3MJ4A

Crystal structure of udp-galactopyranose mutase in complex with phosphonate analog of udp-galactopyranose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
365
structure length
365
Chain Sequence
b'QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-galactopyranose mutase
molecule tags Isomerase
source organism Deinococcus radiodurans
publication title Chemoenzymatic Synthesis, Inhibition Studies, and X-ray Crystallographic Analysis of the Phosphono Analog of UDP-Galp as an Inhibitor and Mechanistic Probe for UDP-Galactopyranose Mutase.
pubmed doi rcsb
total genus 113
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mj4A01
3PJFA 4XYEA 2WYVA 3DTYA 1DFGA 1IB6A 4P4GA 2PGJA 3G1TA 4IDBA 3NV9A 1Z74A 2AG5A 3D5QA 2FRDA 5DNAA 3PDJA 3LSYA 1XA0A 4YAJA 5IDYA 4RPHA 4TQGA 4NK4A 2FSVA 5JSFA 2W2KA 3IAHA 4FCCA 4LSMA 1WP4A 1B8UA 3BTSA 1J0XO 4K28A 2Y66A 4IXWA 2DKNA 4E2YA 4CLRA 3GRKA 5CPFA 5T57A 1B14A 1E7QA 4NJOA 3VAZA 2VZ8A 4OMUA 1S6YA 3RKRA 4MVJD 4Q3CA 1U3WA 1L1FA 3VH3A 3JQBC 1DEHA 2D3TA 4KOAA 1XHLA 2Q99A 1ONNA 5DCYA 5CDSA 3RQSA 3WGGA 2CVZA 3P2OA 4B8ZA 4NI5A 2VWHA 3QV1A 3Q1LA 3PP8A 2HO5A 4H7PA 1XU7A 1X7HA 1CETA 2IE0A 2BRUA 4BVAA 3HJAA 2EGGA 4CODB 4RZIA 1ENPA 3KXDA 4TROA 2FSSA 5A5EA 3ZI0A 3TFOA 2Y67A 3GHYA 4YRDA 2EKQA 4N5LA 4ALJA 2NVBA 2YJZA 3FPCA 3HUDA 1P9LA 2JL1A 4IDEA 4PVDA 2ZTLA 1CYDA 1ZMOA 2QHXA 1MV8A 4ND2A 2JD0A 3EGOA 4ONEA 3GAZA 3UHAA 3TDKA 4I5FA 3ONFA 2O50A 4GVXA 3IP3A 2NU6A 1KS9A 3TZQA 2AHRA 1N9GA 2CDCA 3I4FA 4BNYA 1R12A 4EJ0A 1VI2A 2BFMA 1XIVA 2VZ0A 3ZHZA 4CMEC 4J49A 3JSAA 4DPMA 3GR6A 5H81A 3O38A 3JD1A 2BD0A 5CP8A 1BGVA 2H5LA 3AUAA 2VYVD 3AM5A 3KLPX 3ZV5A 2HMUA 3ZGYA 4HV4A 4KUHA 1QR6A 2DLDA 1RPNA 2DTEA 4YJDA 1NWCA 1Y1PA 3AI2A 1WPQA 1KY4A 2WMDA 2W2LD 3KOUA 3WR5A 3GUYA 1U3UA 4QO7A 5DDIP 4G65A 5BNTA 2OP0A 4FGSA 3RUEA 4PLVA 3TRIA 1IZ0A 2D59A 4IDFA 3BTUA 1WDMA 4JP3A 1LQTA 3RIHA 3PTZA 3GG2A 1FF9A 2BFPA 3OF2A 1V3UA 4OSPA 4J43A 3ZWYA 3GGPA 3JD4A 4GAEA 4AJ2A 4ALNA 1T25A 4IQ0A 3S2IA 2VTDA 2ZCUA 3EC7A 1GEEA 4GWKA 4WCFA 3QE3A 1HDXA 4PIVA 2J3HA 2EWMA 2HRBA 2RAFA 5AXBA 2YDXA 3PJDA 2DT5A 4DLAA 5A3VA 1O9BA 4LCEA 3T4EA 4J1TA 4AJPA 1DDOA 1EBFA 1Z45A 3JV7A 3OIDA 4B79A 4JXKA 3F5SA 2A9FA 5L45A 1YVEI 4QUKA 3EYWA 5JFOA 1K6JA 1N1GA 5JLAA 5GZ3A 4YYZA 1C0PA 1HYEA 2UAGA 4DWVA 4P4LA 3KO8A 1JN0A 4MO2A 2O48X 3IC5A 4J1QA 1T2DA 4WCDA 4XYGA 1HRDA 2X0IA 4ALKA 2P5UA 3WGZA 4UREA 2YZ7A 4J9VA 2Q49A 1P77A 4QFDA 3ICCA 5IJZA 4BO9A 3K6JA 5FFFA 5K6AA 1NASA 4FR5A 3LYLA 4NFSA 3VH4A 1XR3A 4YT8A 3SC4A 4E5KA 1IY8A 5IF3A 3W4JA 1U2GA 1MXFA 1EVJA 1VRWA 2X4GA 1A27A 1IYZA 3BZUA 4GGPA 1ZIDA 4DPKA 5L4LA 3JYQA 2DUUA 4EUFA 4F45A 4LVUA 5CDUA 2ZB4A 4MIEA 4PG6A 5BSHA 1ZZEA 5ICSA 1H9BA 2UUOA 1DIRA 1CWUA 4PLFA 4Z6KA 3PQFA 3TNLA 2D1YA 4YB8A 1DJQA 4YQYA 3WTBA 5I7SA 4PLWA 5FF9A 3R1IA 1UXGA 1Y5MA 2EERA 2VCYA 3A28A 4CLEA 3UGKA 3EVNA 3UW3A 4FDAA 5B12A 4M1QA 4NG5A 3Q3CA 5KVVA 4YJFA 4E32A 1HDZA 3CINA 3Q0EA 4JNKA 1ZO8A 3D4OA 1GV0A 4U0JA 1U1IA 2DU8A 1HWYA 3E9MA 2E4AA 1D7OA 1I2ZA 4MKXA 1KEPA 1N8KA 3ZWMA 4GLLA 4CMKA 2VRCD 2PWZA 4DMMA 1ZJZA 2EV9A 5AVOA 3PHLA 3F9IA 3BMNA 1FK8A 1QP8A 1MC4A 1JW9B 5HS6A 2GYYA 1HDGO 2BKAA 2EIHA 5CDGA 1I32A 2CSUA 4R3NA 2ZYGA 1I01A 4L9RA 5HRUA 4CM9D 2UV8A 1I3MA 3QWIA 2PGDA 3UAGA 5JXWA 4BO3A 1LTHR 1J49A 5A5FA 3HQ4O 2X5KO 2QX7A 4M55A 3UCEA 4XYBA 1U28A 4FFMA 1MX3A 4A27A 4AJLA 4CM6A 5HBRA 3KYDB 3RC2A 4D0RA 4IDAA 1GTMA 4A7PA 5ENDA 3LLVA 1VKOA 1YB5A 3I6QA 3U4HA 1HDOA 5KOIA 4AVYA 4D45A 2I76A 2X5OA 2I9PA 1MP0A 4KUGA 4CMJA 2EP5A 4FSHA 4MVJM 4LRSB 1OZAA 1X13A 1P1FA 2Z5LA 2AMFA 1IPEA 4I5DA 3ZWOA 2CF5A 2QG4A 1LRKA 1OI7A 3DDNA 5IZCC 2IYPA 1IPFA 4TZTA 4BNKA 1U7TA 2QQ5A 2HK8A 4TKMA 2PR2A 4W9NC 4DGSA 1C0LA 2X6TA 3DBRA 3DR3A 4FC6A 3GUCA 3GK3A 4FFPA 4L75A 3VOSA 3WQSB 4DQUA 4BV9A 4RDHA 3RJ5A 4ESOA 4I8XA 1N5DA 3TL2A 1NPYA 5EQFA 3V2HA 3VZRA 4IMRA 1UZNA 4BO0A 5C7OO 5F5LA 4D0SA 5JCXA 3NDIA 4Q3BA 1VKNA 3I83A 2Y1OA 4A73A 2HMTA 5DCUA 2H63A 1FDTA 4RJTA 3ZHYA 4MVJE 1PQUA 4R4JA 3IL2A 1T26A 3HDHA 3QJ5A 4E30A 1F8FA 1FDUA 4Z3DA 2O7QA 1LA2A 2Q2VA 3PYLA 5EMHA 4GX0A 3DC2A 5JPIA 3CMMA 3ZW9A 1D4FA 1M66A 1F0YA 2IODA 4BIIA 3PYXA 1CEQA 3K8ZA 4TRNA 4TZKA 4W82A 2EP7A 2ZQZA 3ETEA 4J2HA 5A9TA 4KP7A 1NX6A 2WD8A 4MPDA 1CERA 4Y8VA 4DIBA 2NSDA 5ES3A 3E6AA 3ZWPA 3H65A 3GY0A 4JCOA 4BNJA 3H2ZA 3E5MA 4MDHA 1SPXA 4XWYA 4ZVVA 4HKTA 4BNZA 3WMXA 1YJ8A 1UDAA 4BO6A 5JY6A 3Q6IA 5ILGA 5G0TA 4MINA 3V1UA 4OOFA 2RIRA 5KIAA 3TWOA 1P33A 4RVSA 1HL3A 3O8QB 3P2YA 2CFCA 4BQPA 2FPPA 4W7HA 4WLNA 1Y9AA 4CL3A 4E6PA 2FPGA 4Q3AA 2J8ZA 1EUZA 4K26A 5C37A 1ZK1A 4ZICA 1E3JA 2BELA 3AY7A 3WSWA 3GVHA 3C3XA 1EVIA 3RJ9A 4OSOA 5DCWA 3AFNA 4PCVA 3DBHB 2FR8A 4E5YA 5C5IA 4DC1A 4Q3DA 1R4NB 3DONA 5T5QA 2JCVA 3DBLB 4OH1A 4N5NA 3JYOA 3JQ6A 4LN1A 4GSKA 5G0WA 4IUYA 1BXGB 1VL8A 1C14A 1RM3A 2X9VA 4XB1A 5FWNA 1GUZA 3DL2A 1R16A 2VT3A 4G2NA 4UEKA 3KM0A 3AOEA 3EZYA 4MVJA 4DLBA 4J4BA 3JQFC 4W7IA 1SAYA 4YPOA 3IUSA 1S7CA 1XSEA 3WJ7A 4CMHA 3I23A 4O0LA 4L8VA 1H93A 4IBOA 1NQOA 1QYVA 4UVEA 4MP8A 2ZYAA 5A9SA 3IDSA 2OZPA 1WZIA 5JO9A 4R69A 4RF3A 5EN4A 3RUIA 1XU9A 2O3JA 3FI9A 3GFBA 