;  3ASK A;  4E7K A;  3VV0 A;  3L2Q A;  1NJI C;  4HCZ A;  1Q82 U;  3R6O A;  3QDR B;  2EFI A;  4BD3 A;  2QQS A;  2DVE A;  4C8Q G;  5GAN 5;  4X34 A;  2R5M A;  2DKG A;  3L2W A;  3NTH A;  3CCR A;  4KUD K;  3SWN B;  1G5V A;  3JCM f;  4JLI A;  1S72 A;  2QTX A;  3LLR A;  3CPF A;  3FJP A;  4A4K A;  5DLO A;  3SB2 A;  1V29 B;  2VGM A;  5DM7 R;  5L8R E;  5GAN 7;  3CXC A;  3OMG A;  5I21 A;  3JCM d;  2WSF E;  3PFS A;  3V8K A;  3UPU A;  5IT9 E;  4C0D B;  3CC2 T;  4M7D G;  1X6O A;  4NS5 A;  1Q7Y U;  2YHT A;  2GF7 A;  2DJZ A;  1WPY A;  2QXF A;  5GAN 2;  3OYB A;  4DQ2 A;  2C06 A;  5HK0 A;  3CC7 T;  2ZPH B;  3OSV A;  4M78 C;  4ZGJ B;  3G6E A;  3SWN A;  4IUU A;  4M75 F;  3QUI A;  2KAF A;  3UDC A;  2M16 A;  2VUB A;  2KDS A;  3FLG A;  3FRN A;  4ZTF A;  1KD1 U;  1QP2 A;  1VQ4 A;  2DXU A;  1YJW T;  4GY5 A;  3NFC A;  2OTL A;  4XAX B;  1LJO A;  2M0O A;  3E9G A;  3PGG A;  4L59 A;  1O9S A;  3C4S A;  3CME T;  2MMP A;  4E7I A;  2QDY B;  4HKE A;  4ZN3 A;  4M75 B;  3GNG A;  1UEB A;  5IAY A;  2OTJ A;  3AHU A;  3FB9 A;  5AYF A;  1Q82 C;  1I81 A;  1LNX A;  4BE0 A;  3CCM T;  2FL7 A;  1WNL A;  3GPL A;  4BDY A;  5C6S A;  4OGC A;  2RA2 A;  2E10 A;  3PNW C;  3QZ5 B;  5D6X A;  3QG1 A;  3S3N A;  5A0D A;  1VQ8 A;  2YRV A;  2A7Y A;  1OZ2 A;  4Y91 A;  3V8L A;  1ZBX A;  5CR2 A;  3OYY A;  2X4J A;  3A8H B;  1KQ1 A;  4LDV A;  4IKF A;  2RK1 A;  2ZPG B;  3QII A;  3JCM c;  4ZGE B;  1NE8 A;  1YJ9 A;  2XDP A;  5CKF A;  3WXM B;  2GFU A;  2RI2 A;  5CKE A;  3CD6 T;  2F5T X;  3PIO A;  3NTI A;  3OYI A;  2VGN A;  4BE1 A;  2JTF A;  5GAM f;  3GNF B;  4C92 E;  5CAI A;  2E70 A;  2EJG A;  5GAO n;  2I2L A;  4EDU A;  4M7A D;  4HCB A;  4QVZ A;  2X4X A;  1S72 T;  4Y28 E;  2HQX A;  4KBM B;  4GLK A;  3BY7 A;  2RO0 A;  5CVI A;  5J26 A;  1VIE A;  5KCO A;  3OS0 A;  2QEX A;  4Z02 A;  1K8A C;  4M78 B;  4M75 G;  5CO7 A;  3TRE A;  4X9D A;  1R8O B;  4EMK B;  2RJC A;  4KUL A;  3G4S T;  3JCM X;  3EFR A;  2PVD B;  1KHI A;  4F7U F;  3C94 A;  2V8K A;  3O8V A;  4UC4 A;  2DD4 A;  3GP8 A;  1VQ6 A;  3M4G A;  4PJO A;  1MHN A;  2E1H A;  3RUX A;  1YJ9 T;  4PJO E;  1XTD A;  5GAN e;  2K4Y A;  1JJ2 S;  3KXT A;  4XU3 A;  4D6W A;  3X24 B;  4N4H A;  3JCM P;  3JB9 I;  2D9T A;  1NJI U;  3JSC A;  1HXD A;  2MWP A;  4HT9 A;  5KE2 A;  2D6F A;  4L6V 5;  1N6A A;  4JS5 A;  3CPW A;  3CCM A;  3H8Z A;  2RI3 A;  3FDR A;  1XOV A;  3QBY A;  3BDU A;  5I2S A;  4QW2 A;  3OYK A;  2OTJ T;  2CGH A;  4EMK C;  3QHS A;  4XTU A;  1H3Z