3MJ4A

Crystal structure of udp-galactopyranose mutase in complex with phosphonate analog of udp-galactopyranose
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
365
structure length
365
Chain Sequence
QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDDAGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPINLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNKFFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTRMFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPYRSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVYEYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMDQVVAQALATFRRLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-galactopyranose mutase
publication title Chemoenzymatic Synthesis, Inhibition Studies, and X-ray Crystallographic Analysis of the Phosphono Analog of UDP-Galp as an Inhibitor and Mechanistic Probe for UDP-Galactopyranose Mutase.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Isomerase
total genus 113
structure length 365
sequence length 365
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.4.99.9: UDP-galactopyranose mutase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03275 GLF UDP-galactopyranose mutase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3mj4A01
1NHGA 4AJPA 2B83A 4FGWA 4IDFA 1B3BA 4RVFA 4J4TA 4P4LA 5A9RA 4P4GA 1E3JA 4QXMA 3T7CA 3LF1A 5ER9A 2XPCA 3TZHA 4A03A 1XU7A 4CM4B 4QEDA 3DEYX 4OQYA 1IZ0A 2JCVA 4TSKA 4WLFA 3ZHBA 1MP0A 4N54A 4DIOA 4XA8A 1E3EA 3QVXA 2WD7B 4NBUA 1E7MA 3STHA 1HLDA 3U4DA 1ENZA 2EKPA 3IUSA 3U4CA 3KTDA 4WE3A 1YBMA 2DVMA 4L76A 3ZHYA 5BSGA 3RUDA 1GD1O 4YA6A 3SXPA 2ZB4A 2VWQA 5L7WA 3WR5A 2O2SA 2NUAA 5ES3A 4BS9A 2I3GA 5TRTA 4XYGA 3PRJA 2GN8A 1MFPA 4Y6RA 1A4IA 2BFAA 1F8FA 1VLLA 1DOHA 1JVSA 3GDOA 1U3TA 4XYBA 1MGOA 1C0IA 4CMBA 1HWYA 3O8QA 4KQXA 4WCFB 2UAGA 3DWFA 1NTOA 3C1TA 1ADBA 2Y68A 4MVJD 4DYDA 3RFVA 2ZJ1A 1I32A 4NQZA 3H9QA 1C0PA 4YB8A 3DO5A 4D0SA 5ITWA 2C54A 4XX0A 3WMXA 1D1SA 4RF5A 1UR5A 1NQTA 4ALKA 3ONFA 4EDFA 2NTNA 3ZWNA 1ZKMA 2BGKA 5G2OA 4RJTA 3ZWVA 4YACA 4KZPA 3GLQA 4F45A 3HZZA 2IYOA 3IP3A 2JFGA 4FQ8A 3AK4A 2TMDA 3WFIA 2PD4A 2V6BA 3T4EA 1CJCA 2DBZA 1HDZA 1JDJA 1PGJA 5EPOA 1E7YA 3GRPA 4S1VA 5JSFA 3GOHA 2NQ8A 4E5NA 3UH1A 8LDHA 2PNFA 8ADHA 2NSDA 3WQRA 2CY0A 4MKXA 4UEJA 3WJ7A 2VNSA 1LLDA 3FWNA 4WNCA 5IDYA 4C7JA 3UGKA 4Q3DA 1Z6ZA 4FR5A 4GBJA 3ZWWA 4YEDA 4KDEA 5BT9A 3DMTC 4O5OA 2R00C 1NVMB 3BTSA 1SNYA 4BO3A 4DYVA 5DF1A 4DRYA 2OBYA 3O8QB 4PG8A 1IOLA 1NVTA 4DC0A 3D4PA 4Y8VA 4G2NA 2DC1A 1SMKA 3INTA 1I36A 1X14A 5HTOA 3GNSA 3Q0EA 4ILKA 3ZDFA 1Y8QA 3UW3A 1A72A 2VYNA 3WBFA 1B15A 1B8UA 1DBVO 1NM5A 4E32A 3LZ6A 3H8VA 3VZQA 3K9QO 2VHZA 1LSJA 4P8RA 4BNZA 4G5HA 2JJYA 1DHRA 1V3UA 1VSVA 4IXWA 2QW8A 1EE2A 4LSWA 5COQA 1D8AA 1EMDA 4IINA 4Y6PA 3E8XA 1UXGA 2PZMA 4LCJA 1YO6A 4IS3A 2OZPA 3CMMA 4TKMA 3W6UA 2J3KA 3TOZA 1X0XA 4LMPA 4JGBA 2JD1A 2Q1WA 4DXHA 1D3AA 2GSDA 5THKA 5L7TA 2ZCVA 5A9SA 3OQ6A 1P74A 3PJFA 3KEOA 3TNLA 3EDMA 4N7RA 4XZ3A 4IGEA 1O94A 4B4OA 1WDKA 2VT3A 1A9ZA 3AOGA 5JAQA 1N9GA 4GH5A 2Y99A 4DC1A 2QRKA 3CZRA 1NBOA 3CKYA 3AW9A 1LUAA 1JN0A 2ZATA 5DBFA 2PKRA 4Q3NA 2FWMX 2HMWA 1DIBA 4LSMA 2HK9A 3QW2A 4M86A 5J23A 2YHUA 3WYEA 3DBLA 1CF2O 5L51A 3PGXA 4FOOA 1Y8QB 1RYDA 3QWHA 5BR7A 4B4WA 3C1OA 2QQ5A 3DZKA 4Z0TA 4A5OA 2YUTA 1MC4A 4BL5A 2AXQA 4J0FA 4A2CA 3RJ5A 1JKFA 2X23A 4WOJA 1KS9A 3H6KA 1EBFA 5A03A 2XOXA 3ITDA 1KBZA 3JQAA 3DXFA 3I83A 1LLUA 4BV9A 3BHJA 1MV8A 3ETGA 2FMUA 1FDUA 3G17A 4UUMA 3QE3A 3PQFA 1YQGA 3VDQA 3G1UA 4EGFA 3PYMA 4IMPA 3R6DA 3DBHA 3RC1A 5F21A 1QYDA 2E6UX 4DPLA 3BTVA 3AY7A 3DZFA 4AFNA 3A4VA 3PK0A 2UV8A 3A9WA 5A9SB 5IF3A 1H9AA 3BMQB 3NDRA 1QV7A 4LVUA 5IN4A 3E5MA 3ZWBA 5CEEA 2D2IA 5JYDA 4XWYA 4E2XA 1N9GB 4YQYA 1DIHA 4RLHA 3DHYA 1RM4A 1LI4A 3EUWA 1EVZA 2ZKLA 2JHGA 1PJQA 1T2FA 2WYVA 3PYXA 1KEUA 3K5PA 1RM3A 1KEVA 2DPGA 2H6EA 3BA1A 3GGGA 1WZEA 3S2EA 5ICSA 3JYOA 5A5EA 1IYZA 4JP2A 5EESA 1EQUA 1AUPA 3FTPA 4NR0A 5FYDA 3DBLB 1BMDA 3NDIA 4XQ9A 5HS6A 3VVBA 5B12A 2J6IA 3AU9A 1DIRA 4QUKA 4IDBA 3ROPA 2DAPA 3WIEA 3GT0A 3IAHA 3K8ZA 4Z0HO 3P19A 3OJOA 2O3RA 3FRJA 3H5RA 1CWUA 4CJXA 1ORRA 5IFLA 3OQ1A 4LRTB 4HXYA 3JQAB 4NHEA 1R4MA 1Q7BA 5A02A 3ZCXA 4IS2A 3ZWYA 2GZ1A 5T57A 3DHNA 2Z95A 4MIOA 4LK3A 4J7UA 3KV3O 2PTGA 4GMGA 4MDHA 4XYEA 4CL8A 3H9UA 1PGPA 4Z9YA 4CMEA 1HYEA 1YRLA 4JJGA 4CR6A 4E31A 1ZFNA 4WCFC 2I3AA 3S2IA 1R37A 4G81A 5K6AA 1ONOA 2VWHA 1U28A 5IDXA 4E5PA 4C7KA 2EW2A 3H7AA 3X2EA 2FOIA 3ZNQA 1HF3A 3SLKA 3IKVA 1JKJA 2Z1MA 1C3VA 2WYUA 3AWDA 1ZK3A 3JQAD 4IJWA 3I9OA 5CPBA 4JJFA 4IQ8A 5I9MA 2BGLA 3NV9A 4I8XA 1NR1A 2UUPA 1EVIA 1PEDA 5JDCA 1V3TA 2VHWA 4NK4A 3D4NA 3F6YA 3PQDA 1R12A 2IYPA 3GR6A 4R3NA 2AHRA 3QWFA 2P9EA 3ZWCA 2ZTMA 5KJ1A 4IJKA 3OFSA 4JBHA 4L74A 5CG2A 1EK6A 2EF1A 1B7GO 1K89A 1XYGA 3NGXA 4QQRA 4B4VA 1LEHA 3FI9A 3V1TC 1LDNA 2NADA 3WFJA 4KUEA 3F9IA 1NFQA 1GZ6A 3FTNA 4GMFA 3I1JA 2C7GA 3JQGA 5CHEA 2BKAA 1SEPA 3HUDA 3DFUA 5CEJA 1O89A 5BSFA 3JQBA 1PJSA 2DQ4A 2X86A 4PLVA 1LRJA 4ND5A 4PN3A 3HE3A 4GI2A 4RF4A 1UXHA 3Q9NA 4YT2A 1QMGA 3D4OA 4U5QA 4J7CA 1YWGO 5TC4A 5K9ZA 1V6AA 5I9LA 4AVYA 1UUFA 3L9WA 5JCXA 1NQ5A 1XQ1A 2VYVD 4JBIA 2ZB3A 1DJNA 