3MJ4A

Crystal structure of udp-galactopyranose mutase in complex with phosphonate analog of udp-galactopyranose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
365
structure length
365
Chain Sequence
b'QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-galactopyranose mutase
publication title Chemoenzymatic Synthesis, Inhibition Studies, and X-ray Crystallographic Analysis of the Phosphono Analog of UDP-Galp as an Inhibitor and Mechanistic Probe for UDP-Galactopyranose Mutase.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
total genus 113
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mj4A01
1I3LA 4RLSA 1V3TA 2Y0DA 1ZCJA 4KQWA 2BH9A 4M89A 3ENNA 2BF7A 4NFSA 2VYND 4RDHA 3DQPA 2O7QA 4J4HA 7MDHA 1Z82A 2AEJA 3FCOA 3PP8A 4DXHA 3P19A 4UEOA 1YKFA 2B5WA 1DRUA 1H94A 1KVTA 1YE3A 4FW8A 5TNXA 3DBRA 1W4ZA 1FDUA 3GNTA 4BO7A 2ZTMA 4NBUA 4FFNA 1B16A 1XEAA 3JSAA 2V6BA 2OGUA 4YT8A 2BGLA 1DIGA 3FF4A 3FPLA 4KMSA 4KOAA 1G0NA 1E7RA 1P44A 5J23A 3GVIA 4S3MA 3I4FA 4FCCA 4PIVA 3D4NA 4D7AA 2PGDA 1LQTA 4Y98A 1V9LA 3LSYA 1CQIA 3PIDA 1J49A 5ITWA 1GTMA 4NMHA 3TN7A 3X2FA 3H9GA 3ZGYA 2Q4EA 2HKIA 2QZ9A 4C7KA 4BS9A 5BSEA 3OFSA 4CV3A 1YOVB 2G5CA 2W2LA 4OSPA 4EJMA 1A71A 3G0OA 1Y9EA 4QO7A 4P4GA 2Z1NA 1H6AA 2D5CA 3GVPA 3H5NA 4J91A 4YWJA 1XU9A 2YJZA 3QWFA 3RBZA 4DTIA 4GH5A 4QTZA 4Y67A 2B4TO 3TRIA 3KYDA 4IGFA 2HK9A 1CETA 3AOEA 5CG2A 1LDGA 3FN4A 3U4IA 3KM0A 4MVJD 4II3A 2DVMA 1RM0A 4J1TA 3WFJA 1GD1O 1E5LA 2BGMA 4FSHA 5HM8A 3EK2A 4BO8A 3OICA 1NBOA 3I52A 3Q0EA 4YJGA 2Q50A 1ZSNA 1WAMA 2OMEA 5THQA 1WNTA 4B3IA 5ITVA 1E7MA 3F47A 2CDCA 2JD2A 4BNVA 4QSMA 1IPEA 2EKLA 1D3AA 3TPCA 3H3FA 5DULA 2IXAA 3MJSA 2O2YA 5JDIC 1U8XX 2UUPA 3I9NA 1N9GA 1EBFA 1Y5MA 1SZJG 3DTYA 4PG5A 3EC7A 2A4KA 4YB8A 4BO1A 2O3JA 1I24A 1UDAA 5MDHA 3IP3A 4DWVA 1U4SA 4E6PA 3GFBA 1NFFA 2G0TA 3JQ7A 3AUUA 4IMRA 4EW6A 3CZRA 2AEFA 3RFVA 3O03A 2X0RA 4E0BA 1Q0QA 3BMCA 3DMYA 4GI2A 4WCFC 2DU8A 3JQAD 2Y99A 2EERA 5FFFA 3ZV6A 1V3VA 3AUAA 1IZ9A 4BQPA 3PYLA 2Y0CA 4CMKA 1PZEA 3K92A 5CEEA 3PGXA 5L7TA 1KEUA 4R01A 3UFXA 5L95A 1P45A 3ITDA 4GWKA 4YJFB 4YQYA 4OKIA 3W8DA 1W0CA 2I65A 4XGKA 4ZD6A 2D5AA 4LISA 5JW6A 4I5DA 3DHYA 2C7GA 5ILGA 3ROQA 2DBZA 5G4KB 3CMCO 4CV2A 2D3TA 1J4AA 3ONDA 3BMNA 5C37A 3CXRA 1T1SA 3PWZA 1VSUA 4JXKA 3TOZA 4CQMB 4WGGA 3RU7A 1A27A 1NVMB 4MP8A 1DHRA 1R0SA 1T2FA 1T2CA 2EXXA 2FWMX 1VM6A 2CFCA 4WKGA 1VJ0A 4L8VA 2H1SA 4ND2A 3OQ1A 5H82A 1E1LA 3LLVA 4WNIA 3OJLA 4FFOA 3DEYX 3JQGA 3Q1LA 1E3WB 2PTGA 3GG9A 5JMPA 1DHTA 2B0JA 1BMDA 1OAAA 2PR2A 1PJTA 1X14A 3ZW9A 5C3MA 3B1JA 3UN1A 5TQVA 4XGNA 1E3EA 4RQTA 4E2XA 4HKTA 4RVHA 1LTHR 2HMSA 1DC4A 1YBAA 1QSGA 2B37A 1WXDA 1FJHA 1Y8QA 4F46A 1PGJA 3DZKA 1JW9B 1LRJA 4QQRA 1T25A 3JD4A 4YXFA 3JTMA 3IJRA 3ICCA 4ZQBA 4R9SA 1M6WA 3PQDA 1Y7TA 2HDHA 4LSWA 5A9TA 2QW8A 5T6BA 5G0SA 3ABIA 1ZXBA 3R3SA 1QG6A 2XAAA 1K89A 4GLLA 1B2LA 5JDIA 2Q2VA 4LN1A 2AA3A 2EJWA 3C7CB 4RO0A 4E12A 4FBGA 1XA0A 2YHIB 4XQGA 4DL9A 1MC4A 1LSSA 1GR0A 1RYDA 4F45A 5AYVA 1LLUA 4ND4A 4YAEA 5CEFA 4O63O 1X15A 2R2GA 4D42A 1GZ6A 2HMUA 3FR7A 3H9EO 4OMUA 2WE7A 4WCFA 4FGSA 3PFFA 1K0UA 1LA2A 1WDLA 4GSLA 2WJPA 3WYEA 5CEJA 4WEOA 1GAEO 4GX2A 1ZK2A 1UUFA 2NSDA 1U8FO 5TS3A 3V2UA 1MV8A 2DUUA 3AM4A 4GMFA 5K6AC 4J43A 1H9AA 1BSVA 2WYVA 1B8PA 4L4XA 2D2IA 2VUSA 3AOGA 1HZJA 1MXHA 1QRRA 1OZAA 4FGWA 1LDEA 1GYPA 1ZVMA 1WP4A 1G0OA 3TZCA 1BXGB 2NTVA 1H6CA 3KLPX 3WGZA 3L77A 3ZV5A 2C20A 4IXTA 7ADHA 1RYEA 1NHGA 2ZTLA 2PZKA 2C2XA 5I7EA 1TLTA 1C0IA 3WXBA 1JAXA 4H16A 1UZMA 4LK3A 4YR9A 3LT1A 4XB2A 4PG8A 4ND5A 3ZWVA 4R1UA 3QQPA 4BKRA 4HX5A 3OETA 4L9RA 2H63A 1EDZA 1NR1A 1GUYA 2A92A 3VPFA 2PKQO 1YRLA 3RJ9A 4E32A 2HJRA 2V7PA 5CFZA 1E6UA 3PXXA 1ARZA 2RAFA 1D1SA 4G5HA 2W4QA 3A06A 4BKQA 3AUSA 2PD6A 3JD3A 3ZU2A 3LC1O 3NTOA 1Q7CA 1JQBA 1I32A 3RAJA 4KDFA 2NQTA 1KEWA 1LLCA 4BGIA 5JE8A 4KUEA 5B4TA 1CERA 3KEOA 4L4SA 2Q45A 2IE0A 2X9NA 1WZEA 1Q7BA 3DBLB 3F46A 4ALNA 2NADA 4LCEA 1T4BA 5T64A 1GQYA 2CUKA 1EDOA 3H65A 3O38A 4YEDA 2HMWA 3HUDA 2O4UX 3ZDFA 1B3BA 1IY8A 5L3ZA 2VUUA 2X23A 5IAAA 3I5MA 1U7TA 1E77A 1YDEA 3GLQA 5A06A 5IDXA 4HP8A 5AXDA 1DC3A 2AE2A 1B0AA 3BHIA 1X1TA 1TT5B 3CTMA 4A0SA 4ZN6A 5A5FA 4MINA 4CLOB 2I3GA 1DEHA 3WBBA 1GV1A 4PG4A 3NGXA 2G1UA 4ALMA 4Q3BA 2BFAA 3H7AA 3GPDG 4FFRA 2HJSA 3VOSA 3WOHA 4D3FA 3LT4A 1YB1A 3BHJA 1VKOA 3HQ4O 2I9PA 1GCUA 2BKAA 4Z0HO 1A9YA 1B7GO 2OL4A 4XA8A 1C0PA 3R6DA 4IMPA 3UH1A 2X5JO 2J5RA 1TVEA 3IC5A 3ZHZA 3OECA 3NTRA 4J0FA 4GSKA 4AJPA 5H81A 5H83A 4BV8A 1HZZA 1E1NA 2X5OA 4UUOA 5JLAA 4A27A 1ZFNA 3G49A 2IZ0A 2R00C 3W6UA 1W8DA 3JQDA 4KZPA 1L7EA 5I9LA 1H5QA 3DR3A 1DXYA 5U4QA 3GEDA 3JD2A 3AY7A 3S2EA 4DLLA 3DFUA 4W7HA 4Z3KA 5G0TA 1ML3A 1QYDA 2PK3A 1IPFA 2DKNA 3AWDA 3ZN2A 4CV0A 4YACA 1ZK0A 1SB9A 2QHXA 5JAZA 3WX0A 4LW8A 3O9ZA 3I9MA 4RZIA 1FXSA 3JQ9A 1XKQA 3BMQB 3RUEA 4PLCA 4E30A 3QW2A 3VPGA 4DQXA 5A1TA 3INGA 4A7PA 1Y1PA 2P4QA 1YOVA 3H9JA 4ND1A 3WJAA 5JCJD 4WLEA 1I33A 1XWFA 3NGLA 2PZJA 5BSGA 5A04A 5IFLA 1DOHA 3IKTA 2EIHA 3E5RA 1N92A 4WECA 1BVRA 5TJHA 4MVJF 1SEPA 3PHHA 4YTEA 1LC0A 3BA1A 4DREA 4NH4A 1NQAO 4TZKA 1F12A 3U4HA 1I3NA 3RCBA 1DC5A 