3MJ0A

Crystal structure of drosophia ago-paz domain in complex with 3'-end 2'-o-methylated rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
SSMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein argonaute-2
publication title Crystal Structure of drosophila Ago2 PAZ domain in complex with 3'-end 2'-O-methylated RNA
rcsb
source organism Drosophila melanogaster
molecule tags Rna/rna binding protein
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3mj0A00
2QVWA 3O6EX 4W5QA 4OLBA 2XFMA 4W5RA 1T2SA 4NGCA 1R4KA 5KI6A 2L5CA 4F3TA 4NGDA 2L5DA 3O7VX 4Z4FA 4Z4EA 4NH6A 3MJ0A 3QIRA 3O7XA 4Z4GA 4W5TA 3O3IX 4Z4HA 1VYNA 4NGBA 4W5NA 4KRFA 1SI2A 4Z4IA 4NH5A 5JS1A 4NGFA 4OLAA 4KREA 5T7BA 1R6ZA 2FFLA 1T2RA 1SI3A 5JS2A 4NGGA 4NH3A 4W5OA 4NHAA 4Z4CA
chains in the Genus database with same CATH superfamily
2BZEA 2QVWA 3O6EX 4W5QA 4OLBA 3HK2A 3HJFA 2XFMA 4W5RA 1T2SA 4NGCA 1R4KA 5KI6A 3DA5A 2L5CA 3U1UA 4F3TA 4NGDA 2L5DA 3HVRA 3O7VX 4Z4FA 4Z4EA 4NH6A 3MJ0A 1Z25A 3QIRA 3O7XA 4Z4GA 4L1PA 4W5TA 3O3IX 4Z4HA 1VYNA 3DLHA 4NGBA 4NHAA 4W5NA 4KRFA 1SI2A 4Z4IA 4NH5A 5JS1A 4NGFA 4OLAA 4KREA 3HM9A 4Z4CA 1Z26A 1R6ZA 2FFLA 5T7BA 1T2RA 5JS2A 1SI3A 3HO1A 4NGGA 2DB9A 4NH3A 3F73A 4W5OA 4L1UA 3DLBA 1U04A
chains in the Genus database with same CATH topology
2BZEA 2QVWA 3O6EX 4W5QA 4OLBA 3HK2A 3HJFA 2XFMA 4W5RA 1T2SA 4NGCA 1R4KA 5KI6A 3DA5A 2L5CA 3U1UA 4F3TA 4NGDA 2L5DA 3HVRA 3O7VX 4Z4FA 4Z4EA 4NH6A 3MJ0A 1Z25A 3QIRA 3O7XA 4Z4GA 4L1PA 4W5TA 3O3IX 4Z4HA 1VYNA 3DLHA 4NGBA 4NHAA 4W5NA 4KRFA 1SI2A 4Z4IA 4NH5A 5JS1A 4NGFA 4OLAA 4KREA 3HM9A 4Z4CA 1Z26A 1R6ZA 2FFLA 5T7BA 1T2RA 5JS2A 1SI3A 3HO1A 4NGGA 2DB9A 4NH3A 3F73A 4W5OA 4L1UA 3DLBA 1U04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVW A;  3O6E X;  4W5Q A;  4OLB A;  2XFM A;  4W5R A;  1T2S A;  4NGC A;  1R4K A;  5KI6 A;  2L5C A;  4F3T A;  4NGD A;  2L5D A;  3O7V X;  4Z4F A;  4Z4E A;  4NH6 A;  3MJ0 A;  3QIR A;  3O7X A;  4Z4G A;  4W5T A;  3O3I X;  4Z4H A;  1VYN A;  4NGB A;  4W5N A;  4KRF A;  1SI2 A;  4Z4I A;  4NH5 A;  5JS1 A;  4NGF A;  4OLA A;  4KRE A;  5T7B A;  1R6Z A;  2FFL A;  1T2R A;  1SI3 A;  5JS2 A;  4NGG A;  4NH3 A;  4W5O A;  4NHA A;  4Z4C A; 
#chains in the Genus database with same CATH topology
 2BZE A;  2QVW A;  3O6E X;  4W5Q A;  4OLB A;  3HK2 A;  3HJF A;  2XFM A;  4W5R A;  1T2S A;  4NGC A;  1R4K A;  5KI6 A;  3DA5 A;  2L5C A;  3U1U A;  4F3T A;  4NGD A;  2L5D A;  3HVR A;  3O7V X;  4Z4F A;  4Z4E A;  4NH6 A;  3MJ0 A;  1Z25 A;  3QIR A;  3O7X A;  4Z4G A;  4L1P A;  4W5T A;  3O3I X;  4Z4H A;  1VYN A;  3DLH A;  4NGB A;  4NHA A;  4W5N A;  4KRF A;  1SI2 A;  4Z4I A;  4NH5 A;  5JS1 A;  4NGF A;  4OLA A;  4KRE A;  3HM9 A;  4Z4C A;  1Z26 A;  1R6Z A;  2FFL A;  5T7B A;  1T2R A;  5JS2 A;  1SI3 A;  3HO1 A;  4NGG A;  2DB9 A;  4NH3 A;  3F73 A;  4W5O A;  4L1U A;  3DLB A;  1U04 A; 
#chains in the Genus database with same CATH homology
 2BZE A;  2QVW A;  3O6E X;  4W5Q A;  4OLB A;  3HK2 A;  3HJF A;  2XFM A;  4W5R A;  1T2S A;  4NGC A;  1R4K A;  5KI6 A;  3DA5 A;  2L5C A;  3U1U A;  4F3T A;  4NGD A;  2L5D A;  3HVR A;  3O7V X;  4Z4F A;  4Z4E A;  4NH6 A;  3MJ0 A;  1Z25 A;  3QIR A;  3O7X A;  4Z4G A;  4L1P A;  4W5T A;  3O3I X;  4Z4H A;  1VYN A;  3DLH A;  4NGB A;  4NHA A;  4W5N A;  4KRF A;  1SI2 A;  4Z4I A;  4NH5 A;  5JS1 A;  4NGF A;  4OLA A;  4KRE A;  3HM9 A;  4Z4C A;  1Z26 A;  1R6Z A;  2FFL A;  5T7B A;  1T2R A;  5JS2 A;  1SI3 A;  3HO1 A;  4NGG A;  2DB9 A;  4NH3 A;  3F73 A;  4W5O A;  4L1U A;  3DLB A;  1U04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...