3MJ8B

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
211
Chain Sequence
QVQLKESGPGLLQPSQTLSLTCTVSGISLSDYGVHWVRQAPGKGLEWMGIIGHAGGTDYNSNLKSRVSISRDTSKSQVFLKLNSLQQEDTAMYFCARHFYTYFDVWGQGIQVTVSSATTTAPSVYPLAPACNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
molecule tags Immune system
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
total genus 35
structure length 211
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B01
1CVRA 4RAUA 2DMKA 2COQA 5FYKU 3UDWA 4P59L 1EGJH 5T1MB 5SWZD 1CN4A 5E2TL 5MEQB 1BD2D 4Z7UE 1YN7B 4Y19A 4QRQA 1MFBH 2BFVL 5HVWA 4K2UL 4LSVL 1A3RH 3ARZA 5IW1B 2OI9C 1A14H 1JMZA 2ADIA 3RWGB 1JF5A 1C16B 1R3KB 3FAXA 5IB5B 2LU4A 3WDJA 1X5KA 4HJJL 2GSGA 4LIQL 1NCUA 3FFDA 3CMOL 3FB8B 5C8JB 1OQXA 1ZV5A 2VDRH 1NCTA 3P73A 4M5ZH 5SWZB 1ITBB 4HFWA 2VAJA 2VMFA 3RGVA 5DS8B 1WSST 4HXAH 4WFHD 3MBEA 5ALCL 1JWSB 4GRMA 4KHXL 1MVFA 5IB1A 1FGNL 4Y8DC 2DMBA 5BOPA 5JW4M 1B0RA 3JTTB 3LQZB 1FNEA 3O2VH 3FO2A 5L0QC 4UOJA 1TQBB 3PQYA 1NBQA 5DRXA 3FQRB 1UM5H 4YDJA 1D5ZB 3IT8D 4DGVH 1NL0H 4MNGB 4OGXH 2F15A 4XP5H 5I30H 4XC3L 4HF5L 4DW2H 5DD1H 3CSYB 4BYHA 1XF5A 3HE6B 3MJ7B 3MRPA 3L5HA 2J8UB 1QA9B 2Z0BA 3T1FA 4M8VA 4YLQT 3CFKB 2A6IA 1QSZA 3EJYD 4JJ5B 4KVNH 4CU8A 1DDHA 4M8QB 3IDNB 5F9JA 1CXIA 2B1AL 3L3GA 4P5KA 3LB6D 5C3TA 4WU5A 4EOWH 4YXKL 2OJEA 1QQDB 1OAYH 5D1XD 5BRZB 2VKWA 3NCJH 4Y2DD 2HTLD 3ZYJA 5KSUA 5FGBA 4JQIL 3MRDB 2B20A 1VKXA 1BZQK 1DBKL 1H5BC 2NY2D 3G5ZB 1GOHA 5DUMH 4NBZB 1DVFC 1UM5L 3HG1E 3FQWB 1EEYA 4WW2C 4NUGH 4U6YA 4ONOA 4EN3D 3FB6B 5FOBA 3E3QE 4OF7A 3KWWA 3VI4E 2OSLB 4GW4A 1A7OL 2OCFD 1KJ2H 2VSCA 1SJVA 5CUSH 3VDBA 4JGMA 3QI9C 2XFXA 2H3NA 3I6KB 3K3QA 3DYOA 3CDCA 4EBQH 1M05A 3I6LD 4XBEH 4KVNL 4U1LA 3FRUA 2EZ0C 1FNSL 3KPLA 3D3VE 4NZRH 4O9HH 4AY0A 2W65B 1KC5H 4U49A 3E8UH 5T3ZE 4ZSOE 3GRWL 1KCVL 5EO9A 3ZTNH 2A6JA 1XGQA 4JPKH 3BAEH 1P7KB 3CZJA 3TH3T 1CL7L 3MJ7A 4EDWL 5T1LB 3JWNC 3TCXA 1N64H 1JZ8A 2VXQH 4X9BA 5HYIA 4X80H 1TVDA 4AH2B 4FZ8L 1DBKH 4JZNA 5L9DH 4F2MA 3HUJB 4M5YH 4M6NL 1FNHA 4W70A 3TBSB 2KBGA 1EMTH 4P2OB 2UWEA 3CVHH 1S5HA 1A7QL 5CILL 4CDGC 2GT9A 3IFLH 5EU6E 5L2JB 2J5LB 1BLNA 1LD9A 4XAWH 3QEHB 4JRXD 2KPNA 4EIGB 1RJZA 2BSTA 3A6BH 2WBJD 3LSOA 5IV2B 2VDNH 1Q72H 4K9EL 4AM0A 4X5WA 2H2PC 4HJ0C 4J12A 1A2YB 2YD3A 4WWKA 1NGPH 2DWDA 2B1AH 2R1YB 5IQ9A 4YR6A 2D2OA 5I75C 3U2SB 1X4ZA 2PW2A 3T0WA 4OCRL 1FPTH 3OKNA 2WINA 4ODTL 2NY5C 1P6AB 4Z0XB 2AEIT 5DJYA 3OB8A 1F4XH 2FCBA 4LRNL 1WBXA 4FQXA 3U46B 2GSGB 2VUYA 3BEVA 5LBSL 2IPUK 3TH4T 5KSBF 5CJXA 2GITB 2ENYA 4QTIL 5E6IC 1UWGL 3STLB 4HEME 1AIFA 4HDIA 3MA9H 1MFAH 1TLKA 5EBWB 1CGXA 2FYYB 1ZLUK 3QIUA 5KW9H 3TO2B 2XTJD 2R1YA 1F97A 3PGFH 1MHEB 3OPZH 2H9GB 2UV3A 5IVXE 3C2SA 3D18B 5KSVA 5CZVL 1LO5B 2C3VB 1FO0A 1PKQA 2HFGH 3TV3H 5C0CA 4P2CG 1I75A 1TCRA 3SDYL 3SBWC 5LBSH 2ZSVB 4NQDE 1H8OA 1H3UA 2F53B 5FAAA 4IRZL 1ADQA 2QKIA 1I1RA 3U1SL 2Z91B 1SEQL 1MWAL 1CK0L 4ALAH 4YDLC 1TQBC 3OKOA 1MHPL 1AO7A 1WC7B 2APTA 5J1TC 2AJSL 4OZFH 1F6FB 2EDWA 5KSBB 5KVEL 3CC5A 3BJLA 2DJUA 1B0RB 5LCVL 1P7KA 4E42A 3G6JB 1LK2B 1UJ3B 2NTFA 2V9QA 4L29A 2FR4B 2Q20A 2OR9H 5DA0B 4OGZA 5JQHC 4YHOL 1RZGB 2OP4L 2H6PA 5CMAA 3UBXG 4BFIA 4WFED 3VWJB 