2EWMA 1H6DA 2VHZA 4GGOA 3D5QA 1P1RA 3GDGA 2VT3A 1R6DA 3ROPA 1G6KA 2NUAA 1I01A 2VZ8A 4OSOA 4FQ8A 1DJQA 1HDXA 3L4SO 1IB6A 3ULKA 1FDTA 1ZSVA 1EBUA 2FSVA 2YHUA 4YT2A 1H2HA 4XQ9A 1NQOA 3KXDA 2GCGA 2UDPA 4FOSA 4BKPA 5F3RA 3JQAB 2Q49A 4YCAA 3WGTA 3QWIA 5JY6A 1T4DA 2ZTVA 3PJFA 4LMRA 4OKNA 1EQ2A 2Y68A 4M86A 5LDHA 4XR9A 4PZDA 2VHWA 5CDGA 3DDNA 1HRDA 4BNTA 2EKPA 5AXAA 2AG5A 2ZQYA 2YFHA 3K31A 2JFHA 3BMOB 3PJDA 4Z0TA 4ZQGA 4MVJI 1Q1NA 4CV1A 2VRBA 1O5IA 3KTDA 4HBGA 1B3RA 3PJEA 2FZEA 2VRCD 1EVYA 5IZCC 1JKJA 1JKFA 3ROKA 2O48X 5FF9A 1DPGA 1NAIA 3FWZA 3OJFA 2I99A 4TVOA 1SEVA 4AJLA 2CY0A 4AFNA 4UUPA 3U0BA 5A4DA 4DLAA 3DC2A 5FI5A 1EZ4A 4N5MA 5FWNA 2AQHA 5C7LO 1EK5A 1WDKA 3U9LA 1LRLA 2FR8A 2Q46A 1K5HA 3AFMA 3OP4A 4RZHA 3IQDB 4M55A 1EK6A 1R0KA 5G4KA 5BQFA 1JLLA 3QWAA 1PTJA 3NV9A 3OSUA 3QWHA 1WZIA 4CQMA 1QLJA 1R16A 4G65A 2WD8A 3GHHA 3C1AA 1LEHA 2AQ8A 1P1HA 2VNSA 5BT9A 1QKIA 3NT4A 4MIYA 4WASA 4XJSA 4ALJA 3JD0A 1NX6A 4J90A 3I3OA 2Y67A 1SCUA 3VTZA 1EVZA 1ZXLA 3KO8A 4HY3A 4IIVA 4JJIA 4EYEA 5IJZA 3T4XA 2YV3A 2X6TA 1E3WA 3E9MA 3JV7A 9LDBA 1A7KA 3NJ8A 3VH3A 3WQRA 5DP2A 2P9CA 2DLDA 1XQ1A 4NFYA 4BNJA 3AY6A 3OJ0A 3AUTA 1UXHA 3PHGA 2ZK7A 3W8EA 3CPSA 4KUHA 1JDJA 4K1LA 4TWRA 1XG5A 1L1FA 3D4PA 1FDWA 2PY6A 2YDYA 4MPDA 5IG2A 4EUEA 4XR4A 4H7PA 4A73A 1UH5A 2IEBA 1VI2A 4MKZA 3GVXA 3JQBA 4W4TA 1R37A 2JL1A 4F6LA 3G17A 3WGYA 2X4GA 2A9FA 2LDBA 3ZV4A 3O4RA 4GAEA 4NNJA 4RVUA 1QV6A 3WBFA 1DFGA 3ZI0A 2VHXA 3F3SA 3C24A 1U28A 1E7SA 3PHIA 3JQFC 2DM6A 4KUGA 1I0ZA 3VZRA 1UAYA 2VWHA 3FNFA 4MIEA 4CL3A 4E33A 1GL3A 2YFQA 1P3DA 4E13A 3NRCA 5TT1A 3G1UA 2ZYAA 4BO2A 4TRJA 2FMUA 1LUAA 2WDZA 2QYTA 3NUGA 5EERA 2C82A 1HDGO 2WD7A 3BTSA 4KTVE 5T57A 3LQFA 1O89A 4IZIA 1U3WA 2GLXA 5JXWA 3PTZA 4CM9D 3Q9NA 4LVCA 4AL4A 3S8MA 4JLWA 1E3IA 2CNBA 4N5LA 1LXCA 4Y6RA 1KY4A 4QO8A 4LCJA 2BI8A 1UP4A 4NK5A 3KUXA 1BXZA 1BRMA 1V35A 3BZUA 4FC7A 3TFOA 2BFPA 4HUJA 2ZCVA 4GX0A 1YONA 1NHWA 3U5TA 3RI3A 2X86A 3OEWA 4CLHA 1BGVA 3AJRA 1RM4A 5I7SA 1U1IA 2P5UA 1B15A 3O8QB 3M2TA 2VN8A 2JCVA 1PR3A 1UAGA 2W90A 1YVEI 1JN0A 1BXGA 1AN9A 1IUKA 5GY7A 1Y8RB 5IF3A 1E3JA 4PLPA 4GPD1 2B69A 3PYMA 5A3VA 3WGHA 5DCWA 3L6EA 5ILOA 2GD1O 5TC4A 2JFGA 2GN4A 3CEAA 1LSUA 3FRJA 4EEZA 3NT2A 3E1KA 3MJ4A 1ZEJA 3I9KA 3UCXA 3E18A 4P4LA 4MJLA 4XIJA 4ZVVA 4KWHA 2GRAA 1HLDA 1O0SA 1VL0A 3H2ZA 1MP0A 4Q3DA 5KVVA 1Q0HA 2E6UX 1GYQA 3DZHA 4EI2A 2Y1GA 3QWBA 3HDJA 4XZ3A 2CD9A 1U3VA 5JAMA 1B14A 4AJ1A 1X7DA 4LRTB 4ALIA 5BR7A 5DCYA 2JJYA 3HNPA 1DB3A 3K2BA 2YY7A 4LSMA 2WTBA 3B70A 1C3VA 1LDMA 2PA3A 5DT9A 1MC5A 4EJ0A 4ZU3A 3SXPA 1M76A 4AG3A 4TRRA 1T1RA 2HAEA 1QYWA 3MJTA 5C7OO 3OM9A 2HMVA 2NU9A 1HDZA 2I76A 4F6CA 3DBLA 1LDBA 4PRLA 1EFKA 3F6YA 3CE6A 5CPFA 3FNGA 2JHGA 3UUWA 2RH8A 3GT0A 2GF2A 3JQFA 5DBGA 2NM0A 4NFHA 4E5KA 3MZ0A 1R4MA 2POQX 1Z7BA 5KKAA 1GV0A 1V3UA 1VL6A 2ZATA 3RFTA 4CMIA 2W2LD 2VYVA 8ADHA 4W9NA 1TT5A 3RUHA 4CLDA 1D8AA 4O0LA 4U0JA 2NVBA 3AW9A 3IUSA 4CLOA 3IIEA 4J6FA 4BOYA 2QRLA 5BNTA 5HS4A 2EEZA 2X1HA 4TSKA 1Q2XA 2J5QA 4PLZA 2X0IA 4ZRNA 3RU9A 3SLKA 1P9LA 2CVQA 4UUMA 1H6BA 1B26A 4YAIA 3AM3A 5JC8A 1Q7GA 4YT4A 4D0SA 2VUTA 2AQKA 4IUYA 4YJHB 4BMSA 1HYEA 1Z7EA 1AXGA 3KYCA 4BO0A 1IL0A 2UV8A 2VCYA 4Z6KA 3X2EA 5CDTA 4Z3DA 9LDTA 2Y1DA 4J49A 3WWYA 2OBNA 1GCOA 3C3XA 3GN2A 5EL0A 1ENYA 1EE2A 4TZTA 4NU5A 3CKYA 2AXQA 2CDAA 5EQFA 1ULUA 4NIMA 2GN6A 1ADCA 4NHEA 3EVTA 3AI1A 3DAPA 1YH3A 4GLOA 1M6HA 4J1SA 4XKJA 3GZNB 3PHLA 2IYPA 2O2SA 4A2CA 4E5MA 5BNFA 4LVUA 1GDHA 4WE3A 2ZQZA 4FJ1A 3RSHA 3GMSA 1TEHA 5JDCC 1XR3A 3VH1A 4BNUA 4C4OA 1PGPA 5L7WA 1ENZA 3I1JA 3WGQA 1QMGA 3HDYA 1YL7A 5KJCA 2PH3A 1QXSA 3TZQA 1XELA 3JQ6A 4MVJA 2X0NA 1PWXA 4EEXA 4ALLA 3JYPA 2ZB7A 2YV1A 4RL6A 3BMQA 2PGLA 4YBZA 1K2WA 4ZRMA 5GZ1A 3C1TA 5IXYA 4DPKA 4ONEA 1SAYA 2BELA 3M1LA 4R68A 1MLDA 3AY3A 2PZLA 4UAGA 3HN2A 4A03A 3S1LA 1U4OA 3HB4X 3GHYA 1S7CA 4CJXA 3F1KA 4A10A 1PJLA 1IE3A 3QV1A 1TI7A 5A9RA 5AOVA 4URFA 3GRPA 3I6IA 1HSOA 1JVBA 3GRKA 3RBVA 4ILKA 3OH8A 3EDMA 1E3SA 3RUFA 1EE9A 4OXYA 4YDRA 5JY1A 2ZJ0A 3NJ4A 2FPPA 4M49A 2Y05A 4GKVA 1ZK3A 3WMXA 1Z6ZA 4Z9XA 3TQHA 4I5EA 3D3WB 3D5TA 4ESOA 2JCXA 1QORA 3LYLA 3C8MA 3NYWA 3Q2IA 1AUPA 1OMOA 1VL8A 2AHRA 3DL2A 1ZIDA 4W7IA 3JQAA 1O95A 1R0LA 1E0DA 4OOFA 1WWKA 4JN6B 1N7GA 1LDNA 4OIMA 4CM6A 4DIBA 4CLEA 2XXJA 3JQ8B 4IDEA 5BNIA 4E3ZA 1F17A 2H5LA 4G81A 3KV3O 2C5EA 5I8WA 3NDIA 2RHRA 1PZHA 1ZSYA 4NR0A 3I9LA 4QECA 2EGHA 5JMWA 3WB9A 3GGOA 3BXXA 3L4BC 4AJJA 5KJEA 1BW9B 4ZQFA 3F4BA 1DLIA 5DBFA 5I8ZA 3VH4A 3EHEA 1IHYA 3Q9UA 4B79A 3HJAA 4DVJA 2HRZA 2FHSA 3MCVA 4CR8A 1U2GA 1I2BA 1CIVA 4CM4B 4QEDA 3W4JA 1PS0A 4XQCA 2GNAA 1P0CA 3H4VA 3PWKA 2FRDA 2YQ5A 3DAGA 2VQ3A 4CPDA 4EJ6A 4D44A 5TRTA 4BO4A 3EZLA 2IYOA 5G0WA 1ZK4A 3ZWMA 4HFJA 4UUNA 2QQ5A 4R16A 4ZA2A 2WEKA 3BTOA 5JDCA 1NFRA 1U5CA 3DWFA 3LF2A 3HDHA 2V6MA 2IZZA 3FR8A 5L9AA 1W73A 3ZNOA 3TNLA 4D3DA 3QJ5A 3KETA 1P1KA 3VVBA 1P1JA 3QSGA 4IJKA 3CSDA 4DQVA 4BNKA 3MTJA 3D3EA 1E1KA 4ITUA 1Z73A 1HTBA 3HN7A 4IIUA 4U0KA 1QYXA 2HK7A 1JA9A 3WGOA 3LC2O 4E2WA 3MEQA 2NU8A 1I30A 1PIWA 4HFMA 4K6CA 4L75A 2X9GA 4GL4A 4OAQA 3FBTA 5JAIA 4DA9A 4CQLA 4JQCA 2SCUA 3P2YA 5HA5A 4R1SA 