1P0CA 2C07A 3H7AA 3ONDA 1OAAA 3NGXA 4B7CA 2D2IA 1ISIA 1NYTA 4CLHA 1C1DB 4YA6A 1Q1NA 3DBHA 3EY4A 4J90A 5T6BA 1T4DA 1ONOA 1NTOA 3GDFA 1I3KA 1HXHA 3QY9A 3KSZO 2VQ3A 5DP2A 4NBTA 1QYWA 2Q2QA 2ZB8A 4ZRNA 3KZVA 1VL0A 4B4WA 3E48A 4NIMA 3X2FA 3PFWO 2X5JO 1NVGA 4J6FA 5BSEA 2A35A 1MUUA 5DF1A 5H82A 4CM9A 2OP1A 4O1MA 4G81A 5L95A 3NUGA 3GOHA 2PLAA 4PZCA 1C0KA 3GPDG 4DIOA 1ZBQA 2O23A 4BMSA 2PH3A 3TL3A 3ONEA 1Y8QB 4YRBA 4OKIA 3NT2A 1BTOA 3MWDB 3BIOA 2X58A 1SEVA 4PZDA 2VZ9A 2PKRA 4UVIA 4CR7A 1ADBA 2VRCA 2HSDA 4BNTA 1DHTA 3VPHA 2VN8A 3VPFA 3E9NA 5LC1A 1A9ZA 1Z73A 4FB5A 4O59O 5B4TA 1RYEA 5I8ZA 3ZHBA 1ISJA 5LCXA 4IS3A 4PLPA 4J4HA 4WJZA 2F1KA 4XQCA 5G4KA 1Z75A 2NVWA 4S1VA 1LX6A 2CNBA 2EW8A 3DZGA 1N92A 1E3SA 2IRWA 1DLJA 4FJ0A 1NHGA 3KBOA 2YHUA 3KHUA 4BGVA 3V5NA 4CQLB 3D4NA 1P3DA 3C7DB 1R0SA 3EHEA 3UF0A 2V6BA 3PDUA 5ER6A 4FQ8A 2A92A 2EKPA 4PGFA 2NNLD 4QT0A 3KYDA 4IQGA 4U0KA 3RBXA 4UUNA 3Q2IA 4ND4A 1LSUA 3K9QO 3RUDA 3M1LA 4HFJA 3MOGA 4PLZA 2JD2A 4GX5A 5ER9A 3AUSA 1R15A 3ZH2A 2NM0A 5JE8A 4XD2A 3W1VA 3O9ZA 4U7WA 2HLPA 4DYVA 1HZZA 2NVUA 5BNIA 2YW9A 2IEDA 3JYPA 4YAGA 3U49A 1EK5A 4CMAA 1QRRA 3WBBA 4CUZA 4UUMA 1U9JA 2JCXA 4PG4A 5F1PA 5GMOA 1CJCA 1IOLA 4IINA 2AW5A 3DZKA 1X7GA 7ADHA 5JC8A 2X23A 4KWHA 1GY8A 2CY0A 3LT4A 4CR8A 1YDEA 5KWEA 1B7GO 1W73A 3VTZA 1PJCA 1EVZA 1U5CA 5FYDA 4DYDA 5AOVA 3B6ZA 3F46A 3NDRA 4HX5A 1JWBB 2O4CA 3ZNQA 5IXYA 2NU7A 5B4UA 4JJFA 3HZZA 4M89A 4B3HA 2GF2A 4RF5A 5TNXA 3INTA 1R4NA 1TEHA 1ISMA 4OM8A 4OQYA 1DC5A 1GYRA 5TGDA 2X86A 2QZZA 1UP4A 3WS7A 3VZQA 5C3MA 3ST7A 1SNYA 2SCUA 4YACA 3ZN2A 5FI3A 4UVGA 3GMDA 1I0ZA 2PZMA 3OP4A 2P5YA 2X9GA 2XF8A 4QEDA 4HFRA 4DRYA 5L9AA 2VWQA 1KY5A 4EI2A 5F21A 5JAIA 5DOZA 1PWZA 1YGYA 3AWDA 5IDQA 5DN9A 3LC7O 3BTOA 3JCZA 1ZK2A 3LT2A 3IJRA 1O5IA 3D3WA 3NKLA 1I2CA 1H6CA 1H6BA 2IEBA 1XYGA 1ZJYA 1B8PA 1WNTA 2GD1O 2VHYA 3IMFA 4P38A 1WMBA 4R16A 3TN7A 5AQ1A 1HDCA 2C7VA 4U8GA 3FWZA 1A7KA 1B8VA 2YQ4A 3ZWWA 4YT4A 5GZ1A 2O4UX 4NDNE 3NTOA 2YYYA 3UCXA 4K9DA 5JAQA 4D3FA 2B36A 3A9WA 4JJGA 5I7VA 1EDOA 3HG7A 3FSRA 3P19A 4WEOA 5CG2A 2ZJ0A 5EINA 2V65A 4XQ9A 1U4SA 1ZSVA 3FNHA 1KERA 4KDFA 5B4VA 1H6DA 1YBMA 1LDMA 4J0FA 3H9QA 1G0OA 1YOVB 1YH3A 5TQVA 1DO8A 1V9LA 5HA5A 3OBBA 3HB4X 1KOLA 1ADGA 3L4BA 4X54A 2CUKA 4IJWA 3OJ0A 4XYLA 1ZCJA 1EUDA 4QX6A 3OIGA 4HNGA 3H8VA 4RVDA 2I3GA 1SO8A 3GVCA 1F8GA 3WQQA 3MWEB 4ZQHA 1UDBA 1VJ0A 4J4TA 1NFQA 4WCFC 3IKTA 2DC1A 2J5QA 3JYNA 4GH5A 3ZU2A 1W4ZA 2VYVA 4MVJP 1FJHA 1PIWA 4BGEA 2VHVA 1Q7CA 2JFHA 4YVFA 3WWZA 2C2XA 4XQGA 4GLOA 2E49A 3V2UA 1YBVA 2I99A 3IP1A 4R1SA 4AJ1A 4MVJH 2JFFA 1F17A 2FZWA 3ANNA 3H3JA 1AHHA 4P22A 3QVXA 3I3OA 4ND1A 1DRVA 4J1SA 3H9JA 4J7UA 4FW8A 4PG8A 3IKVA 2PFGA 3PVZA 5KTKA 2UVDA 3HADA 4BNGA 3UXYA 2Z1MA 4YTEA 3HWRA 4CM4A 2Q1WA 3PI7A 4LGVA 4AL4A 2VOEA 4JJIA 3WGQA 4CMIA 5I9NA 4II2A 1LC3A 3PHJA 1PZHA 1QLJA 3LC2O 3PZBA 5ICMA 4DQXA 1ZW1A 4UUOA 3WBFA 2ZCVA 1HEUA 1DRUA 4RPKA 1LC0A 3DZBA 2GN4A 3LLSA 3W6UA 4GQAA 1E3WA 1NWHA 5U9CA 1D8AA 3ZZNA 5GZ6A 3JTMA 1PJLA 1BW9B 4CMIB 3IJPA 3NEPX 4DVJA 4E33A 4EEXA 3N7UA 1LBEA 1DAPA 3M1AA 2HMWA 2OGUA 2BFAA 3VVBA 1PWXA 1W8DA 1LRJA 3BMNB 3DOCA 1NPDA 4IDCA 4WNCA 1V3VA 1B15A 1HLPA 5A3JA 4E31A 1TT7A 2BI7A 4RVGA 4QXMA 2ZTMA 3IS3A 4OGWA 4OXKA 1NNUA 1Q7BA 4BNUA 1YL7A 2RH4A 4BMNA 1GEGA 1P45A 1ULUA 3KRTA 1QMGA 1BXZA 2YV1A 4M87A 3OEYA 2BF7A 4O63O 1KIFA 4OYRA 1DPGA 4FOSA 3DFZA 1E7WA 2DBRA 1JLLA 3NAQA 4BO5A 2WEKA 3CIFA 2Y1FA 4XEHA 3GG9A 1J5PA 3ITKA 2FPIA 3EZLA 4Z0TA 1H6AA 1YRLA 1K6IA 2E6UX 1LLQA 1AXGA 1BDMA 1HZJA 4MVJF 4EJ6A 2C54A 1VPDA 3ZHXA 3BHJA 3ZNPA 3GZNA 2UDPA 2ZYDA 3EK2A 3G0OA 4F3YA 4L4XA 3C1TA 3JQ9C 3S55A 1IHYA 4ZQBA 2P9EA 3GEMA 1TLTA 1NQ5A 2W2LA 4UEJA 1NM5A 3KYCA 1LDYA 4ALMA 3H5RA 3ZNNA 5I7EA 3MJ4A 4L4RA 2Q50A 2WSBA 1B0AA 4A26A 3HSKA 2GGSA 3DOJA 4D7AA 4BNLA 3LT0A 3L6DA 1UH5A 4Y6PA 1UXKA 4P8RA 1YL5A 4RORA 3NYWA 1BWSA 4EEZA 3EUWA 3OM9A 4XB2A 3WOHA 4YT2A 2VYNA 1MXHA 4DPLA 3L9XA 2DPGA 1HLDA 4IGEA 4L74A 3VH2A 3OEWA 4R54A 1T1RA 2DM6A 3LK7A 3DXFA 4F46A 3KVOA 4XKJA 1O8CA 3DBLA 4CV0A 1UR5A 4RQTA 1AXEA 3MJCA 3RCBA 9LDTA 2VUUA 3FD8A 2AQKA 3TF5A 3NT4A 1H9AA 4E4YA 3ZWAA 1E3WB 4D42A 5BR7A 4XR9A 3JD2A 3U09A 2JJYA 3JQ8B 1JA9A 1E1KA 1ZEMA 4NBUA 5DZSA 2CDAA 2EEZA 1C1DA 9LDBA 3JD0A 1K0UA 1HE5A 3ASVA 3D64A 1TT5B 1LDNA 3DHNA 4W99A 4BUCA 4BNMA 4CLOB 1WW8A 1U4OA 1KVSA 4ND3A 3OA2A 1XQ1A 3FF4A 4CUJA 1Q0HA 3INRA 5U4QA 2A4KA 1GYQA 1ZK4A 3F4BA 2EKLA 2BH9A 3DEYX 3HB5X 3ORFA 5BNFA 5A03A 2G1UA 3PHGA 5JMWA 5CAEA 4L0QA 2BI8A 1YBAA 3GN1A 1VL6A 4IJKA 4PFJA 4MVJI 4IPTA 4EJMA 2RBEA 3W6ZA 5H83A 4IJUA 2WWRA 4GKBA 2FP4A 4ID9A 4HBGA 2GSDA 3TZCA 3BHMA 3GT0A 4RF2A 3CEAA 5A05A 3WIEA 2ZB7A 1MLDA 2E37A 1C1XA 3VZPA 3PGJA 1G1AA 3NRCA 4RGBA 4TWRA 3FHLA 4QQRA 3TFQA 1XQ6A 4P4NA 3LDHA 4IGFA 1RYDA 1ADCA 3D0OA 2ZTVA 4NBWA 5CDTA 5HS4A 1P1HA 3UH1A 2V7PA 2WE8A 4TVOA 4YJGB 3BMOB 3GRPA 1OBFO 3H6KA 1H2HA 3JQEA 2P4HX 3JQAA 1NAIA 4GWGA 4WEQA 2BGLA 1PR9A 4M54A 4IS2A 3PWSA 1SBYA 2PD3A 1PJBA 3H9UA 2W90A 1BVRA 3I6IA 3FNFA 4OOEA 2AEFA 1NR7A 2VHWA 3D7LA 5JMPA 1PGQA 3TZ6A 4Y6SA 1PJTA 3WWYA 3KEOA 3RBZA 1N1EA 5AXDA 4IDGA 3FPLA 5FI5A 3IIEA 3H2SA 2NACA 