3KLHC 3MUHL 4Y5XB 5SWSD 32C2A 3MLSH 3BXNB 3V0WH 1FNGB 3PWLA 1P5VA 2K1MA 1JGLL 4OB5H 4XP1L 5FHBH 1FZJB 4I5BB 5TPWL 3LKOA 4QYOB 3ZE1F 3WJLC 4OZIB 1EERB 4X4MA 4O02L 2YRPA 1KF9B 1ADQH 2V9RA 3M45A 2HVKA 4HUWB 4OCYH 1XCQB 4FQ1H 5MHSD 1B6UA 1KJMA 4FQIH 3I9GL 3RKPA 2Y7QA 3SCMA 4L4TB 4L9LC 1ZGLM 4I2XB 3H9SD 3IS0X 4U6XA 2R0WH 4EI5A 4WWKD 3IXAB 3U0PA 4RWHA 2PTVA 4FTVA 2CR3A 4PY7B 4RNRA 3P4OA 2D7TH 2K3TA 1JRHH 1S7XB 2E27H 2J88L 4TULL 2VDMH 3TBSA 1Q1JH 4MSWB 3RVTD 1BVLB 2HH0H 3OB0H 5DVLA 3BMVA 4N0FA 2PN5A 1HNGA 4PUBL 4Y5VA 3QCVH 4IMKC 1UWEL 3GIZL 3KPQB 2AW2A 5IGXL 5TQ2L 1RUPH 2J4WL 1RZ8B 1CFTB 3C5JA 4CNIA 1YYMH 4PTUA 2VJXA 2DLFL 3UTOA 2YKLL 2B7DT 4QEGA 4CMHC 1U2HA 5CHNA 1UCBH 3AM8C 4XX1E 1JWUA 1FNGA 1FC1A 3CVIH 1HK6A 3BXNA 5AZ2H 4MNGE 4LASH 3MRIB 2MQ0A 4NPYB 4U6VH 2VDML 1KCKA 1W72A 1U8HB 5J12B 1R3LA 5D9SB 5JOFA 4D8PA 4PRIE 3GSQA 4XMKH 3LEYL 1QSFD 3BOVA 5IEHA 1DBBH 4M61B 1WK0A 4ZFOA 1FP5A 1JWSA 3BIBX 1JHTB 4OZGF 3O8XB 1RAMA 3ABZA 3T77A 4LLMB 3IAQA 1NEZB 4RA0C 5KN5B 3ARBB 3QIWA 2O61B 2QV2A 3LEXB 4AJ0A 3ZT5A 5CD5C 5C0AD 3WLBA 1FCCA 7CGTA 1XZ0A 3B8YA 2OR7A 4O00A 3C8KB 4NQSB 1B2WH 3QPXH 4NN5C 1CFQB 3LKPA 4N5EC 4U7MA 2JB5H 1A9EA 3MRJB 3TNNA 1RMFL 4OZHB 2G60H 1AI1L 3HPJB 4NRXB 4ZPVA 1RZ8A 3CH8A 5GZNC 2A6IB 3HE7C 3VRIB 4RDQF 3HMXL 5I16B 4AQ1B 3MV7B 4KK8C 4G5ZH 5C0JB 1QACA 2HKFH 4I0PA 3IJHB 5DUPL 4KROC 3UTZA 2AK1H 3BW9A 1CFSB 3L3OB 3NCBB 5D8JL 1XT5A 4LLUA 4E41D 4H20L 3PL6A 1EO8L 3EYUH 4P9HH 4LCUB 3B6SB 4CVZB 4NJAH 3NCMA 5T5NF 3MLUL 1MCWM 3WFHA 1S7WA 2D4DA 4S1SH 3BWAB 2OL3L 5A2JH 4L4VA 3L5JA 5SV3A 3RGVC 5C9KA 1J1OH 1CFNB 5ADPH 1JNNL 2DM3A 3DBXB 4EI5D 3FT2A 4HQQL 5FXCH 4JFDD 1T0PB 2BHUA 1RZJL 1VSCA 2AGJH 5ALBL 3WFBH 4NNYA 1NBVL 4AK1A 3O6MH 1C7TA 1FRGL 3W0WA 2YPLD 1QLFA 2R2BB 1ZGLB 3AAZA 3HE6D 3K2UL 5EIIA 2EYSB 4YDKL 2Z4QA 1EAPB 2YXMA 2VLJB 2WBJA 3IJSA 2FJGA 2OTUA 2R23B 3S36L 3THMH 2HFEA 2X1XR 3KDMB 3VXME 4QNPE 3C6LB 2O5ZL 5GGRB 4QTHB 4KUZH 5EBMB 1KOAA 2VDKL 4OCMC 2EIZB 1R6VA 5E8DH 2CDGA 4GKZA 2R1WB 4P9MH 4PY8J 2WIIB 5FYJE 3B3IA 4PJ9A 3OKEB 1D3CA 2GK2A 4RAVA 4F57H 5CGYD 3HC0B 3LIZH 4JKPH 4MAYC 1FFPA 3P77B 2NY1C 4Q0XL 2FJFB 3KVQA 3UJIL 3U4AA 2YMXL 2JIXA 3QI9D 4LLYA 4YGVB 4JQXC 4UBDD 4F7EA 2AXFA 4L5FH 2DKSA 5GPRA 5DEFA 3I84A 4ORGB 3B2VH 4OZHF 3NN8A 2QR0A 1LP9E 3QT2A 5F7NC 1OLLA 4CVXB 5DC4B 2YD8A 4NKOB 2CUHA 4NRYB 3D69B 2VXQL 3ZE0E 5JA8B 4X7TB 4PJIA 4YDIL 3NA4A 3RX5A 2NXZD 2RCSH 4RFNB 1JGDA 1MAML 1VCAA 2B1HL 5DK3A 4FMFA 2Z35B 5C07A 1LP9A 2ED8A 3GSVB 1KN2L 1W8OA 4OQTL 4FG6D 1BBJB 1JNHA 4PJBE 1AD0A 1I7UA 4NDMB 4CN1A 2A6KB 3QXDA 4RGNE 3EIFA 4P3WA 3KPOB 3G6DL 5DFWH 4B0MM 4OLYL 4G6MH 5F97E 5DMKA 3H6JA 5D6DC 1T4KB 2YK1L 1FZMB 3VFNA 5GZND 1SYVA 1TZIA 3T1FB 5D6CB 4LAJH 3RWIB 1S7QB 3BRFA 3ZDYF 4YXLH 4OFPA 5C3LD 2ADFH 3IETB 3KPTA 4YQXL 4JO3L 3RVXD 5FO8B 1F4YH 4DTGL 4ODSH 2X2YA 1QBBA 2X7LA 2Q76B 2XA8L 3O3AA 1NGZB 4G8GE 4XH2B 1CF8H 1ES0B 4OF8A 4PP2B 3UP1A 3VFPA 5I1HL 3T2OA 4KKLC 4NQDD 5ITFB 3WL9B 5KS9B 3CVIL 2X9XA 3BE1L 2OM5A 4DGIL 3MV9D 4JFFB 4PJAE 2EE2A 1JNLH 1P84K 1IILE 5DYOB 3PDDA 2HRPL 1OSZB 4KTDL 4QF1A 2IPTL 2VLMD 5J1SC 2NXZC 3LN4B 2F74B 3TJEL 3MLWH 5IWLC 4PJBF 3T09A 2KDGA 5CEXB 