3QVSA 2OP1A 2VTEA 1NVGA 5EJ2A 2X9VA 1LC3A 3HSKA 3RASA 4JNKA 1WMBA 1RWBA 4BO5A 1X7GA 1RKXA 1FDSA 3KEQA 3V1UA 4R3WA 2GSDA 1ISIA 2X0JA 2J5KA 3MOGA 1T2AA 2NTJA 2PD3A 1A4IA 4B4VA 2WE8A 3FSRA 3ZNNA 3GY0A 1R15A 2QG4A 4L73A 3PYXA 4WOKA 5IN5A 3KRTA 4CMAA 2Q99A 4DGSA 2PGJA 1HKUA 4GX1A 1ENPA 1K3TA 1PU2A 2BI7A 1PR9A 2JAHA 3AM5A 2E4AA 2EW8A 1YB4A 4XYBA 3ETGA 4DIOA 4INAA 2CDBA 4H15A 4IJWA 3ZWXA 4GBJA 3OHSX 3H5AA 4DPLA 3RC7A 3RD5A 4J0EA 1Y81A 3FPCA 3G79A 1P1FA 3WQQA 3IKVA 3ETDA 3ZH2A 4RVFA 3L4BA 1PQUA 4IQ0A 2VZ0A 3N7UA 3GNQA 1GZ4A 4M1QA 1SBYA 4L74A 4XWYA 1H93A 1KEVA 2B83A 1VC2A 1UP7A 2O7SA 1DAOA 2BLLA 3JD1A 2PWZA 2PKRA 2Y0EA 5K0ZA 3GOHA 4U5QA 2D8AA 5L4SA 1WVGA 1YL6A 3JCZA 2NQ8A 3ZV3A 2CZCA 1OFGA 5CPBA 1WPQA 1PSDA 4OYRA 3GNSA 2OBYA 4ZJUA 5TF4A 2E37A 5TSDA 3CINA 1NYTA 2HLPA 4BNYA 1NFQA 2C7VA 4WK6A 4BMNA 2VOEA 4YRBA 5LC1A 5HBRA 2I6TA 1Y8RA 3FTNA 4MP6A 2EG9A 1IOLA 4XD2A 4IDDA 1XIVA 4BIIA 4DRYA 1EEHA 2RHCA 3SBOA 4XYGA 4YT5A 3LC7O 4TRMA 5I7VA 1A7AA 3M2PA 3A1NA 4WOJA 3GH3A 3DBHA 5KJ1A 1P0FA 3RUDA 4CM8B 1NVTA 5DOVA 1CYDA 2AMFA 1ZMOA 2PKQP 2E82A 3COSA 4DIFA 5K9ZA 3GFGA 3CIFA 1MG5A 3H9UA 1BG6A 2Y1OA 3GUCA 1KIFA 4PLTA 5EIOA 3PIIA 5JYDA 5K6AA 2PLAA 5CDSA 1Z45A 3D4OA 4J1QA 3KB6A 1GUZA 1W6UA 4MKRA 4RGBA 5JC1A 1VE9A 4J4TA 4FD3A 4Z9YA 4MVJE 4DLBA 4D46A 2B4QA 1I3KA 3VVCA 2G82A 3HB5X 4PLGA 3INRA 1Q0LA 4UEKA 3ORFA 5CP8A 1ADGA 2ZB4A 3K2EA 3I83A 4NG5A 1NWHA 3H6KA 4P4NA 4R54A 2YQ4A 4AICA 4BNNA 3B1KA 4FOOA 4NU6A 4OJNA 4RPJA 3E6AA 3KVOA 4I8XA 1HE2A 4CR6A 3ROMA 1ISFA 3GGPA 2V6GA 1MA0A 3ONEA 4MDHA 4E5YA 4Q3NA 3SC4A 1PZGA 2H9IA 2NU6A 3ANMA 3DBVO 3E9QA 5EESA 3ZHBA 2TMGA 5L4LA 3ZZNA 1K6IA 2WM3A 1ZH8A 3EY4A 1PJBA 2IZ1A 1DIBA 3HFGA 3WLEA 4LRSB 3UGKA 2YV2A 3EVNA 5EQDA 4CM1A 1ADBA 3L6DA 4NJMB 5I9MA 2D1YA 3OA0A 1NXQA 3ZWNA 3F9IA 1RM5A 3RIHA 3TL2A 2Y1FA 1XSEA 1FDVA 2VHYA 1EUZA 4ZQEA 3VZSA 4R51A 4XDZA 4YJHA 1S6YA 3ZWBA 3PEFA 4BQRA 5A3JA 2GDZA 5FI3A 1QYCA 1V6AA 1YJQA 3JQ7B 1KY5A 1B8VA 4YRDA 3QIVA 4H3VA 4QUKA 2CMDA 5IN4A 3N74A 1QV7A 4JP2A 5DP1A 2O3SA 4PLVA 2I5PO 2P68A 5L51A 3V2HA 3TFQA 1HDYA 3WSWA 3DOJA 3ZWAA 4BB6A 1R4NB 4PVDA 1HLPA 2V65A 3DAFA 4KDEA 4P38A 4UREA 5GZ3A 3Q2KA 4MKXA 5I7FA 4CM7A 4WNCA 1E6WA 2AG8A 3KSDO 3GZ4A 1HDOA 3ST7A 3GZNA 2O3TA 1ORRA 1R12A 3JQCA 4IGEA 3W4IA 4AJKA 4U7WA 1O9BA 5GMOA 1KEPA 2B36A 4B7UA 1O94A 1Z75A 4YVFA 1C0KA 4N7RA 2ZYDA 1L7DA 2GYYA 1BVUA 1NASA 4GKBA 3QP9A 2Q2WA 1XHLA 4PLFA 4WLUA 3HE3A 5IDYA 2VOJA 4FDAA 5CDUA 1YB5A 1ZBQA 3NKLA 1NP3A 4J1NA 4TROA 5ENVA 3UKOA 2FZWA 3W8FA 1YXMA 3E82A 4M87A 1DO8A 4R69A 3WIEA 3ASVA 3GC6A 2I67A 3RROA 3MJCA 3W6ZA 5COQA 1LLQA 5KWEA 4HNHA 4BO3A 3UAGA 1YWGO 3OQ6A 1F0YA 2B4RO 3KZVA 3CZMA 1WW8A 4K28A 1MGOA 2R00A 1VJ1A 5TIIA 1ZKMA 4XJTA 4JGBA 4HV4A 4YJFA 1R66A 2W2KB 4IM7A 3VTFA 1Y6JA 1YJ8A 3FWNA 2C07A 2J6IA 2JD1A 3D0OA 2C54A 2P91A 5AVOA 5LDGA 4BGEA 4E4YA 1E5QA 1N8KA 3TZ6A 5C7IO 1XCBA 1M75A 3GDFA 5ADHA 2D0IA 3E03A 4JP3A 5DNAA 5B37A 3E5MA 1I36A 1HYHA 5DCUA 1OC4A 3WTBA 3WICA 3DONA 4GMGA 2VRCA 4CR7A 4I9NA 3MWDB 1KVRA 4DBZA 2FP4A 1VKNA 3ASUA 3ENKA 3PVZA 4I1IA 5F1OA 4D0RA 3DOOA 3S2FA 2ZCUA 4II2A 4E21A 1QYVA 3JYLA 4BV9A 3PJGA 1PJQA 4IZHA 4TMFA 2OP0A 3UICA 3RJ5A 2D59A 3LK7A 4ZGWA 2WMDA 3VDRA 1O8CA 4CUKA 3LU1A 4YJDA 3AU9A 2QYSA 3I23A 5MGBA 1BHSA 1LQUA 2ZB3A 2Q4BA 3DZFA 1KC3A 4K9DA 3E8XA 1EVIA 2DTDA 4L0QA 3R0IA 2B5VA 1ZO8A 3WQSB 1CF2O 3WG9A 2HO5A 4B4UA 3E48A 1B8UA 1VLLA 1J0XO 4WLNA 1E7QA 3WFIA 4W82A 2HU2A 1HF3A 2Q1UA 2EP5A 2J3KA 5F5LA 2PH5A 3SVTA 2C5AA 1KETA 3DHEA 3OIGA 1ZW1A 1NQ5A 2YHIA 4IQ8A 4FFMA 4PCVA 1PS8A 4FJ2A 3H9QA 1UXKA 2OOSA 4WUVA 4ID9A 5FYDA 2QX7A 2PNFA 3SJ7A 5B4VA 1PQPA 4IJUA 1MUUA 3LT0A 1SO8A 2JKVA 1H9BA 1MFPA 2Z95A 5IZCA 2NNLD 3QE3A 3V8BA 4GX5A 4RVDA 4BVAA 4JIGA 3S2GA 2YYYA 5ICMA 1GEGA 2ZB8A 3IAHA 5COAA 1NWCA 3NDJA 2OHXA 1E7YA 4CUJA 5BSHA 3IOYA 3KBOA 4AJIA 1YO6A 1YBMA 4BHTA 3JQEA 4RPGA 4BUCA 1ZMTA 3K30A 3C85A 3DTTA 1T2DA 4GWGA 1K6JA 2DFVA 1IHXA 2P4HX 2WWRA 3VZQA 1HT0A 3EMKA 4M8SA 2X22A 3FBGA 4RORA 4TVBA 3LT2A 5IXSA 3WMWA 5A02A 1HWYA 2J3HA 3F1LA 4BNHA 1CQJA 1LJ8A 5EMHA 4CM9A 1ZZEA 1VSVA 2FOIA 1DFIA 4OO3A 1GADO 1JWBB 2VHVA 3TL3A 3VPHA 1C0LA 1LSJA 5JBIA 1MX3A 1PS9A 2ZIZA 3OMLA 2PD4A 5B12A 3M6IA 3TWOA 4UVGA 4MVJH 2OZPA 2X5KO 2PV7A 1JVSA 2RH4A 3ITKA 3JYOA 5KIAA 5L7YA 2NLOA 2AE1A 4BKOA 2VWGA 3V1YA 2HCTA 2V6FA 4RF4A 1X0VA 1GUFA 2OFPA 4OOEA 2PZMA 4PN3A 3PLNA 3HADA 2HSDA 5ER6A 2O3UA 1KERA 2D4AA 2QZZA 4FPXA 4X54A 4C7JA 4HWKA 2DC1A 3QHAA 1ULSA 2CF5A 3TJRA 3ZW8A 4XIYA 2J3JA 2JCYA 2VYVD 3ZCXA 3WYCA 4BMVA 1F06A 4DUPA 4CMHA 1JWAB 3TOXA 2F1KA 3Q11A 3CH6A 4HADA 4RCVA 4XYEA 3ZNPA 1JKIA 4MO2A 4AJOA 1U9JA 3FNHA 3GEMA 4N54A 1KBZA 4N18A 4OHUA 2QIOA 4FFPA 3ZWYA 2VYNA 3KOUA 2P2SA 4LGVA 5IZ4A 3QA9A 4ND3A 4PFJA 4WCDA 4R5HA 5CAEA 2GN8A 4R1TA 4RVSA 3VAZA 2UYYA 1RM3A 2B35A 4CM8A 4GVLA 4M54A 1DIHA 2X7HA 3MWEB 2DT5A 3KSZO 1P77A 3HDQA 4EZBA 2EGGA 2GO1A 3LLSA 3PWSA 4XGIA 2X58A 4PGFA 4L4RA 4QFCA 2NVUB 2P9GA 2Q1SA 3DZGA 4JBHA 1YGYA 4IDFA 1KVSA 3P7MA 1C1XB 5KVCA 3CUKA 3TDKA 4MVJP 5BSFA 1WDMA 2E48A 4EBFA 3QY9A 1SMKA 1I10A 3FNEA 2I66A 3GUYA 3DMTC 3IS3A 1ISGA 1LI4A 4LMPA 