4YJGA 2EP5A 3WNVA 1Q0HA 1DLIA 2D3TA 2P5YA 1GZ4A 4IZIA 3FNHA 5FWNA 4XDYA 1TI7A 1X13A 2E4AA 2QZ9A 3DBRB 3KYBA 4HKTA 1KVSA 2CVQA 4WLOA 1P31A 1NVGA 2W90A 1X7HA 3ZGYA 5F3RA 1Z45A 5L4NA 4MKRA 4E33A 4K26A 2DBQA 1YJQA 4GVXA 4L9RA 2O3JA 2PV7A 1JVBA 1YQDA 2YFQA 4XB1A 2J5QA 1GV0A 2ZTVA 1E7QA 3M6IA 1Z75A 3UF0A 1FDSA 4A26A 4BQRA 6LDHA 4YYZA 4OHUA 5JNLA 5GY7A 5KVSA 1I3MA 2HAEA 1BXKA 2AQIA 3UKOA 3LT0A 4Q3AA 4XD2A 4A7PA 4ND2A 3VZRA 1SO8A 2GF2A 2A94A 3VH4A 3WGZA 2PH3A 1HDOA 1F0YA 3NGLA 3W4JA 5JBIA 5L9AA 3DMYA 3GMDA 1H6BA 1NAIA 3WYBA 3JQGB 4G65A 3DOCA 3PTZA 3ZN2A 5G4KB 4UEOA 2C07A 2Y1OA 3T7EA 3DAGA 3HNPA 4CLEA 1Q7GA 4CLDA 2Q3EA 2A9FA 5JAIA 1H6DA 1AXGA 2UVDA 1VI2A 3QV1A 4M87A 3KSUA 4CMGA 4R5MA 4YJGB 4ZICA 4J1TA 1GZ3A 2VHVA 4Q3BA 1L7EA 3DMTA 3NJ4A 3E6AA 2IE0A 5FFFA 1DFGA 2JKVA 3ENKA 4MVJM 5A1TA 4ITUA 2JD2A 4DTIA 5L45A 1VKOA 3PP8A 2HMSA 4L73A 3MJCA 2NVBA 5DOVA 2AG8A 2VUTA 3KZVA 1I3KA 2I65A 2LDXA 4KWIA 2IEBA 4OOFA 3ZWMA 2FN7A 1HE4A 2CVZA 2G82A 4TWRA 1HKUA 4BIIA 3INRA 5JXWA 3OEWA 5KOIA 1H2BA 2Z1NA 4YVFA 4ALJA 4JLWA 4A0SA 3NT4A 1GTMA 3E9QA 6ADHA 4BGUA 1N1GA 1E1MA 3VTFA 1U7HA 4IXTA 1QR6A 4XGIA 1NWCA 2BGMA 3TZQA 3IIEA 4XIJA 4HBGA 1FJHA 1M67A 4Y98A 1XG5A 2QG4A 2FPIA 1Z7EA 2D0IA 2VOEA 4PVCA 2Y1GA 3BHIA 5KVVA 4BNWA 3U4HA 3ZI0A 3PWZA 4GL4A 1VKNA 4XYLA 3NDJA 3HDHA 3I6IA 4RVHA 1I33A 4ZJUA 1MLDA 2A92A 1C1XA 3EC7A 3KLPX 5KJ6A 1YVEI 4YRAA 1DEHA 4ZQEA 2GZ2A 3ZH2A 4I5GA 2POQX 4NU5A 3E9MA 3IC5A 3JQDA 1G6KA 1PS0A 3OHSX 4ZU3A 4JX8A 1HE2A 3H2SA 3QLJA 4FPXA 4LGVA 2ZTLA 4F46A 3LT4A 4WEQA 1S7CA 4AJEA 1XSEA 1U9JA 1W4ZA 3NX4A 5TLSA 3FNGA 1GDHA 3OM9A 3ABIA 1GPJA 4KWHA 2JAHA 2VZ9A 4YAGA 1B26A 3TF5A 1U1IA 4B7UA 1ZVMA 4M1QA 3I23A 4YT5A 4XGKA 1YOVA 4NFSA 2Q1UA 2ILTA 3EHEA 3ROKA 4XYMA 3P2OA 1B2LA 2B37A 3L6DA 4QFDA 2ZTUA 2W2KA 3AI1A 3MJSA 2IODA 3MJTA 1YL5A 1ZJYA 2HMTA 3N7UA 4NBRA 3TRIA 4CUJA 1E7WA 4BOYA 4XR9A 4CV0A 4BKOA 3PLRA 4GX5A 4NJMA 3WGHA 3U5TA 2VT2A 2C59A 1FDWA 2YY7A 2DT5A 4XRGA 3NTRA 2NNLD 1E1LA 3ONDA 1G0NA 3DBVO 1E0DA 4EUFA 1DFHA 1TXGA 2EEZA 2GN9A 2YQ4A 3D5QA 5AXAA 3LLVA 4CMCA 1IUKA 1ISMA 4ZQFA 4RORA 4CUKA 1ZBQA 3D3WA 4YT4A 3QVTA 1ZCJA 2HDHA 2CNBA 2P68A 1Y9AA 1YXMA 2WD8A 4IGFA 2Y67A 2NU6A 1ONPA 2CSUA 4CV1A 4CMJA 4JBGA 1IL0A 1LDGA 4DPKA 1ADCA 1EFKA 1W8DA 2GPTA 2Y93A 4N5MA 4UUOA 3AM5A 3L0DA 4O63O 3C24A 5EIOA 5EQFA 3ORFA 4RV9A 3GC6A 2D59A 3KVOA 4U8GA 2B5WA 1JQBA 3F3SA 2I66A 1X0VA 1YDWA 3TL3A 3WGYA 3Q11A 3HB5X 1VPDA 4QO8A 4DQVA 3KXDA 4JXKA 4BO7A 4F6CA 5CP8A 3NTOA 4YRBA 1GAEO 4J1NA 2I5PO 4CMIA 3WJAA 3CINA 3RBXA 3DFZA 2O2YA 3PQEA 3E03A 3RFTA 4FFPA 3RUHA 1E3IA 3VPGA 3EK2A 4FFRA 5JMPA 4EW6A 2ZB7A 2W2KB 4ZRMA 3WQQA 2D5CA 1PQPA 3CUKA 3RD5A 2RCYA 4H3VA 1KETA 3CSDA 1H0KA 3S2GA 3QVOA 1I3NA 4R16A 2YFHA 3GG2A 2WTBA 4NJMB 3K73O 4CMEC 1HSOA 2E48A 3A14A 1WP4A 1PJLA 3PIDA 4IDDA 4OXKA 3VPHA 1ZMTA 4CM5A 4GAEA 1BVUA 2GN6A 4RPLA 1GYPA 3PEFA 3WGOA 4BNLA 4MPDA 3RQSA 4AJIA 3I3OA 3KETA 2D8AA 4GWGA 3H4VA 2EJVA 3N58A 1ZEJA 3D3WB 3E18A 1E5LA 3H3JA 4L4XA 2CDBA 3CTMA 3JTMA 4OXNA 4CM1A 3ZV3A 4B79A 1F14A 4J90A 2Y1CA 5JDCC 1Q0LA 3RC9A 1IHXA 2AQKA 1I2BA 1P3DA 2PLAA 4FOSA 5FF9A 5I8WA 1ZJZA 4FD3A 1F12A 1NNUA 1DRWA 4KTTE 3RBZA 3VH2A 5T67A 4BNYA 1YKFA 1AXEA 3HADA 3AUSA 3I52A 3QSGA 1NPYA 4AG3A 5CFZA 1GL3A 4E3ZA 5DCWA 2P4QA 3NTQA 4IQGA 1MXFA 1B8VA 2X0NA 5JCJD 3JQBC 3DZHA 1U2DA 5GZ6A 1ID1A 1ZSYA 5IJZA 4II3A 1ZNQO 3Q2KA 2BH9A 4OKIA 1VM6A 3LDHA 1HL3A 1QG6A 1R4NB 1BXZA 4YJDA 5KJFA 2AQHA 1M6WA 2YZ7A 1J6UA 1PWZA 1NASA 3FHLA 3F5SA 1P1FA 4J91A 2O3QA 3P7MA 1UDAA 3UCEA 1E3WA 2CFCA 1Q1NA 4MVJF 3TFQA 2Q46A 3ZV5A 2BLLA 1T4BA 3PHJA 3LQFA 2I76A 3TSCA 2WJPA 4M89A 1LSOA 1LRLA 2XXJA 5H81A 2CVOA 2C5AA 5T6BA 4H15A 3RKRA 3B20A 3K96A 4ALIA 2PZKA 4CODB 1ONNA 2P9CA 3LC2O 1TB4A 2FHSA 2EW8A 1E3SA 1NP3A 1WDMA 3R3JA 4RCVA 3BMOA 1IULA 1JLLA 5CPFA 3K30A 1KIFA 3PJGA 4IDEA 4BGIA 5FI3A 1GFSA 1F17A 4AJLA 4BNGA 2X58A 3MOGA 2HCTA 5JW6A 4DREA 3UHAA 5KNLA 2JAPA 3ZWOA 2BI8A 3PDJA 3GMSA 4CMHA 4CLRA 3JQ8A 1K3TA 3QQPA 2JFFA 2J8ZA 5I7SA 5A4DA 4OYRA 5G0VA 4E5KA 2BFOA 2BI7A 1A27A 3PYLA 4XJSA 2NU7A 4MJLA 3MJEA 5TF4A 4PG4A 3KRTA 1ISGA 1G1AA 1H94A 1EEHA 3OH8A 5DZSA 3JD4A 1E3WB 2O50A 1M76A 1O8CA 4FFLA 1LDYA 4Q3CA 4D7AA 3ENNA 2PD6A 3QVSA 3ULKA 3U62A 2BF7A 3HDJA 1ADFA 5C5IA 5I9NA 1I10A 1MXHA 3AY6A 4Z6KA 3QVWA 2HJRA 1R6DA 3ZHZA 1QYCA 1UH5A 1U3WA 1JW9B 3B6ZA 3QJ5A 2O3TA 9LDBA 1DXYA 4H16A 1CERA 1TT5A 2W98A 2QYTA 1QLHA 1WMAA 4PLPA 3UXYA 1DC6A 1E1KA 1ML3A 2VUSA 3I9JA 4CQMA 7ADHA 3EMKA 1LSUA 4B7XA 1EE9A 1T2DA 3BMOB 4D0RA 2WDZA 4D41A 1ZEMA 4CV2A 1UDCA 3ZNOA 2VQ3A 3GG9A 1PQUA 4WCDA 4R4JA 3D5TA 4M54A 1HT0A 5KWEA 3H5NA 4RQTA 3CEAA 3JYPA 4P22A 1XU9A 2VOJA 3GFBA 1ISHA 4Z9FA 4GVLA 2E49A 5L7YA 4QTZA 4BKQA 4W4TA 4PGFA 4Z3DA 4CLRB 3JQ8B 4PLYA 4XEHA 4W7IA 3WTBA 3HDYA 1P1JA 3JQ6A 1FF9A 2R6JA 1YBAA 3EY4A 3OEYA 3PHLA 5DP1A 5G0WA 3DZJA 3UAGA 1NAHA 2W2LA 3WOHA 4CR7A 3VKUA 4Y9DA 4BUCA 3MJVA 1S6YA 3OP4A 1DIGA 1B14A 5A3VA 2H9IA 4CM9A 1TVEA 4IMRA 3AM3A 2E37A 2OGUA 2VNAA 1UXJA 3PWSA 2ZB8A 1WXDA 2B69A 1L1FA 3RU7A 4AL4A 2BFMA 4BGVA 3UCXA 3WLEA 3MWDB 2CD9A 4AJHA 4B4UA 4I1IA 4XDZA 1YE3A 2WE7A 1YJ8A 5LC1A 3C3XA 1TT5B 4WJZA 2HLPA 2Q2QA 3SC4A 3VH3A 1Q7CA 3EVNA 1LTHR 1K0UA 4NI5A 2VRCA 