3MJ0A

Crystal structure of drosophia ago-paz domain in complex with 3'-end 2'-o-methylated rna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
118
structure length
118
Chain Sequence
SSMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of drosophila Ago2 PAZ domain in complex with 3'-end 2'-O-methylated RNA
rcsb
source organism Drosophila melanogaster
molecule tags Rna/rna binding protein
molecule keywords Protein argonaute-2
total genus 23
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3mj0A00
5JS2A 4NH3A 4W5RA 4Z4FA 4NHAA 1VYNA 4Z4EA 4NGBA 4OLAA 2L5DA 1T2RA 3QIRA 3O7VX 4NH6A 1T2SA 4NGDA 5JS1A 1SI3A 3O3IX 1SI2A 3MJ0A 4Z4IA 4F3TA 2QVWA 4KREA 2L5CA 1R6ZA 3O7XA 4NGFA 4W5NA 4Z4HA 4OLBA 3O6EX 1R4KA 4NGGA 4Z4GA 5T7BA 2FFLA 4NGCA 4W5OA 4NH5A 5KI6A 4W5QA 4W5TA 2XFMA 4KRFA 4Z4CA
chains in the Genus database with same CATH superfamily
5JS2A 4NH3A 4W5RA 4Z4FA 4L1PA 1VYNA 3HO1A 4NHAA 4Z4EA 4NGBA 1Z25A 4OLAA 2L5DA 1T2RA 3QIRA 3O7VX 3HVRA 4NH6A 1T2SA 4NGDA 5JS1A 3F73A 1SI3A 3HJFA 3HM9A 3O3IX 1SI2A 3HK2A 3MJ0A 1U04A 4Z4IA 4F3TA 2QVWA 4KREA 2L5CA 1R6ZA 2BZEA 3O7XA 4NGFA 4W5NA 2DB9A 4Z4HA 3DLHA 1Z26A 3O6EX 4OLBA 1R4KA 3U1UA 4NGGA 4Z4GA 4L1UA 5T7BA 2FFLA 4NGCA 4W5OA 3DLBA 3DA5A 4NH5A 5KI6A 4W5QA 4W5TA 2XFMA 4KRFA 4Z4CA
chains in the Genus database with same CATH topology
5JS2A 4NH3A 4W5RA 4Z4FA 4L1PA 1VYNA 3HO1A 4NHAA 4Z4EA 4NGBA 1Z25A 4OLAA 2L5DA 1T2RA 3QIRA 3O7VX 3HVRA 4NH6A 1T2SA 4NGDA 5JS1A 3F73A 1SI3A 3HJFA 3HM9A 3O3IX 1SI2A 3HK2A 3MJ0A 1U04A 4Z4IA 4F3TA 2QVWA 4KREA 2L5CA 1R6ZA 2BZEA 3O7XA 4NGFA 4W5NA 2DB9A 4Z4HA 3DLHA 1Z26A 3O6EX 4OLBA 1R4KA 3U1UA 4NGGA 4Z4GA 4L1UA 5T7BA 2FFLA 4NGCA 4W5OA 3DLBA 3DA5A 4NH5A 5KI6A 4W5QA 4W5TA 2XFMA 4KRFA 4Z4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JS2 A;  4NH3 A;  4W5R A;  4Z4F A;  4NHA A;  1VYN A;  4Z4E A;  4NGB A;  4OLA A;  2L5D A;  1T2R A;  3QIR A;  3O7V X;  4NH6 A;  1T2S A;  4NGD A;  5JS1 A;  1SI3 A;  3O3I X;  1SI2 A;  3MJ0 A;  4Z4I A;  4F3T A;  2QVW A;  4KRE A;  2L5C A;  1R6Z A;  3O7X A;  4NGF A;  4W5N A;  4Z4H A;  4OLB A;  3O6E X;  1R4K A;  4NGG A;  4Z4G A;  5T7B A;  2FFL A;  4NGC A;  4W5O A;  4NH5 A;  5KI6 A;  4W5Q A;  4W5T A;  2XFM A;  4KRF A;  4Z4C A; 
#chains in the Genus database with same CATH topology
 5JS2 A;  4NH3 A;  4W5R A;  4Z4F A;  4L1P A;  1VYN A;  3HO1 A;  4NHA A;  4Z4E A;  4NGB A;  1Z25 A;  4OLA A;  2L5D A;  1T2R A;  3QIR A;  3O7V X;  3HVR A;  4NH6 A;  1T2S A;  4NGD A;  5JS1 A;  3F73 A;  1SI3 A;  3HJF A;  3HM9 A;  3O3I X;  1SI2 A;  3HK2 A;  3MJ0 A;  1U04 A;  4Z4I A;  4F3T A;  2QVW A;  4KRE A;  2L5C A;  1R6Z A;  2BZE A;  3O7X A;  4NGF A;  4W5N A;  2DB9 A;  4Z4H A;  3DLH A;  1Z26 A;  3O6E X;  4OLB A;  1R4K A;  3U1U A;  4NGG A;  4Z4G A;  4L1U A;  5T7B A;  2FFL A;  4NGC A;  4W5O A;  3DLB A;  3DA5 A;  4NH5 A;  5KI6 A;  4W5Q A;  4W5T A;  2XFM A;  4KRF A;  4Z4C A; 
#chains in the Genus database with same CATH homology
 5JS2 A;  4NH3 A;  4W5R A;  4Z4F A;  4L1P A;  1VYN A;  3HO1 A;  4NHA A;  4Z4E A;  4NGB A;  1Z25 A;  4OLA A;  2L5D A;  1T2R A;  3QIR A;  3O7V X;  3HVR A;  4NH6 A;  1T2S A;  4NGD A;  5JS1 A;  3F73 A;  1SI3 A;  3HJF A;  3HM9 A;  3O3I X;  1SI2 A;  3HK2 A;  3MJ0 A;  1U04 A;  4Z4I A;  4F3T A;  2QVW A;  4KRE A;  2L5C A;  1R6Z A;  2BZE A;  3O7X A;  4NGF A;  4W5N A;  2DB9 A;  4Z4H A;  3DLH A;  1Z26 A;  3O6E X;  4OLB A;  1R4K A;  3U1U A;  4NGG A;  4Z4G A;  4L1U A;  5T7B A;  2FFL A;  4NGC A;  4W5O A;  3DLB A;  3DA5 A;  4NH5 A;  5KI6 A;  4W5Q A;  4W5T A;  2XFM A;  4KRF A;  4Z4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...