4XCFL 2VZVA 2AXFB 3VWJD 3O6FD 4DAGL 4XPGL 2NW3A 4Y1AA 4ELKB 3V7AE 4F9LC 1PDKA 5HJ3A 1OWRM 4PRPD 1A4KB 1G1CA 1MSPA 3S3JA 2YN3A 3BISA 5ERWB 4QWWC 1HHHA 2PR4H 2Z8SA 4L8CB 1A47A 4LLWB 4AEEA 1WWAX 1PSKH 3RY5A 2H26B 2WNGA 4PJCE 2EDJA 5BQ7B 1T22B 1U3HA 3TVMB 5D7JA 4K3GA 1U8NB 3KG5A 4MQ7A 3ZE2E 4LPXA 4CNIB 2XA8H 3VXSB 3UC0L 2DQCL 4QHMB 3GMPA 4JFQA 4YHNA 2OL3B 5IJVB 3D85D 5HD8D 3UO1L 3WLWC 4GW5B 43C9B 5E08L 4NUJA 5BV7B 2GQHA 4QXGH 2ZPKH 2QHRH 3EFDH 5E5MA 4Y4KC 3SE3A 1H0DA 5FGSA 3A6CH 1G7PA 3BPLB 1OARH 1BGXH 4Y2DC 4ZFGL 3F7YB 5IMLA 4L8BB 3VXTA 4OLYH 5EU6D 3CDYA 1DVFA 5FHBL 4U1JA 4ZDHA 4JY6A 1V5JA 3BVNA 3OJDB 4JFEE 4NQCE 2VISB 2DQDH 1BQSA 4QNPF 4JFOA 2VLJE 3V5DA 2NNAB 2BP3A 1A7BA 4LSVH 3GMPB 4OCXH 5I71B 3TYFA 2YPVH 5C09A 3SDCB 4JM2C 4X4ME 4J8RA 3GBLA 4PBWD 4F37F 1A1OB 1RHFA 1KTKE 5E00A 1LO2H 5D70H 1I8KA 5F7FA 3JWOL 1G7QA 2WK2A 2D31A 2XY2A 3OAYH 2FNBA 1BGXL 3NA9H 2BVQA 4XAKD 5ERWA 3BZ4B 2BSED 3QSKB 3NPSB 1NGQH 2C3WA 3ILPB 4S1DD 3O9WD 3NFPA 1ZS8B 2W91A 1N2RA 1GGYA 1FAKT 3HC4L 1SYSA 2VC2H 3QXWA 3HAEB 3TN0A 3SO3C 3EDEA 3A6CL 1PD6A 5GS2H 43CAA 3VRIA 5A2LH 5ACLA 5B21A 3JUZA 2CK0L 2UVFA 5T33L 2I5YH 5HY9B 2RFXA 3AXLB 3WIFB 1YNLL 3L3KB 2Z35A 1SJEB 2AKRA 4XPAL 3DSFH 3U0WL 2D31B 3T0EC 2I07A 2HJKB 4LF3B 1WCBA 2HLFC 3PL6B 2ZCLH 1G9NC 2YC1B 1CXFA 2DLGA 1TIUA 3U82B 1JUFB 2Y23A 3SDXB 3DVIA 4OM0H 3H8NA 2P43B 1ONQB 2WQ8A 3BKYH 4FP8L 4HG4J 3MLRH 4M7LH 4PJCB 3VFOB 2FDBP 15C8H 3CLEL 5E1AB 1OAXH 3MXWH 4PGBA 5LJYH 1F3DJ 2EDNA 1MFEL 5HI5C 4XWGH 1RZFL 2AGJL 4PRIA 1QSVA 4DVRH 1IMHC 2VC2L 4HGWB 3RHWK 5IF0B 4BSWB 1L6XA 4R4BB 2I27N 4ZS7L 1BAFL 4D9LH 3S9DB 1DR9A 1X4XA 3H0TB 5TQ0L 1CLCA 3C5SA 4F9PA 5D5ME 4RGOH 2ZKHH 2CSPA 1GPOH 4HUXB 1C5DA 2AV1B 2YUVA 1A4KA 5AYUL 2LVCA 1F6AA 1CIDA 1N5YH 1RIHH 2HFEB 1S5IL 3S34L 5D7LE 1VPOL 1E4WL 2ZUQC 5GS1A 4WEMB 2HFTA 1NC2D 3ZTNL 4OQ1A 4RWYH 5F88A 1PG7L 5INDB 5C0AB 4MXQC 1KG0B 3ARVA 5FFLA 2IH1B 5BZDA 3MCKB 3OB0K 4N0FB 3GSXB 2DIAA 1TITA 5IB4A 5BS0A 2QSCL 1O7VA 5IW3A 3LSOB 5JW4Q 1OWWA 3GRWH 4LSUL 5C09D 4JFFA 1DBMH 3MBXH 4M7JL 5E56A 1MLCA 5AYUH 1ORQA 3BZFA 1F90H 2BXZA 1WFTA 2YZ1A 5FUCC 2XQBL 2R8SH 2V2WB 2VLRB 4ZG1A 4MX7A 2W0FA 2ZCKL 1CFVH 2FX9H 3RBSA 4V2CB 4WJ5B 1EX0A 4NC0B 2HKHH 4TNWK 2XZAL 3ZT7A 1B0WA 1G9MC 3BH8A 3P2TA 3T0EE 1LILA 1LEGB 3O45B 4FRWA 4G80B 5I66B 1ZGLA 3EFFB 4F3FB 3WCYA 4NM8L 1AD0B 4NWUL 2NY3D 2IMNA 4ZYKA 5KVGL 2YD5A 3S37H 3V6BR 2R9HD 3ZKXC 5FUCE 2DJSA 5I73C 1OAUL 4TTDC 2P5ED 4PJ9C 2QL1A 3I2CH 3RWEB 2GJ6D 5GS1B 3RWHA 5DD6B 4XVUD 1EVUA 1Z3GL 4Y0GA 5I1HH 1G0DA 1A7PH 1S7TA 1CFVL 5SV4A 2IADA 3N0PB 3L5WA 4D9LL 5ACMA 2CLVB 3BO8A 4WCYL 3C8KA 2Z9TA 2X4QA 4L3CB 4P3DA 4KXZH 4P2OC 1QBML 2X9WA 1I7ZB 4LSSL 5LGKA 4FTVE 1ZLVK 3WXWL 4U1GB 3LPGA 1EHXA 4ODHH 4GBXB 4P46C 3ARFB 1RPQA 3HFML 3ZKSD 2AK4D 2HFGL 5ID0B 2JIXB 1UM6H 2AJ3B 2RBLA 2YBRB 3DV4A 3S35L 5T5FH 4ZXBB 2AXHA 4NJ9H 4BQCA 1TNNA 4YFDB 4YGAB 1KJVB 1A8JH 3GI8H 3TM6A 2WBJC 3ULSB 5F7HA 4YXLL 1KYOJ 4NBYB 5DO2C 5KSVB 3UZVB 2D7QA 1QHPA 4XNMB 4LSTL 5DFVC 1DQTA 4S1SL 3RY6A 4L3EB 2FWOB 2CRZA 4ZUVA 3I3BA 5CEZH 2AK4B 3CSYA 3QI9B 1JUFA 2W9EH 1N5YL 2YA0A 3X12B 4HDIB 2CLRB 4Z7VE 3VFUA 4HWEH 1JYNA 2H26A 1NPUA 4KXZI 