2W8ZA 1IPFA 1X15A 4TRRA 4YXFA 2FPPA 2H5LA 4AJKA 3FR8A 2H1SA 2QRJA 1OFGA 2IZ0A 3RFXA 3ITKA 1PL7A 3W8EA 4MIEA 1LSSA 4BNUA 4PLZA 2UUOA 2OFPA 2P9GA 5B37A 4CV3A 2O7SA 1VC2A 4XB2A 3JQ9A 3AFMA 2VTDA 4EUEA 4TROA 5JPIA 4TZKA 2QRLA 1PJ2A 2VYND 2ZQZA 3GRKA 2OL4A 4OKNA 1NQAO 5KVCA 2QIOA 4N5LA 1XHLA 4D42A 5KKAA 4WLVA 3W1VA 3BIOA 3WGQA 3JYQA 3WQSB 4DQUA 1MUUA 3O26A 3H9JA 1U7TA 3IL2A 3TFOA 1FDVA 3EW7A 3JSAA 3UICA 1Y81A 1VE9A 4A73A 4W99A 5JY1A 3JD3A 4ND1A 1P77A 2Q45A 4MO2A 2EV9A 3PDUA 1GR0A 1DAOA 1XGKA 5KJEA 3VPXA 1SC6A 4EJ0A 2EHDA 9LDTA 2ZYGA 1NPDA 1BW9A 1LA2A 3NEPX 3RUAA 4RGBA 2PR2A 3I9LA 1YB5A 4LVCA 1BG6A 5C3MA 4FGSA 1DHTA 3LVFO 3KBOA 3HWRA 2OOSA 4BV8A 1PZFA 2X5OA 3C8MA 4ALMA 5HRUA 1Z7BA 4CMAA 3KYDA 3PLNA 1AE1A 3TZKA 3OICA 3V1YA 4BO9A 4BHTA 1LDBA 1VL6A 2HJSA 4OXYA 3GA0A 4D3FA 4R5HA 1MG0A 1V0JA 3I4FA 1Y5RA 3QRWA 1CIVA 2O3SA 2QHXA 2C2YA 4BO2A 3K2BA 4L0QA 3MEQA 2OP1A 5THQA 1F8GA 1EZ4A 1PJTA 3PXXA 5JYEA 4E2WA 3OQBA 4YCAA 1YH3A 1OC4A 1O95A 2AE1A 3DBHB 3GVPA 4WNIA 4B8WA 3UN1A 3GH3A 1V9LA 3WDSA 4BMVA 3GFGA 1I30A 4B8ZA 3GQVA 1ZUD1 3LSYA 4J49A 2HK7A 4MVJH 1ZXBA 4XQEA 3H5AA 2GDZA 2X9GA 3GVHA 1Y1PA 3GUYA 1PU2A 1I5RA 1GYQA 3S55A 2Z5LA 3JD0A 3VZPA 3D64A 2HRBA 2XXBA 4M49A 1HEUA 4MOWA 3D1LA 3Q1LA 2O7QA 5TQVA 3WX0A 2PGDA 1R16A 2DBVO 3R0IA 3VC7A 2GUGA 3EZYA 4NBWA 3S2FA 2BHLA 4BNXA 1PIWA 1PTJA 1ENYA 4OMUA 1QP8A 3IKTA 4DIBA 1BW9B 2DU8A 1Y6JA 4LN1A 3E5RA 1ZK0A 2Y1FA 1Z73A 4R68A 3OIFA 5TT1A 2Q49A 4Y67A 4XKJA 2WYWA 1GEGA 3KYDB 2Q2VA 4D79A 2IRWA 3WICA 4D3SA 3D7LA 4ID9A 2Y66A 4MP3A 1Y8RA 2OP0A 3HSKA 3OF2A 1T26A 3FNEA 4GQAA 1I0ZA 5IDQA 2HUNA 1R4MB 2NM0A 5B1YA 4AJ4A 3MZ0A 3Q6IA 4D46A 3W4IA 4ZGWA 3F1KA 3KEQA 4URFA 3ZZNA 4JP3A 4ZA2A 3RAJA 3I9KA 4II2A 4GKBA 1C14A 5BSEA 3SJ7A 5COAA 1H5QA 1CETA 3K6JA 4DLBA 4GGPA 1U3VA 2X9NA 1LLQA 1HYHA 4F6LA 2GNAA 2Q2WA 1DSSG 2FP4A 1ISIA 2UDPA 4RF2A 3Q2IA 4FFMA 4FFOA 2NTVA 2CF5A 1HRDA 1HDCA 1JU9A 3ANNA 1I2CA 3GVCA 5TS3A 4E12A 3I4CA 5CAEA 3JQCA 5IN5A 4FCCA 1A71A 2B35A 2HSDA 3KO8A 4FDAA 2EP7A 3RC7A 2FR0A 2GGSA 1SEVA 1T25A 3DONA 3DTYA 3P2YA 2HMVA 4BO5A 3KUXA 3PPIA 4CR8A 3FSRA 4R41A 1NX6A 4NH4A 4BKRA 4W82A 4DA9A 2FR1A 4DWVA 1Y9EA 3WWZA 1W0CA 4BNFA 1KVQA 2DM6A 5B4UA 2PGLA 1XQ6A 4B3IA 3VOSA 1DC4A 3K31A 5BSHA 3KSZO 1IHYA 5DCUA 4IQ0A 4QT0A 5T64A 4YR9A 3IQDB 1BDBA 2BRUA 1ZO8A 4BGEA 4ZQBA 2B36A 1YL7A 4J6FA 1NHWA 5JO0A 1Y8RB 1MA0A 3ROQA 2H63A 1UZLA 3HB4X 1HE5A 4BNMA 1VRWA 4U7WA 3DR3A 1QSGA 2NWQA 3RBVA 4K9DA 5K0ZA 4KQWA 3WS7A 1D4FA 4NZ9A 3FF4A 1HTBA 4WUVA 1NFFA 4EEXA 5EERA 5TSDA 3CZMA 3KM0A 2AQ8A 2JHFA 4CL3A 4HADA 1OOEA 1U2GA 4QO7A 3U3XA 4ZVVA 3DQPA 4I9HA 5AXCA 2X7HA 4U6QA 3BMNA 4W7HA 3RU9A 1SB8A 1B0AA 3OBBA 5L4SA 1ZXLA 1R0KA 1LX6A 1AN9A 2YV2A 5KVQA 2GASA 1UXIA 4CLOA 3SX2A 4IIVA 1M6HA 4BVAA 2GRAA 1K6XA 4TRNA 3GAFA 3SBOA 2C2XA 1TA4A 4UULA 1XIVA 2NQTA 3NYWA 3OIDA 2DTEA 3OA0A 1HLPA 2AEJA 4HWKA 1U8XX 4NFHA 4D45A 2AEMA 1BWSA 2D5AA 3DTTA 1MG5A 2OO5A 2G0TA 5IG2A 3MTGA 2ZJ0A 2V6GA 3GZ4A 3RASA 4DLLA 3QWBA 2FZWA 3C7CB 3KLMX 3FNFA 1T2CA 4BB6A 1EDZA 2C7VA 4IPTA 4HNHA 4OL9A 5JE8A 1OMOA 4GWKA 4ALNA 1P45A 4JNKA 2PA3A 3A28A 3AI3A 1Q0QA 1DC5A 5GZ1A 5IXSA 2DFDA 4O0LA 1R66A 4NPCA 3E48A 4KUHA 4CPDA 4AJNA 4EBFA 5HBRA 2RH8A 4H7PA 2RHCA 1ISFA 3ICPA 2XF8A 4KTVE 5BNTA 1JAXA 3MOIA 1E92A 4IM7A 3FN4A 4NMHA 5IXYA 5ADHA 1VL8A 3ICCA 3BMNB 5CDUA 5LDGA 1W6UA 5L53A 4XIYA 3ON5A 2Y1EA 2J5KA 4BNIA 1FK8A 5A04A 3BHMA 3RIHA 4IY1A 3O9ZA 2PY6A 1JWBB 4R1NA 4J2HA 4CLOB 3PJEA 3W6ZA 3ZWXA 4KUGA 1P9LA 4N5NA 4BNVA 1PR3A 1NR7A 5TIIA 1E6EA 1CYDA 3V1UA 3VVCA 2B4RO 1PSDA 3MTJA 1IB6A 4FC6A 2JL1A 4KOAA 2Y0DA 4BO8A 3E9NA 4C4OA 1X1TA 2NACA 7MDHA 3C85A 4QX6A 3SEFA 1P0CA 3ADOA 3PGJA 1JA9A 2RBEA 1XLTA 3V2UA 1PX0A 4YRDA 3JQ9C 4PLWA 4J3FA 2Q4EA 4DBZA 1XKQA 1DPGA 4UVIA 2QZZA 3H9GA 3RROA 1M75A 2WE8A 3M1LA 1SOWA 2ZYAA 4HFRA 4RVGA 3AJRA 3PWKA 1UP7A 4PZCA 3UCFA 4YAKA 5A06A 4RZIA 1ENOA 1LBEA 4IDCA 1P0FA 5DP2A 2PZJA 1GV1A 4Z9XA 3L4SO 1EK5A 4WLUA 2EWMA 3NKLA 3L6EA 5BNFA 2RAFA 3JQFC 3F4BA 1C1XB 3ETDA 4LCEA 3RC2A 4YT8A 5C7LO 3M2PA 3GY0A 4ZRNA 4ZHSA 1T4DA 3Q9UA 2YHIA 2GLXA 4M8SA 3SVTA 2VWGA 4XR4A 3ADPA 3PHGA 3K92A 1GYRA 3AY3A 2PGJA 3CIFA 3O4RA 3GN2A 3ZV6A 1T2EA 4WK6A 1QORA 2C82A 1H2HA 3WG9A 1AHHA 2G5CA 5T8KA 3VH1A 4ESOA 5JMWA 4HFNA 2EG9A 3DL2A 2WWRA 1NFRA 3RSHA 3PFWO 5AQ1A 5ENVA 4J7XA 4YDRA 5LCXA 4IUYA 1NXQA 2RIRA 2ET6A 3DHEA 5A9TA 5ITVA 4Q9NA 1YOVB 2RH4A 4ZQGA 1JKIA 3ZU2A 3AOEA 4M55A 3PI7A 3OJEA 5ICMA 3HFGA 4RZHA 5U1PA 3DB2A 2CDAA 5JS6A 3FPLA 4AJ2A 1LC3A 3LF2A 5I7VA 1LNQA 1N2SA 2JCYA 2Y0CA 4R1SA 5EJ2A 5EQDA 1VJ0A 2OBNA 3WYCA 2YDXA 4E13A 4FJ2A 5F1KA 1X7DA 1XR3A 1XWFA 2ZCUA 3PIIA 3TWOA 1EDOA 4LISA 2NU9A 4BNKA 3BYZA 2FZEA 1WMBA 3DOOA 2LDBA 3GGPA 4E2YA 2CZCA 1BRMA 3H65A 5JAZA 1P1IA 4RDIA 1B8PA 2YHIB 3TQHA 1HYGA 1LDEA 5KKCA 4OQZA 5HS4A 4PCVA 2NU8A 3PJDA 1MX3A 1DC3A 1UP6A 3AUTA 3E82A 5TGDA 1L7DA 1YGYA 3PZBA 1KY4A 1OZAA 3CMCO 3OSUA 2TMGA 4K6CA 4RPJA 5DOZA 2VZ0A 4HUJA 5JC1A 5ILGA 3GDGA 3RKUA 1VSUA 3IDSA 4YAEA 2GO1A 2ZK7A 3ZNNA 1T2AA 4WOKA 3B1KA 2G17A 4CMIB 3BTOA 4J16A 3IS3A 3RI3A 1PZEA 3EZLA 2YW9A 4MINA 3ZWAA 3LU1A 1E6WA 2ZIZA 3OECA 3GNQA 4RPHA 2ZQYA 4JQCA 2J3IA 1BTOA 3D3EA 3AI2A 5C7OO 4GKVA 4FB5A 2VN8A 3ANLA 