2NACA 1LLDA 3B20A 4P22A 4CLRB 3RKRA 4BO6A 1D4FA 2G76A 3Q3CA 1U3UA 2OXIA 4IXWA 2FSSA 4YAJA 3I9OA 5JPIA 3TF5A 2JFFA 3C1OA 3DB2A 4MIOA 5L53A 1E3LA 1N1GA 3ZU5A 4D45A 5B4UA 3U09A 1SB8A 3QVXA 1PJSA 1SOWA 2IEDA 1T26A 1ZEMA 3HZZA 5TGDA 1I2ZA 1KVUA 1ONNA 3GR6A 2IXBA 2YZ7A 3HHPA 4NJMA 2Z1MA 2CVZA 1BDBA 2FPIA 3PDJA 5FEUA 1TB4A 5TJ9A 1ADFA 4BNWA 3IMFA 1PGOA 2DPGA 3EAGA 4Y6SA 5KJFA 3FI9A 3I9JA 1WMAA 3D1LA 4JROA 4WLOA 5JO0A 4E5PA 1KOLA 3VHRA 1DLJA 1UXGA 1UJMA 1DIAA 4PZEA 5TX7A 3GA0A 4D79A 2A35A 4AJNA 4CODB 4PZCA 4DC1A 2VNAA 1OI7A 3DO5A 3DOCA 3OEYA 5L40A 4F3YA 1R4NA 1UZNA 3AI3A 4J4BA 2VTDA 2Y1CA 1HE5A 2W8ZA 5U1PA 3PI7A 5HWSA 1CEQA 1XGKA 3BIOA 3I6QA 1C1DB 1TT7A 4IY1A 4QT0A 4IDGA 4R5MA 3WGGA 1HE3A 3PRJA 4IINA 3PZBA 2C29D 3NAQA 4HFNA 3L0DA 5HRUA 3QLJA 1KYQA 4Q3AA 5KKCA 1I2CA 5IDWA 1NPYA 1JTVA 1PL6A 3NX4A 4CMJA 1CRWG 3JYNA 2EKQA 4GQAA 5G0UA 4ALKA 1X0XA 4YRAA 2OO5A 3HFSA 5L45A 3ADPA 4NI5A 3BMOA 3KHUA 5A9SB 5IDQA 2HK8A 1PJ4A 3AFNA 2RIRA 3E9NA 4OXNA 5KVQA 4Q3CA 4IDBA 1PZFA 4PLWA 1DSSG 2GR9A 3DZJA 2E49A 3VH2A 3A28A 5T5QA 4YPOA 2GZ1A 4CMEC 2NU7A 4NDNE 2VWPA 3DMTA 4DYVA 4J16A 3P5SA 3IP1A 3RC2A 4EGFA 2EP7A 2ILTA 4PLYA 1MG0A 2W2KA 4Y8VA 1LDYA 5HTOA 1EVJA 4XRGA 1PQWA 5ES3A 5HS6A 5JAQA 3B6ZA 3WJ7A 3T4EA 1PX0A 3SJUA 1AXEA 3U62A 5DF1A 1HDRA 4DC0A 2BHLA 4I9HA 3ZHXA 1LNQA 4EDFA 1E7WA 4KQXA 4CLXA 3DZIA 1T2EA 3RC1A 3V1TC 1ONPA 3W1VA 2P5YA 1C14A 3IDSA 1ZUD1 2RBEA 2HQ1A 1GQQA 1Y9AA 2XOXA 4RF5A 3UF0A 2WYUA 3F4LA 4UVDA 5DZSA 1PJ2A 1M66A 1X7HA 1BXKA 4IBOA 4G2NA 4P8RA 1P1IA 3OJEA 3N58A 4Z9FA 5B1YA 3DHNA 2XPCA 2DBRA 3OIDA 3UCEA 1MFZA 2O3RA 1KVQA 2UVDA 2DBQA 1K6XA 1EMDA 4MP3A 3DZBA 2WD7B 3AK4A 4BNMA 4XYLA 1AHHA 4BNGA 3U4DA 1XLTA 4XEHA 3UW3A 4B4OA 4XX0A 3VDQA 6LDHA 1ZNQO 4AJEA 4CM5A 3BTVA 1ZJZA 2AQIA 4I5GA 1LX6A 2DTEA 2DFDA 1DFHA 4OXKA 1OOEA 1P33A 1YDWA 3K8ZA 3A14A 3CMMA 2OUIA 2FR1A 4PG7A 3U3XA 1UZLA 2GASA 4RPHA 4J7CA 1DDOA 1M2WA 3VZPA 1G1AA 4PVCA 4RPKA 4BNIA 3M1AA 3UCFA 3S55A 5JSFA 1NM5A 3FTPA 1HXHA 1PWZA 2FN7A 3WLFA 4DBVO 4YAGA 5F1KA 1ZJYA 4K26A 1MXFA 1GPJA 4RVGA 4AJHA 4NBVA 2UAGA 2O3QA 2VWQA 5ICSA 3EW7A 4ROSA 1CWUA 4NBTA 1I3MA 4BO9A 4FB5A 3LZ6A 5JNLA 1NAHA 5DN9A 3STHA 3U4CA 3ETEA 4CMEA 1AE1A 5JYEA 1FF9A 2O23A 3MOIA 3RKUA 1RPNA 2YW9A 4Q9NA 3PFWO 1ID1A 4YYZA 3BYZA 3ADOA 3GAFA 3MJVA 5AQ1A 4I08A 5G0VA 2OORA 4Y9DA 3IUPA 3RVDA 1J6UA 1ISHA 4RV9A 3JQ9C 3K73O 1NQTA 4QX6A 2EW2A 4YA6A 3O8QA 1NR7A 4CL8A 1GPDG 3GAZA 2Q1WA 4U6SA 3UOGA 4IDCA 1SNYA 3ZHYA 3KSUA 5U9CA 3RBXA 3SLGA 4RDIA 4CMCA 1X1EA 1PGNA 1QP8A 1TXGA 3QVOA 3WIDA 5F21A 3DBRB 1E92A 5LCXA 4AJ2A 4EITA 4MOWA 4J2OA 1F8GA 1A72A 1OC2A 2IODA 3OJOA 5CDYA 1AHIA 2G17A 4W99A 3A9WA 3SC6A 3ZWOA 3PK0A 1HYGA 4N5NA 1MB4A 1U2DA 4JJGA 1R4MB 4A5OA 3LF1A 3BHMA 3PHJA 1YBVA 4B7XA 4CMIB 5L4NA 1VJTA 1UXIA 5T67A 1PL8A 1O6ZA 1VPDA 4MVJM 1M67A 4R41A 3RUIA 4S1VA 1V8BA 2Q2QA 4NQZA 1Z74A 3GVHA 4BL5A 3PGJA 1N2SA 2FPGA 1E1MA 1TA4A 1ONOA 4XDYA 3F5SA 3GPIA 1LU9A 4QFDA 4HFRA 1XU7A 1D7OA 3NTQA 4E2ZA 1XQ6A 3ZWCA 3QVTA 4FN4A 1P31A 3EYWA 3H2SA 1X13A 3L6OO 4HXYA 2LDXA 3KYDB 2Y66A 4UULA 1KC1A 2ZYGA 3VKUA 3WNQA 4B8WA 5KJ6A 5ER9A 3KYCB 4DPMA 1JU9A 1JAYA 3OIFA 4AJ4A 4D3SA 1YQXA 4O5OA 1GZ3A 2GUGA 4UVIA 3G1TA 3ICPA 3R1IA 5KVSA 1UDCA 1N5DA 1D1TA 2NTNA 4XB1A 1VRWA 4FS3A 3PLRA 4B7CA 4YAKA 1YL5A 2YUTA 5EPOA 4BGVA 2Y1EA 4YJGB 2GERA 2GN9A 1PJ3A 3H8VA 3GN1A 1U5AA 3GK3A 3KLMX 2P9EA 3AI2A 5AXCA 3ZU3A 1PEDA 3LDHA 1A4UA 1KS9A 2PFGA 2BFOA 3EZYA 3C7DB 1N9GB 4B3JA 1N7HA 4TKMA 1V0JA 1GFSA 1ZK1A 4DMLA 2HMTA 1BWSA 1SC6A 3EUWA 4WLVA 3B1FA 4DQUA 2IDZA 1CDOA 5KNLA 4EUFA 3VPXA 2H6EA 1NNUA 2EF1A 1IULA 3INTA 2NVUA 5A03A 4FR5A 4TQGA 1A9ZA 3ANNA 4RF3A 3BMCB 4I9UA 4B3HA 2AW5A 2ZJ1A 5CHEA 4WPGA 1CJCA 4JBGA 1C1XA 4QXMA 1XYGA 1DRWA 3WWZA 4B8ZA 3VC7A 1DC6A 1DJNA 3FHLA 3ON5A 2EHDA 4CMGA 4B4WA 1EFLA 2JD0A 3PQFA 4OL9A 2GZ3A 1GYRA 2Z5LA 4ZQHA 1OBFO 1BDMA 5G2OA 5JCXA 1QLHA 3PQEA 4IS3A 5JCJA 1YQGA 4CLRA 2DPHA 4I5FA 4BB5A 4E31A 4ZICA 4GVXA 2F00A 4XQEA 4E5NA 2ZTUA 4GGPA 4KWIA 2J8ZA 4PG6A 4WEQA 4EUHA 5F5NA 2O50A 1P74A 5GZ6A 3JQBC 4WLFA 3ZNQA 1E6EA 1PGQA 2EJVA 3BMNB 3PZRA 1HDCA 4J9VA 3OQBA 3O26A 1I5RA 3NT5A 1NTOA 3JYQA 4J9UE 1HETA 4OM8A 3KYBA 1DIRA 4RF2A 4OQZA 4IDAA 4RPLA 4BNZA 3AU8A 2YDXA 3MTGA 2RCYA 2GPTA 2NVWA 2NWQA 1RJWA 3BAZA 5A5EA 3JQGB 4OH1A 1I8TA 4JJFA 1J5PA 1ISMA 2DUWA 2BFMA 2JAPA 1U3TA 4OGWA 3G3EA 5C5IA 2C0CA 2Y93A 2UUOA 3TSCA 2WYWA 4CQMD 4JK3A 4KP7A 2C2YA 3MJEA 3H5RA 1Y8QB 4XRRA 5JS6A 3C7AA 2VZ9A 2HRBA 3H3JA 3NEPX 3HWRA 4R1NA 3UXYA 1BTOA 4BNXA 3PDUA 3D3WA 1NPTO 4FFLA 1FMCA 3WTCA 1C1DA 3RUAA 3TZKA 3IL2A 3NDRA 3DXFA 2I3AA 3ZU4A 3T7EA 2X8LA 2Q1TA 5T8KC 1AGNA 3P2OA 1IYZA 1NPDA 1U7HA 2CSUA 2GZ2A 4JBIA 1A5ZA 1FK8A 4NBWA 4UEJA 3R3JA 4K6FA 3HG7A 2QRJA 2BGKA 4NBRA 1PL7A 4IJVA 1QR6A 3GF4A 1PJCA 5G4LA 2XF8A 1YQDA 2ET6A 3GEGA 3I4CA 3GVCA 3JQ8A 1HL3A 3GDOA 4UVEA 3FD8A 4L76A 4J7UA 4R3NA 3T7CA 4TKLA 2FR0A 4BKUA 5A9SA 4FC6A 5KTKA 3OBBA 1XDWA 5TLSA 5COBA 3GQVA 3RFXA 4O1MA 5DOZA 3SX2A 4WCFB 3ANLA 1ISJA 1GU7A 4NJOA 4Q3EA 3K9QO 1BW9A 1ENOA 3WSVA 4RQUA 3IJPA 4D43A 2DTXA 4KTTE 1H2BA 2DAPA 2BMAA 1GQ2A 4CUZA 4CQLB 3A4VA 3EGOA 