4LLWA 3QRFM 3P9MA 3PDOA 1D5ZA 4UDUB 3HAEG 4HJJH 4WW2B 2GK0B 4K94C 4DUWA 2F58H 2BX5A 2WUCH 5ISZD 1Y6KR 5DMKB 1UZ6E 2X4RB 4WFGE 2VABA 3HG1B 1KB5L 5HXMA 2XN9B 4MB4A 3AAZB 1JF1B 2C5DC 1IKFH 3GI9H 5LWYH 2NX5B 3SE8H 3P73B 4UV7H 3VXUD 1X5ZA 1V3MA 3I75A 4PJXE 1I4FA 3DECA 3DGGB 3G5YB 3VWKC 3NIGF 3SGKC 5AUMA 5LQBH 3L6FA 4PP2A 1A6PA 1XGUA 3VFPB 1B4JL 4Q2ZA 4MNHA 3UBXA 1TQCB 5A2IH 4IDJH 3GMRA 5C2UB 1U58A 1A6WH 2IADB 3CX5K 1ZTXL 3A0OA 2JCCA 4U0RB 3MRKA 1FSKC 4Z78A 1KBGH 3VXUB 1F3DH 4ODUA 5EFIA 4X7SL 4F7TB 2OBGA 3JV6B 3TZVA 4N8VA 2F8XC 1AFVL 4K7FA 1S9XB 5IMLB 1KLFA 2A77L 3LOWA 4HAGA 4R3SA 4YFEA 1RUKL 1OCWH 4LSSH 4Y19E 5ID1A 4LKXA 1JGVL 4Q9BA 2OXGA 4XZUA 4PBXA 3T65B 3UTTB 4BZYA 2N4IA 5D2LB 1BQLL 1OVZA 3MYZA 5CKGA 2OSLA 4Y4FB 1YMHA 2D4FA 4KRNA 3QHZH 1MCHA 3OZ9H 1FJ1B 3OG6B 1J0HA 3LPFA 2V6HA 4D9RD 2VDQL 3SKJL 5K59E 4OAWA 1IEAA 4LPTA 3O3EA 7FABH 2V9TA 3IDMA 4U1MB 4FQCL 5J6HA 4AEIH 2JJWA 1B3JA 3DV6B 4I9WD 5BRZD 3EYQD 3QQ9C 1T1YB 4EN3C 5HJ3B 3MGTA 1QLRA 2LV4A 4Z6AT 2VO5A 5IJKC 4NNXA 1NGXB 1WJ3A 3RDTA 1M7DA 1LE5A 1FZKA 1JPGA 2Z8WC 4MCYB 2IBZX 4IDLA 2CQVA 3O9WB 4X4YA 1W72L 4QXTA 5GIRB 1QFWM 3IDNA 4XMPH 1Y0LB 4QXUH 5ICXA 4W4NA 4HPOL 3LH2L 1SEBB 5DT1L 2P5WA 4GFTB 3RTQB 1CF8L 1R3LB 5D9SA 1KB5B 3PIQA 4ZFZB 4N0YL 5EBWA 2YPLE 1NANH 5KS9A 3E2HC 3QNYB 5J1AA 2VOTA 5BXFA 1YN6A 4Z5RB 4OF5A 4AENA 1N64L 1FO0H 3RPKA 3WUZA 3ZDZE 5AD0A 4LOUC 2BCKA 5F8RC 3ORJA 1CL7H 4L4TE 4W68A 3GB7A 3SGEH 5ID1B 4LEXL 1NMAL 4NO0D 1CE6B 3RWJA 4PJGF 4QRRA 1WICA 4X4XB 3E6HB 4K7PH 5IHLB 3RWCB 2VXSH 5JMOC 2A9NH 1YEFH 1T7XA 5HHOA 5CCKH 2ICEA 3GHEH 4G43A 4R7NB 1GSMA 4WUUD 1GPOL 5DI8B 1MHEA 3CMOH 3GSWA 3TT1L 2AQ2A 3D6GA 1A7NH 4MXQD 4PREB 5IFAH 5I8KL 1BOYA 4BSVB 3GMNB 1FE8L 2QADD 3GSVA 3GJEA 3GBNL 2R0KH 1I7RB 3MA7A 4JZOB 5DTFB 3U7AA 4H0IA 2EH8H 3VFVB 1A1NA 1I8IA 2R2HB 5TF1L 4XCEA 3LV3B 2GW5A 1P4BL 4M43H 5FA4A 3WFCL 1MFCL 1M7XA 15C8L 2EDHA 3CLEH 2DTSA 1BQLH 4KROD 43CAB 4F33A 5DD3H 2G2RB 3L3HB 4UOW1 3VW3L 5CEZE 3LKOB 4QYOA 1NBVH 1ZT1B 4DKAA 5IHZB 1HIMH 5ALBH 4OM1H 5DJ0B 5E2UH 5GGUB 2W92A 4TVPH 3I6LE 1QTYT 2AXJA 4PJ5E 5GRXG 1BOGA 4WWKC 4M5ZL 1DN0A 2H1PL 4NNPH 5I73B 5JOEA 2ZJSL 5DHXB 3BZEB 3PP4H 4WHCA 4IBLT 4Z7UF 3ZKXB 5KSAD 3MJ9L 4OI8A 1FYTA 2X10A 3KHOA 4U6YB 5B8CC 1JFQL 4WUKH 3ULVD 1CGTA 2VXVL 1HINL 4B5EA 5JHLL 2XNAB 3WN5B 1JYVA 4PJ5A 1YMHB 3WIHA 1HN1A 2X4OA 4XNQB 4I3SL 5CP7B 3FB5B 5BRZA 5AYQA 1KJ2B 1C5BL 5KANG 1IKFL 3GI9L 5LWYL 1H0DB 3N1QC 5C0ND 5J06A 4ISVA 4JFPA 4LVNB 1U8OB 1DBJH 3MV7E 5I74B 3DX6A 4DVBA 5DK0B 4K71C 4RCAA 4JVPA 2N1KA 4CMHB 1YY8A 3LN5B 5EFIB 4DEPB 3UXFA 4YHOH 5I17A 5JNYB 3JUYA 1WBXB 2JELL 2G5BA 2VDKH 3VFMA 1MCBA 4BJLA 4Q97A 1T3FB 3OXSB 3L9RB 3QEUA 1IAKB 2CKBH 1S9KC 4P3CL 1I9IH 4NZUH 4UNVA 1YZZA 2FECL 2AJZA 3KYKL 4XBEL 2BNRA 3F12A 4X6BA 1H8SA 2XN9E 4NO0A 4M6OL 3GJEB 3QUXD 3VGDA 5IT2L 5DLML 4KRLB 3BWUC 1BLNB 3VXRB 2G60L 2ATKB 4P2OA 1EEQA 2GYSA 4N1HB 4PRAA 1Z9OA 1W0VA 5AZEL 4DJMA 1R3IH 1U8PA 2XZQH 2DI9A 1A9EB 3MRJA 3MGTB 1NAKL 1X4YA 3LS5L 3CK0H 1OTTC 3D0VB 3KYOA 1ES0A 1EFXD 5EZOH 1NGZA 3RAJL 1R3HB 5EN2A 3PDOB 4MQTB 4JRXE 3RZCB 5JOPE 5DDHB 3SJVB 2HMIC 4WDIA 2EYTB 4MJ6A 1I85C 4PJFF 5J57B 4JFHE 5E6YA 3C2AL 