4JJIA 1A7AA 1RM0A 4D44A 4RF3A 3BZUA 3I5MA 5TJ9A 3ROMA 3HG7A 1QXSA 1OC2A 1OBFO 2HK8A 3LT1A 1PS9A 2AE2A 3WNQA 4CM7A 3ASUA 4LW8A 3DZBA 3T4XA 2IZZA 3B1JA 2CDCA 3TL2A 1KVRA 2ZYDA 1P1HA 1QV6A 3FWZA 3QP9A 3N74A 2GR9A 4ND3A 4Q39A 4B7CA 1XEAA 1LQTA 1QYXA 1YDEA 3SLGA 3ONEA 3RUIA 3GPIA 1BDMA 4PG7A 4LMRA 3QA9A 1P1KA 2BMAA 3AUUA 3L4BA 1VJTA 2YV3A 2NVUA 3CXRA 4IIUA 1ZH8A 1ZSVA 4UVEA 2EJWA 2PH5A 4KDFA 5C37A 4I08A 4GPD1 5A05A 5U4QA 5EL0A 1A7KA 3L6OO 2YV1A 3E1KA 1GU7A 1HETA 4NIMA 3GF4A 2EERA 2J5RA 1KC3A 2AG5A 5DNAA 1H6CA 3I9MA 5HA5A 1UP4A 4K6FA 2EIHA 1DLJA 4FFNA 4CUZA 2GN4A 1UJMA 2B5VA 1JWAB 3QWIA 4IDAA 1I2ZA 4OGWA 3JYLA 4FJ1A 4NFYA 1J4AA 1ARZA 2I6TA 4L75A 3HFSA 1WNTA 4J9VA 1CRWG 4TVOA 2Q50A 5FI5A 2DBRA 1PR9A 1C0KA 5IZCA 2P91A 4BO1A 1N7GA 4E30A 2O48X 4HV4A 2VUUA 3JV7A 1Z74A 4YTEA 5CDTA 4A27A 4E0BA 1LXCA 4JIGA 4OIMA 5L95A 1BSVA 4ZD6A 1GQ2A 4CM8A 4IZHA 2P5UA 4FIZA 1Q2XA 3IUPA 3ANMA 4U0JA 1ZMOA 3AU8A 4BNNA 4R54A 3WWYA 3V5NA 1EFLA 5EINA 1EUZA 5DULA 2B4QA 2NVUB 2R2GA 4OO3A 3GVXA 1X7GA 5KCZA 2SCUA 4WLNA 1H9BA 5DBGA 1V35A 1ZW1A 4DL9A 2DTXA 4BMSA 5LDHA 3FBTA 5F5LA 1HZZA 2C20A 4XCVA 4EYEA 2D1YA 3GNTA 2C29D 4X54A 1PQWA 4UUNA 4J0EA 3LC1O 3GVIA 3HN7A 2WM3A 1SOVA 3JQEA 3UVEA 3WBBA 1UDBA 4OAQA 1SCUA 1IE3A 1PZGA 2YQ5A 3F5QA 2GERA 3EVTA 3A06A 5A3JA 4GSKA 1KVTA 3SC6A 4AJJA 1ZSNA 1DDOA 4TKLA 3RVDA 3B1FA 3INGA 3VDRA 2GZ3A 1EUCA 3JYNA 1PZHA 4ALLA 4CQLA 4I5DA 4TVBA 2X1HA 3M2TA 3OIGA 4DIFA 2P2SA 1SPXA 1LLCA 1OAAA 3OJLA 4IBOA 5I8ZA 4FJ0A 3TN7A 3WGGA 2CUKA 3BMQA 3NT5A 1R15A 4ZQHA 4UVGA 3C7DB 5DN9A 4XQCA 4K1LA 3GN1A 3TZ6A 1HSZA 3KHUA 3DAFA 2I99A 3RUCA 4CQMB 4QECA 1U4SA 2O3UA 4HY3A 1U8FO 1DRVA 4PLFA 1WAMA 3AUAA 4CM8B 1SBYA 1U5AA 5ER6A 1QYVA 3GEDA 3IJRA 2DUUA 5EN4A 3TDKA 1CQIA 4FC7A 3HDQA 4E6PA 2E82A 2WSBA 4W9NA 1P33A 2I9PA 4JK3A 3WSVA 1MC5A 1RKXA 1AGNA 4YAIA 1I24A 4HX5A 1P44A 4I9NA 4WEOA 2OUIA 3GPDG 1N5DA 5KJCA 1TT7A 3QIVA 4RPGA 4CLHA 4PLGA 3FD8A 5KIAA 1ZIDA 1H93A 2DFVA 1EVJA 4DMMA 1R0LA 3HHPA 3CH6A 4CQMD 5JDIA 5KTKA 4XGNA 2FPGA 3JQ7A 2PK3A 1QRRA 4AJ1A 1ISJA 4J1QA 3P5SA 3L9XA 2FY8A 3WB9A 2DKNA 5TX7A 4XJTA 4ZN6A 3JQFA 4YJHA 4BMNA 1KVUA 3IP1A 3MWEB 1XA0A 2JD0A 5T5QA 3V2HA 1J49A 2I67A 1E3LA 4CQLB 3EYWA 4DQXA 5CEFA 1QLJA 1YB4A 2X5JO 4MKZA 1KYQA 5L3ZA 1B16A 5T8KC 2F1KA 2EKQA 3G79A 4I9UA 4RVSA 1GUYA 4BB5A 3BAZA 4MIYA 3VPSA 4EJ6A 1I01A 2W2LD 1SZJG 1WW8A 3DAPA 4R69A 3AOEC 1PGOA 4P38A 3UFXA 3TOXA 2Q1SA 3JD1A 4YWJA 2VYVA 5DDIP 3HN2A 5IDWA 5U9CA 5JC8A 2G76A 4CM9D 4NBVA 4TMFA 4HP8A 2B0JA 4IDGA 2GCGA 4PG5A 5AVOA 1GY8A 4J4HA 2A4KA 4MVJP 4NG5A 1PGQA 1Y5MA 3EGOA 2O4UX 4P4NA 4E21A 2VRBA 1DO8A 4R9RA 1WZIA 5CDYA 2X22A 3W4KA 3AM4A 2X8LA 5G4LA 5AXBA 3F46A 4L4RA 1NPTO 4TZTA 3QHAA 1K6JA 4UVDA 2FRDA 3F1LA 1PJCA 3GZNA 2C0CA 2VRCD 3JQ7B 4FN4A 4RQUA 2DTDA 1JAYA 1E1NA 2IZ1A 2NVWA 3NJ8A 4OJNA 1WWKA 3C7AA 3TZCA 1DIAA 4PVDA 2AMFA 4YJHB 2F00A 1WDLA 1HDGO 3ZU5A 4HFJA 1BXGA 1PJBA 3NRCA 4NJOA 4DBVO 4PRLA 3DBRA 2O4CA 1UAYA 1HDXA 4RVUA 3IMFA 4NDNE 4ND4A 3OA2A 4O59O 2OHXA 3KYCA 1KY5A 1N1EA 1V3VA 3BMCA 5JLAA 2JFHA 4CMKA 1BGVA 1FDTA 1NWHA 2Q99A 2W4QA 2GD1O 3U0BA 1Y7TA 1E6UA 5HM8A 2IXAA 2PKQO 1NYTA 3GGOA 3H9EO 3L77A 4YJFA 2C5EA 5BNIA 1BHSA 3JD2A 4KP7A 3C1AA 1XDWA 3ETEA 4R9SA 4D43A 2CF6A 3FPCA 1QKIA 4PIVA 3G1TA 4QFCA 4IJVA 1KOLA 4RO0A 1YL6A 4EUHA 5CDGA 1DRUA 4BNHA 1LDMA 4JROA 2XAAA 4JCOA 3WSWA 1I3LA 4FSHA 4UAGA 3I9NA 2IXBA 4DUPA 1OI7A 1R0SA 5G4KA 4CM6A 3I6QA 5I7FA 1CDOA 1U5CA 1KERA 2QX7A 4L4SA 3SJUA 3R3SA 1TLTA 5TJHA 1P1RA 1DJQA 5H83A 3GZNB 1FXSA 5HWSA 2HMUA 3WTCA 4FS3A 5L40A 3GEGA 4MP8A 4EI2A 3TPCA 2YJZA 1YONA 5GMOA 3UOGA 1HE3A 2AA3A 2FSVA 1GCOA 1E7SA 4NBTA 1RPNA 4IJUA 2EGHA 1PL8A 3NAQA 4XQGA 2EKLA 1BXGB 4LRSB 5G0SA 4O1MA 1GUFA 1WLYA 1PJ4A 1C0LA 2VWPA 4FBGA 4OSPA 4R01A 5DBIA 3LC7O 4NNJA 5B4VA 1ZZEA 3M1AA 1XELA 3L4BC 1O5IA 3V8BA 1N7HA 5L4LA 5COBA 3KYCB 2AW5A 3BMCB 5G0TA 2X0JA 5MGBA 4YBZA 3GEMA 3OMLA 4GX1A 1F06A 2AEFA 2EGGA 2Q1TA 3OJ0A 3PHIA 1PS8A 3IJPA 4U0KA 1UZNA 1KEPA 3WGIA 4OH1A 4YJFB 1PWXA 1YS4A 1LRKA 4D3DA 1EVYA 4DMLA 2J3HA 4B3HA 5JY6A 4E2ZA 5C7IO 3U09A 4PLTA 1LU9A 5AXDA 4UEKA 3DZGA 1GPDG 4RL6A 1I8TA 1GQQA 4PLHA 4WECA 4I5FA 2V7PA 4R1TA 4QSMA 5JO9A 4BKPA 1LJ8A 3MJ4A 3AFNA 4UREA 1ULSA 1ZK1A 3U49A 3CE6A 3PFFA 5IZCC 1DB3A 5CG1A 1T24A 1LQUA 4TQGA 1K6IA 3ZV4A 3ZWPA 4EEZA 2UYYA 4E5MA 1GQYA 3KB6A 4NK5A 4WLEA 4PZDA 5F5NA 1PL6A 2V65A 4RLSA 4E4YA 1GCUA 2DPHA 2PKQP 2WMDA 3TJRA 5G0UA 4CM3A 4BO4A 2YYYA 1ULUA 3VZSA 3ZNPA 4NU6A 2R00A 3OETA 4WGGA 2P4HX 2NLOA 1LC0A 1UXKA 4XRRA 2X4GA 3FCOA 3RUEA 4AJOA 1A9YA 1WVGA 5F1PA 1C1DA 5H82A 3GDFA 1ENPA 3KSDO 2VHXA 1E7RA 4GGOA 5I7EA 5GZ3A 1TEHA 2Y0EA 3U4IA 4ONEA 1X1EA 2OMEA 4L8VA 3GHHA 4DLAA 1U4OA 1SB9A 4O6VA 1GADO 3O38A 3LYLA 3HQ4O 3V2GA 3PZRA 3HJAA 3GUCA 4B3JA 4PFJA 1T1SA 1RM5A 3H2ZA 3QWAA 4I5EA 1GEEA 5FEUA 1O6ZA 2JCXA 4Q3EA 1BVRA 1D7OA 5F1OA 2VZ8A 3WLFA 2VHYA 3G3EA 1QYWA 1VJ1A 3GK3A 3WGTA 1GUZA 2CMDA 4RVDA 4Y6SA 3W8FA 4N18A 1O0SA 5BQFA 1RJWA 1IZ9A 4YAJA 3B70A 2EXXA 4WKGA 1D1TA 2A35A 4ROSA 3RWBA 1WPQA 3VKVA 2B4TO 4MVJG 2Q4BA 2X5KO 1M2WA 1IY8A 1E77A 2PZLA 1U3UA 1ZK4A 4UVHA 4EITA 4OOEA 3NUGA 5IZ4A 4DPMA 3L07A 1HDYA 3IOYA 3GAZA 3S1LA 3OJFA 2IDZA 4Z0PA 2PWZA 3CPSA 4BO6A 