2GNAA 2IDZA 1YONA 1QG6A 1ENYA 3PWKA 2J5RA 3KETA 4XX0A 1E92A 1OOEA 4BKPA 3EDMA 1E1LA 2O3UA 5L4NA 5A06A 3MEQA 1VLLA 3PEFA 4UAGA 4KQWA 2FHSA 2OMEA 1WDKA 2QRKA 2HRZA 3C7AA 4LRTB 4RCVA 4AFNA 2QYTA 5JAZA 4AJEA 3L4BC 3K5PA 4CLDA 3MTJA 1NVTA 1TXGA 1TI7A 1P1KA 1LLUA 3GFGA 4CM3A 2GN8A 5CHEA 3GNTA 1G0NA 2WTBA 3VZSA 1O94A 4S3MA 3GVXA 1GPDG 3E5RA 4BQRA 4NFHA 4DBVO 2EGHA 4INAA 1AHIA 3TJRA 4LW8A 2O3RA 1ID1A 2Y93A 1MG0A 1ARZA 4KTVE 3AJRA 5TRTA 2VNSA 2JHGA 2YQ5A 1VJ1A 1PZGA 1GYPA 1U3VA 1V8BA 3RVDA 4NJMB 2C59A 4RDIA 4E21A 5JW6A 2HU2A 3U9LA 1T2EA 4Z9YA 2H6EA 3VVCA 3GH3A 1VJTA 3AI3A 4JIGA 4CM7A 2WYUA 1WXDA 5EJ2A 3WXBA 1VSUA 1V6AA 4IIVA 1GAEO 2O2SA 2W4QA 3ZWCA 4WE3A 4DBZA 5L4SA 3DQPA 4YAIA 2IXBA 4E13A 1Z7EA 3SEFA 1PZEA 4BNXA 2FWMX 3LC1O 1X1EA 3MZ0A 4NU5A 1I5RA 4IJVA 1U3TA 1F12A 3C24A 3RFTA 1UXHA 1R37A 1QKIA 4L4SA 2XOXA 1E1NA 1T2CA 1GUFA 3BMOA 3CPSA 3BMQA 5EESA 5HM8A 3I9LA 2GZ1A 4HUJA 2DQ4A 2GCGA 3FNEA 1EQ2A 1XDWA 3OJOA 1NP3A 1DRWA 1B2LA 1P1IA 1YXMA 2X8LA 4BNHA 5IN4A 1VSVA 2C29D 1ADFA 3H5NA 2IZ1A 1PX0A 3C7CB 3U4CA 4B7XA 3V1TC 2P9CA 1HE3A 3CKYA 4NBRA 1I24A 4J7CA 1GD1O 3F6YA 2I3AA 3BYZA 3LVFO 4I08A 2XPCA 4KMSA 4C7KA 1D1SA 4NFYA 1PJ2A 1DBVO 3M2PA 4MP6A 2CVQA 4GMGA 4UEOA 1G6KA 4CUKA 5DP1A 2HKIA 3DZFA 1EEHA 1PS0A 2B5WA 1RM0A 1JAYA 2JFGA 3ZU3A 3W8EA 1FDVA 2P4QA 1UAYA 3QIVA 4GPD1 3GEDA 4GI2A 5JAMA 1H94A 2O3TA 1ZSYA 2NLOA 3SLKA 3DZHA 1H2BA 3VPXA 1XEAA 1D3AA 3DB2A 3SJ7A 4Z3KA 1V0JA 1HE4A 2AEMA 4KDEA 1ORRA 5L53A 4QFCA 3WGIA 3A06A 4TRMA 4I5GA 3I5MA 2DFVA 1IHXA 4R1UA 2QRLA 4RVHA 4E2WA 3GQVA 1DAOA 4NR0A 2B83A 4L73A 4YJGA 1E7YA 4KTTE 3QHAA 5KCZA 4R01A 5THQA 3DWFA 4N18A 2C7GA 3C85A 3GVIA 2VUSA 4LVCA 1PQWA 1X7DA 3D5TA 3R6DA 4ZU3A 3OETA 1ZVMA 2VRBA 4IY1A 4AICA 1LLCA 1B3BA 2DTDA 1LLDA 2VHXA 3OA0A 4WNIA 5F3RA 5JDCC 1A4UA 3AUUA 3OQBA 4J2OA 3RU7A 1YJQA 3PXXA 4GMFA 2Y0CA 4LMPA 4CJXA 4YEDA 2XXBA 3T4XA 3UCFA 5KVSA 3B1FA 4RF4A 2GN9A 3ROPA 1UZLA 1X0XA 1GDHA 2YV2A 3ON5A 3QVWA 5DBFA 3SJUA 1QYCA 3WICA 5JYDA 1HSZA 2NU8A 5JS6A 4QECA 1CQIA 5B37A 1MB4A 2PA3A 3I52A 1WMAA 1A5ZA 1LSSA 1ISGA 3WLFA 4MIYA 4YJFB 1NAHA 2O7SA 1NHWA 4Y67A 3STHA 3GEGA 1WZEA 4XRGA 2Q4EA 3WGYA 2RHCA 2ZQYA 1T2AA 4WLOA 1O6ZA 3AY3A 3AOGA 2GRAA 5A4DA 1CIVA 3H9EO 4CQMB 3UN1A 1JQBA 3E1KA 5DOVA 5AXCA 3WG9A 1CQJA 3K96A 1HF3A 1WVGA 3MTGA 4WGGA 5I7FA 1RKXA 1J6UA 3HNPA 2HJRA 3RI3A 4C4OA 4YQZA 5HWSA 4MIOA 3TOZA 1ZMTA 4FFLA 1QSGA 4ZHSA 3A4VA 1E7SA 3U62A 4F6LA 3INGA 3JQAB 1DC6A 2PZKA 2W8ZA 2D8AA 4ZN6A 3ADOA 5JDCA 1LJ8A 4HXYA 4PVCA 1TVEA 2YHIA 3FCOA 2VTEA 3O03A 4FC7A 3ASUA 1UP7A 4IM7A 4WLEA 2WYWA 1LUAA 2VUTA 5IDWA 1GR0A 2NQTA 2OXIA 4BKQA 3FTPA 3KLMX 2I5PO 5LDHA 4HP8A 1TA4A 4B7UA 4ZRMA 3TSCA 8LDHA 4CMGA 4TMFA 4Q3EA 2FZEA 3ICPA 4F6CA 1B16A 3UKOA 5EL0A 3GHHA 4DUPA 4EW6A 3FWNA 3ZW8A 5JDIC 3PHIA 4AJIA 3S2GA 1GZ4A 3LQFA 1E6EA 4CPDA 1LQUA 5F5NA 2OORA 2GLXA 1P0FA 4Z9XA 3RC7A 1KBZA 5CDYA 5IFLA 5A1TA 1H0KA 1DFIA 1LSOA 3K30A 1PJ4A 3O4RA 1D1TA 1DB3A 3M6IA 1Y9EA 3WTCA 4IZIA 5ENVA 3SLGA 2Q2WA 3F47A 5DULA 4NQZA 3C1OA 1X14A 1E77A 2G0TA 2AQ8A 2HDHA 3ETGA 5IZCA 4NBVA 1PU2A 2C5AA 1TT5A 2RHRA 3CMCO 4CLOA 2X0JA 3MJTA 5IAAA 5L7YA 4BV8A 2DTXA 1IL0A 3U5TA 2B69A 4CM1A 1SB9A 2HJSA 3F3SA 2NTVA 3AUTA 3DHYA 1QYXA 2PK3A 3HN7A 5MGBA 1LDGA 2GO1A 1SEPA 5TT1A 1EMDA 2PY6A 4M8SA 1JKJA 3TZHA 1NQAO 1NQTA 1UXIA 3JQDA 3PJEA 2BGKA 2IYOA 4PLGA 1UDCA 1R4MB 1PGPA 1Q7GA 3VTFA 3OJLA 1UAGA 4CMCA 5JNLA 2J3KA 2ILTA 5B1YA 5DBGA 1K2WA 4XQEA 3NX4A 1BHSA 5L7TA 4JBIA 5BQFA 2BFOA 4IMPA 1PTJA 3GNQA 1YO6A 3KYCB 3GN2A 1EBUA 3ROMA 4R68A 2E82A 5CEJA 5U1PA 3SBOA 1LI4A 3B70A 5DBIA 4AJKA 3RC9A 1DJNA 4I9NA 3QWBA 2AXQA 2NUAA 3A14A 2D4AA 4YDRA 1R4MA 3DBRB 1Y8RA 3JQ7B 4I9HA 2BLLA 1A4IA 1AN9A 3P5SA 3W8FA 1DIHA 6ADHA 3NJ8A 3PPIA 4O6VA 2DPHA 4AJOA 4JX8A 2RH8A 4B8WA 3UICA 1PJSA 1C0IA 1UZMA 3DOOA 4FFNA 4NZ9A 2EJWA 4FPXA 3LZ6A 1YB4A 4H15A 4PRKA 1QLHA 4OKNA 4FD3A 1EDZA 4WKGA 3RUCA 3SX2A 1KVQA 3D1LA 1MC5A 4XYMA 2HCTA 3HDJA 4YJHB 1HDRA 2GUGA 1KEWA 1F06A 2CDBA 3MJVA 3ENNA 3B20A 4EBFA 1EVYA 3IOYA 5TLSA 1NBOA 4C7JA 4XJTA 1HKUA 4RL6A 1LDBA 4E3ZA 1WAMA 3DTTA 5ITVA 2RCYA 4ZGWA 3ITDA 3GMSA 3VH1A 3K2BA 2Z1NA 3DAFA 4BO4A 4A0SA 4UVDA 3RD5A 2Y1DA 4NPCA 1SC6A 5KJ1A 1W6UA 4PRLA 3JQ9A 2P2SA 4M49A 4B4VA 1JWAB 3JQGA 1YQGA 4JROA 5I8WA 3T7EA 3E8XA 1I2BA 2EF1A 3ENKA 4QO8A 3EMKA 4CQMD 4XIYA 1C3VA 3QQPA 4R5HA 2ZTUA 1GL3A 1KEVA 2FMUA 5JO0A 1P31A 3KB6A 3GVPA 5KKCA 4R9SA 3JQFA 2PTGA 5IXSA 2Y05A 4L76A 1JKIA 1PEDA 3L77A 4ZD6A 3ULKA 2I67A 1E5QA 1PS8A 3WNVA 1EFLA 1Q2XA 3QVSA 4DTIA 1IULA 2LDXA 2YFQA 1J4AA 3AFMA 5F1KA 1YOVA 3PIIA 4CM4B 3N74A 3UUWA 4JK3A 3UOGA 3KSDO 5COAA 4YR9A 4D44A 1P44A 3RWBA 1GCUA 2PGLA 3G49A 3PGXA 1WDLA 4DQVA 2FR0A 4RLHA 1KETA 2ZKLA 4CR6A 3WYBA 5CEEA 4ZQEA 3FBGA 2EXXA 3NGLA 2E48A 4WASA 3U0BA 3AU9A 3GDGA 3QP9A 4D41A 2JKVA 4HY3A 2VHZA 4CLRB 2DFDA 2FR1A 1XGKA 1K3TA 2AEJA 2NTNA 2YUTA 1DIGA 4KWIA 1UUFA 4TKLA 3I9JA 3CE6A 1PJQA 2G17A 3V8BA 3L6OO 2BMAA 2V6GA 2X1HA 4WLFA 3ZU5A 2DVMA 1GU7A 1F14A 1ISHA 1MG5A 3AI1A 3IUPA 4N5MA 5KKAA 2NADA 2Q1UA 3DHEA 2OUIA 4LCJA 3O26A 4BL5A 2IZZA 2B4TO 4R1TA 4R3WA 1E7MA 2X22A 3QWAA 1ZKMA 1KYQA 