4CN6A 5JLZB 4M62L 5T1MA 4P3CH 5BO1L 2IPTH 4PD4J 3FO2B 2AQ1A 2C3VA 2LTQC 1MLBB 3INUL 3LEYH 2XTLA 3CXDL 2VZOA 3NZHL 3BE1H 5ISZB 1J5OH 4O2FB 3LQMA 1YEDA 4G8EB 4Z77B 2PYEE 4HGMA 1T20A 4KI1A 1RIVL 3BGFC 4WI7A 4R90L 1C08B 5EC1A 3MOAL 4EI6A 3DRQB 1ZLVH 2ERJB 4H25B 1M7DB 1RIUH 3TJHC 3FB8A 1JJUA 4JJHA 1FQ9C 3H2WA 5C0GB 3GMOB 4XVTH 1AO7B 1NCCL 5CLWA 2AJZB 4YDLB 1R5WA 3S96B 3TA3D 3GIVA 4I0PD 4XTRC 2VZ3A 4IMLA 4ZQKB 3SDXE 3K46A 2P24A 3DUUB 4MLSA 1QFWI 4LCYB 1U3JA 4M93B 4UTBH 2CJUL 3VXNB 5HYQA 1YN7A 1XH3A 1E6OH 5DXWA 3F7QA 4RFEA 4U0RC 4U1KB 4KQ3L 5FF6B 1FIEA 5HDQL 3D9AL 1VEPA 1MQ8A 1J10A 1U8PB 4QHLB 3AM8A 2W9LA 5C0IB 5JIPA 3RX7A 3MOBL 2BHZA 4WV1B 5DRWB 1JRHL 3GGWA 4J6RH 1JPFB 5IOPA 3FTGB 3BRDA 4YBLB 3RVWD 3KPRB 3C5ZC 4CMMA 2I9LA 2XA3A 4MDIB 4TN9A 3SKOA 3VGBA 1QR1B 5B4MD 4HIIA 4J1UB 3OGCA 4G80A 3FB5A 4F37K 4NZUL 4PRHA 4H5SA 1TVBA 3EBAA 4HS8H 4RQQA 2VLRE 2QSQA 3W0WD 1JZ2A 1MIEH 2NLJB 3W5NA 1FVDA 3SDDA 4P59H 2BSSA 3VE0B 3QDGA 2ATPB 3W9DB 2BSRB 2DLFH 4Y2DB 5JORB 5BV7L 2VITA 3MQIA 1A3RL 3TBVA 1K6QL 4FZEH 3ARGB 1G7HA 3VCLB 1VFOA 2QQKH 3O3UN 2X4SA 1HSBA 1ACZA 3RWFB 3BP7B 4Z7QE 5T1DH 5I17B 1RUPL 2J4WH 3AREA 3QUYC 3H9SA 4R90H 1NCAL 3RWDB 4X6DB 2CMRL 3OGOE 4MJIE 1MJ7L 3BPNC 4CADA 5M94B 2CUMA 3OG4B 3DGGA 3G5YA 4DZ8B 1F11A 4GS7B 1WWBX 1T66C 3MLXH 1MFDL 3GMMB 2FWOA 3RDTB 1LO3L 3ME0A 4XPFL 1RI8A 1IEBA 2CDEB 1DCLA 4IIQB 5D7LD 3MBEB 2PXYD 2GHWB 1CYGA 4L29B 5HYFA 1MJUL 3NZ8A 4G3YL 2JKXA 2V7NB 4FG6C 1HHJB 1I1FA 1XGTB 3OKMA 4Y4HD 3TBVB 4GAJH 5BCAA 1YNTA 2X41A 3H9YA 1N7MH 1OAZL 3ARFA 5FB8B 3VXMD 1UKTA 4EQ2A 2ARJA 2D7OA 3B9DA 1PKOA 4PGJA 3BN3B 2RIKA 3C5SB 4ZAKB 2HFFA 4XC3H 3HB3C 1GGBL 3UYPA 5ECJE 4Z0BH 3DRQA 6FABH 1P7QA 4D0DA 1H15B 1T2QH 2NY2B 2X9YA 4WY7H 4QY8A 4KFZC 3TFKC 4HPOH 3H3BC 3LEVL 5DFTA 3QG6A 4FXGA 1P4LA 4NRZA 4PR5B 3ELAT 3QPQC 5J11B 1MVUB 4OIIH 1NGQL 3UPAA 4BH7B 2I25N 3P30H 3WNKA 2Q7YB 4WUUB 4U1KA 2CXKA 3UYOD 1MNUL 1EO7A 4W6WB 3KPPA 1AGDB 4LRNH 4HS3A 1U58B 1A5FH 4YEFA 5M95B 5DUPH 1JV5B 4V1DB 4EDWH 3NVQA 3REVB 4PJIF 1DQJA 1MWAH 1KPRB 3MLYH 4GKOA 5FKPB 4NGHL 4KDTA 5E9DD 1RJLB 1LVEA 2VLRA 4JO2H 5H2BA 2WINB 4X6CA 4LFHD 3OKNB 4XMLL 1BM3H 1N8ZB 1UC6A 1MJJB 1NEZA 3WV0A 2R0LH 5KVFH 5DD5H 2DIBA 1X44A 5DFVD 5ICXB 1T20B 3X3FL 1EGJL 4N9GA 4UU9A 1CLOL 4NJ9L 5MI0C 3S88H 3K4ZA 2MTPA 2E9WA 1VFMA 4PV8A 2O5YL 3UJTH 2C3HA 4N90D 1AE6H 4NO0B 2P7TB 2B0SL 4HKXB 1LD9B 2PUQT 2DM7A 1OY3B 3P4LA 1N0LA 1YEEH 1FO0L 2Y5EA 1XF2B 3MRRB 1JWUB 1VA9A 5CSGA 2DQUH 4P5TC 4PRHD 1DUYB 5AWNH 3MRBA 3QIBB 5FYJU 3HI1A 4YDJB 3IETA 3MLZL 3MPCA 1YMMB 2MSPA 3RBGA 4DN3H 1QYGL 4MXWL 5K9QG 3QG6B 4YDVB 1IBGH 2HN7B 1HQ4B 5KTEH 2ZNXA 4PRAB 2A83B 1IC4H 3WKML 4HIIB 4NM8H 1QVOA 3QIBD 4M4PA 4D0DB 1N59B 2LE9A 2A73A 4R4BA 1P7HL 2IGFH 3X13B 2R9HC 1ZLUH 1ZA6B 4R3SB 3O6KH 1Q72L 2IBZY 4H88L 3VXMA 3KPSD 1G7PB 4LDOB 4UV7L 3LQAH 4KY1L 3ZTJG 3U0PB 2XTJB 5CILH 5INCB 4RIRA 1P4BH 4M43L 2MOVA 3VXUA 4PJAF 5C9JB 2R8SL 1UWEH 3GIZH 4XB8A 4HS6A 1B0GA 4U7KA 4OCNC 2L0DA 2QQLL 4YFLF 3SKNA 4KRPB 2C1OA 3G5ZA 2SEBB 2ORBH 3RJDA 4GJTB 4NQXB 2EYRA 3VXOB 3NZ8B 5EOTA 2XTJE 3GIVB 2OLDA 4Q9RH 1KIQB 5EWIL 1A7NL 3GMOA 4U1HB 4HS8L 4FQHB 3ZKND 4O4YL 2NY2C 2N56A 