4J43A 1YBVA 2HKIA 4J2OA 3JCZA 4R1UA 1H6AA 2BD0A 3Q3CA 1MFZA 4BKUA 2Y05A 3EAGA 3COSA 4W9NC 1C1DB 2X0IA 2O23A 5AYVA 1SAYA 4EZBA 1FMCA 2FSSA 3WIDA 1K2WA 2NTJA 2X6TA 1MB4A 4YPOA 4KMSA 4W6ZA 3FR7A 5TNXA 1HZJA 1YQXA 1YB1A 2J3JA 4K28A 1K5HA 5DT9A 5JDIC 2HRZA 3X2FA 4FW8A 1KEWA 2BFPA 3O03A 3MCVA 3GHYA 3UUWA 5JAMA 4A10A 1ZK2A 2V6MA 2FR8A 3ZW8A 1XCBA 4BNJA 2QYSA 1AHIA 2G1UA 3ZU4A 2DUWA 1A4UA 1PGNA 5CDSA 2HO5A 3K2EA 1J5PA 1HXHA 1B3RA 5AOVA 4OM8A 4RPKA 3VAZA 2D4AA 1V8BA 4HNGA 1IPEA 5DCYA 1N8KA 5JCJA 1DAPA 1M66A 4HFMA 1EQ2A 5EMHA 3G0OA 4WASA 1EBUA 1RYEA 3PVZA 4GLOA 4J9UE 2RHRA 3D0OA 1G0OA 4UUPA 3VTZA 2VTEA 4CLXA 3DDNA 3DC2A 1N92A 3BTUA 2YDYA 5A5FA 5ENDA 4R51A 3VPFA 4RDHA 4CM4A 2Y1DA 3KOUA 2X9VA 4S3MA 3LK7A 3S8MA 1VL0A 4PLCA 3RUFA 3RJ9A 4TRMA 3F47A 1HDRA 2OORA 3ZW9A 3ST7A 1RWBA 3FBGA 2V6FA 3LLSA 2DLDA 3WXBA 4BNTA 4OSOA 1PJ3A 3LT2A 2WD7A 4J4BA 4GLLA 4PG6A 1Z82A 5IAAA 5MDHA 4MP6A 4MVJA 3WMWA 4J1SA 3G49A 1DFIA 3PHHA 3R1IA 4BO0A 1E5QA 1CQJA 4TRJA 2OXIA 3ZU3A 3F4LA 1T1RA 2X0RA 2WEKA 4GX2A 4MVJE 4PZEA 2NV6A 1R4NA 1NQOA 3U9LA 3NT2A 5B4TA 2IEDA 3VHRA 2PFGA 3ASVA 3W8DA 3A1NA 4E5YA 4GX0A 2VCYA 3DZIA 4JN6B 4MVJI 2BELA 3QY9A 3RCBA 5JFOA 4INAA 4DGSA 5ILOA 4EJMA 4DVJA 1UAGA 2HQ1A 1CEQA 4U6SA 5TT0A 1UZMA 4WCFA 4YQZA 5K6AC 1KC1A 1ADGA 2PD3A 1W73A 4Z3KA 4F3YA 2GYYA 4PRKA 4BQPA 1JTVA 4WPGA 1J0XO 4AICA 1EUDA 2HU2A 4GSLA 1A5ZA 4R3WA 3DOJA 3ZHXA 1O9BA 3H3FA 3BXXA
chains in the Genus database with same CATH superfamily
1NHGA 2IUSA 4TM8A 5C5DA 4B3RB 2W6OA 2CN1A 2B83A 4FGWA 5F3WB 3GT3A 2GPBA 5A9RA 1MW9X 1E3JA 5AKIA 3T5AA 2A7QA 1KSFX 2XPCA 3ESRA 3SMQA 3TZHA 4A03A 2XUKA 3AHFA 3VR5D 1SHUX 1QFSA 4UD6A 1NT4A 2DEUA 5KZMB 1E2DA 1EWYA 4G4SP 1TCUA 4L28A 1ZQ1A 2IPAB 4P92A 4DIOA 4C7OB 4TTTS 4YR7A 4WN9A 3JASB 5JUWA 1E3EA 1M1XB 2IIQA 3QVXA 4LY0A 1E7MA 4ZQCB 4BN0A 5JSUA 3STHA 3U4DA 3I3SR 2A9RA 2OILA 4OAPA 4KSCA 1BJRE 5BW4A 2JLXA 4NS1A 3IAS1 4IRXA 2CBGA 2EKPA 4F38A 3IUSA 4IJ6A 1YR8A 3U4CA 3H1GA 3CVXA 4ZCIA 2WJ6A 1A9SA 5K3SA 4JZYA 3VPBA 3ZHYA 5HQ3B 2QJRA 1X8XA 3H5IA 3QBVA 4K9OA 4FONA 1VB5A 3SXPA 2TMKA 4GVPA 1VHLA 4R8MA 2PEZA 3WR5A 4D8XA 3H2IA 4MJ3A 1CU1A 2AHOA 2CFOA 1DG1G 3IPLA 3NWEA 4LNHA 1L5VA 4MRVA 4UMFA 4XGQA 3RVQA 5KOHA 5C51B 4QG7A 4JOCA 5CXSA 2QJTA 4PYLA 4B43A 2XWSA 4PTZA 4XYGA 5DO9A 4F96A 4K0RA 4Q1BA 3E0QA 3T7AA 4L0DA 3QLUA 2D00A 4KPUA 4M9XA 4QIHA 2J0UB 1C0IA 2QYHA 2BGTA 4J3JA 4ZPXA 1OD6A 4XWTA 1IQ0A 2QUAA 4BQSA 2TSYB 2NO1A 4KQXA 2NO9A 4E88A 1G20E 3DWFA 4AI6A 4DEVA 1Y7PA 2J0EA 1TQ8A 4FFBA 3VR2D 1MIOA 2Y68A 3VSEA 4R05A 3T4PA 5BRNA 4G24A 1WMSA 3FVTA 5SICE 4DYDA 1HGXA 4MR8B 3RTEA 4AXXA 2VBCA 3K0FA 3L8MA 4ITVA 2OHFA 1JDSA 3EGEA 4D8TA 3B3AA 2J6CA 2ZSAA 3S7ZA 4LYGA 4XX0A 1Y6FA 4RIIA 4RF5A 2AT1A 2HPZA 1BS9A 5AIBA 2H2DA 4UU8A 1LK7A 3U4GA 3ONFA 1LV8A 4FE7A 1VHQA 4LV8B 2NTNA 1J7KA 3PHBE 4YRTA 1ZKMA 1ZD5A 2J4DA 3NWBA 2BGKA 5G2OA 3HHEA 4L5BA 1L5NA 5YASA 4WN9B 1FXWF 4I3FA 3AR8A 4F45A 2IYOA 4D02A 5HXAA 1ODCA 3OQJA 1ZOPA 2JFGA 5AM4A 2VQSA 2AUMA 1TMGE 2R84A 3AK4A 1SC9A 1PN3A 2NUBA 2YRWA 1VLVA 1JRLA 1JIUA 1OJ7A 4AX4A 4HOYA 4TWBA 2QSYA 4P3NA 3UA3A 1W5AA 4JVMA 3L0YA 3QYFA 4EB6B 2FJ0A 3P9SA 4LFBB 3GLFE 1PV1A 4B3CA 1V4BA 1YFJA 1XCPA 5F51A 2DR0A 3OBIA 4C4TA 1U65A 4JUDX 3WQRA 3ZOKA 1B2RA 4LIPD 4ECEA 4RSRA 2ORIA 3KS9A 1RXUA 3B6KA 3BPSA 3HVJA 2JJ1D 2YNMC 1ZN8A 1L7BA 1LTKA 4QU8A 4JR0A 4FR5A 4UCFA 5EP2A 4X62B 3ZWWA 4I4NA 1W0JD 2OK8A 4YEDA 5D1NA 4O5OA 4C4YA 2R00C 2C5SA 3LY7A 2FUG1 4KPUB 3ENZA 1G3UA 5E6RA 4ZI7A 4DRYA 4ZAGA 4PG8A 1IOLA 3MGBA 2CNDA 3QY0A 4P0TA 4DC0A 2PQ2A 4DFDA 3D4PA 4Y8VA 4G2NA 3ZBPA 3GGSA 4PBTA 4UW9A 5FORA 4M2LA 3INTA 4FFBB 4Y1FA 4AECA 1MIOB 3GJSA 3I01M 1UPFA 4I55F 3ETLA 3GNSA 1S8AA 4FXOA 2O0MA 4TTPA 2GESA 1PI3A 2VYNA 3K0FB 1B8UA 1MW8X 2ZWAA 1NM5A 3DMGA 3LZ6A 3L1KA 3NCHA 1HEYA 2VA9A 1OYOA 2WW8A 1KQGA 2ZP1A 2C88A 4XX0B 3DE5X 5ETJA 3DDZX 2DMRA 2XA1A 3QNWA 4RJJA 4P8RA 3ZDBA 4BNZA 4TQ9A 2JJYA 2O8CB 3EIOA 2G70A 4JJ6A 3KSRA 4IXWA 3KVNA 1S89A 1EE2A 2IPNA 4B6PA 3O2SB 2BR4A 4Y6PA 1KKMA 1POXA 3CG4A 2PZMA 1D2AA 1JP7A 3FCUB 2J7KA 1EFDN 3BL8A 4OHPA 1GKUB 5GVRA 2ZRDA 4AQYB 4V24A 5DBHX 1MR3F 2XCTB 1Y1QA 1X0XA 3HFRA 1CVRA 1IBCA 2JD1A 2Q1WA 3BULA 2JG3A 1P7CA 3IVAA 1YFKA 3PNBA 4QUHA 1Z16A 1PLJA 1NYLA 4UE3S 2ZWIA 4A92A 2ZPAA 3KEOA 3TNLA 2IY7A 3MSXA 3W5HA 1JQDA 3PEUA 2XCRB 4IGEA 2NP7A 4B4OA 1WDKA 1JHAA 2F62A 2V9CA 3AOGA 4S24A 1EK1A 2J9ZB 3DR5A 1U0JA 1TC1A 2JJ2A 1NBOA 3CKYA 3RS8A 1I2MA 3RWOA 1EFAA 3VR3A 1W581 3B6IA 1NBWB 5JJBA 3AI7A 3O0TA 1FYVA 2PKRA 4DTCA 5E6RB 4ZI7B 2C9YA 3B2NA 1FMLA 4HLDA 3A3NA 4I19A 3LHKA 2HK9A 2PDAA 3QW2A 2EX1A 2JVJA 3V55A 5I7HA 2M6KA 4N3GA 2CEAA 3P9IA 4RY9A 4DADA 3STXA 3WYEA 4QNRA 2H8GA 1L2TA 3ETHA 2CCGA 4FOOA 1CEXA 4I4IA 5KSPA 5TY0A 3NP9A 3TMAA 5TMPA 5BQXA 2J3QA 3PNOA 4B4WA 3WY9A 1J21A 3R3VA 3A32A 4U9IS 1PR5A 2J4FA 2Y92A 3CWQA 2FX2A 3FB4A 2AXQA 2VTVA 3QE4A 4OV6B 4A2CA 2HNAA 2X23A 1CUHA 1B93A 1PUIA 1KS9A 3MPOA 3R77A 3MUFA 1XT6A 2P3QA 3ITDA 4L72A 1WU8A 1GFWA 3DXFA 2H1OA 3I83A 2KHZA 2XMQA 3DQQA 4X1OA 5CTAA 1LLUA 1CHNA 4BV9A 1HNNA 3K70D 1FTQA 3ETGA 1NE2A 3G13A 1Z13A 4F8JA 3A3YA 4P2GA 3G17A 4TLLB 4RMGA 3ECAA 4XLLA 3KPWA 4EOGA 3UAZA 3VDQA 4ES6A 1U0RA 3G1UA 4EGFA 2XDWA 3R6DA 