4CL8A 4OJNA 5JC1A 1P1JA 3GPIA 1NFFA 4UULA 4PG7A 3WGOA 1A71A 4ITUA 1PGOA 4XDZA 4CQMA 4RPGA 1WWKA 2P91A 1ENOA 5JBIA 4DREA 4FS3A 5TJHA 2CZCA 1DIAA 3I9NA 4XGIA 2B4QA 2Y68A 2OOSA 5EQDA 3JQGB 2GERA 3VKVA 3VPSA 4XJSA 3WLEA 2YFHA 4BNWA 3AY6A 2DAPA 4OO3A 7MDHA 1E6WA 2PKQO 1BRMA 2F00A 1DIBA 3PRJA 3ANLA 5TJ9A 4A5OA 3QWFA 1UXJA 4JBHA 3WGHA 4W4TA 3I9KA 1N2SA 2WE7A 4H16A 3ZDFA 4PN3A 5F1OA 3ROKA 3QRWA 3WB9A 5EPOA 4Z0PA 4BB6A 3B1KA 4E2XA 4ALIA 4BNFA 2Y1GA 3HN2A 3PFFA 4BO2A 3FBTA 2NVUB 3M2TA 4J16A 1E0DA 3RAJA 2C82A 2OFPA 3GZNB 4N54A 4R51A 4YCAA 5L51A 4WPGA 3VDQA 4A2CA 4D79A 3Q9NA 1CF2O 1CDOA 5CG1A 3QW2A 5ILOA 1ZH8A 4OIMA 5L7WA 2W2KB 1BXKA 1GZ6A 1P74A 5KVCA 1PSDA 2NQ8A 1XG5A 2H9IA 3H4VA 4E0BA 4ZQFA 3S2EA 3F5QA 1ZNQO 1AUPA 4AJ4A 1X1TA 1YL6A 2VNAA 3Q11A 3FNGA 1ZXLA 3UVEA 5JYEA 5K6AC 4LMRA 4OL9A 2V6FA 2TMDA 3TZKA 3Q9UA 4JGBA 1QYDA 3ETDA 1IZ9A 2BHLA 1PJ3A 4J3FA 4NNJA 4BB5A 2G5CA 2HMSA 5GY7A 4RPLA 5KJFA 4D46A 4J0EA 2I65A 1OFGA 3D3WB 1OC4A 1HDYA 3WX0A 3FR8A 3RFXA 4II3A 5TF4A 2ZIZA 3O8QA 3CTMA 3NTQA 1I33A 2O2YA 1WLYA 3DMYA 4GX2A 3K31A 2J3JA 3GGOA 4YWJA 4HFMA 1T1SA 1FMCA 4BS9A 1Y8QA 2D5CA 1EE2A 4RVFA 2PH5A 2AA3A 5FEUA 1M76A 1XLTA 2YHIB 1IE3A 2H1SA 1BXGA 2GN6A 4EGFA 2Q4BA 1E3LA 3JYLA 2X0RA 2NV6A 1L7DA 1X0VA 2QYSA 1FDSA 2R2GA 1DFHA 4OHUA 3PHHA 4I9UA 3V1YA 3K73O 3G3EA 4Q3NA 1YWGO 1ZSNA 1GQYA 4DC0A 5C7LO 1HYGA 3L9WA 3OIFA 4FGWA 2FOIA 3E9QA 3HFGA 4XZ3A 4Q9NA 3WFIA 4FFRA 5BSGA 2IZ0A 2EHDA 4DMLA 3OJFA 4ZA2A 4GVLA 3HDQA 4K6CA 4A03A 4CMBA 1VE9A 4YXFA 1E1MA 1TB4A 2I66A 1QV6A 2EW2A 1MA0A 1YS4A 1BDBA 3VHRA 2X9NA 4B4OA 1OC2A 5COBA 2CVOA 3G17A 4FJ2A 2LDBA 2WJPA 5G4KB 3U4DA 1MFZA 3RUFA 1A7AA 2QZ9A 4NJMA 1GQQA 1GFSA 4CV3A 5T67A 3K92A 3N58A 1LRLA 1M6HA 1GCOA 3VDRA 5KNLA 1VM6A 3NJ4A 5KVQA 3TOXA 3VPGA 4QSMA 2V6MA 4B4UA 2NWQA 4EITA 5I9LA 1T24A 2BGMA 1FDWA 1GV1A 2C2YA 1BMDA 5CPBA 4MVJG 5G4LA 4I5EA 4IIUA 4WOKA 3QVTA 1DC3A 2PD4A 1KVUA 3T7CA 3WYCA 4BO8A 4D3DA 4HFNA 1EK6A 4BHTA 3I1JA 4A10A 3WFJA 4TSKA 1U5AA 1Y8RB 3JQ7A 2WD7A 4PZEA 2CMDA 3G79A 3H5AA 2OBYA 3BTVA 4J91A 2Z95A 3KTDA 1HYHA 2GDZA 2Q1SA 4DXHA 4LISA 3L07A 3S8MA 3NTRA 1RM5A 2IXAA 2JHFA 1ZK0A 1EE9A 3OJEA 2O3SA 3I9OA 1PR3A 1UP6A 3EAGA 2Y99A 2C0CA 4J7XA 1ZFNA 3DAPA 2C20A 4MP3A 3F1KA 3U3XA 1R0LA 4K1LA 4GX1A 3DMTC 1V3TA 4E12A 4E2ZA 3ANMA 5HTOA 5T8KC 1Z82A 3GZ4A 1SMKA 4B3JA 3L6EA 1EUCA 1M2WA 1BVUA 5A9SB 1Y7TA 4O5OA 1L7EA 2Q1TA 3V2GA 1SZJG 3AM3A 4GKVA 1JU9A 2VYND 1PGNA 4WLVA 3WMWA 1JAXA 3FRJA 5EIOA 4WUVA 2GZ2A 1QV7A 4OQZA 4RQUA 4RO0A 4BOYA 1BSVA 1W0CA 4EUHA 2W98A 5DT9A 4B3IA 3FN4A 4DLLA 4NHEA 5TIIA 4JN6B 4YT5A 2ZJ1A 2D0IA 3R3JA 3H3FA 2VT2A 3BMCA 1IUKA 4LSWA 3R0IA 4W9NA 3W4IA 5K9ZA 1RM4A 5KJEA 3WNQA 3PK0A 4YAKA 1ONPA 3DZIA 5I9MA 1Z6ZA 4RV9A 4E5NA 1T2FA 3BXXA 2PNFA 3WYEA 4GBJA 2YV3A 4CV2A 2CF6A 5C7IO 1YB1A 1DHRA 1EFKA 2GPTA 1H5QA 1CRWG 3PIDA 5T8KA 2R00C 1R6DA 1Z7BA 4MJLA 3WIDA 3RKUA 4UUPA 3BMCB 4CM5A 1KEUA 1SCUA 1HETA 4Z9FA 2ZK7A 4BMVA 4TRJA 3S2FA 3ZWXA 2XXJA 4D43A 2B4RO 8ADHA 5G0UA 2Q46A 4CM8B 3GLQA 4DIFA 3QWHA 3AOEC 3EW7A 3WJAA 2PD6A 1MGOA 2PZLA 2AG8A 1E5LA 1PQPA 3RROA 3RUHA 1B26A 1I3LA 2WD7B 4WECA 1GADO 3E82A 5ADHA 1QORA 3D3EA 2OL4A 3F4LA 3RASA 3WGTA 2B35A 4XCVA 4R9RA 4XGKA 3MOIA 4AJHA 4CQLA 1JDJA 2JAHA 2FN7A 4NMHA 3W4KA 1RJWA 3ZV4A 3VC7A 1PL8A 1XKQA 2B0JA 3I9MA 1BG6A 1KVTA 3BHIA 2XAAA 1Y5RA 2AE2A 3K2EA 4WCFB 1R66A 5JCJA 3WSVA 4CM8A 4FOOA 4E5MA 5THKA 3CH6A 1ZK3A 2DBVO 1U8XX 5CEFA 2HQ1A 2ZB3A 4NU6A 4XRRA 4YBZA 3KYBA 1YKFA 3HE3A 4WLUA 1SB8A 2WDZA 3OMLA 4FN4A 2JAPA 4GL4A 3UFXA 5TS3A 3NDJA 1R0KA 3RSHA 3MCVA 4ZQGA 4HNHA 3FR7A 2X7HA 4PG5A 1M6WA 1GQ2A 4BKRA 1ENZA 2HK9A 4YAEA 3CUKA 4FBGA 3G1UA 3TQHA 1KC3A 1YDWA 2ZATA 3S1LA 4BNVA 2Y0DA 3CXRA 4EDFA 4D3SA 2HAEA 3D4PA 4ROSA 4RVUA 1O89A 1T4BA 1YQXA 4JQCA 2DBZA 4AG3A 2J5KA 2VOJA 4BNIA 1PGJA 3LF2A 2EJVA 2VWPA 1FXSA 2PZJA 5IN5A 1V35A 3PQEA 4XGNA 1DOHA 1MFPA 3MJSA 3HDYA 1HT0A 3GAFA 3IQDB 4Q39A 3SVTA 4GSLA 1EQUA 5T64A 1EZ4A 2DBQA 3OH8A 4BO7A 3ZWBA 4BKOA 5MDHA 1LNQA 1AE1A 2A94A 4URFA 1JKFA 5A9RA 3FTNA 1A9YA 3L0DA 3PZRA 3JD3A 3AK4A 5TC4A 4ALLA 1NR1A 3ROQA 5IDXA 4IQ8A 4BO1A 3GF4A 2NTJA 3CZMA 3ADPA 3PLNA 3WQRA 1KVRA 1YE3A 2NU9A 3I4CA 2DUWA 1Q0QA 3PJGA 4PLYA 2D5AA 5JDIA 4BGIA 2QW8A 1I30A 3AU8A 3RU9A 1AGNA 1N9GB 4TRRA 3OECA 1UJMA 4KQXA 4LK3A 1U7HA 5G0SA 1N7HA 1DLIA 3BMQB 3OSUA 1ULSA 3PLRA 3AM4A 5J23A 4JBGA 2QRJA 1ML3A 2QIOA 2GZ3A 1I8TA 2G82A 2G76A 1LEHA 5EERA 4OXNA 2OBNA 4BKUA 3RBVA 1Y6JA 2PKQP 4EYEA 4HWKA 3NT5A 5KJCA 3QVOA 1LDEA 3SXPA 1HE2A 3QSGA 4CLXA 5AXAA 4Y6RA 5BT9A 2YDYA 3DZJA 1ZXBA 1XCBA 4W6ZA 5L40A 2Y0EA 4GGOA 1K5HA 1M67A 4N7RA 3PYMA 4OAQA 2YY7A 4I1IA 1I10A 4TVBA 1O0SA 3OQ1A 3JQAD 4R1NA 4PLHA 2ET6A 5K0ZA 3CZRA 3GDOA 4IDDA 2B37A 4JP2A 2Q45A 3U4IA 1RWBA 3RFVA 3E03A 1PS9A 4HADA 4IXTA 5AYVA 3LF1A 3WDSA 1DXYA 4ND5A 2C5EA 3ZU4A 2CD9A 4Z0HO 3DO5A 1JVSA 4XA8A 1N7GA 4PLCA 3RC1A 4EZBA 2UUPA 5JY1A 2UYYA 1NXQA 4XIJA 3OFSA 6LDHA 2Q3EA 3BA1A 3JQ8A 3HFSA 3LT1A 3B1JA 3H9GA 4ILKA 1JTVA 1E3IA 2AQHA 1ZUD1 4M86A 4U5QA 1DC4A 1XELA 2X0NA 3ZWNA 1P1RA 1E6UA 1KC1A 4U6QA 1BW9A 1HTBA 4AJJA 1QXSA 1NPTO 4JLWA 2P68A 1I3NA 3OICA 4ZJUA 