4RLHA 4W6ZA 2GGSA 4CM4A 4U6QA 4YQZA 1H0KA 1WLYA 8LDHA 1DAPA 2C59A 3WR5A 4D41A 1GY8A 4O59O 3OF2A 3WS7A 3L9WA 3V2GA 1UP6A 4NPCA 3PPIA 4CMBA 3RC9A 4R4JA 4J3FA 3WGIA 3UVEA 4IPTA 2CVOA 3L07A 1F8FA 3ZWPA 5DBIA 1HEUA 5ENDA 4MVJG 2WSBA 2NV6A 4PRKA 4J2HA 1LBEA 2DBVO 4IS2A 4A26A 5EN4A 4R9RA 4U8GA 3VPSA 2FY8A 3TZHA 3K6JA 4ZHSA 4BNFA 3GGGA 1LSOA 4CM3A 3SEFA 3LVFO 2ZKLA 5THKA 3K5PA 3GG2A 1SPXA 3D7LA 3Q6IA 4IQGA 4W9NC 3ZWWA 2BRUA 4BNLA 2JHFA 5A05A 2IRWA 1YS4A 4PLHA 5I9NA 1IZ0A 3QRWA 4Y6PA 2HUNA 3W4KA 3GMDA 3K96A 2R6JA 3U49A 4XCVA 2DQ4A 4JCOA 5EINA 1DBVO 4Z0PA 5KCZA 2BD0A 4DMMA 1LRKA 5KOIA 4AVYA 1T24A 3OA2A 5T8KA 3VKVA 3WYBA 3AOEC 3F5QA 4RJTA 3BTUA 3S2IA 1UDBA 1UXJA 3WNVA 4E2YA 5F1PA 4O6VA 2EV9A 4NK4A 4XYMA 3UHAA 1N1EA 3QVWA 2O4CA 4WJZA 1EQUA 2J3IA 2AEMA 2XXBA 5JFOA 2CF6A 5DDIP 6ADHA 1HSZA 4OQYA 3RUCA 5TT0A 5CG1A 5JO9A 1SOVA 2TMDA 1EUCA 3L9XA 4DYDA 4FIZA 2A94A 1EUDA 4HNGA 3V5NA 4UVHA 4JX8A 4J7XA 1GEEA 4Q39A 2QRKA 2VT2A 4BGUA 1DRVA 1UR5A 3RWBA 1F14A 3WDSA 3ONFA 3DBHB 4FJ0A 2W98A 4TRNA 2Q3EA 1HE4A 1Y5RA 3D64A 4NZ9A 3DFZA 3RQSA 5AXBA
chains in the Genus database with same CATH superfamily
1R0ZA 2QGZA 1PD0A 2PUWA 3C7KA 3NHKA 1SBZA 1B23P 2X8BA 3KD3A 1IHUA 1YZ3A 4INPA 4KQWA 4RJIA 4JGGA 3C3YA 4G0YA 1E0JA 1QHXA 5GWXA 1W47A 4PAOA 7MDHA 3CN7A 3K7EA 2J30A 5GTDA 3O93A 3SS8A 3FCOA 3VR5D 3VPDA 3G8YA 1WSAA 4U3JA 1YUBA 3QBDA 2HLDA 1D6NA 3E81A 5ALEA 1AKRA 3MAGA 2IA5A 1ZAKA 3LCMA 4OM7A 5M3BA 1FDUA 1X3LA 4AWBA 3AJ8A 4KWEA 2X0FA 1N5OX 2ZTMA 1GTL1 3GJ4A 4HZIA 1E2LA 1ZR4A 2ZUBA 1E6KA 4JUDX 3WKDA 1GILA 3KJIA 1IBKB 5FWYA 1N3IA 3CF2A 4B6QA 4AS1A 4ND6A 4KPUA 4FYIA 1P4AA 1EWTA 1XNJA 1R18A 1OI4A 2HXGA 5FWXB 1T1EA 1JEQA 1XQYA 2I1VB 4YJ2F 1G0NA 5FV7A 3ZQ6A 1JVNA 1FNMA 2EU8A 2ZPUA 4OP3A 1FVFA 2DULA 3I12A 3NEJA 3K0CC 5AM5A 4I4LA 1ZH2A 2PGDA 4Q24A 1LWNA 5F3WB 1CQIA 5LM3A 1TUBB 4YRLA 1CUSA 5ED0A 1JHMA 3LC0A 4LC1A 3X2FA 3H9GA 1TVCA 5BWNA 1AMUA 2Q4EA 3FMIA 2O8CB 3W8RA 1U0TA 5H9WA 4C7KA 1DEXA 4EHJA 4BS9A 5BSEA 4FLEA 2DOKA 3AETA 4EJMA 1O95C 1K9SA 1K5DA 2MYTA 1RCTE 3FOWA 4YWJA 4NSNA 4J91A 3RBZA 4F60A 4GH5A 4OQQA 3CF6R 4QTZA 5H1YA 3RREA 1AUXA 3TRIA 2PEZA 3KYDA 4FU0A 1LX7A 1XB2A 3LOPA 3OCCA 3ZXYA 2JBAB 3WWCA 4H1UA 2I0FA 1GFIA 1IZZA 1LDGA 3I76A 3SYKA 4EF6A 5CD1A 2PX3A 5FOWA 3UG6A 2CXTA 2WUDA 3N2NA 5FP0A 5BQ5A 4ERNA 3NWOA 3LUPA 5JAUA 4L8WB 1EFTA 3EPJA 3SWWA 2YOGA 5HJ5A 2OFFA 3T3DA 3A4YA 3AMVA 4HUTA 3QXGA 3M1IA 4DS3A 4B3IA 5AVQA 1WZNA 3EGDB 4KACA 3G8AA 4PGAA 2OO7A 3FPSA 3GT7A 4QSMA 3WBKA 1IPEA 2NSJA 1D3AA 4V2IA 1YFJA 5JADA 3ZGXA 3TS1A 1XZFA 4FE3A 1VKJA 2HXYA 4DMCA 3LNCA 5K09A 1SZJG 2Y8EA 2ZYVX 1SXJB 3EC7A 3P2MA 4E4TA 2O3JA 1UDAA 4A1OA 2HWYA 1J1UA 2V03A 4QFBA 5JXIA 2WNSA 1U8EA 3L0IB 3ZE9A 1NFFA 2G0TA 4QRDA 3QX8A 3AUUA 5JQGB 3RSZA 4EW6A 3ZS9A 3CZRA 1DAHA 4KGXA 2KMLA 4KQFA 4N65A 4A3SA 3O03A 4EARA 1VCMA 1FNBA 2J6HA 1Q0QA 3ESDA 4K87A 4Q16A 3A11A 3DMYA 1Z88A 1Q3TA 2F3SA 1GGHA 1RMYA 4GI2A 4DR4B 4NPHA 5CHYA 2Y99A 3DL4A 1E2UA 3RAFC 1NUQA 2I4NA 3GRYA 1VE3A 3VDNB 4WY2A 3ZPXA 3SSNA 4BQPA 1RPTA 3JX9A 5DLDA 5CEEA 1BOOA 2JI7A 4LYGA 1GU0A 3UXEA 2QBYA 5HIIA 3TW6A 5L95A 1P6UA 2XCSB 3GJYA 1KQ3A 2X3UA 4CIBA 3QFFA 3A1EA 3W8DA 3RC8A 2I65A 4WH0A 3P0IA 1TYDE 2D5AA 1RPJA 3E4CA 4BMYA 1VJDA 5JW6A 4I5DA 4BLVA 4FVTA 1BIFA 5AHOA 1A9XB 3ZZUA 4XUEA 4LZJA 3P2KA 4TT3D 5SYMA 4Y1RA 1J4AA 4CF6A 1TJ5A 1XK7A 2H2WA 3K0CA 3IILA 3DAOA 2FYTA 4JXKA 4CQMB 1OXSC 3KC2A 5ALKA 5A2GA 4WGGA 4MP8A 1DHRA 1R0SA 2VH2A 2FWMX 1HFKA 1VM6A 2G70A 2CFCA 2QYOA 1VJ0A 4HQKA 2P0AA 4WKGA 3SHTA 5BR4A 5K0SA 4ND2A 1RI1A 3OQ1A 3ZCRA 3MBOA 4OREX 1E1LA 2ASEA 2LWIA 3LLVA 3OJLA 4GQBA 3RT9A 5D6OA 1I3CA 2ZE6A 3V1LA 3EN0A 3WLIA 4ZOQI 3BRWD 4KXUA 1DHTA 1BMDA 1N7JA 2DMRA 1R6BX 3NHYA 2B9VA 1PJTA 2HXSA 4CF4A 5JANA 4BMXA 3RYCB 2XUQA 4C4AA 2B7LA 1RJDA 3FNIA 4CKWA 1Y3FE 2IEZA 2WHPA 4FTWA 3MJRA 2QQ0A 1E3EA 3A6LA 3UUFA 3M3DA 3ZHCA 3T7RA 2PN1A 2OHGA 4JSYA 5EXEA 3TSAA 5JEEA 2QUJA 1YBAA 1XJCA 2V4MA 1Z28A 2XA2A 2B37A 3MW8A 4KNVA 5D85A 4DLWA 2QTZA 3UV6A 2QV0A 1N75A 2ONKA 3DZKA 4XSHA 3HGTA 4DIMA 4JBXA 5B7GA 3L7MA 3JD4A 3ZY4A 3Q3JB 5EE1A 3QZUA 3ICCA 3QPBA 4V38A 4LYFA 3KHSA 2QG9A 2HNAA 4DDTA 4J0KA 1ZBDA 2W2OA 2ZETA 2AJDA 1L7QA 1FYDA 2IT1A 5ARCA 2ZI3A 1FA9A 2H17A 1MO2A 1YMUA 2QW8A 2FWBA 4MUHA 3UWPA 4HQRA 3ABIA 3DHVA 2PQMA 2VYQA 1PAUA 1VMEA 1IY9A 4K81B 2NZUG 4D4LA 4GYWA 2HYDA 3HM9A 2AA3A 1C7RA 2EJWA 1JHUA 1NLMA 2AFVA 3Q8KA 3ZDYB 8OHMA 4JASB 4AI6A 1MAVA 4HD8A 1IWPB 1H2ZA 2NUPA 2QAGB 1E3TA 2D0PB 1ORIA 3I05A 4BMOB 3D5EA 1V8FA 2I87A 4DL9A 4M9UA 1G7SA 1GR0A 1G5TA 5KC8A 3ML1A 5E0OA 3UJBA 4BLPA 5CEFA 4O63O 4OA5A 2R2GA 1VBNA 1T4CB 1RWOA 5I9IA 2WE7A 3DYBA 4JUFA 2D06A 3WDKA 2OBMA 5H4GA 5ICFA 4FGSA 1PR5A 3KZXA 1WDLA 3WYEA 2WJPA 3L7BA 4KH1A 3IEIA 4HDSA 1MA3A 3O4FA 4I46A 3OFVA 4PYOA 4ZMRA 1IN8A 1M2VA 1UUFA 4CKXA 3C6ZA 2DPYA 2HNKA 1X94A 1AQIA 1IN4A 1BFUA 1IY0A 2R5FA 1KI3A 4G4SP 1U8FO 4GM4A 5TS3A 1G3MA 1MV8A 1TRHA 1FFXB 1GZ7A 2XHEA 4CI0B 3SE0A 5K6AC 3U4QA 1H9AA 4Z86A 5IJWA 1IBCA 1OJLA 3R3ZA 1B8PA 2HJ9A 4L4XA 5ADWA 3KE8A 3RRBA 4BWVA 4HH3C 5F4BA 1XF1A 5TGTA 1PFQA 3AOGA 2V7VA 5CIYA 4EFKA 3LOQA 4CFYA 1ZVMA 