4RAQA 4BU1A 4G1FA 1AM4D 1LGYA 1H22A 1FP4A 3EGXB 5EC8A 1KJQA 3SC3A 3ER6A 4LSGA 3V7FA 3AY7A 2B94A 3SPXA 3X1WA 4AFNA 4B47A 1Z63A 2F8SA 2EJBA 1QR2A 1SKBA 3BAFA 3L43A 4PIMA 4Q7JB 4BY9E 1WABA 2C95A 1OV6A 4DLYA 4J94A 5LU9A 4JLJA 3K8QA 3AF2A 2PIDA 1Z4PX 1X1DA 2NO6A 4LVUA 1PCXA 3M9LA 2HHAA 5JYDA 2D2IA 3GRAA 3QNUA 4BX0A 4FDLA 1E8DA 4RVOA 1QIFA 3DHYA 1RM4A 4TV9F 3UJ3X 1DU4A 1YBHA 1EVZA 3ESYA 3HPQA 3R2JA 4MWZA 5ALZA 2ZKLA 2JHGA 1RXVA 2BMFA 3FM9A 3OTHA 2CV0A 1RM3A 1TJ3A 2D1SA 2DPGA 1R6XA 2H6EA 2R8YA 3HVKA 4H4DA 1CQIB 4A0FA 1N0VC 1WZEA 1PG5A 2DPMA 2X7JA 3JYOA 1IYZA 1TAHA 4QDUA 1BD3A 2VPPA 1EQUA 1AUPA 4JENA 4QDKA 5AH0A 3D6FA 3OOWA 1HFKA 2AEEA 2HA2A 5B12A 5HS6A 1XZDA 4QXAA 1EJ0A 3AU9A 3OTIA 2CJYA 3VYSB 3ROPA 5IT4A 3BFKA 3WIEA 2OV8A 2XYGA 3DMHA 2QL5A 3GT0A 3IAHA 5EXEA 3PD0A 2G5TA 1UEIA 4U4AA 5D86A 1P8JA 4EG6A 4G3XA 4J7AA 3GJ7A 4B8YA 2YKGA 1CWUA 2ZCJA 1TO2E 5IFLA 2CNWD 4UPDA 1P5JA 4LYFA 1YU9A 2QSZA 1Q7BA 4AULA 5A02A 5CVJA 5I4BA 4X00A 5CYPA 2ORWA 2Y4OA 4IS2A 4KMRA 3KKOA 3VJMA 2FEXA 5KYXA 2DG2A 3VI3B 1XKLA 2PZBA 2VA8A 3EEIA 4JJAA 4UJ3A 4MDHA 1Q95A 3G0IA 1UBJS 2Q4OA 2FPWA 5E4JA 2AVDA 4HNAA 2VF8A 4KO1S 1FP4B 3MRXA 5BN3A 1B41A 4XM1A 3JWGA 1F6BA 4G81A 5K6AA 1ONOA 2VWHA 1LLFA 1XNJA 2PJRA 1E9AA 3LCUA 4KN6A 3I6YA 1EP9A 3X2EA 1Z2AA 1HF3A 3QELB 1E2BA 1JKJA 3JZMA 3KWMA 4ZPJA 5FLEX 3BMXA 1D6MA 2CZQA 4K8OA 2Y3IA 1GA6A 3IV7A 4IJWA 4LPSA 2G09A 4FX2A 5I9MA 2BGLA 3NV9A 4I8XA 1Q6YA 2UUPA 5H59A 1V3TA 2VHWA 2PUBA 3D4NA 1Z5OA 1I2DA 3MWKA 6CHYA 1DARA 1R12A 1RYZA 2FETA 2IYPA 2YXEA 3O2NA 2AHRA 3K15A 4TS4A 1FNNA 1PFWA 4JT8A 3JYHA 4NCIA 1X9HA 3UT5B 5A1JA 1JIKA 2PMBA 4U5XA 1K89A 5I7SA 4B4VA 1KDPA 1LEHA 2DY0A 1LDNA 3TTWA 4RMIA 3F9IA 1GZ6A 4HYYA 1I7PA 5CM2Z 5CHEA 5CEJA 3SC2A 3D6AA 1EFUA 3CONA 2VZEA 4HLUA 4AC9A 1PJSA 1GL7A 1XD9A 2DQ4A 1VFNA 1LRJA 2JZCA 4YRLA 5AJYA 3HE3A 5HUQA 2PH7A 2Z4RA 1JGTA 4N8EA 1GGHA 3FVQA 4UASA 5B1IA 1ZKDA 2OHVA 3FSGD 4MLZA 1JDUA 1QMGA 2W6JD 4TPKA 4U02A 2G36A 4J7CA 4U5QA 3SJCA 4HAWA 4ESHA 3ELBA 5PGMA 621PA 3ECSA 1HFEL 4MUJA 2E4YA 4IEFB 3SM3A 1IH8A 1FPMA 4KLCA 5JNVA 4BFZA 5SZKB 2ZB3A 2A4MA 1DJNA 2W22A 3AHGA 1OHHD 4G56A 4G5RA 3PX3A 4OI4A 4YJGA 2OZVA 5TMEA 1HNWB 1TRHA 2P5YA 2RB5A 4HNAB 4OIFA 4IZIA 1Z4OA 5BN3B 4Q18A 3ZYZA 1X13A 3NLLA 1GZHB 3DBRB 5B1EA 3SHVA 5GTDA 1KVSA 4YXWA 3T3GA 1FFCA 1GVNB 4FUTA 2FQ1A 1FSFA 1J0CA 2VJQA 3IT3A 1KI7A 1Z45A 2P9ZA 3KLBA 3OO1A 4HEQA 3U1TA 1QP0A 1MT3A 1GKKA 4PCUA 1XDDA 5KDOA 1IEWA 1JKJB 1YQDA 1AT1A 1V41E 2J5QA 2VPXA 2Z83A 4RD2A 5DGHA 3TMKA 1MX5A 4U2BA 3B9PA 2IUTA 2JDIA 2PO7A 1TU4A 2HLDA 2JZOA 4PPGA 3V4OA 3M6IA 3TXXA 4FLFA 1SXJA 2LRHA 4OHKA 2LP4Y 3O2QB 3WYGA 4C5AA 2GS9A 4RJ2A 4BASA 3UKOA 3PUKA 3SZGA 1W19A 4UM7A 2ZJYA 1KHHA 2PMDA 3IP5A 1SO8A 4ND2A 1ATZA 1FXUA 2A94A 4HB3A 4KGDA 4RABA 1ZL0A 4E15A 3WGMA 2W7TA 5IVIA 3R7SA 3P9YA 2G6TA 5ARDA 4ZJPA 3BQ9A 2Z43A 1HOTA 3EQ9A 5JBIA 1LX7A 5L9AA 5KAPA 3GMDA 1E0AA 1NAIA 3EXHA 3J81k 4AZSA 3LBAA 2XCQA 1ZD9A 4KSBA 1I1NA 1FVOA 4OATA 3DAGA 3VHQA 1Z4IA 1P18A 2P9YA 4TXJA 2BGUA 4LF9B 2HIAA 1H6DA 1AXGA 1E2MA 2PXAA 3IVXA 3F5DA 1EA5A 4LYHA 1YR6A 1WQ1R 4EKIA 1RKUA 3W3AH 3IEVA 4CMGA 3QUBA 3AJAA 5DU2A 4YJGB 4J1TA 4Q3BA 4O0MA 2XT0A 1L7EA 1W9MA 3DMTA 4W8HA 4YV0A 2JLAA 3FH0A 3D2BA 3JWIA 1NP7A 4QJBA 1DFGA 1W2GA 2JKVA 4HN9A 4HTFA 4QGFA 4HXFB 4IG9A 1T9ZA 3O92A 5EWMB 1RJFA 2B4AA 2D2FA 2I2XB 1ZUWA 4WZAA 3IAFA 4BYMA 1YIDA 2HM7A 1TK3A 5ALLA 2Q3HA 4M6WB 4BQNA 1VJCA 2PJZA 3RSOA 4L73A 2NVBA 5DOVA 1UF9A 2JGLA 3KZVA 1SXJB 2LDXA 1ORVA 2I87A 1GLNA 4ZDIA 3C7TA 3H9CA 2FN7A 4PNPA 1BKSB 4GBMA 4OGLA 4UM8B 2JLRA 3G8DA 1GUAA 5FR1A 2Z2IA 3DLBA 4TWRA 3JQPA 1D7AA 1NZDA 5JZVA 1SC3A 1IHUA 4BIIA 4HNUA 3ILVA 3EXFB 3PR2B 1IOWA 1EFPA 4H3SA 5FHQA 4OQQA 2XNDA 3ESQA 3THOA 3WLOA 4M1MA 4F91B 2Z1NA 4G5FA 3KOOA 4JLWA 2VP0A 3LMKA 3FKJA 3NTXA 5JMTA 1QRSA 3O31A 3EFOB 1XTIA 5IU6A 4BGUA 3TEFA 3HM2A 1S3IA 1RD4A 3VTFA 4IXTA 3WKCA 3EXHB 4XGIA 2INGX 4LDZA 1NWCA 4ZOLF 2BGMA 3D6MA 1Z4NA 1D2EA 1SHZA 4NAHA 2ONKA 3KQWA 4Y98A 4DRXA 5L8VA 2J3MA 1E79A 3QPWA 2FPIA 1Z7EA 4PHFA 4PVCA 4TTSA 1F4PA 1WHSA 3NFRA 5HK8A 2VYCA 3BCRA 4QGHA 4EMUA 1VCOA 4IH9A 3V7NA 2I4LA 4ZOEA 1YIOA 2AN4A 2JLCA 2UZ1A 4RVHA 4KVGA 4KFSA 2QGFA 5MF6A 1QIIA 1C1HA 1VMKA 5KCMA 1MLDA 2A92A 3EC7A 1D2RA 1GTJ1 4N3CA 5KJ6A 3HJFA 521PA 5KYTA 4ZQEA 5KNDD 2J41A 3KJHA 2VH2A 5EKSA 2V4MA 1T1GA 1QYIA 4NU5A 2QN2A 3IC5A 3JQDA 5DJ5A 1Q14A 3B8HA 2H1VA 1DPFA 1MDBA 3OI7A 3LT4A 3T1OA 4WZAB 2W6MA 5PNTA 1V16A 1S7CA 1KHTA 4QA9A 4EFDA 1JG6A 3NX4A 1UPTA 3FCAA 2HJWA 4PX3A 3FNGA 3OTOB 1CJBA 1GDHA 2P9FA 3L02A 1GPJA 4AN4A 3SMVA 4ME6A 1GZSA 1TFUA 2FMHA 1QO0A 5CK4A 5DVZA 3ZD7A 5C35A 1B43A 3DSRA 4G1BA 2PUDA 3UJAA 1QH9A 1WZNA 1N8SA 3TM5A 1YFZA 4M37A 4QU9A 1EQAA 4XYMA 5FD8A 4WD3A 2ID8A 1GZ7A 1L1EA 4JH0A 3KT0A 4MMZB 4GMDA 1RWNA 1EFPB 3S1SA 3QFTA 1LNZA 3VJLA 5B3KA 3MJSA 1OTYA 4UDXX 2XWQA 2J45A 3MJTA 1AV7A 1YL5A 1J23A 2HMTA 3CLRD 3GWZA 3PNSA 3Q7TA 1INLA 4ITRC 4MZDA 3DT9A 4CFYA 3R4VA 4CUJA 3U1VA 2W4MA 2AF4C 1NMXA 3Q7EA 3PLRA 4D9NA 4LF8B 1RJGA 1T3LA 1ZMBA 3WGHA 3U5TA 4B6FA 3RQIA 2C59A 1VHDA 1BAPA 1LBSA 2YY7A 2A9OA 3P9CA 2DT5A 4DRXB 5M5BA 4MUIA 2EFCB 1P75A 3P0RA 1MH1A 1E1LA 2FPIB 4Y6QA 3FCCA 3HYNA 3BG5A 1TM7E 1WHSB 4EUFA 