4Y4KA 5ALCH 3SE3C 1LO0L 2DYPD 1VENA 2W9EL 5HY9A 2DBLH 1MUJB 4OLUL 4CW1A 1KLUA 4M7JH 3TZVD 4L8DA 4RGND 3SE9H 3OX8B 1J8KA 4BKLA 4D0CB 5HDBF 4WI9A 5I0ZA 5DD0H 3HAEA 3VG0L 5EBMA 1A7OH 1BWWA 4MD0B 1I7TA 3HNTL 3OKKA 2JELH 1MWAB 3OAZH 5FYLE 4OGXL 4K8RC 4K7PX 2EDYA 5D72L 1J87A 2P4AB 3IJSB 3ULUC 3BP4A 3B83A 2XICA 5FGCE 3SJVA 5D6DA 4C59B 2R69H 1P6FA 4NKIH 5MENE 3BDBA 4PP1D 5J9PA 1UG9A 3TJHD 4ZSOA 1L0YA 4YHKL 5GRYA 1QLFB 1G7LA 3C09C 2B39A 4BFEA 2OXHA 4I0CC 5I1AB 4HKXA 1J5OL 1RZFH 3KPRA 4GXUN 3X17A 3S37X 2RFXB 3AXLA 5BS0B 1RV6X 3OXRA 4XNMA 3U4EB 1CDUA 4MD0A 3T4YA 3H9SB 1DN2A 4JDTL 4G7VL 1HILA 1S78D 1U6AL 5BRZE 5F7EL 4FQLL 3RU8L 1A6VH 1BJ1J 5C8JA 3TVMD 1E4JA 3ZO0A 1C8PA 3NFPB 4JKPL 4MNQE 3B8SA 1A14L 2Q87A 4RFOH 1N6QL 1BREA 5JPMA 1C5DB 2AV1A 5D1ZC 5IW6A 4KAQH 1H3WM 3MRCA 1YEKL 2XOTA 1MHCA 3CZFB 3MACL 5GGSA 5KSAC 5I9QB 1G0XA 2JJVA 3H0TA 4P4KB 1J1PH 5BVPH 5F44A 1CLYH 3VXSA 2DLTA 4F9LA 4NQDA 4POYA 1YQVL 3TYFB 4ZMAT 2Q6WB 1BFOA 4EVNB 1UXSB 3K80A 3TO4D 1BECA 4OUUA 4AG4L 2GJJA 2HAZA 2UWEE 4LLVA 1XF4A 1OP9A 2IG2L 1PYWB 1L0XA 3VG9C 3QQNA 3BQUD 3CSGA 2Y36L 5E5UB 3V2AR 2DKUA 2MPAL 3O6FA 3L5XL 2EH7L 4APQB 2CPCA 5EUKB 2GFBA 5KZCD 2ED9A 3WN5A 3T0ED 5DURD 5E4EB 2HVJA 5GQBA 2ERJC 1I1FB 3OKMB 2BVEA 3ARBD 4QLRA 4LCCC 5F3HB 4TNVK 1SBSH 4K55A 4LP5A 3HZVA 4IOFD 1KYOK 1GAFL 1RIHL 3WUWA 3VMPA 3T2QA 3QXAA 1T22A 5ANMB 5ICZB 3QHFL 1FL6B 5F1SA 4YHPA 4M6NH 4MCYA 4Z7UB 3BEWA 5EA0H 1KCUL 2BNRB 1E28B 2EH7H 5ENWA 1FNFA 3L7EA 5DUBB 3D0LA 1J0JA 3S98A 1NFIB 5TDNA 4H8WC 1AXTL 2GY7B 5CEZD 3MTRA 1E4XI 1UM4L 5HGDA 1MCPL 5IP4A 1VGEL 3HZVB 4HIXL 3WXVL 5HGHA 4YH6A 1FJ1A 4PRHE 3EJZC 4YHZL 2VXVH 3PGCB 4OZ4A 1PZ5B 2A6DA 3CSPA 3L5IA 4JFOB 4HPYL 4LCUA 4PJGA 2IWGA 5EUOB 2HMID 2CR6A 3T3PF 2V17H 3N50A 1QR1A 4M1DH 1RK1A 2WUBL 4BUGA 3GHBL 2J6EL 1D9KD 3ROOA 2BNUB 2PW1B 2XN9A 3PJSB 4A6YL 5FYJD 4AMKL 3I6GB 1CT8A 4FQCH 4MJ5B 2HT2C 1P4LB 1VFBA 2VLRD 1KCSL 1J18A 3W82A 5BZDB 1EIBA 4U6XB 2MCPH 4WI3A 1U8QA 3MRPB 4MS8D 4P48A 3SGDI 5DJXA 3IRZA 3HKFA 4QRRB 3CFBA 4LCWE 3FOLA 1A0QH 3ZMRA 4X9FA 4Z7QF 5L7XH 4EVNA 1LE9A 3P0YH 2A6KA 1QRNA 1MFCH 3MV9E 5HDBE 4GUPB 3D1MC 1XR9B 4WCYH 4Z95L 3UAJC 3NPZB 5TF1H 1FZJA 5I74C 2P8LB 5DGQA 3Q3GA 3T2NL 1IGJB 1YYML 4RRPG 1MJ8L 1OP3H 1TZHB 4QHNB 4IJ3B 3L3KA 4X7DC 2AJUH 4JY5L 4Y5XA 4X7TA 3CDGB 2Y9RT 4TVPD 2M26A 5FYKE 1KT2B 3D69A 5IHUH 2X5PA 2CIIB 3V4PL 4PY8I 4BH8A 2N7BA 1IGCH 4ONHB 2V7NA 1HCFX 3CXHK 5J6GB 4LEXH 2O93L 2NY0C 3QQ3A 4PGEB 5IEHB 4FFYH 3RY6C 1EVTC 1A6WL 2BDNL 4NWTH 3ZL4L 1U8LA 5GISL 3VGGA 2D7TL 3MZGB 3BZ4A 5T5FL 3S97C 3V4UH 2W60B 3QEQE 5B8CB 4UT7H 2OR8A 2XG5A 1UFUA 2IFFH 1JN6B 4OV5B 1IEAB 4KVCL 1KN2H 5FM5O 1YJDC 2X4SB 1AGBA 2Q8AL 5TE4L 2D7MA 5EU7C 1V7NH 2VZ1A 3KPMB 5KJRL 2ATPA 1Q9LA 3RRQA 3HE7D 3HRZA 2WUCL 1CGSL 1MRFH 1ZT1A 4WWID 5ANME 5E8OA 5EZIH 3BZDA 3MRNB 3MGOA 2BDNH 4NWTL 4PJHB 3EOTL 5HDLA 2UUDH 4H5SB 4X8JB 5MEPA 4U31A 2BNQB 2DWEB 4H1LA 2FYYA 1JHLL 2MNUA 2BOCB 1JE6A 3S37L 2AJ3A 4MDIA 4P2QE 5FK9B 1RK1B 3KLSA 4J3UA 3S4SB 3PGDA 3HE7B 4U6HA 1IQWH 3LMJH 5JXEC 3MBEC 4Q0XH 1HWHB 4NO2B 3B9KC 2K7PA 4KKCC 1MRCL 1A3LH 1I3RA 2NMSA 4GBXD 2NZ9D 4B7LA 1LK3L 2G5BB 4XPBL 3GSNA 3MNZB 4MMZC 4PRNA 