A;  4DOW A;  3VUZ A;  3CME A;  1N9R A;  1NPP A;  4NOY A;  2LC4 A;  1JB0 E;  4M77 F;  5FRO A;  4M77 C;  2E5Q A;  4JUV A;  3V7C A;  2WAC A;  1BI1 A;  3HKS A;  4MZP A;  2RJF A;  1QVF S;  3CCJ A;  1M1G A;  2V8I A;  3RES A;  4M78 G;  1NZ9 A;  4IUQ A;  4DOV A;  4JLG A;  5GAM g;  3DLL A;  3S3O A;  1Q7Y C;  3L2U A;  4FT2 A;  3JB9 G;  2RHI A;  2YLC A;  2LCL A;  4ELY C;  1UGS B;  1Q86 U;  1QVG A;  2RI5 A;  3CC2 A;  4FL6 A;  5J3B A;  1KQS S;  1G3Y A;  3CBO A;  4TVR A;  3OYL A;  4PJO C;  2CZ0 B;  4DA4 A;  4C8Q E;  2XIC A;  3OA6 A;  2BIV A;  4J7I A;  1OI1 A;  2RM4 A;  5LJ3 e;  4JS4 A;  2LX9 A;  2MAM A;  4BUG A;  3ZFJ A;  2RD1 A;  5CK9 A;  3OW2 S;  3CCR T;  3X25 B;  3OYG A;  2O4X A;  1UGP B;  3HRU A;  1BI3 A;  2A3L A;  2DTH A;  4M77 B;  4O5V A;  3J80 E;  2DK3 A;  4RCC A;  1M4Z A;  5EG2 A;  4IUP A;  4PJO G;  2NLU A;  2P0Q A;  4C92 A;  1LOJ A;  1QP3 A;  2KVQ G;  2PVO B;  3MET A;  5C0M A;  4RG2 A;  2ZPE B;  1M8V A;  5GAN 4;  3E1S A;  1HK9 A;  4OF1 A;  4XTW A;  1Q86 C;  4M75 D;  3CCL T;  3CCV A;  3EAE A;  3BW1 A;  3OMC A;  3X20 B;  5M9O A;  3QO3 A;  4M7A B;  2QQB A;  4JRP A;  1VQ9 T;  2M9U A;  2E6Z A;  3JB9 F;  4M7D D;  4WF2 A;  1KC8 U;  3RMS A;  1BI0 A;  4IUR A;  1W4S A;  2MWO A;  4M77 A;  3VJP A;  4EMK A;  4J5Y A;  5LJ3 j;  2DIG A;  5GAN g;  3CCQ A;  3DB4 A;  1VQ7 A;  1UB4 A;  2XI9 A;  4C8Q D;  4XTV A;  4F7U G;  2RJD A;  4MDW A;  4N4I A;  4B9W A;  1YIJ T;  2WSE E;  3MP1 A;  4HA8 A;  2DEQ A;  2QQR A;  2K5F A;  2L3R A;  3QXE B;  4FT4 A;  4PJO F;  3JAM E;  4CRI A;  3JCM J;  3J7A F;  2KQW A;  4A54 A;  2L89 A;  3FIF A;  1M1K U;  3JRZ A;  4F7U A;  4XQ3 A;  4M7A A;  1I4K 1;  4JDS A;  3LH0 A;  4N4G A;  3OYE A;  2MI6 A;  4BI4 A;  4M7A E;  2QA4 T;  1KQ2 A;  1G3S A;  3H6Z A;  4XTY A;  1N9S A;  4M7D A;  3QYG B;  3JCM g;  1AHJ B;  3ZBD A;  2LRQ A;  4XK8 E;  2DZ9 A;  5LJ3 d;  3V7S A;  1YI2 A;  3L2V A;  3CXC S;  2EWN A;  5I2M A;  4OB3 B;  2RHZ A;  4RCB A;  3X28 B;  5LJ3 f;  5FU6 C;  2EKO A;  5D6W A;  2CZ6 B;  2RB6 A;  4N0A A;  4BE2 A;  4HT8 A;  4PNO A;  3G71 T;  3LWI A;  4M77 E;  4C92 D;  3DB3 A;  4M78 D;  2LCC A;  1K9M U;  2ZPI B;  1Q81 U;  1VUB A;  3OS5 A;  2XG8 D;  4A4F A;  5CKH A;  5LJ5 j;  3JCM W;  2P4T A;  3HHT B;  4O6J A;  3L42 A;  2EYQ A;  3SD4 A;  2JZ2 A;  4C5E A;  1I5L A;  1K9M C;  3GIB A;  3LGF A;  2DPP B;  5GMK j;  4M75 C;  3GOX A;  3VKI A;  2ZPB B;  1YI2 T;  1WGS A;  4M78 F;  3JCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...