2EEZA 3ZVNA 1FS5A 3P0HA 3LM8A 3RVPA 3LLVA 4CMCA 1WY7A 1K68A 4QQFA 1U8EA 2J08A 1ISMA 3BRWA 1RDFA 4RORA 1ZS9A 2WKQA 1DMRA 4CUKA 4Q7LA 2OC4A 4YT4A 3DEZA 3QVTA 1ZCJA 2P68A 5CNKA 4C4AA 1H2XA 1YXMA 2WTUA 4RTOA 3IPXA 3HA7A 2CNKA 3ODGA 2GPTA 2Y93A 3TOCA 3SU8A 1K8QA 3AM5A 4Q34A 4RV9A 3RB8A 2ZW9A 3K8OE 3MVEA 4EATA 2XTNA 4U8GA 3LBFA 2QTBA 5CLHA 3HXMA 1RI2A 4L6IA 4RMJA 5P21A 1V16B 2PZGA 2QMEA 1QWOA 1LVGA 1YDWA 2WJGA 3TL3A 2IL1A 5CAEA 3JRNA 4Q00A 3NRBA 1EP2B 4NBNA 4U3JA 1POWA 2HREA 3KXDA 3VR6H 3W04A 4BO7A 4PYMA 3V8QA 5A7FA 1CR6A 4Q7MB 4UUQA 4A0GA 4AS2A 1GAEO 3J7TA 4GRDA 4YRBA 5I6DA 4EWLA 1Q1EA 2X8BA 4EARA 2F3PA 1I5EA 1A2OA 3QMPA 4BRZA 1V7QA 2VTKA 1VMIA 1E3IA 3Q9LA 4PNHA 3L7JA 3RFTA 3VPGA 2AC4A 3ZIDA 4F3RA 2V4UA 1EFRD 3E9ZA 2JW5A 4NWIA 3M83A 5G41A 1D6SA 1TU0A 4H3VA 4EY6A 1KETA 4GFDA 4M83A 2D7DA 3CSDA 2A5JA 1Y1RA 3L0CA 3QVOA 3ZDXB 1I3NA 3WLTA 4LF6B 5IKXA 1L4BA 2YFHA 3H2HA 4M9QA 2Q3DA 2QN9A 4MUBA 4OHBA 3K73O 4CMEC 1HSOA 3PIDA 4CM5A 1QIMA 3UIEA 5TF0A 1CJKC 2GN6A 2XNJA 4JL6A 1ZGAA 2WB2A 2CJFA 3B7PA 3D6UA 3WGOA 3F7OA 3T3EA 4BNLA 3RQSA 4UNIA 3NWJA 3E2IA 1JR4A 3OFND 3V4FA 3H4VA 4AP5A 5CITA 2EJVA 6NULA 3TLXA 1ZEJA 2GNPA 1GSOA 5C4IA 3LX6A 4OFWA 3VPDA 2DUMA 5JYCA 5H3HA 1Y0BA 4OXNA 4CM1A 3ZV3A 3MXOA 1F14A 4ZKEA 3C6BA 3CW2A 5EZ5A 2TYSB 3MJRA 2AQKA 5K09A 4P6VF 4FOSA 3KPYA 3IIJA 3ZHSA 1ZJZA 3G2MA 3SOZA 1ECLA 1NNUA 3IUMA 1QAQA 2OCKA 3EOBI 1IEXA 3NV7A 3VH2A 3WLKX 5LNK1 1A95A 3FDJA 4J75A 2LNDA 1YKFA 4C6HA 3KQPA 2ZWOA 3F8TA 3W77A 2WWVD 5KSOA 2NVOA 3AUSA 1E69A 5JI3E 1PNQA 3M4XA 5CFZA 4E3ZA 3BZWA 4U3JB 5DCWA 2ASEA 1UJ2A 4AZ0A 4IQGA 4DCVA 4GPIB 1U2DA 3Q41A 4PRYA 1ID1A 3SKVA 5IJZA 3K09A 1D6NA 4II3A 1ZNQO 2GEFA 1L5QA 4MSUA 4NCHA 2Z6AA 4Z4GA 2BONA 3PKIA 4OKIA 2W0MA 1HL3A 1N2HA 1QG6A 1Y7HA 1BXZA 4NSNA 5KJFA 5ISMA 3G9QA 1M7BA 4FHCA 2AQHA 4YFYA 3T7JA 1V45E 4H77A 4KMOA 2NXJA 1JLSA 2AOVA 4LXQA 1J6UA 1UJ4A 2CJWA 3FHLA 4HQ6A 3NAGA 3F5SA 4IVNA 3C3EA 3VO8A 3LXXA 2Q21A 4MVJF 4N82A 3NHUA 4ZVOA 2Q46A 1T4BA 5EY5B 5TPZA 3LQFA 2R6DA 3U4AA 1COZA 1AGXA 3DPSA 1DDIA 4Q24A 3FPSA 1FQWA 2RH5A 3PCRB 1TRKA 5H81A 1XX6A 2FSGA 1IQUA 1SRQA 3G5TA 2H0RA 3K9GA 4OP3A 1VI6A 5D3KA 3RKRA 3PPXA 4QFBA 2NT4A 2PZKA 1TZ2A 2IP2A 2Z2ZA 3PEEA 4CODB 1RAIA 4R1OA 1ODSA 1BWQA 4F9GA 1XJCA 2Q5IA 4UTNA 4RBNA 3DE0X 4DWOA 1N3IA 5D01A 1E3SA 3KAQA 3MN1A 4MYDA 1HE1C 5KQGA 2F8MA 3ES9A 2F4VB 5E3HA 1JLLA 1TKCA 3ZOZA 1KK3A 5JZBA 1G66A 1V11A 3K30A 3PJGA 4IDEA 3R74A 1S8OA 1Q5PA 5LMZA 1HQKA 4AMGA 5DMHA 2VP2A 1YI8A 3M4JA 1H5NA 4NLLA 3UJ7A 5LD2B 3GFPA 4TVKA 1YR2A 1U0NA 2RIPA 4D9HA 1JNYA 3IXMA 2NPIA 1G2IA 2RHMA 4TWIA 2JGNA 1KDZA 2GTIA 4FCWA 1XPUA 1TYEB 5BV7A 2AI2A 2C2GA 2JAPA 4R9VA 4RK4A 3ZWOA 1W88A 1MB2A 2P62A 2ZJ3A 3GMSA 2I6UA 3IFSA 4RY0A 4YI3A 4CETA 4CLRA 1IHPA 1IB0A 3R9XB 1H3FA 3K1TA 3LS2A 2JBHA 3IMCA 2HTEA 3W8NA 3AVVA 1CF4A 2YINC 5A4DA 4FSXA 1JG4A 2P3OA 3NYIA 5LWQA 2DFTA 2QQ0A 2I80A 2R97A 2QN1A 4N3AA 2M1ZA 4G89A 2P7HA 5TF4A 4L95C 2PUCA 5DKFA 5REQB 1ISGA 2LIVA 4LX8A 5DZSA 2OO3A 4OQXA 4HWSA 3V8PA 2QM3A 2JI4A 3ZGXA 2I2CA 5DGTA 2P40A 5CCXA 3AVQA 3QVSA 1EJBA 2PAAA 4QGAA 3ZD6A 1H0RA 2AZDA 1ADFA 3K94A 5I9NA 2YOHA 2Q3FA 3AY6A 3BA6A 4LVOA 2JEOA 3ZHZA 4Z6KA 4S04A 2MYUA 1GDDA 3DE2X 3AVUA 3UWSA 3ZS9A 4UOEA 5JI2E 5IJ0B 2NYAA 3NM5A 5EI5A 1O6FA 1RMTA 1UMBA 4PO1A 3T7KA 3B1YA 1RZ3A 2BMWA 1I1OA 2BH2A 3D3KA 2W98A 1DAGA 1WMAA 1DBWA 2I2WA 3Q6NA 1E1KA 1ML3A 2VUSA 3I9JA 3O3CA 4B76A 3EMKA 3OT5A 2QSJA 4DM4A 4B7XA 5J5AA 1JLLB 1XZBA 1V11B 2Z9CA 1ZEMA 4PZLA 3S27A 3L7NA 4TXLA 1WD5A 3PTAA 4N48A 2GB4A 1DJMA 2D1RA 3GG9A 4DCNA 1VMEA 3M1IA 4R4JA 2W2TA 4CI0B 1NJ5A 1AOXA 1WXWA 4LRXA 5KWEA 3KOXA 3H5NA 3CNNA 3WL3A 4WQMA 3IEMA 3B5IA 5LBUA 3GXBA 3BC1A 2FUNB 5KTSA 4EPRA 2ZRCA 3E9CA 2HADA 1XU9A 2VOJA 4Z9FA 1OX5A 1QP7A 2RGRA 2E49A 1C7IA 1H5UA 4E3WA 2ST1A 1W88B 1R0RE 1YZQA 4W4TA 3FPEA 2WJZB 2F4NA 3EODA 5F64A 4CLRB 3KKQA 1KZ6A 2ZG6A 1MT0A 3WTBA 1NUAA 3SDBA 3PHLA 5FWDA 4IX9A 1JPNA 3DH0A 2DR3A 3TTTA 3VKUA 1G8SA 1RQLA 2ZTHA 4LY6A 3OP4A 3BIJA 2YWFA 3R44A 2H9IA 4Y9RA 4BZZA 1CVIA 4BVLA 1U7PA 2ZUEA 3NIWA 2XNCA 3D02A 2IX9A 2OGUA 2VNAA 2GHIA 1UXJA 2Y71A 3PWSA 4EY5A 4ZYZA 2B69A 1L1FA 3ADKA 3KEMA 4H27A 4BLSA 4ARCA 5E7JA 2PKWA 4FEGA 2Q5HA 1WB9A 3NHJA 3UCXA 5IASA 4G25A 2C97A 2NX2A 4HWPA 4IWXA 4NONA 1YZGA 3SICE 4I1IA 1UMBB 2CL7X 3W05A 3SHFA 2R3SA 1YJ8A 1FFEA 4RQBA 5H0IA 1Z18A 1NNEA 3VH3A 1JHYA 3QJGA 1Q7CA 5H1YA 1LTHR 3RAEC 1RWXA 3NYQA 2A86A 4RY8A 1SXIA 5C8YF 3SS7X 1EGVB 1F6WA 3U9TA 4IIJF 2HCJB 3N8GA 1FX0A 3L84A 2QNBA 1ZC3A 3C7KA 3FR8A 4MNTA 1DQRA 4OQ4A 3MINA 3QEMA 2H1SA 2I2AA 2DGDA 4KVAA 1V7CA 2I6SA 3E9RA 4PAQA 5E9AA 1YRBA 3KWJA 3C8UA 5U4XA 1XP8A 3UB4A 2PBFA 3OG9A 4M8KA 4NBKA 4ZO6A 4ATNA 1L4UA 5BV8A 2YVUA 1B73A 3OPXA 3ZYCA 4RJIA 3W8EA 3AJ9A 5DX8A 1N6HA 2NZXA 2ZWPA 1LSSA 3RVMA 1HL7A 3VU1A 4OM7A 2FTKE 3A36A 2JIMA 3P2IA 1FVFA 1LBTA 4JKOA 3P0JA 4M8IA 4NMLA 3U7JA 2W42A 5B37A 2AKAB 4CV3A 1RXYA 3AFMA 5A4FS 2AJDA 5IKOA 1W87A 3I1IA 4K5QA 1XCOA 4D6XA 2XT6A 1N5JA 4TZKA 3UJ6A 3WQBA 2NZJA 1AKNA 2VYND 3DPIA 1P2GA 4OKNA 5CLLA 5AI6A 2QIOA 2EQBA 3BK2A 4N5LA 3UT0A 5I47A 3COVA 1SHLA 2R86A 1TQHA 4JNCA 4YCDA 4Z9BA 3WK8A 2Q29A 2NYUA 3G88A 3P52A 3TNJA 4ZJYA 3W5VA 3BIOA 1HLFA 2PSHA 3JYQA 