4KZDL 3EO0A 3U79A 3UPRB 3OZ9L 4C57C 1YNKH 1XGUB 2YA1A 3HZMA 2FL5A 3HCVA 2H2SD 1BJ8A 1F6LL 1A0QL 4LRIC 2PKDA 4PV9B 4AM0B 4GO6B 5HVGB 1JPGB 1HH6B 1U8OA 1BWMA 3LB6C 3SDDC 2W0KA 2DQJL 3K0WA 3LZFL 5IVXF 3C6SB 3L3JA 3I02A 3MCKA 2HT3D 2QEJA 2JF1A 4GG6F 2W0LA 4PJAB 2F74A 3IFPB 2PCPB 4EIZC 1TXKA 1S9VB 2B5IB 4DK3A 3O6ML 4PS4L 5IBLC 3TIEB 5KVDH 4XPBH 3U4BH 5BXFB 3ZSSA 4XP9L 2H41A 1CZ8L 4NJAL 1NFDA 1J8HA 4R4FL 3SPVB 4LGSB 4LQFH 3C5ZB 5B3JF 3H9HB 3ARGD 3RTQC 4YBLC 1IQWL 4ZUWA 2D0HA 4FFZH 4GG6B 2ZSWB 1E4KA 3VI3E 2HT2D 5BQ7A 3GDBA 1IT9H 1JZ5A 1J0KA 5JTWA 3QUMH 3RJQB 5D2NC 5IWLA 3BHBB 1SHMA 5I1LB 5B38G 5D1XB 3EYUL 1BZ9A 1UA6L 1JL8A 2NX5D 5DJ0A 1RZ7L 4FFVD 1XFPA 4G42A 2OTWB 4K3JH 4QRTB 3VXSD 1FO0B 1KLGA 2ZCKH 1RUQL 3FT4A 5GZOC 4OZGB 3HR5B 2X4PB 5C6WH 3KNBA 4N9GB 5HPMB 3GSQB 4OV6F 5HYEA 3MMEA 1WWWX 1F45A 4JFYA 1MCOH 4MNHB 5IR1B 4NO2A 1H3PH 1T2QL 5DEGB 1E4KC 3T1WA 4JHBA 4MCZA 1UQSA 4WU5B 5C6TH 3R8BB 1T89C 1IM3B 5GRJH 4AIZB 4PTUB 2P8PA 2VE6A 2PR4L 5HHOE 12E8H 2GAZB 2VABB 3HG1A 4JPVH 4PJFB 3K1DA 3RTQD 3FT4B 3IVKA 5DJZA 3QQ4B 4ERSH 1MELA 3HE7A 4U6HB 4D9QE 2R29L 5EU6A 3VD7A 3TGXA 1NFIA 1KC5L 1SMAA 3RPIB 3QB7C 2DWDB 1IAMA 1H5BA 4FQLH 1J11A 2R4SL 1A3QA 3ILPA 4P46D 2ZOLA 5M7QA 4RSVA 5I1EH 2PW1A 3GJFB 4R9HA 3WFCH 1DSFH 2IAMD 1V3LA 4XX1G 4JO4H 3QJHA 1CG9A 2EXWD 4UAOC 4LASL 2EIZA 2X4OB 1AGCA 4JZNB 1CLYL 4NKDB 5DUML 1X5JA 5C0CD 3EOAA 2YN5A 2WIMA 3L3IA 3WIFA 3BKJH 3LKRB 3AB0C 3MXWL 1JF1A 1OAXL 3ALWA 1K4DB 2JJTC 1RY7B 1S9VA 4LLMA 1TJGH 4UB0H 1DFBH 4MAYA 3VMNA 1NFDF 4TTGA 1FDLH 1HWGB 4J3WA 3TJEH 5KS9E 3QCVL 5D7KE 5C0CB 3B2UC 3GMMA 2CUIA 4HEPG 3RL2A 2GK0A 4Y5YA 1CQKA 5L2KA 2J1KA 1FBIL 5AAMA 2IH1A 1FAIH 3LRGA 4BH8B 4OSUH 2CDFB 4P57A 3EO0B 1BFOB 4FHBD 3ZYOA 4YHKH 1T03H 3ECBA 4XNYH 5CP3H 5F3HA 3IGAB 4Q6IC 1J8HD 3QFJE 3SKNB 1D5BA 4ZUUB 5A2FA 3U48A 5MERB 4JO3H 4G6FB 2WBJB 1ZHLB 4LHUA 2MHAA 4AT6B 5DR5L 4A6YA 1A6AB 4KJYB 5I76A 4PJAA 5DJYB 4W4OA 5B39A 3ARDB 4HIEB 3E0GA 1IKNC 1JZ7A 4KPHH 4P4RB 1PG7H 2D0FA 4N8VB 4D2NA 4DZBA 1ZHKB 2VN7A 5I16A 3TA3C 1CDCA 5F6IB 3O3DA 4JFED 1FDLL 2J8UE 2NR6C 5HHPB 1BZ7B 2M1KA 1NUDA 1LDPL 3U4EA 3HZMB 4KDVA 3JTSB 2NY3B 4Z78B 2GIYA 5HHNA 4G7YL 4WENB 5ILTL 1AKJA 1WIPA 4OCSH 4LVEA 4UZGA 4TSCL 2BHYA 3PDGA 5ACZB 4LEOB 4QRRD 2MJWA 4QRRE 5F8QC 2Y5TB 3CH1B 4MNQD 3QFDA 4P2RD 2Y6SD 4RGOL 5FUOH 4K23L 5T3XL 5IIEB 3VXSE 2Y36H 2YS4A 2IPKB 1GGTA 3G5VA 1KN4L 1RJYB 4ELKA 2BK8A 2NY5H 2XWTA 3B2VL 1JP5A 4IRZH 3KXFE 4OLZL 2IAMA 4F8QA 3CK0L 2N7AA 4PJXF 4Y4KD 2O26U 4NKQB 5E8OB 2NZ9C 3N06B 1YYLH 1P2CB 5LAXB 3QH3B 5ITBH 3DETC 2PTUA 1I7UB 4MXVE 4NDMA 3PV7A 1SM3L 1MIMH 2ED7A 3MRQB 4PJ8D 1JNNH 3OKDA 4A2LA 1X7QB 2HWZH 2WUBH 1T0MA 1S7RB 1MY5A 1M4KA 1ZHNA 4YC2B 3I3DA 1CDYA 3QEQD 5F96L 5SX4H 4U1MA 5I1DB 2ZOKB 3JVGA 5EO1A 5F7UA 3DSFL 3U0WH 1ETZB 3U9UA 3L7FA 4IHOB 3TPUA 4LGPB 2ITCA 2DRUA 2DQEL 1DQDL 1PBYA 1J1XH 2IAMC 1DANT 3LCYA 3IFPA 4AIXA 3C8HA 4E41E 4U1JB 1XGYH 3C9NA 4NT6B 3FFCD 4O02H 1NAMA 1BZ9B 3TNMA 1K5NB 1KLUB 1MJ7H 3SJVD 5C0CE 5F3BA 4HT1H 3NMEA 2F58L 1A6AA 3WS6C 2I24N 3OKEA 4DOHB 2J8HA 2X6MA 1TZHA 4QHNA 5EUOF 4J4PD 3V4VL 1KUMA 2C7UB 5EBLB 5ILTH 2IANE 5CHNB 5E99L 5I19L 1DLFL 1IT9L 4IMKA 