1ACMA 1G0OA 4D8VA 4J3NA 3ANSA 1SBCA 1NOIA 1JG7A 1Y89A 3TRKA 1G7CA 4ZDIA 2KE5A 1J8FA 5AKKA 4EMBA 5LP6C 3MYYA 1NHGA 5IM4F 4JV5B 4V0LA 4BAZA 4RVCA 4H16A 4LK3A 1S7GA 4PIPA 1MRNA 2ZRBA 3M3HA 1EP2B 4XB2A 4CWAA 4HJRA 4UFNA 2QN7A 1CUIA 2YW2A 3CPEA 4HX5A 1KAQA 1WTAA 3OETA 4RUKA 1SXQA 1RI2A 1NR1A 1OFUX 3TD2A 1CUCA 2IZOA 2R1VB 1SCIA 2PKQO 4X3CA 1YRLA 4ZAWA 2F1IA 4IP0A 2V7PA 4QVKA 1S2MA 2VPZA 1SM4A 2VF5X 3BXFA 5D01A 4BVEA 4FNAA 4L7QA 1MH1A 2G06A 2C3MA 2PLFA 4G4JA 1L4GA 1RI5A 3KPUA 4GRAA 4HVLA 1KI9A 3HJNA 2ZBQA 1RP7A 3RAJA 1W6RA 2NQTA 6GPBA 3L06A 1KEWA 4RCZA 3CVVA 1LLCA 4JR0A 2OCGA 4YRCA 4BGIA 1C3XA 2AB0A 4W5HA 4MTLA 4B3SB 1MOSA 1CERA 2DWPA 3KEOA 4L4SA 4ODIA 2CV2A 3AR6A 4GMKA 2JGAA 4ALNA 2NADA 4I81A 1T4BA 2XIQA 4MYUA 4UUAA 4P7BA 3BH6A 4FI3C 5T64A 3SSOA 4Z51A 4K3VA 4CEIA 2Z04A 4YAOA 5AOCA 1MN6A 1SUIA 2HMWA 1NXPA 3HUDA 1B3BA 1CB0A 3C15C 4FHCA 4ND8A 3VZDA 2OCAA 2X23A 3T1QA 1OXMA 3TSOA 2DB3A 3GLRA 4OJTA 1YDEA 2M1ZA 2ZP1A 2AE2A 4HP8A 4Y2HA 2PGIA 1AGPA 2HGSA 4JWKA 5F76A 2O1XA 2G9UA 5BSMA 2O1SA 1FW6A 3LYAA 4RJJA 4JI1B 1GV1A 3HXTA 4Q66C 4AG6A 3T9EA 2WF6A 3ZZTA 3NGXA 1XK6A 2OECA 2XGGA 4N39A 1WBDA 4JI2B 3NIWA 4FFRA 4FFSA 3ROTA 4D3FA 1XZKA 1G5IA 1OBOA 4C0AC 1VCHA 1YB1A 2H1HA 2PZBA 3BHJA 5JI3E 3SJCA 1X8KA 1QK3A 1VKOA 3HQ4O 4GOLD 1S1MA 3WA7A 5ESWA 1B7GO 3OBIA 2ATIA 4B82A 2V4UA 2XJ4A 1C0PA 3WGUA 4IMPA 4QUDA 3U31A 1ETHA 4EF4A 1G7TA 2JZCA 2NT3A 2X5JO 3CNOA 3M6MD 3RC3A 2AMVA 1AGXA 4ENVA 1Y4UA 1MB2A 3IC5A 2V7WA 3OZSA 5HM6A 1LBSA 1DQZA 2Z30A 3GFPA 3LGSA 4GSKA 5H81A 3DHWC 4LQDA 2X5OA 4JQOA 5SY9A 1KZYC 1FNNA 3R7SA 3I9FA 2WHYA 5LOVF 2FRVA 3QYJA 3TSWA 1JG6A 1Q3KA 3W6UA 4RIIA 5LP6A 2Z8XA 2VJKA 3KJZA 4FBMA 5BT8A 3HXKA 3HR4A 1E59A 3DV9A 4I1OA 5CB6A 4CT0A 4M7PA 1T8UA 2A30A 3BFKA 1OIXA 1N6KA 3AY7A 1W0JD 3ENQA 3B12A 3GEDA 3PPYA 3UXHA 4GP9A 3O3NB 1QO0A 2XNSA 1KRXA 4RTMA 5G0TA 4EO9A 3ZN2A 1LJLA 2ZSAA 2YWJA 4FYMA 4JL6A 2OFWA 1ZK0A 2QR5A 3M4XA 5DX1A 4G23A 4RHYA 1KY3A 3OOSA 3TGPA 2WJAA 1IN6A 1MIHA 1PNTA 4U1RA 1CUZA 1CEXA 3B52X 3FPEA 3EXHC 1XKQA 3M5DA 3GJTA 4L2IB 4UHHA 3V4FA 2FZ5A 1Y1PA 3AWIA 1YOVA 4KAXA 4ND1A 5FO0A 3WJAA 3KK0A 4CG2A 4GZ3A 3B9RA 1GFZA 1XWFA 3NGLA 2PZJA 1XD9A 3X1YA 5A04A 1FQKA 5BSGA 1GPUA 5IFLA 4HXFB 2J32A 4I66A 5A6SA 1K75A 4WECA 1XL0A 3QUTA 1BVRA 3DLCA 4IWXA 5A7FA 5TJHA 1WXQA 3EF1A 5A6VA 3PHHA 4JMPA 4N47A 2DQYA 1SC3A 1KI4A 1KKUA 3BA1A 1DX6A 4D4HA 3BGWA 3RCBA 4OHPA 1V43A 1J24A 2VHZA 5E3IA 5KTOA 4LZOA 5HEKA 4I4IA 1KGDA 4C0BA 2VDWB 4R2XA 2VT3A 3ROPA 4AY2A 3EDQA 3LUJA 1XJ0A 2NUAA 4J3JA 4Y30A 3SKYA 2IYTA 5K0NA 2VZ8A 4EY7A 5AW4A 3MINA 1QH1B 3M9LA 1FDTA 1HLGA 4LYHA 1P9NA 5DBOA 5E7IA 4YT2A 4O4HB 5F9FA 2BDTA 1NQOA 4XWAA 4LWPA 4XUCA 4QELA 4FOSA 2FPOA 3PPXA 1QZXA 2RK3A 3SY8A 3PQ6A 1O7JA 4OATA 4DUZB 3IKLA 4TV8B 4HPJB 2Q6KA 1OSNA 3QWIA 5D3QA 1KXJA 2AC7A 5EVJA 3PJFA 5GJWC 3TNYA 3HFRA 3O4IA 3OZXA 4LMRA 4CKCB 1Q3HA 2FNAA 2VSOA 2Y68A 1KPHA 4KRXA 2VHWA 4IVNA 4QDTA 5HJ2A 5CDGA 4QAJA 2RGRA 3LZCA 5FHRA 4GDFA 4AP6A 2WA2A 3K31A 3PJDA 4TV9F 4DQXA 2JFHA 4N40A 4ZQGA 4MVJI 4Q9KA 1O5IA 1U7WA 1RKUA 4HBGA 4YP5A 3T5GA 4Q4LA 3WLHA 5JPDA 4RK0A 4AYXA 4TZ6A 2X7XA 4QGAA 2DH6A 2XNHA 1EVYA 1TTPB 5IZCC 3M49A 3ROKA 2EBHX 1RRCA 3VSDA 3L1IA 3TW8A 1HKHA 4GRIA 2NXNA 2VKTA 1W87A 3AIOA 1XZHA 1Z5PA 3NOOA 4X24A 5IAGA 4AFNA 4QEZA 2NMVA 2D0DA 3SEZA 1WXIA 3N9IA 1QKKA 4UNQA 2GZMA 3DC2A 2F1JA 3WMGA 4BZZA 1IVSA 1DMSA 2J9ZB 5FI5A 2C4UA 3CO0S 1ESEA 3GPBA 1KA9H 1EFDN 1KOJA 2QTWB 4KNYA 2FR8A 2Q46A 5K3AA 4RZHA 1LPNA 1FFSA 5G4KA 5FUQA 5KX5F 3ESBA 3T15A 3OSUA 1OZFA 2YXBA 2ZAIA 1O0BA 1ZICA 2WSYB 3KCQA 3EXFA 1CV2A 2LGJA 3Q3VA 1WZIA 4LX8A 2PJUA 3U7QA 2IY8A 4C4PA 4G65A 2J4FA 2Q4TA 1N6IA 3C1AA 1AOXA 4RMHA 1P1HA 3X44A 5BT9A 3ZV7A 3NT4A 3EXHA 4MIYA 3P45A 1CZKA 4XJSA 4B71A 5JTTA 3MGGA 1JV2B 2Y67A 4IH4A 1SCUA 3V1NA 1VG8A 1G19A 2BTQB 5EWLB 2WIDA 3M8KA 1GT6A 5HKKD 3T4XA 2FZCA 3WJ1A 2O6HA 3JV7A 1E3WA 2I1QA 2NU8B 4W5TA 3AFHA 3BFXA 1A7KA 5E6RA 1XEWX 1GTJ1 2W2MA 5DP2A 4DB4A 3V7UA 2J5BA 3MOSA 3HNOA 1OFVA 1XQ1A 1I2MA 3MBKA 1R7RA 2GPJA 4BNJA 5A4FS 1ZM2A 3OJ0A 4K7JA 1SH7A 4RKRA 3AUTA 1UXHA 4MPPA 1Z0AA 2MYUA 4YAUA 4YV1A 4JU9A 2R3SA 3W8EA 1MO5A 4KUHA 4KXYA 4XJVA 3BICA 1ZGBA 1GKIA 3D4PA 3K0HA 3SLRA 3ZDEA 1DQRA 4Q9HA 1WZUA 3ADBA 1CDZA 1NI3A 4EUEA 2ZRDA 1N1DA 1S2OA 2MMCA 1CR6A 4NESA 1P29A 3IPXA 4E5VA 1VI2A 2W6PA 2XYRA 4LJ5A 3RT7A 4EW1A 4TVSA 1EE1A 3D6FA 3I8OA 4KR0A 3UAXA 1A4RA 4F6LA 2LDBA 2MHCA 2ABWA 2CL7X 3IIKA 3V42A 3Q10A 2OAP1 4IIHA 2AUMA 4AS2A 4GAEA 4NNJA 4B48A 5JXGA 2CJPA 1DFGA 5FOXA 1COWD 2HW8A 3C24A 4M0FA 1BQ3A 1HUQA 5D2CA 4B87A 1T5IA 1BEZA 3A6FA 1E1YA 4FKBA 1SUEA 2CXXA 1I7QB 3VZRA 1I0ZA 1UWKA 4JCCA 5FO1A 1NXSA 1X80A 1OVGA 2IIPA 5LXTF 3VYRB 1EJ2A 4F5EA 5A5GA 2FMTA 3NRCA 5TT1A 1GPNA 1EFPA 1TVMA 2VQSA 4PYNA 1AK9A 4BO2A 1X6VA 3LKDA 4HGYA 4M1EA 1YRBA 2WFMA 1D0VA 2QYTA 3CZPA 3NUGA 2VA9A 2CJWB 3QG1A 4BY9E 2C82A 4QOEA 5KI6A 1HDGO 3E1GA 3BTSA 1XFAA 3FKSD 3LQFA 1O89A 4JP8A 4D5GA 1Z0ZA 1W2WB 2HSEA 5JXWA 3MMZA 3S8MA 1H1TA 4UQOA 3D1JA 2JIBA 3VTAA 1Y8ZA 3I2JA 2VTBA 2IEAA 4YP6A 5AI4A 1HA3A 1PLJA 3COVA 3GLFA 5AJHA 2BMWA 4DCOA 1QQ5A 1QZTA 4DV6B 3OZEA 