5TX7A 3KUXA 3AW9A 5L3ZA 5G2OA 1Y81A 1SOVA 4UVHA 3DAGA 1PL6A 3GC6A 3HHPA 3JQBA 2WM3A 2P9GA 3E18A 3GA0A 3R3SA 4J9UE 3P7MA 5TSDA 3VKUA 1ISFA 2R6JA 4MKRA 1U2DA 4QTZA 3RUAA 4DL9A 1I36A 4H3VA 5LDGA 4PLTA 4Y9DA 3SC6A 4R41A 2VWGA 1X15A 3DFUA 4RLSA 1C1XB 4BNNA 2TMGA 2FY8A 2B5VA 2J3IA 1E7RA 2O3QA 1A72A 1K89A 4WK6A 3DMTA 4IZHA 4FFOA 3Q2KA 1U8FO 4EUEA 4U6SA 1NVMB 1M75A 4KZPA 2JD1A 4YRAA 3COSA 2R00A 2AQIA 4G5HA 5A02A 1K6XA 1PZFA 3CSDA 4FIZA 3OQ6A 1YQDA 3DBVO 1LXCA 1GZ3A 1LSJA 2J6IA 1JVBA 2POQX 4R5MA 1GPJA 2OO5A 4DA9A 3QA9A 2OHXA 3QLJA 3W8DA 4CMEA 4CV1A 1NFRA 4OXYA 5JCJD 3KV3O 5IZ4A 3C8MA 3ZV3A 1PL7A 1Q0LA 3KEQA 3ZCXA 4XDYA 4Y98A 2GASA 5G0VA 4WOJA 5A04A 4K6FA 3C1AA 1HSOA 4MKZA 5COQA 3A1NA 3BAZA 3KSUA 3MJEA 3PWZA 3PQDA 1ZEJA 1VC2A 3LU1A 2I6TA 3F1LA 2HUNA 1B3RA 5ITWA 4MOWA 5KJ6A 2Y1EA 5CFZA 4BGUA 1OMOA 3ZV6A 4AJNA 2GR9A 3X2EA 3ABIA 3GGGA 2AE1A 5IG2A 2JCYA 5BSFA 4NK5A 4KUEA 2HMVA 1LU9A 1O95A 4NH4A 4XR4A 1E3EA 2Y1CA 3GNSA 3JQCA 1SOWA 3EVTA 1DSSG 1GUYA 2PV7A 3OHSX 2HK7A 4E5PA 4RZHA 3ZWVA 4J1NA 3L4SO 4FJ1A 4RPJA 3ZNOA 3TPCA 2EG9A 4YJHA 5TT0A 1XWFA
chains in the Genus database with same CATH superfamily
2HPHA 2N9UA 4ZC1A 1JZQA 4I50B 3NHAA 1F6DA 3WKEA 3DP7A 3SZOA 1TDJA 5KQGA 2AG5A 1ECLA 4I0WB 1QZZA 3VU0A 3CW8X 3K53A 3OO1A 1XJQA 3TNDA 4IKEA 2IUFA 2GWHA 3OQIA 1IDN1 3EGXA 3MINA 4OGKA 1O58A 4JFAA 3DEJA 1X70A 2CL0X 4TQGA 5AHRA 2FSVA 4ZV7A 2W2KA 4RWZA 4LOIA 1QQAA 1WP4A 1B8UA 2AOTB 3FCSB 4OK5A 4P3OA 5AIAA 4K28A 2HW8A 4DYHA 4W1QA 5L3SB 3PVCA 5LZ2A 3OSZA 3E70C 3GRKA 4B17A 2ZT5A 4HN2A 3OAAA 1FFCA 5CGQB 4BLPA 2EC5A 5A4JA 3AKEA 4NJOA 5JIBA 2C5GA 2RFLA 2BTQB 1KQFA 1KOJA 3E9RA 1RZ3A 4JENA 1PG0A 1Z2CA 2H3HA 2GAJA 3DAOA 4FCVA 5A2QA 1L1FA 4C2BA 1Z25A 5C8ZA 2D3TA 3LDGA 2BEUA 3G23A 3KWFA 2O7NA 3T8YA 2PUAA 3ONWA 4M0DA 1ONNA 1EGQA 3EPPA 3F67A 5DCYA 4YPOA 5G53C 3HGMA 4KHZA 2CVZA 3P2OA 2C4NA 5HE8A 1UMKA 4OQ4A 2QGNA 3TX6A 2AXEA 2VWHA 3D6UA 3UANA 3QV1A 1JBEA 1BD3A 3AT1A 3Q1LA 4KQ1A 1LNZA 3A1DA 1OFVA 4H7PA 1F8UA 2ODQA 2OYSA 2ZVPX 1C3LA 1CETA 1LX7A 3E8SA 3OQJA 4UHJA 5IH3A 3WAKA 3EBOA 3NWEA 4KN9S 2EGGA 2IV3A 1NW7A 1EVLA 4ATNA 4BP9A 4RZIA 4CODB 1F0PA 1HE8B 4PSCA 2FZ4A 5D3KA 3EGXB 3ZPXA 1V1MA 2OFWA 1D6JA 4EGJA 2VP0A 3F5MA 5KTMA 4WZBB 3LYAA 3TRDA 3RYIA 4GEGA 3TJZA 5FD8A 1FJ2A 1CYDA 1ZD9A 1ZMOA 2LD4A 4GZ3A 4KI7A 2AD5A 3VHXA 5KC8A 2FPLA 2IH4A 3QNUA 1Y37A 3EGOA 3NYRA 5CA1F 5HCIA 2D2FA 3NPAA 3W04A 4GVXA 1N2OA 4FYWA 2NU6A 5AVVA 5HQTA 4BNYA 1AZLA 1NI4A 3IQZA 2EATA 2M6SA 1DTWA 1KFBB 4CMEC 1VPVA 4QOEA 4R2KA 1G8FA 4A0GA 5CP8A 5HF5A 5WRFA 3N2KB 3AUAA 3UTDA 3N3BC 3Q9SA 2HMUA 5KHAA 4F9FA 2QMUA 4HAVA 4HV4A 3OURA 2I9KA 1IRXA 4TUYF 1GGFA 1ODLA 2J30A 3OC6A 1RPNA 4O5AA 4BRSA 1NWCA 1BOOA 2GK7A 1KYTA 2QGZA 1DZ3A 4CN9A 2ZR8A 4FZJA 3GUYA 2E3JA 3MGBA 6Q21A 5FBHA 5DDIP 1CC1S 4OQLA 1JEAA 3RVBA 2WV7A 2GBIA 1FFDA 3TRIA 4YJ2F 4CHGA 2QUJA 1TK9A 1TKAA 5FV4A 1THMA 1BEZA 2GO7A 2YV5A 2FWPA 3ORQA 2HWXA 1UDRA 2ATEA 3RIHA 4NYIR 3PTZA 1KAGA 2EVWX 1FF9A 1P2GA 1BHJA 3AHGA 1EFHA 4RK5A 1OWNA 1TIPA 1CEEA 2H4ZA 2ZU6A 3ZWYA 4EA6A 4YIKA 3MWDA 4GAEA 1B00A 4AJ2A 1E3DA 1L8LA 1Q22A 2J9XB 3S2IA 2PPLA 1T29A 3Q3JB 3AUKA 4C88A 2MIIA 3VHQA 3RS8A 2D13A 4AKGA 4JB0A 3AL0C 1QP0A 3NHLA 2EJCA 5KBYA 1ZUNA 3B3JA 2HRBA 3B3AA 1PTJC 1ST3A 1VHWA 4RNDB 3T54A 1DUIA 1BZYA 4DZTA 2BUCA 5AR1A 1UBHS 2BCEA 3K1YA 3LP8A 4UW9A 3FFWA 3PQ2A 3OD5A 1W76A 2QVBA 5L45A 1ZLXA 1KIAA 3SHQA 2IHZA 4ZO4A 5TMDA 4JUIA 4YRJA 2PBLA 2WWWA 2QTNA 1HYEA 4KR0A 2RHWA 3UJDA 5CT8A 1NJSA 3ADKA 2G07A 3L06A 2QVGA 4UC0A 5TY0A 4P4LA 3KO8A 1JN0A 1FZQA 2I80A 3SIWA 3VBEA 4ANFA 4K7JA 5BPFA 4P81A 3L1JA 1OBHA 4MGYR 4NBKA 4ALKA 2J5XA 2P5UA 3BD9A 4U5XA 4AXXA 1QRDA 1RU3A 4G07A 2JC3A 5KO2A 1EK2A 1C9EA 3ICCA 3K20A 2UZ1A 4TTQA 3UWMA 2GCOB 1K6MA 3FNQA 1NASA 1DQSA 4QYTA 1XR3A 5BW8A 3OLYA 2OO3A 3SC4A 2IYAA 4K9KA 4E5KA 4LY3A 4N40A 5KYUA 2F2TA 1NVBA 1FXUA 2XNDA 1VRWA 4AD8A 4C43A 3OZDA 2KX7A 3OZEA 2LPMA 5LP6F 3C97A 2BFCA 4GGPA 1ZIDA 5L4LA 1DV1A 1ISSA 1H65A 3L1KA 2PANA 1VL1A 2DUUA 4F45A 1F2UB 4ZYVA 4JYPA 5CDUA 2ADFA 1A2KC 4B6FA 5ICSA 5E7JA 1AF7A 4Z1OA 1D2NA 1KBOA 1RXVA 4Z7NB 1A8HA 1N2ZA 2D1YA 2H8KA 2HB6A 2WJIA 5EP4A 4YB8A 4YQYA 1QGOA 3LTNC 4PLWA 4C08A 4ZTBA 1UXGA 3HHEA 2VCYA 3EZ9A 3DVQX 4X1YA 5EMKA 2O2HA 3EVNA 3QBVA 5ARDA 3R9KA 2XOKA 4NG5A 4N76A 2F1RA 2HF7A 2C42A 3BH0A 4E32A 1KE1A 1GTL1 3VOAA 1ZO8A 1KNXA 3VNQA 4Q34A 2DU8A 2JGLA 3OEHD 4HZUB 3E9MA 4E1VA 2E4AA 1TEZA 3T15A 3MQ2A 1I2ZA 1UBNA 3K5HA 4MKXA 2Q28A 5KWVA 1K27A 4DMMA 2F62A 4RD1A 2EV9A 4YJ3A 3F9IA 3EHDA 2IF0A 4M88A 1FK8A 1FUUA 1QP8A 4O2RA 3CBQA 3Q3EA 3IUMA 2GYYA 1HDGO 4J7AA 3EN0A 4JLJA 4QZVA 5CDGA 2O2ZA 4PPQA 4XGRA 1TUIA 1I32A 3MTQA 4R3NA 3LUDA 2ZYGA 1I01A 1ZUWA 1AMNA 1IUPA 1G9SA 2W22A 5ESRA 5AW2A 2IHBA 1J49A 2XT0A 2MT9A 1DQYA 4M55A 3ZS9A 5MGNA 3OO0A 2BFBA 4LYFA 1U28A 3VSEA 2BBWA 4QBKA 1U8EA 4MMXB 4HRYA 4LOHA 1G98A 5HBRA 3KYDB 3RC2A 4CM6A 4PGAA 3ZUGA 2DX7A 3ELDA 2QN2A 2VAMA 1T0HB 1GTMA 4A7PA 2PSJA 4YAWA 4P80A 5B64A 1YB5A 4Y18A 3ELUA 2PMBA 3WADA 5CLFA 1OFIA 1RD4A 1HDOA 3MQFA 4JQSA 4AK9A 5KOIA 2OAGA 2I76A 5EZYB 2W2QA 5IAOA 3V42A 3I42A 4KUGA 4TQ9A 3TKYA 3VJKA 