4KQMA 1U7TA 1IMOA 3JSAA 3UICA 1JE1A 5LA6F 1N2EA 1KO1A 5JY1A 4BN5A 3T3NA 1P77A 1HQDA 3FCSB 1DV1A 1CRQA 3GLTA 1BQEA 1FFAA 1DAOA 3PDUA 1SQGA 1ORWA 1SN7A 2Z08A 3GLVA 4KQIA 4KQCA 4X95A 5KJEA 3WBKA 3GLGB 3PNKA 3MRVA 4PQFA 5A4JA 3RUAA 4DCUA 4R71A 1ODFA 2H5IA 3CF2A 3I9LA 4CTJA 5JQGB 3BGIA 2I7XA 2KPOA 3EGCA 2VATA 2KBEA 1DAIA 4EENA 2WQ6A 3GUVA 2OOSA 4JB2A 2R96A 1TM3E 1PZFA 2X5OA 4BV8A 4ALMA 2UZ4A 3OJXA 3OIUA 1Z7BA 3DE1X 2QZPA 3K2QA 2UVPB 3DEKA 4P4TA 3PLNA 2KBFA 4GT1A 5A0FA 3ZE8A 4ZDJA 2PKXA 2JLWA 3V1YA 2O8NA 1LDBA 3EDYA 2HJSA 1FX0B 2ISSD 3TRDA 3KAJA 3FJOA 3ZHUA 1CNMA 1MU0A 1V0JA 1TUBA 3I4FA 3MINB 3KPJA 1U0EA 3DEFA 3QEMB 5IC5A 4U2DA 3V4SA 3R6GA 4ACBA 4UHCA 2JJ2D 4IHAA 3K2BA 3WRWA 4P3XA 4S2EA 1MHTA 2XBUA 1AB5A 2OP1A 121PA 1EZ4A 2DLCX 2J09A 3PXXA 1FTYA 3SE0A 3QZUA 4YCAA 4ZTUB 4P86A 1YH3A 1O95A 5K8UA 1DTEA 4UOQA 3AW8A 1WXQA 1I6KA 3OPYA 2E0IA 4WNIA 3RVNA 5BY2A 3AEUA 3GH3A 3L5KA 3I01A 4IMIB 1NF8A 3Q7RA 3FAKA 3S2SA 4CCWA 3LSYA 1B6GA 4F5YA 2HK7A 1PF7E 1G7RA 2B8NA 2BE7A 4IO0A 4XQEA 3VR1A 4BWGA 4BZPA 4DLKA 3GVHA 4BFWA 1N2ZA 2IKQA 4BX9A 3FRHA 1JQEA 3DYVA 2HRBA 4M49A 5IT9A 4KREA 1W75A 2OBBA 3GLHA 1A77A 4BZXA 3OOHA 4ML3A 5E1OA 5HPYB 3IQXA 4UBLA 4F04A 4QTXA 2RHWA 5ESWA 1SVNA 5DX0A 2YVKA 4OMUA 5KQLA 4X91A 3IKTA 3IOEA 1DXQA 4LN1A 3RLIA 5BUQA 5JADA 3E5HA 5TT1A 4Y67A 3WAKA 1GEGA 1HG0A 4D79A 3WICA 4D3SA 1J1ZA 1J0DA 1S9HA 3OD5A 3D7LA 4ID9A 1GRQA 2Y66A 5EJAA 4DGQA 3GLRA 1XDBA 1IU9A 3OF2A 1R5JA 2AC2A 3FNEA 4M8NE 5B1SA 1TUBB 2WBLC 2EW1A 4EHIA 4D0GA 4O4LF 1QK5A 2VJLA 3TRJA 1UQUA 1FX1A 1P29A 4UQPA 3F1KA 1I2AA 2V1UA 1J1UA 1WXIA 4OHXA 3GPLA 3HJTA 1L4GA 1WD7A 2EBWA 3MYYA 4I14A 3BB3A 5I7AA 1ANKA 5BSEA 1N0UA 2K6GA 1CETA 4DLBA 4IDOA 3EGIA 3OPYB 1DUVG 1RYMA 1VRVA 2F1JA 2XWPA 4MS3A 3UMRA 3L4KA 1HYHA 2D1TA 4E5SA 3BIXA 4D9IA 2YXDA 2JFPA 2W48A 3QKWA 5GINE 5IK2D 3L41A 3FHTA 4F12A 3AHHA 3GVCA 1IFXA 1RE0A 2DLNA 3I4CA 3JQCA 1HMYA 3D59A 4BCBA 1AKMA 1MVOA 3T1HB 3SCZA 2OFWA 3KXIA 3CRMA 4FGKA 1XWIA 1QJ4A 3GFFA 4FDAA 3GLHB 1Y48E 1CRPA 4OMFG 3HGMA 1DVRA 4WDQA 3UATA 1T25A 1JIJA 2HMYB 1ZH0A 3KUXA 4BO5A 3FSRA 4HL6A 4BKRA 3CPEA 3RAPR 3B78A 2FR1A 3REOA 4ZYXA 1PUJA 1QPBA 5DNWA 1ELOA 4ZAYA 1W0CA 3N2KA 4MVWA 4TTIA 3W1WA 1OKKA 2AGVA 3K9LA 1WTCA 4PZZA 2CV1A 1DC4A 1HE8B 2P6OA 4DANA 1IHYA 2VP9A 1Y6QA 5CFOA 5KSWB 4QT0A 1Z4MA 4GI7A 4JI8B 4R8RA 3GARA 3I0ZA 3AEQA 3IQDB 1NOJA 1IM2A 2C9BA 1EE1A 4I3GA 1I14A 1JYSA 1YL7A 1AKRA 2NTYC 2DE0X 3ROQA 2H63A 3RS7A 1MQAA 1UZLA 2FMFA 4AY3A 1CUJA 5TR9A 3TW4A 1VRWA 4U7WA 4D99A 1EX6A 1QSGA 3TKAA 2NWQA 4URYR 3IOBA 4N0QA 4DMGA 1CV2A 3ZD9A 3M6MD 1D4FA 3EIWA 3FF4A 1HTBA 3LX4A 2VRNA 3A2MA 3BXZA 3D2CA 1FP6A 4KG7A 4YP9A 5JS2A 2B8EA 2GBGA 1T5OA 1T9AA 3L8DA 2W2PA 1VOTA 3UTDA 5DM1A 3SZMA 4D74A 3ZCUA 2W11A 3DDUA 4D3YA 1N2OA 3PEYA 3IUJA 3T3PB 5EHGA 3FTCA 3T3DA 2P0EA 1N2GA 2H85A 3C5HA 4J0KA 4ZGGA 4I9HA 2AFHB 4BLUA 5AXCA 1UMCA 3WHLA 5KB3A 1JSRA 4HGOA 3OLYA 4C20A 3A27A 4ND7A 1J2EA 2YZMA 1RQ7A 3IPAA 4WFIA 4OLAA 5KHOC 4CKEA 4WZAE 3VKHA 5L4SA 1PFQA 3FLMA 1R0KA 2RGUA 3EASA 3DKKA 2QLLA 3N53A 1U80A 4KXXA 4ZU6X 4DNXA 1KR5A 2GASA 4LF5B 4R2MA 4WXHA 4L8WB 1QAOA 2HWWA 3BD7A 3UV3A 2MU1A 2O6HA 1NRJB 4FW9A 1K6XA 1WIWA 2ONCA 2C2XA 2F8LA 3PXDA 4UULA 2VT6A 2EZ4A 2XCOA 3LXRA 3KCNA 5EMLA 3E9EA 1MKYA 2VO1A 1M1YB 1PT7A 2DTEA 2IXFA 2L18A 2XTZA 3OIDA 3N2KB 3PC6A 5TMBA 2ZUWA 4NFHA 1BOFA 4D45A 2A1UA 2IT1A 3C3KA 3SK0A 3LXUX 1BWSA 1DX6A 3DCIA 1OZHA 5C0OE 5DPMA 1M5RA 1U2QA 4ZOQI 2CWWA 1MG5A 3N6VA 2FXIA 1S1CA 5CFMA 2OCXA 5IG2A 1Q0TA 1H4TA 1VCNA 2NUPA 2ZJ0A 3AEQB 2ZRQA 4HPWA 5C7YA 3HYSA 3REGA 3CJQA 2FPUA 4EHHA 1N8TA 3N0TA 2FZWA 2RGCA 3C7CB 1CY2A 3FNFA 4GZLA 4CG0A 4BB6A 3DV0B 1FYEA 4LJSA 3T15A 3TQTA 1OH5A 3R0XA 1P5FA 1UBTS 3VSCA 3KL2A 2JDID 4NPAA 3V8RA 3SNHA 2QG6A 4FZRA 1BE6A 1GTRA 4KFRA 3HTXA 3D7KA 3HYCA 5BT8A 1Q0QA 1SRRA 4PQEA 5A4KA 1AMOA 1M8GA 1YRYE 2JA2A 1X39A 4ESEA 5ALRA 4KUHA 4CPDA 4AJNA 4EBFA 3EBOA 1GTZA 4Q4LA 4DCCA 4QRIA 3W9YA 4GMKA 5DI3A 4ZT3A 4L1KA 2PHZA 1CDZA 4ER6A 5BNTA 4RLQA 4KYVA 1SUCA 3FN4A 1RXIA 4NMHA 4EZIA 1UMCB 2QAJA 1QUEA 4MYRA 3ICCA 3RNLA 1YZVA 3RT7A 1UWKA 2MTBA 2Q6IA 3CLTC 4P2BA 3N8HA 4YRRA 5DEIA 5CDUA 4L8FA 3FPFA 4KK3A 2Y1EA 3CG0A 2MSCB 3LIPA 2AZMA 1A5TA 3H2YA 4N76A 1U3GA 3QMVA 5A04A 4CKEB 3D8SA 1JJ7A 3HWX1 4NCNA 4YDSA 1TEXA 4PZPA 3ZDYB 3O9ZA 1Z2DA 4C7MA 4PYNA 1FNCA 2C4NA 2EQ5A 3Q98A 1NNSA 2ZS9A 3CURA 2IC5A 3K4QA 4QGGA 1P9LA 4ADSG 2QX9A 3AH8A 3PNLA 4ER3A 4U2KA 3U1BA 1D03A 1NGSA 1PR3A 2LCFA 2WNIA 1KP9A 2PT5A 1CYDA 3GFOA 4MO9A 4BTEA 4CKWA 2P30A 2Y0DA 4BO8A 4C03A 1UFVA 2D2EA 2A1UB 4DIEA 3E9NA 2QTMA 3PXUA 2UUAB 2NACA 2NXEA 4L27A 4ZHQA 4QX6A 1JZTA 1KI6A 3NXKA 4BQFA 4JV5B 3W90A 3ADOA 4H59A 4HN4B 4TTRA 1CW2B 1JA9A 1XLTA 3F3YA 1RYHA 4TOIA 1ZICA 3R5SA 4G4GA 4WINA 2NUPB 1KJ9A 4YRDA 5LZ5A 3F3KA 2XQVA 1VBFA 1DPGA 2CDRA 2H2HA 5L3QB 2QZZA 2X1LA 2G9ZA 3H9GA 3RROA 1V8OA 221PA 4HFRA 1SOWA 3V1NA 4JU8A 5HE8A 1C8VB 4NAVA 3WJ2A 2AW3A 1UP7A 4PZCA 1NJ2A 1W36C 1GNLA 1IUNA 4RZIA 2ZRPA 3KEFA 3RYFA 1E5DA 3RJTA 3V8NA 1XNQB 4L8YA 2JIBA 3UHJA 1EK5A 1D1QA 2JKZA 2XCIA 3U4QA 4PZAA 5DK6A 1ZGHA 2JLSA 3L6EA 4KBGA 2GF0A 5LQJA 3IERA 5C7LO 4YT8A 2DYKA 3AHCA 4US0R 2H3EA 3T5PA 3GY0A 5DYTA 5BSFA 4ZRNA 4OJYA 3ZV7A