1YS2X 2PNJA 3CVUA 2QT0A 1NONA 2YUIA 3MCAA 2GJAA 1JTEA 1BRMA 2W4MA 3BWEA 1Y34E 3LA8A 1E5DA 1GQOA 4D4GA 1CY7A 1NHWA 2F3TA 3RI3A 2FB9A 2X86A 3OEWA 4W9MC 3CKKA 4JU8A 1FFBA 2P6OA 3EPHA 3ZC3A 3SIRA 1HRKA 1TK2A 2V7QD 3R4CA 1ESDA 4ISBA 1YVEI 4Q9JA 1JG4A 1CIPA 4E2YA 1TQ4A 1Y82A 4K6KA 2I2BA 4B3GA 3LPDA 3OKPA 4RFSA 4URHA 3NWJA 5AJWA 2CC2A 4AMVA 4ED9A 2B69A 2L0XA 4YJ3F 4ZZ2A 2CV1A 1A9SA 4HDMB 1E2DA 2UYGA 3DMNA 3GB9A 3L6EA 5FA5A 1IXYA 5TC4A 2IQ5A 1A5AB 4ZHQF 4P3PA 2GESA 4YRTA 2SECE 2ZTHA 3CEAA 1JA0A 3DFFA 3TR6A 1KZ7B 1LSUA 3ECCA 4II7A 1YNSA 1PDWA 4RTJA 2G77B 1DAGA 1ZEJA 1NBIA 3LY8A 4P4LA 3W2IA 4MJLA 3SZ3A 4ZVVA 3DVSX 2GRAA 1CTQA 1O0SA 1TVKB 1QH0A 1VL0A 2Y77A 1JIUA 4S0XA 3CNHA 1XJ5A 4Q3DA 2G9NA 4D3XA 3KQNA 2E6UX 1GYQA 3KLNA 2XSZD 1P8AA 1IMOA 3NFYA 4QQFA 2ZR7A 4EI2A 2CYBA 2WTEA 4E7PA 4XZ3A 4A8JB 4TTAA 4HTFA 2CNKA 2WG1A 4U02A 2IY9A 3U0VA 4RX1A 5C1IA 4AJ1A 4E7OA 4LRTB 5BR7A 1DWUA 1IEVA 2ZQ5A 3K2BA 2YY7A 5EZYB 5KBYA 2B4YA 1I7DA 1QB8A 2WTBA 3B70A 5AHXA 1EA5A 3HK2A 1J0DA 1OPRA 3WRXC 4TRRA 3MJTA 1VJCA 2O0MA 2E4WA 2D5BA 3A9SA 3F6RA 1YBHA 2NU9A 4MS3A 2WUVA 1J0EA 5AFSA 4BAUA 2QUAA 4HT3B 5ITWA 3R7WA 3SR3A 1LDBA 2KB0A 2VL7A 1OYVA 3BDIA 3BEDA 3CUUA 3T3MB 4R71A 2F43A 3CEHA 1M0EA 4HN2A 3UUWA 5DBGA 2GF2A 1P1CA 2JFXA 2NM0A 4A5SA 2WF9A 2I22A 5ALQA 1I2DA 4P08A 4EYKA 5HVNA 1Z7BA 1GV0A 3S0JA 5I01A 5DTIA 2ZATA 3U4MA 4ZC8A 5KCMA 3RRZA 5BMVF 2CK3D 4Z2YA 1UJBA 3MMNA 3RUHA 1WU8A 1FXWA 3NW9A 2IOQA 1F38A 3AW9A 4U0JA 3ZGNA 5EKSA 3IIEA 3DOEA 1NQUA 5BNTA 3LUAA 5CXQA 1IY2A 2EEZA 1H3NA 4TSKA 4IVPA 4EDHA 4ZRNA 5F33A 4MITA 3JVDA 2M6KA 4JDPA 1ZGCA 4ZOCA 3D4IA 3T1VA 4WOPA 3CCCA 2Z2ZA 3GCDA 1L6RA 2CVQA 4A6EA 1WUHS 1H6BA 1B26A 1YKGA 3IP6A 4ZI5A 1AA9A 1IWBB 1U63A 2VDQB 8GPBA 1H22A 2V0CA 3P5BA 5EMNA 2HZ7A 3P96A 4R7GA 1AHPA 5FPYA 1RQRA 2AQKA 4IUYA 1FSSA 4BMSA 2FXVA 1JEAA 3E27A 3IEPA 2WQ6A 1FPQA 3KYCA 3B2QA 1UC9A 5DNEA 1DKOA 1FUUA 1Q1EA 4AN4A 1V2GA 4IF6A 5LWQA 1V5FA 5CDTA 3X2EA 2Y1WA 4LYDA 9LDTA 5JHGB 5JOQA 1XPRA 2Y1DA 1C4WA 4GO1A 2XBMA 4F0JA 4MMZB 2B1IA 5CR9A 3GN2A 2BGUA 1ENYA 1UMDA 2FH5B 4P6VF 3T0IA 1NJ8A 2FK8A 1C1HA 4Y0VA 2A5JA 2UUCB 2PL5A 4RSHA 4RGQA 2GN6A 3HL4A 1OZHA 4WN9A 1M8GA 1RWNA 1U2PA 2CEAA 3AI1A 1YH3A 4DLNA 3PA8A 3FDZB 3NRJA 3PHLA 2ZSUA 4XWTA 4QRIA 3DAYA 4BX9A 5BSWA 4GW3A 2VHTA 3IQZA 3OO1A 1GDHA 3FPBA 2IWHA 1GNQA 2ZQZA 1KHTA 3KU4A 1GP2A 3PWTA 2G4VA 4LXYA 4D9MA 3RSHA 4S05A 5I5EA 3DV0A 1XMIA 2Y4NA 2OSVA 1UEXC 3I1JA 3W7BA 4YK7A 2V7GA 3M70A 5KNDH 3UPUA 1R4ZA 3GFFA 1Y6QA 1QXSA 5KJCA 3C87A 2FQYA 1UBGA 2VEDA 4L5CA 2K6GA 3WB2A 1VIDA 2GZDA 2I62A 1NJGA 4RL6A 3BMQA 4YBZA 3VR2A 3H04A 4XI9A 4ZRMA 3RNLA 3UJ3X 9MHTA 4IMJB 1SAYA 4KAJA 4IXMA 1AKQA 3HUEA 3U37A 2OD2A 1FP2A 1QIDA 1SU4A 2Q29A 4RWZA 1D7AA 3HBFA 2SICE 3WFZA 1CVLA 2XODA 2WQZA 2WU4A 4IDOA 2ZS8A 4S1WA 3RAPR 5AVWA 1S7CA 3ANYB 2EJBA 3T54A 4BN5A 4CJXA 5KMGA 4LYAA 4L5YA 2XCTB 3IPAA 1L4NA 4NJEA 3GRPA 2BC9A 3I6IA 3OOYA 4NENA 4BVLA 1NE2A 1JVBA 2GA8A 5JD3A 3RBVA 4MEAA 1EFHA 2ZJ2A 1J25A 1CUWA 1EWKA 3SOPA 2XCQA 3ES9A 3H19A 2M6SA 4HGRA 3LCVB 4HYYA 2IZ7A 4TM7A 5G41A 2Y05A 4UTNA 4ZCTA 1ZK3A 3WMXA 1SG9A 3N2GB 3AP3A 3OP1A 4DE5A 6NULA 3SHVA 3L8ZA 3D3WB 5J2TF 2C31A 3VR4H 3VR6H 3SZMA 3UMGA 1V96A 2W8BB 2AH5A 4KC0A 3SCZA 2RE8A 2J7PD 3VR3A 4TTRA 5ALWA 3C8MA 1JDVA 1Z6AA 2FUNB 4LHWA 2PRSA 4RY8A 4ARBA 1GPLA 1QDLB 2VCHA 3PNOA 3Q2IA 1VL8A 2GBFA 4KO1S 2I6GA 3DL2A 3R0QA 4W7IA 1ZWKA 4KMMA 1E0DA 1T9DA 1V47A 1WWKA 3O21A 1KDZA 3N2KA 4ITRC 4GYJA 1HK7A 3RADC 3V4OA 4Q4CA 1VE6A 4CM6A 2E55A 1JFFA 2JFWA 1USWA 1UMKA 2OT3B 4DIBA 2GPSA 1LB1B 5IVPA 3STYA 4E3ZA 3GJ8A 3OQVA 4HAOA 1TUIA 3T06B 4I3FA 3II6X 4ENSA 2IU6A 4EQZA 2XI4A 5BN3A 4BCBA 1Z5GA 4LPKA 1TCCA 4FGUA 1YR2A 2PU7A 4FR2A 3L0PA 4G5OA 1BW9B 4QHTA 2O7NA 2Z6AA 3MUEA 2P9HA 4HAIA 1DLIA 2WKWA 4PR0A 1A8QA 4ZOAA 3VH4A 3FYUB 5K6RA 1IHYA 4A2QA 1ZH4A 2QE6A 3U1BA 5P21A 2HRZA 2FHSA 3MCVA 4CR8A 4C2TA 3GLFE 3RIGA 4QEDA 1H3EA 3HDTA 1P0CA 3QFHA 3E3OA 1CJKC 1ODTC 1CUYA 2AVNA 2QVGA 2YQ5A 3DAGA 3OPYI 2OILA 4JVLA 4B2LA 4CPDA 1RHKA 2ICAA 4ZXFA 4BO4A 4D44A 5J3JA 5BMOA 3ZWMA 1CBUA 1NY5A 3PUHA 1LW6E 5K0GA 2GZAA 2QQ5A 1E2EA 1F0NA 1P7ZA 3GCZA 2ZT5A 2I4TA 1I1NA 2N9UA 1NFRA 4UMVA 4JT4A 2JGEA 3TOSA 1U5CA 4YX9A 4CXMA 3HDHA 1XNQB 2V6MA 2IZZA 3LPMA 4FR0A 4O29A 4GKJB 5H0IA 3IXMA 5E9AA 5FLYA 3ZNOA 2IPMA 5ALSA 3VVBA 1RIIA 2E89A 4QODA 1DGQA 4LJKA 3QSGA 5EWJA 2E1RA 1UDWA 1VJRA 3ET5A 1CDDA 2RHBA 3TW0A 3U9TA 2ZRJA 5HKLA 1QANA 4HEA6 4PU0A 1HTBA 4IIUA 4N6NA 1AVTA 2AN4A 521PA 1OU4A 3NYIA 4F6RA 5KNDA 1KRWA 3G9UA 4IRUB 2PMWB 1K8XB 2O2GA 1PE0A 2LE0A 1NULA 4OAQA 5DM4A 3DJFA 3D3JA 3LX6A 1W44A 2HPZA 5HA5A 3IP9A 1KAEA 4R1SA 4DM3A 5TMPA 1KEEA 3CRMA 2O8FB 1UQRA 2VDMB 4BQSA 1LC3A 4P7GA 4EP1A 4EG5A 2FWNA 2XUPA 3R41A 4AQDA 2AV6A 2ZRGA 4F8JA 5FR2A 2KI5A 5K03A 1JDTA 3ILSA 4ZCQA 2Z6UA 5ALYA 1DBRA 1QCDA 2F62A 2WF5A 3WIBA 4C87A 3BG5A 4ZVTA 4TYYA 1AKVA 2OB2A 4CG1A 2X0JA 2J5KA 1EFVA 3IVCA 3KDSE 2OV2A 4IKEA 3ZHRA 1G8JA 2JCBA 2PD3A 1A4IA 1L4KA 3OJWA 2P2DA 5FTKA 2XV1A 5H70A 3H1TA 2DCMA 2LV8A 3ZNNA 1WUJS 1M8FA 2GJ8A 3QEMA 1WUYA 3MGAA 1AUQA 1Y7PA 3F7TA 1XZLA 3KRTA 1XXLA 1DT5A 2Q99A 3VR4A 