5M29A 1W36D 4TM7A 3EEFA 2ZSIA 1NQWA 1P1FA 3NASA 1BS1A 2HH9A 4QXRA 2AMFA 5JNSA 2CNDA 2WJ3A 1JSXA 4MQ5A 3SIRA 3UJ9A 4JELA 2QD2A 1X3SA 3UXEA 5DHRA 3IV9A 1HDIA 1QVWA 1VG8A 4BNKA 2O5VA 4RVOA 5AUNB 1GUAA 1K9VF 1TM1E 2GT1A 2HK8A 1HNXB 1JZTA 1C0LA 2PQ2A 2AJBA 2XVXA 3ABRB 5E1MA 1VHDA 3PNYA 4Q4HA 5C1DA 3NXKA 5LLDA 1NMZA 3VOSA 4L75A 4RMHA 2JJ1A 3HSYA 1E4EB 4LDZA 2IH2A 1V7PC 2CLIB 3RJ5A 2EX1A 5EZQA 1ZVVA 1N5DA 1NF3A 5ALEA 2Z5VA 2C7OA 1Q57A 2FMTA 2V96A 4LFCB 2JIOA 4HI0E 5EQFA 3V2HA 2IYUA 1W6RA 3VZRA 2NP7A 4MWBA 4IMRA 2NGRA 2IYWA 3DF7A 3WJ1A 3IBFA 4I4TF 5BV8A 2X4IA 2XODA 4Z7JA 1Q3TA 3OTQA 1DGQA 4Y2XA 5JWOA 3I83A 2HMTA 4HGOA 2RGWA 1FDTA 3ZHYA 2JIDA 3AF1A 1OU0A 1PQUA 3L0YA 2RBKA 4UD6A 2AOUA 4AMUA 1A9XB 5IARA 5FJJA 2PMCA 1HQDA 3AR9A 3ZLBA 3P94A 2Q2VA 3PYLA 3QUTA 5EMHA 4EAAA 5J43A 1XMOB 5I7WA 4GXNA 4KXWA 1RQNA 1JLSA 3ZZUA 4TLCA 4BIIA 1G8JA 3PYXA 4U8HA 3SEAA 3K0HA 3ZK9A 4JLPA 1G3UA 2J09A 2ZQZA 2F59A 1IN8A 3FCEA 1QFYA 4J2HA 3AWIA 2TRSB 3DT9A 1YA4A 4YBRA 4FHCA 4CEHB 3IQIX 1WKBA 5HF9A 2JJ8A 3AETB 2NSDA 4H60A 4KG7A 2YJ5A 1SXJE 1P3JA 3H65A 4N3AA 3FPGA 3FUXA 1YVRA 3H2ZA 4HLDA 4MDHA 1GA4A 4XWYA 3T5BA 4RENA 3QVJA 1CZKA 1UDAA 1MX5A 3DUFA 4LDRA 4UU1A 3ONVA 5ILGA 5G0TA 4A0FA 1JDBC 1KZ9A 5KTTA 3HVIA 1Y4SA 2XUJA 4EO4A 1R5JA 3LCRA 4OAPA 3NHBA 2FDXA 1ZOSA 4TM8A 5CUQA 2FPPA 3U9TA 1NURA 4WLNA 3EZXA 2QE7D 4CL3A 4X20B 2H1HA 2FPGA 1CXZA 3EXEA 3QLEA 4KEAA 5D7NA 2OV8A 5K0FA 1J99A 5JAPA 4N7JA 1EGAA 1IN6A 1PWHA 2DKOA 4DV0B 2QD5A 3BC1A 3IMGA 3QPAA 5K3FB 3HBJA 2BELA 3AY7A 1OB5A 1KK1A 3C3XA 4UD2A 3K4HA 2IYTA 2X19A 3NCTA 3PFCA 4HLQB 3JRWA 4B47A 5KCMA 1YUBA 4DLVA 2JCVA 3EASA 4OH1A 2R6DA 3JYOA 5KNDH 4L5JA 4AZTA 3JQ6A 1N6LA 2F43B 2Q3HA 2ZVDA 3KU4A 4GSKA 1J1UA 4JQYA 5E6SA 3CF6R 1J0EA 2NO6A 3BN3A 5DHUA 4G2NA 1XPOA 3ZDBA 2IYLD 5H4GA 3T41A 5JYDA 3HI6A 2KHZA 1NNI1 5BWBA 4BLVA 3F2IA 4X0EA 5CVDA 2X76A 4ZO9A 3MRTA 1D03A 2GBLC 4FMDF 2H1WA 5BW6B 4CMHA 3DLCA 4N4AA 2EBFX 1IPHA 1VLJA 3OY2A 3RIYA 2PZ8A 1NE7A 1H93A 2CHVA 1QYVA 1FBNA 1KO5A 4C0WA 3LQKA 5A9SA 1QPGA 1YJCA 4OHRA 2B20A 4AX8A 1FRFS 2QDKA 4MROA 4R69A 5JO9A 1NDHA 4EHFA 4TMYA 5DCLA 2Q6KA 5EKSA 1JDBB 1Q50A 1JFSA 2QN8A 1CUWA 3GFBA 4ZCLA 5EUCA 1G3QA 3H7AA 3ONDA 3TQFA 3GAAA 4RK6A 3OZSA 5LPNA 1I0IA 4LSGA 1K8YB 2ECFA 3EC1A 3PNKA 3GO4A 5T6BA 2BJWA 1D1PA 1XZAA 4Q1FA 3T0GA 2W6OA 2XMZA 1ONOA 1NTOA 3GDFA 2CV1A 3KQVA 1XCOA 5LKRA 3LIPA 1ATIA 4DJ5X 4MPTA 1D8TA 2XCRB 1F3LA 3EFEA 1R6TA 1UCFA 2OWDA 4QWMA 1E59A 2ZB8A 1VBKA 1AKYA 5F2OA 3RO7A 2QLLA 2YVQA 4UASA 3E48A 1HOTA 4ZAZA 2R1VB 1MB9A 5SY6A 2QM3A 3TXYA 3LAWA 2IIPA 4QHYA 4LE2A 1NY5A 2J32A 3R75A 4O1MA 4DW8A 5IFKA 1RYHA 3NUGA 4L0CA 3VR3A 5I6DA 1C0KA 1U6KA 3GMIA 4FWIB 3UAZA 2VSXA 4DIOA 3G9ZA 1XCPA 3F3MA 1II0A 1PW7A 2PH3A 3ONEA 1D6MA 4YRBA 1EUQA 4P7JA 4OKIA 1P5JA 2G80A 3M4NA 5KTSA 5BNZA 1R0WA 1W2WB 4TS1A 1UK7A 4C05A 3EFBA 1FRVA 2Y8EA 3OZFA 5D5HA 4BNTA 4D8WA 3FOFC 4L5BA 4RMGA 3VO9A 3S27A 1I5EA 2VP5A 1TO6A 2YBDA 1OZFA 3MMZA 5JAOA 5LC1A 3UO8B 4FB5A 1Z73A 5B4TA 3HU2A 2VDUE 2WM9B 5I8ZA 2FWBA 1XRSB 1QZXA 3ZWKA 2YN4A 1JWLA 3HRKA 2OHHA 4WJZA 3ENVA 4FI3F 1OXVA 4MCAA 2NT3A 3LC0A 2B4KA 2IHKA 1LX6A 3FFTA 2AWNA 2IZOA 1QQ7A 2EW8A 1C7ZA 3CEJA 1A9XA 3SVZA 1E3SA 1Q0SA 4EPXA 1FZTA 2L17A 3TD6A 5LA6B 4BLSA 3Q98A 5HUHA 5TPZA 2Z58A 3OG9A 2YHUA 3E1GA 4CQLB 3ZYZA 1NBIA 1P3DA 3UF0A 4LHYA 4RLFA 5DU2A 2V6BA 4OI0A 2PZGA 4BAGA 4RACA 2EKPA 3WRYA 2J0QA 3UUFA 2NNLD 4QT0A 4KIUA 3RBXA 1XWWA 2V7QD 2W58A 4UUNA 4UTVA 1LSUA 2A7QA 3ZD9A 2OOKA 2HDOA 1H5UA 3V1MA 1WP9A 1FP7A 2IUUA 4NYMR 2FPMA 1FEZA 3GJZA 1SQFA 2NM0A 3ZH2A 1AQNA 4AY6A 1II9A 3W1VA 4JB2A 2IS1A 4H1TA 4IIJA 1XHEA 3SMQA 3SZUA 2BV3A 4U7WA 1PE0A 4N3CA 3C5VA 1HZZA 2NVUA 3IVGA 1AZWA 1NRWA 2C03A 3A6EA 2RHGB 1N8TA 4NF2A 3C87A 4ZKDA 4CMAA 1J2JA 4MPPA 1QRRA 3WBBA 1JPJA 3EVBA 3LX8A 4C7MA 5C5DA 3EIHA 5F1PA 4Y6OA 1YZTA 4G63A 5CM8B 5F33A 3VYRB 3ZQ6A 3QBTA 4M0EA 2J9FA 1LQ2A 1XTRA 4ETWA 4YMTA 4HDQB 3HCNA 4KWHA 2G7ZA 2VP6A 3IDFA 2CY0A 4MQEA 4BDSA 2EEPA 1FFSA 1X42A 3LT4A 2PX5A 5DM0A 3MT0A 3MUOA 1QJCA 1LI7A 4CR8A 3CF4A 4KKVA 4MI9A 5I4KA 1Q6ZA 2C77A 2D06A 4ZXPA 3RVJA 4IF6A 5T4EA 1FOEB 2ZPAA 3X1DA 2CV2A 3ZNQA 2O4CA 5B4UA 3BWDD 4Z4CA 1MKYA 3HMKA 4M89A 4QNNA 4B3HA 2ZJFA 3WNCA 3FCAA 3G2IA 3PC3A 4UMEA 1TEHA 5JANA 5B36A 5LA6F 1GYRA 1P61B 1ODFA 2BKUA 5JUWA 1D6SA 4JI6B 1SNYA 2OO5C 2SCUA 3ILXA 4RQBA 3ST7A 4EG6A 1C9NA 8ATCA 1I0ZA 2QXUA 2W8BB 5IDVA 1SD1A 4X45A 2OYCA 1NT4A 3OP4A 3WWDA 1TECE 4RADA 2XF8A 2YXEA 4QEDA 2P0AA 4HFRA 4DRYA 2VWQA 2WU0A 5DOZA 1YGYA 3HC7A 2QSZA 2WVHA 2HI0A 5DN9A 1R1DA 1T6BY 2CJWB 3PQ5A 3EEIA 4HWSA 1J90A 5L3QA 1H6CA 1RHJA 3QUAA 3HCWA 1NYQA 3OPMA 4D2IA 6REQA 1B8PA 1WNTA 3BIXA 2IVZA 4R16A 5ALOA 3TN7A 4TLAA 2X8JA 3LX4A 4U8GA 3FWZA 1A7KA 2YQ4A 3SYKA 5GZ1A 2KWIA 2O4UX 1ZN7A 2P35A 1G21A 1TRKA 1N32B 1N8SA 2BBTA 3JVUA 5JD3A 5AW4A 3DVAA 5B12A 1OH6A 3BXFA 1IJEA 2IIVA 3PX3A 4UTXA 4JJGA 3X1YA 1EDOA 4F4HA 2NYVA 2FG5A 3FSRA 3MCWA 3ZXXA 2IA5A 2I54A 4B7AA 5JBQA 3GRUA 3E7WA 5AJWA 1I1OA 2ZAMA 1LBIA 3NHFA 5A6SB 1Z3CA 4K6GA 4K88A 4PINA 4BPBA 3URMA 2D1SA 3L8DA 1ZSVA 1E2UA 2I7DA 4KDFA 2A84A 1YBMA 5TQVA 3VV3A 5KSYA 3P0JA 4C22A 3ZEAA 4BC0A 1QAOA 1KOLA 1XHFA 5JECA 5LQMA 4X54A 3C6KA 3NI2A 4GPEA 4N48A 4BCCA 2D1QA 1E1RD 4HNGA 1KO7A 4P36A 3KPYA 4XOUA 5L6LB 3W8RA 3GVCA 4ER6A 4JI8B 4BU1A 4ZI7B 1KKUA 3HUTA 5K45A 4JASB 3H6GA 1XZKA 1ZP6A 3K9LA 3T3IA 2E4WA 3NUQA 1VJ0A 4J4TA 4ES6A 2WAMA 4JLDA 5FFNA 4DNPA 4I9GA 3A1UA 4LJRA 1Z3IX 2C9DA 3PWTA 3BERA 4YVFA 5AW3A 3WWZA 1SVUA 2Q2NA 2E49A 1YBVA 2DHDA 3K0BA 2I99A 2ZE8A 4QFBA 3IP1A 5ESXA 1RRGA 4MVJH 4KRYA 3WHPA 3ZK8A 4B6EA 2P11A 1GUDA 4U2GA 1AHHA 4NLLA 4UMVA 3QVXA 4KZKA 4C4YA 4BQFA 2R3SA 2GHRA 1HZZC 5AQEA 4ZARA 1C9KA 3EQ8A 1IIRA 1Y4DE 2IOHA 2CNWD 1VDZA 2FTKE 3U3MA 4X7RA 3K35A 4GP9A 1UQUA 4M1SA 1N9ZA 2IL1A 5CDFE 1H3EA 4FYVA 2W83A 1C2YA 3NBKA 1SVNA 3WIVA 4YUYA 5I3ZA 2ZS9A 2C78A 3LDUA 3HWRA 4QM6A 2Q1WA 1T3TA 3CUTA 3EZNA 3PI7A 1WCWA 4L9AA 4W9RA 5ALFA 2DEUA 2JZCA 5BVHA 3I1IA 1P3Y1 1MIOA 1OI2A 4G23A 2P2CA 2B94A 1PZHA 2LE0A 1SY7A 3GROA 3KQTA 5EPEA 5TPZD 1L5LA 2GPWA 4KE9A 4DQXA 3OTOB 1JEYB 2YICA 2OKCA 3WBFA 1GTSA 2ZCVA 1XU4A 1ZBDA 3AH8A 5IM5A 1HEUA 4RPKA 5CM9C 4Z3OA 1QRTA 4L3OA 5BXYA 2ZYRA 2GN4A 2BFFA 3B2EA 4HVTA 4D0NA 4EUKA 1C7IA 1E3WA 1Z16A 5U9CA 3N2NA 1BN6A 5K3EA 3ZDQA 5JQGB 3RABA 3JTMA 1KJ9A 1BW9B 1U6JA 1LW6E 1HNNA 1EBBA 3M9XA 4MW1A 4JITA 4TV8B 3QXHA 3AINA 4FR0A 4AZSA 1E58A 4OHWA 4G4JA 4RELA 1GL9B 3VOTA 4EEXA 3T12A 3C3YA 1QX3A 5AUPB 3WIOA 2BSQA 4NEGA 1OXXK 3N7UA 2IY8A 1KFEB 1WHTB 2FF5A 4RMNA 1GGMA 2P5SA 2HMWA 4XX1A 1KGDA 2KE5A 4PRZA 3SZMA 1VP3A 4TZ6A 3DHVA 2UZAA 3E58A 3ZTTA 1ZR2A 1UDXA 3KZMA 5K1ZA 3RHZA 2ZZKA 3FUCA 1V3VA 3TGPA 1QGAA 4PPYA 1M8FA 1QAQA 1YDMA 4E5UA 1SKMA 1HK7A 2ZTMA 5L8VA 1TCUA 3ELWA 4PF1A 1YFLA 4FWTA 3GLHA 3L7BA 2RH4A 2PU5A 3BSWA 5FTNA 3UWDA 3K2IA 3SY8A 2Q9AA 4XLTA 1ULUA 1OX4A 1SKUA 2HNKA 1UBMS 3N53A 1QQBA 2CD7A 3ILVA 4M87A 4P7KA 1OWMA 1EEXB 1MVLA 1SM4A 4O63O 2W6JA 5L6MB 5KNBA 2O2JA 4LRXA 4FOSA 1UIRA 4QU9A 1E1CA 2FLKA 1FNSA 3CF2A 4POOA 2Y2VA 4CRWB 2WEKA 1IFXA 3CIFA 2GVNA 1I5OA 4GS5A 4HT3B 1M6YA 3ITKA 4DV5B 1EINA 3EZLA 3GIWA 4JLAA 4M1MA 3FMOB 4Z0TA 1H6AA 2JFBA 5I7UA 4I14A 2R0QC 1LLQA 2YC2C 1BDMA 3IV6A 1D4ZA 1N6IA 3SEQA 3ADCA 5JRDS 1TM4E 4BEBA 1GZUA 2C54A 1Z4NA 3BL6A 2F48A 2NUBA 3NTUA 2GJKA 1EFVA 5CT4A 3V7YA 2IH5A 4F3YA 1GTJ1 4JUCA 1BHQ1 1EWRA 2YXBA 3OD1A 5E7MA 3P9CA 5IYZA 3S55A 3G2QA 4WNAB 1JFRA 3S1SA 2MR5A 1C4XA 1W36C 2YZ2A 3W05A 4X8OA 1LDYA 1G21B 1G7TA 3H5RA 2BHRA 1DAKA 2WSBA 4N8DA 2V8BA 2QNBA 2WV9A 3RIXA 5HBGA 4D4JA 4LY0A 2IEYA 4JYAB 1L3CA 2GGSA 5EKDA 5EKUA 4E5SA 4D7AA 1YMQA 2HQOA 3LCCA 3U3KA 3WQBA 2EBHX 3OZRA 2H4YA 3KSRA 2REBA 5C5CA 4XJXA 6REQB 4O4JF 3AHHA 2WA2A 4G1BA 4P8RA 1JB1A 1SQ5A 3PNMA 4LY9A 1YR3A 4U7GA 2BGGA 3FB4A 3AW8A 4EEZA 2IYRA 5F3DA 5HFAA 3WOHA 4YT2A 3ML1A 2Z9DA 4DPLA 2DPGA 1JPNA 4IGEA 4TT3D 1NXVA 3DMNA 4QT4A 5M7EA 1ODJA 3VH2A 1QO9A 2DM6A 2D7CA 5DYYA 4F46A 1Y1RA 2DSNA 5ESDA 1Z5PA 1H4QA 2W0SA 4CV0A 1OGYA 4NBLA 1UR5A 4GMDA 1AXEA 2A58A 4IRXA 4C20A 2AQKA 3CQ9A 1POXA 1NXOA 1UPBA 3DDUA 4TYNA 4HZIA 3NHRA 1I80A 1QF9A 2CDRA 2RGNC 2XDWA 2XVZA 4P84A 5GQSA 3JD2A 2CB9A 1W4RA 4W6QA 1CRQA 3JQ8B 3WKAA 5K3SA 1KK0A 5AM5A 1ZEMA 3BRCA 5TXGA 1JJAA 1ZMBA 5B3JA 1SXJB 2Z4TA 1YZQA 3JRNA 5C7YA 3D64A 2OCPA 2QVZX 4H3SA 3S70A 4CG2A 1WW8A 1U4OA 4ND3A 9MHTA 3FF4A 3KSAC 1E69A 2OEPA 3KNZA 2AVDA 3ZKWB 1G3MA 1T91A 4C2AA 3CRRA 3GLIB 3D3KA 2APJA 2HT1A 4DCGA 2A4KA 4YALA 3KLOA 2PSEA 2EKLA 2BH9A 2JBWA 2A5YB 4YY3B 2PV0A 1GKIA 3V46A 4AMGA 4DQDA 3PXUA 5LNK1 3FAZA 2JARA 1GSHA 4RD4A 1XNQB 1U2RA 1GZ5A 1E2IA 2HRRA 1QG4A 4UXIA 4EJMA 2VDWB 3PQ6A 4Y9TA 5H83A 3W2HA 4IJUA 4HDAA 3DKRA 4LXGA 3TZCA 3EWAA 3L0ZA 4EFMA 2ZB7A 3RHFA 1C1XA 3AXSA 1JG7A 2H7YA 3B36A 4KIGA 4XSGA 5FBQB 3TLKA 1NG9A 1J5XA 3W3ZB 4A23A 1BJRE 4IHJB 4WVLA 1V45E 4JR2A 3H87A 3M5PA 1XQ6A 2D5BA 3A26A 4LYHA 4B6GA 5KUTA 4IGFA 1RYDA 4KXUA 2WDPA 3N07A 4GQBA 1PHRA 1KMMA 3DC7A 4NBWA 1Z0UA 4MQLA 3SQDA 1H1LA 3JZIA 4PC7A 4PQGA 3EBPA 4CHTA 2WE8A 5JNTA 3LDAA 4YJGB 3WYFA 5FLKA 2YZGA 3BMOB 1M5TA 1OYWA 1OBFO 3GRPA 3H6KA 1Z37A 2Z6AA 2P4HX 3JQAA 3JASA 3MWLA 4M6WA 5JJBA 1UBGA 3DXZA 1CE8B 1K7CA 3BHNA 2JJMA 2V4ZA 4M54A 2Z4SA 3PWSA 2PD3A 4GPBA 2GEFA 5J47A 3PXBA 4MUGA 4HR7A 2JI6A 1COWD 2QAGB 4QRIA 4UEWA 5DW3A 4C5CA 4F4JA 5C3UA 4ZT2A 5FUBA 4Y6SA 1PJTA 3KEOA 4LJ4A 4M7PA 1CY0A 1DKLA 3EA5A 1NATA 1RHQA 4NYJR 4UM7A 1H1DA 2WG1A 4TMTA 3NZEA 1T9HA 1WXEA 1YS1X 1HE1C 5AXDA 2F1JA 3RBZA 3EIQA 4HDKB 4CCWA 1GNTA 4L4UA 4D74A 4ZDIA 3H2SA 4M0UA 2GNAA 2GJ8A 1OQAA 5HW0A 4QPZA 2VATA 5IAGA 1Y3IA 1ENYA 2F3TA 1M74A 2Q6OA 1VMDA 2V7BA 4MDYA 2R4QA 4MS3B 4K9PA 4ZYLA 1P19A 4MJXA 3KETA 2UXBB 4UE3S 3VJMA 1E92A 1PQ4A 4IHKA 4ZI7A 3FUVA 1OOEA 2IEIA 3VO8A 5A06A 2PCJA 2L82A 5F9MA 3SS7X 2ZE7A 2QV0A 5HZMA 4B6SA 1N0UA 4R1MA 2HPZA 4EG8A 4C0JA 3IULA 1UKBA 1ZONA 2N3ZA 3FWPA 1Z17A 5HSGA 1WDKA 5B58T 1DELA 4CDRA 5BQOA 4HEA6 4AJEA 3L4BC 2REQB 3I5AA 1TLFA 5JJKA 3MTJA 5JV5A 5LN1A 1TXGA 3GJQA 3T3GA 1ZUHA 4ARAA 3SM9A 5A6SA 4CM3A 3IVAA 2O1WA 3IEVA 3RJZA 3MWYW 1Z2OX 3LL7A 3HP1A 4TZ0A 4DR1B 1ABFA 1RDFA 3GVXA 3DVAB 4S3MA 1WMSA 1P5ZB 2ZJ6A 3JWJA 2OBLA 1KH3A 2EGHA 2VDQB 2PQ6A 3G0HA 1IMJA 2Y93A 1V5IA 4MRNA 5JCZA 1E9EA 4LJAA 1BMTA 1ARZA 2CBGA 3AJRA 2C0QA 3OQVA 2Z8XA 2VNSA 