3VR6A 1SCQA 3N2IA 2XD9A 4AN0A 1ENPA 1T34A 3HVKA 1C7ZA 1AKWA 2YMLA 1OI3A 1QJCA 1YB4A 2H1IA 2WMNB 4HSEA 1X2BA 3ZD9A 3FYDA 3KT3A 1U2EA 3E05A 4DPLA 2YS7A 1EUDB 1GRRA 2LKCA 1EVLA 2WSSD 3OAAA 3NC0C 3FPCA 4MKIA 3P4XA 3G79A 3TNJA 2AD5A 2UZ1A 2GZSA 4FFDA 3FH0A 5F52A 3N7UA 2OESA 1KEVA 4LRUA 4Y1EA 4R40A 2HBZA 1DAOA 1OT3A 1NC1A 2QXTA 3FIUA 1Y3AA 3A1UA 2PWZA 2Y0EA 5REQB 1AU9A 1J2TA 2ZWOA 3AJ9A 3N8NA 2D8AA 5FUMA 1Q84A 5L4SA 1GAWA 4W7SA 4ZAXA 3SX0A 1ETUA 4BE9A 1IHOA 4H6VA 5FNZA 2CZCA 2QRVB 3O8OB 2XZTA 4HMOA 2QRNA 4YCMA 1YCHA 2OLJA 1WXWA 1L5HB 4UFOA 1NYTA 5FLKA 2ECQA 5LYYA 1GZVA 2OKCA 4YRFA 4YRBA 3URMA 2GBPA 2JIQA 2VOEA 5KTRA 1MW8X 4XOUA 5CB8A 5JNSA 2IHTA 4B31A 2EG9A 2G5PA 3IEUA 3EXIA 1XIVA 4ZMBA 3E70C 2CXOA 4JFAA 3OY7A 4BEVA 4QPNA 1DQYA 3VO2A 5JWRA 1AK2A 5EFZA 1RWQA 2BZ0A 1CZLA 4FNMA 5C8YF 2Q07A 3IHWA 4ZYYA 3M2PA 2P4EA 3GFOA 3HP7A 1SK9A 5EKTA 4PPNA 4MUAA 1CD5A 1OIVA 1XRNA 3L0OA 4WUTA 4LDAA 3A2KA 3DBHA 1D2NA 1XJQA 3COZA 1Z22A 3GJ5A 3RUDA 3VJRA 3S4YA 1QCCA 1NVTA 4L9AA 4MRRA 4XIFA 4IFBA 2AMFA 2IPXA 3RS7A 3K70C 3COSA 2Z2YA 3IT0A 1BJKA 3UMFA 3CIFA 4GL2A 2Y1OA 4IIJB 1KIFA 3BQNB 3RK1A 4NV3A 2PSJA 1EDBA 2NZVG 5DHAA 3UO8B 1T29A 1YQQA 4C21A 5CDSA 3VVLA 3KB6A 1GUZA 1R00A 5BN4B 1X87A 5FBZA 4J4TA 2E4YA 2JARA 3I1FA 3OE4A 3QYFA 4UJ5A 3UIEA 5JUWA 3ABOB 3FCAA 3R3UA 4FXOA 3G5MA 1AURA 2XYQA 3T1HB 3IBYA 3VVCA 2G82A 1TKAA 5THXA 1XNRB 4AMBA 1SXPA 2PE5A 5JISA 3ORFA 1X7YB 2QLBA 4FMCB 1ADGA 5JJCA 3AUFA 2JEYA 3I83A 4MUKA 2AMLA 1HQKA 4LG1A 3Q88A 1LBTA 2EL7A 2P9FA 3AVOA 1RBZA 2OFXA 4EWLA 3LLUA 3N0TA 3PRYA 2WYOA 4NLLA 3UB4A 1UBHS 4FOOA 2QMHA 5EHZA 3TBKA 4NCNA 1AQ6A 2QTRA 1D2AA 4I8XA 4WNAB 4CR6A 2RI1A 2WAXA 2ONJA 1DEAA 4R2IA 5EWMB 1Q16A 1J8YF 4QULA 4UU8A 1NMXA 1DRKA 5K8TA 4XD7A 4LV8B 1PZGA 1ZIYA 2H9IA 2KYRA 3C5CA 2ZZKA 4Q7MB 1TUBA 3SC4A 2NPOA 3SC3A 1JEJA 3NXKA 4YXWA 3NP9A 4C7XA 4EGSA 2TMGA 5KS2A 3ZZNA 1QZZA 4AY4A 4DV0B 3PR1A 2O8CA 1ZLXA 1ZH8A 1PJBA 1U0GA 1IN7A 1DIBA 1BA2A 1XD2A 2BSXA 2IZ1A 1EWRA 2P90A 2ZRQA 3L7NA 3LPAA 4NTZA 4D8WA 2YWBA 3SGLA 4F04A 4F2GA 4NJMB 1KMQA 1R10A 1TKCA 4HO1X 2XWJI 2VJBA 5CYFA 4LWZA 4EHLA 2DWUA 2M1XA 3WRYA 5JJKA 1DG9A 4MSUA 1ORWA 1ZM7A 2OM6A 1G7RA 3VZSA 2VF8A 4FONA 5HZKA 2P1RA 4R2WA 3VUFA 3H4IA 1E2KA 4DILA 1ULTA 3JQ7B 1N2IA 1F7VA 4H3VA 5IN4A 3N74A 4JP2A 5DK6A 4UAJA 2XCLA 5A1JA 2P68A 3V6MA 1IJFA 3V2HA 1HDYA 3GCWA 1XZIA 5AM4A 2ZLBA 2MSCB 1R4NB 1U90A 5LVAA 1G8KA 3RSGA 3WGMA 1GDTA 1KJZA 4KDEA 4UREA 3T94A 4Z2AA 5GZ3A 5K99A 1NBAA 1NTRA 2O19A 5I7FA 2C2ZA 3LDGA 3WLMA 4KSCA 1IIRA 2A8YA 4B9AA 4D25A 1P6QA 1JEOA 2GD0A 3GZNA 3UBTA 1R12A 3NDPA 1IJEA 2ERCA 5GMOA 3PTLA 2BJHA 3M6VA 3VHXB 3VI3B 5DHFA 2QM3A 1SXJA 2GYYA 2XUHA 3W2FA 3NPAA 4GKBA 3WL4A 1GZDA 2X2EA 1WXHA 3EDRA 2IYYA 4DARA 1YZKA 2DH5A 3NM5A 3GH1A 4ND7A 5IDYA 1MQ9A 2VOJA 2VQ6A 1E8MA 2JI9A 1YB5A 3JWPA 2M2IA 4JJ4A 4L3OA 4J1NA 1BXRB 1OFIA 1UWCA 4Q15A 1BROA 1LTQA 3UKOA 3W8FA 2ECOA 1JXAA 2P77A 4LC0A 2HGZA 1YRYE 3GC6A 4JS0A 2QUIA 3MJCA 4LZPA 1ICIA 2C3YA 3C3CA 3WWOA 3G8CA 4EQ6A 5KWEA 4BO3A 3DZCA 3UAGA 3C5WP 5SYAA 4U7GA 5HUHA 1VTKA 3CZMA 3OSZA 1WW8A 4K28A 1K5PA 3F9RA 3P4UA 3Q4GA 1Z13A 4M8LA 4TYNA 2IOFK 1YVRA 2W6JA 1SCJA 2ZDQA 2QL7A 2I6FA 1NLZA 1MJNA 4HV4A 2GILA 4D3YA 4DKJA 2IHZA 4LMAA 3MLAA 1MB3A 1Y6JA 3VTFA 4E1AA 1U0LA 2C07A 3BGVA 2J6IA 4H9GA 4DHWA 5JYDA 2JD1A 5JG7A 1USVA 3D0OA 5D00A 2OM2A 3OVMA 3AT1A 2ZZNA 5LDGA 2VSXA 4BGEA 5GINE 1ZLYA 1E5QA 2RFLA 3O0DA 1XCBA 5IRCD 2VDOB 1UC8A 4URVR 5TS2A 3ZOKA 5C1BA 3E03A 3I5AA 3DEKA 4JP3A 2A84A 4BRZA 1SUSA 3E5MA 4ZI7F 2NUTB 3AFOA 1I36A 1HYHA 3CNLA 3O2SB 5DCUA 3G8BA 4UPVA 3WTBA 4DCMA 2BR5A 1T35A 2GMWA 3AUKA 5FPHA 3DONA 2ZB2A 4EMSA 1F3OA 1Y8AA 5DE3A 2HIAA 4I9NA 3PI6A 4X93A 3MWDB 3RS9A 3VPAA 5CB4F 1KVRA 5IC4A 3IQWA 3Q12A 3VV2A 1VKNA 3ASUA 1YB7A 3EF3A 3ENKA 4JA2A 4O1IA 3D8SA 4DW8A 2JLWA 4II2A 3RYCA 1GO2A 3JYLA 4ZTZB 4FOTA 3OU6A 4TMFA 1NIJA 4UU1A 1JFTA 1J1ZA 3OZFA 4C3UA 4IXDA 3LU1A 2PYZA 3X1MA 3UT0A 2H7XA 3EZNA 1CUJA 4QOGA 4N0EA 3PEEA 3I23A 3SHQA 2QV7A 2RI0A 2RJ3A 2Z9DA 4Q00A 3EQZA 4YMHA 3N53A 4AW9A 2Q4BA 4NNOA 1K2VN 1OLUB 3DZFA 3FCXA 4RVNA 4S1NA 1SXGA 5IJ9A 2EFDB 5JNWA 1QK5A 4CL8A 2DR3A 2B8TA 3HA3A 2QPLA 2GB4A 2B5VA 4PFQA 3SD7A 2R2AA 1ZO8A 4EFLA 2DF8A 3H5IA 3OPQA 1CF2O 2CLCX 1ACJA 2RGGA 2P78A 3DMDA 2KM1A 1YFZA 1J0XO 1KEZA 2A86A 3I64A 4TOIA 4WV3A 5FNVF 2HC9A 5KYWB 3CJQA 3KZNA 4RACA 4PTZA 2AKEA 3NEAA 2JH8A 2C7PA 2PH5A 4LECA 1KK2A 1P2DA 1NI4B 3DHEA 3OIGA 1TZBA 2QVCA 4RZSA 3HLTA 3VNQA 1WHTB 3C5VA 1P4SA 4RXMA 3VR5H 3H9QA 5CM8B 5EJFA 1SU6A 2BEJA 3QXCA 1U0BB 4FCVA 4M1WA 4G4GA 2G72A 3L6RA 4HRYA 1UXKA 2X19A 4ASUD 2QX7A 3QUBA 2I03A 2PNFA 1YE5A 3JWGA 3K6RA 4H18A 4DLTA 1IC6A 1T4CA 1L7MA 4YRZA 3IALA 3LT0A 2F9MA 1SO8A 4ZO6A 4X60A 2BJVA 2WYIA 1MFPA 3D3NA 2NNLD 3CM0A 4OK3A 2OHOA 5IUKC 3HFJA 4NG4A 3QE3A 4MW0A 4NC9A 3V8BA 4RVDA 4BYMA 3ISJA 4BVAA 5JVDF 4W9RA 3I34X 2OCLA 5BOSA 4V0NA 3S2GA 4HDRA 4Y6LA 2YYYA 1M1YA 4EB6B 1W96A 5ALFA 3EVBA 3AL2A 3IAHA 1XA4A 3IBSA 1NI5A 2Z43A 1N2CB 2VPXA 3MLBA 4MTCA 3U3MA 4CUJA 6ABPA 5HDBB 4AJIA 2XR1A 2I71A 3TDNA 5JALA 2FX5A 5M2QA 5HILA 3JQEA 4MR9A 4BUCA 4EI7A 1ZMTA 3P26A 3W3ZB <