4KTVE 2HQBA 4RM2A 1FPMA 3K9HA 5JADA 5I45A 2XE6A 1V8BA 2YIMA 1SCDA 3QU2A 4RDIA 4CKYA 3W2TA 3B7GA 4DQLA 4ENQA 4WKPA 5E4YA 3U9LA 1T2EA 4UNIA 4Z9YA 3DTVB 1JDVA 4JI1B 5TDHA 1Q0RA 1NJ6A 1JF8A 2QPAA 2XTMA 1V8FA 5DLEA 1LVUA 1VSUA 2X3UA 3MRVA 1P7YA 2W8BA 3WB0A 2O2SA 2W4QA 3ZWCA 1QIDA 2CXRA 1P17A 5BY2A 4NEQA 5BRNA 2VJPA 4HG2A 3QSYA 3HV0A 3IAS6 4X8HA 4BNXA 1X1EA 2HFKA 4NU5A 1I5RA 4QUBA 4IJVA 1OFUA 3GIDA 4JSRA 3FGZA 3C24A 3NM5A 5TQJA 1UXHA 3FB1A 1KMQA 1QH9A 3AEKB 1T2CA 2R8YA 4B82A 3U5ZB 3O31A 2ZWVA 3K09A 3I9LA 5LL6P 1DAGA 4ITRC 2GM5A 3ZUPA 2QZJA 2OYRA 2DQ4A 2GCGA 3F0TA 1XDWA 4FQ7A 3VR0A 4AZ0A 1P1IA 1FFAA 3H04A 2Q07A 3V8NA 3UYLA 3AZPA 3VNRA 5IN4A 1MIOB 1JQ5A 1PT8A 3AP2A 4LJ6A 3OTGA 3ZLTA 3C7CB 4ZTUB 4L28A 3OFNA 4HRAA 4B7XA 1E1RA 2Z2JA 2P9CA 2AX4A 2SNIE 3CKYA 4NBRA 4J7CA 3FGOA 4I6GA 2FSUA 4U2FA 2FEAA 2FPPB 2HGZA 2VXYA 3RRNA 4YRNA 4PGHA 4KMSA 5LWHA 1N3YA 1CSEE 4QJ5A 2ZJAA 4B9AA 3FLAA 1DBVO 2FK7A 1UQTA 2EFCB 4B3GA 4IRUB 4EG1A 1FTWA 3QF7A 4NENB 3WGJA 2EX0A 4FMCB 4GMGA 3DPUA 4FB4A 1TAHA 3RSOA 2EQAA 1PEAA 5F2NA 4K05A 5TVKA 2HKIA 4NS1A 1OT5A 1Z0FA 3DZFA 1KIMA 3QLVC 3F5FA 5AKXA 3Q88A 3H42B 4X63A 3G8AA 3GJYA 3B60A 9ATCA 3DWGA 4MYHA 4RZXA 2I4LA 1H2BA 1NLMA 3H84A 1RZRD 1YV9A 3VRHA 4AN1A 3IB6A 3KLBA 4WINA 2CDNA 3KOXA 2YWRA 2ONJA 4EGAA 1V0JA 2PKCA 4PYJA 1EXDA 4UM5A 2Z8ZA 1A04A 1VZ2A 1BROA 3A06A 2HC9A 3I5MA 3VI3B 4RVHA 3M34A 1D0VA 1BA3A 1DAOA 3LWNA 1GO2A 3E3MA 4JZYA 4RTMA 4JEUA 2UUCB 4BMPB 3QHAA 4R9UC 2NO7A 5THQA 3BSFA 2C7GA 4MWOA 3ELYA 1MPTA 4LXXA 3T35A 3ZCPA 3GVIA 3KEGA 1NN1A 3KFXA 4TV9B 4Z4EA 3SR3A 4ZCIA 1RP1A 4X1IB 4KVZA 2IYYA 2YY6A 3IE1A 4IV5A 3OETA 1CFJA 4JBNA 5AUQA 1SCJA 3QI7A 2DTDA 1LLDA 2VHXA 3PR1A 4F12A 1VYVA 1E64A 4JNCA 3RU7A 1YJQA 3JVEA 2W42A 2HBZA 3PKZA 1C4OA 3B1FA 4RF4A 4H3KB 3ON5A 3QVWA 3CNOA 3WICA 2XNSA 3V9PA 3NGMA 4IOLA 4OHPA 3K6SA 4QECA 5J9FA 4HTAA 3SR4A 1ZCFA 1B42A 1NM5C 5HUQA 1W25A 3JVDA 3A6JA 3ZC3A 4KPUB 1LSSA 4KXNA 1N5JA 2L42A 4ARBA 1HTWA 4IVNA 1NHWA 3STHA 5DNWA 1C7FA 4RHYA 3WGYA 1W0JD 1XPUA 2ZQYA 2EL7A 1T2AA 3DB1A 1Z7YA 4LZZA 4LFBB 2WFZA 1TQHA 3AY3A 2VJCA 3AOGA 2GRAA 4FNGA 5AM4A 3HB1A 1YR1A 3UMGA 4UAUA 1G5QA 4KWTA 3UN1A 4UNRA 2FFHA 1EAMA 5DOVA 1G2QA 4LF8B 1EXMA 4LZOA 3TGLA 3RQIA 5I7FA 1IHDA 2W6MA 4U2KA 3C39A 3HNPA 2HA7A 4EHBA 3S68A 4C4OA 3V48A 1NVKA 2DWCA 3WWOA 1U94A 1J5EB 5HWSA 3TOZA 2GI4A 2HHCA 5J3JA 1ZJWA 2NP6A 1JALA 2VHCA 2O8DA 3LY8A 3QEOA 1E7SA 4F6LA 1N3IA 3MCZA 1CU1A 1C9YA 2HM7A 1FMTA 2PZKA 1RJGA 2V7UA 2W8ZA 3I64A 4R6XA 4GI1A 1XK7A 1T9ZA 2YHIA 1DT3A 3O03A 4N49A 1C3OB 1L4BA 2QN6A 3EGDB 4D8TA 4FNOA 1BFDA 2IXDA 4WLEA 1LUAA 4H7KA 5IVIA 3CE9A 2OXIA 1FYEA 5HCNA 4KR3A 4O2BA 1VCHA 2ID9A 4HC4A 4B7UA 1OTYA 3TSCA 8LDHA 4RXMA 1KO8A 5KVAA 4BE7B 4L6AA 4F6CA 2QLJA 1B16A 1LKZA 1ZICA 1OF1A 3GHHA 4C6SA 1DAIA 4DUPA 4EW6A 1BN7A 4LZPA 2I7CA 1LBHA 5JDIC 3C7KA 2C5HA 1Z26A 1KJZA 1GZ4A 3IDOA 2HY7A 1E6EA 2DUNA 3LQFA 1KFCB 1P6XA 5DNVA 3TLXA 2OORA 5EUQB 4G5GA 5HF6A 3A9SA 4UMDA 1ZU4A 2AN5A 1YUNA 5IFLA 3E9DA 3OM1A 1H0KA 5DTEA 1PLLA 3O4RA 5DLQC 4BE4A 1ZM2A 1SUEA 1D1TA 1YR2A 4FGJA 4F1WA 4Z53A 1Y9EA 4IZIA 3SAJA 1LS6A 3HDGA 3NQ41 4NQZA 3C1OA 2GPYA 1DQNA 5C52B 2F8MA 2UKDA 4GOND 5FWYB 3ETGA 5H1YA 5IZCA 3OPYB 3U2QA 4EPRA 4L15A 2C5AA 2BCGY 1RADA 2XV1A 4EECA 4XEUA 4B6QA 3MJTA 3ZBUA 4OQEA 1ZMXA 3C8UA 2DTXA 2NTEA 3K05A 4PU0A 3WYAA 4DMUB 5B6JA 4CM1A 2HJSA 3F3SA 5TEVA 2NTVA 2OB2A 3DHYA 2NAFA 2O6HA 2QMZA 3EODA 16PKA 2E5LB 4F71A 2GTHA 3HN7A 3DL0A 4M46A 1ML4A 2PY6A 3IHTA 3SCZA 5HPYB 3TZHA 1R0CA 1P9OA 3WV5A 2F55A 3LG2A 2FRVA 3L46A 3JQDA 3PJEA 4RC9A 3WE7A 3KL4A 1DCKA 2EARA 2I62A 2IXEA 1UDCA 3ZOKA 1UEXC 4FE4A 4ZAGA 1Q7GA 1DOAA 3KEFA 3SFTA 3VTFA 3UAXA 5B5SA 2BPOA 3KB2A 1KI2A 3VYUB 2ILTA 2LIPA 1LNSA 5B1YA 4PAGA 1OGIA 1SG6A 1CZLA 2H85A 3NRBA 1RAGA 2BFOA 3G9UA 4A8JB 1PTJA 4CN8A 1OH5A 3S2ZA 1AKNA 1Z5UA 1R6VA 3GNQA 1M1YE 1NYLA 3GJRA 3O0DA 4HQOA 4I1UA 4QFMA 1TZKA 4P08A 4QXAA 4WNYA 4RTOA 1EWVA 3QQ5A 4R68A 4TLDA 1YKGA 2FW1A 3ROMA 4BQSA 5U1PA 3KBBA 1LI4A 2ZBEA 3B70A 3TRHA 2O14A 3SJZA 5JR3A 2HZBA 2RIPA 3A14A 4YDRA 4MRPA 4F97A 1EKXA 2C3PA 2BLLA 3DV2A 3IELA 4TLEA 1AN9A 1T15A 1UJ2A 3U16A 3P5SA 4AG6A 4ZT5A 5FTJA 3WI7A 4MVYA 3FYUB 4O6VA 1E9AA 1X9HA 1MAWA 1SHLA 3V80A 2FN3A 4B8WA 2WF7A 5J4HA 4OJKA 4NZ9A 3ZVLA 4TN1A 5DSXA 1ZL2A 2X77A 1LBQA 4Y2SA 1R5OA 3C16C 3MB8A 4ENPA 1TZ2A 1N78A 1SCKA 1QLHA 1EDZA 2H59A 2N1BA 3D31A 2DQKA 4WKGA 1F60A 2P2ZA 4Y2HA 4BZZA 3OE4A 5K0JA 1MC5A 2AKAB 1WX1A 1JLKA 1FNMA 2PU7A 1ULAA 5DXFA 1QZ3A 1YVDA 2HCTA 1Y8AA 1RKVA 1XJ0A 4NBNA 3RG8A 3PFGA 4YJHB 3M9WA 5CT9A 2GUGA 3DE7X 1BAPA 1FDOA 2YXNA 3B20A 3FROA 4QGHA 1GA1A 3IOYA 3IEPA 2YZKA 5MN4A 5TLSA 5KOHB 3NMUF 1Y34E 2HV9A 2WNHA 5E1BA 1JA0A 4RL6A 4C7JA 3K70D 2ENUA 3BPSA 2Y9PB 4MUKA 4OK3A 2P9QA 2R5NA 2PX0A 3GMSA 5B6PA 1BGXT 3DAFA 2VTBA 1T4CB 1UFVA 2RK3A 1T8YA 3CBGA 4M9QA 5AJUA 4A8JC 3RU2A 4A3SA 3QPBA 3QX7A 4RSRA 1JWAB 2OK7A 3JQGA 2FYTA 4MULA 5DB4A 4V1CI 3NEJA 4HAXA 1MTZA 3BJIC 3T7EA 1FXWF 4N0DA 4NP6A 4QO8A 4CQMD 4OJYA 3IEKA 3D5EA 3SIPA 1OIXA 3KV1A 3QQPA 4KXYA 2FMUA 3JW8A 1P5HA 2FQQA 3KB6A 4BMXA 2QENA 5KKCA 2GYUA 3JQFA 4LHSA 4YRPA 1F1BA <