4JDVA 4MD4B 1B2WL 3QPXL 5GGRA 2DQDL 5TQ2H 3HE6C 5CKAA 2C1OB 4FZ8H 3HZYB 3T3ME 5L9DL 4HJGA 3IF1A 2F54B 3WD5L 1BHGA 2A9ML 1OAZH 4KPHL 3GMRB 1ZLSL 1F4WH 5F7MC 1QEWB 2ICCA 5JXEA 1MFNA 4AYFA 1OP3K 4ORGA 1LO0H 4HZLA 1MH5B 2VL4A 2H1PH 4NNPL 4L4VD 1MAMH 1F11B 1JPST 1YQ2A 3FB7A 1LO3H 2DJ4A 4G6AC 3UYRH 4LL9A 1E6JL 1OB1A 3AS2A 3D9AH 3AUVA 2R2EB 3Q6FA 2AJUL 3T0EB 5F70A 5AZ2L 1V8HA 4U1NA 4PJEA 1PZ5A 2A6DB 2BVPB 3KXFB 1NCAH 1AKJD 3T0XA 5C92A 3HE6A 2DTMH 4WNQA 3TEUA 3SY0A 1T5XA 4ZOCA 4FZEL 1J12A 4OLXH 3TFKD 3BFOA 3RVWC 4KRMB 3P9MB 3U9PL 4X5LA 3JV4B 4XCFH 3DIFB 5A40E 2J12B 1MH5A 1TFHA 2IF7A 2OJZH 1T83A 3T0VA 2BNRD 3NPSC 3NTCL 3SQBA 1NC2A 3ZDZF 3W0WB 3SE4A 4FXGB 4NRZB 4IOIA 4QO1A 5J11C 3L95A 1I9EA 3HTLX 1U93A 4J3XA 5F7EH 3RU8H 1KXQE 5INDA 2FBJL 2FJHA 2G75A 5E9DE 2XYCA 3LRSA 5JDSB 5HYJE 3S5LA 1Q9WA 3SDCC 5HHME 3T2NH 2YXFA 4XHQA 3P4NB 2EYRB 3BWAA 1Q9OA 4C83B 3GSRB 1G84A 1WCQA 4GQPH 2IBGA 4HV8A 2R69L 1SEQH 1FYHB 1QFWL 5TE4H 3MO1B 3U9PH 2C7UA 5EBLA 3VXQB 2APVA 3O4OC 1V05A 2EXYD 2GJZB 3U7WL 1DE4A 2PO6C 2W60A 4L3EE 4R97B 2ARWA 3FKUS 1OF2B 4JRYA 2PO6A 4HF5H 5HHQA 3U46A 5IFHL 3O2VL 3N9GL 4TUKL 1D6EB 3O6LH 2ENSA 5CGTA 3ULUF 1HXYA 2Q7YA 4OCWH 4RISL 5GISH 5CIPH 3V5KA 5ADPL 3O41B 3WO3B 5JDSA 2OK0H 5DD5L 3HNTH 2EDXA 1UCTA 5I15L 3NBNA 3C6LD 3HUJE 1KCRH 2E6PA 1HQRB 1EHLL 2XIDA 3RWCA 1AY1L 4GS7C 4OZHA 1YMMA 5DVKA 3EFFA 3MJ9A 4F3FA 3RUGA 4H20H 4ONFH 5L8KB 1IM9D 1ZLSH 3V6FB 4XB7A 2VIRB 5EU4A 1HQ4A 3QUYB 1MHCB 3EOBA 4NOBA 3WD5H 4WEUD 5JXED 2OQJA 2B1HH 1QRND 1WISA 4KJQC 5HGHB 4JM4L 4GLRI 5J1AB 1XIWA 4JFDB 3SCMD 3KPQA 4RZCB 1UJTA 4K3DH 2PNDA 4Y5VB 2QHLA 4MA8H 4UIMA 3RDTD 4GG8A 3RY4A 3V9FA 2UVEA 3AS1A 5IGXH 5IQ9B 4MZ3A 3SQOL 4L8DB 1MLCB 4KKNA 3GBML 3VJ6A 5GRVK 3C6SA 3L3JB 5IQ7H 3LIZL 5IB3B 3UCRA 2Y25A 3RHWF 1DQMH 1NBZB 3BEWB 3SDDD 1N8ZA 3PQYE 1KB9K 1FZKB 4MAUH 1BX2A 1QO3B 5H94A 5E8DL 4JPIB 1SJHB 4JM2F 4LQFL 3E6FB 5HGBA 5IT2H 1A4JB 3T8XA 1T21B 1IGYB 4K9EC 3O3AB 1BEYH 3QDMB 1FIGL 4ZD3L 2CH8A 2BRRH 4BQ9A 1H3XA 3DVNB 3WDHA 1B0GB 4HS6B 3R0NA 5E94B 4GLRH 2ZJSH 3VE0A 5DZLA 2XZCL 3RIFF 2QADB 5DQ9A 1FZMA 3VFNB 1JYXA 4GAJL 4HUUB 4HK3J 1EBAA 2IQ9L 3WFBL 1L9NA 5AWNL 4P4RA 4GQ9L 4BFBD 1G6VK 3G04B 4Z7UA 1A1MA 3MV8E 4N0RA 3QCUH 4HZAA 2APWA 3MLSL 3TT3H 5E8EA 4I8DA 4NKMA 1C5BH 3PV6B 5FCSH 3HI5H 1UWGH 3CDFA 3ECBB 4R8WH 1CLZL 1U42A 3U36B 5E94A 1DP0A 1MIEL 1IKNA 3IFOA 2A74B 4P23D 2EH8L 4LCYA 4Z7WE 5HYQB 1IAIH 4P2QD 5BV7H 3G5XA 3MLYL 2PTTB 1WAAF 3EKCA 1FPTL 4TVSa 2FIKB 3RL2B 4UILH 3CXHJ 2IEPA 2CO6B 4IIQA 4G7VH 4KC3B 4M00A 4G8FA 3VG0H 3VDAA 3MO1A 4LLQB 1GZQB 4S0TD 4JCMA 2W59A 5DO2D 4XVSH 4D0BA 4WW1B 1HILB 2MKWA 1TTGA 2Z31D 3V6OA 1P7QD 1YJDH 4FQJH 4L4JA 1PZUB 1X3DA 5IHZA 3VD4A 3SGKA 2L7JA 1ZEAH 5DHVH 1U8KA 4HUVA 5ICYA 3RVXC 3QZWG 4UIMB 3BGAA 3CFCH 1B6DA 1J8HE 5GRUH 5GJTL 1YMMD 5I1IL 3Q3GB 3RWDA 4GRLD 1M6OA 1J0IA 1NCCH 1BJMA 5IIEA 5JPMB 3OR7A 1RHHB 1XMWA 3G08A 3SKMB 3ARGA 3VCLA 4RGMC 1D5MA 1YEKH 3SDAB 3MRHB 1EA9C 4P0DA 3NFNA 4XVUC 3KYOB 2R56H 1VEMA 2VAAB 1MWAA 3CMGA 1OAYL 5DQJA 3R1GH 5DHYB 2NW2B 3REWA 4P49A 1T5WB 3C8DA 5DJAA 3RGVB 2P8MB 1QBLH 1UEYA 4LPUA 4LNVA 4AL8H 4RFEB 5KTEL 1T89A 1S7WB 5IVOA 1RU9H 5F9DC 5FKPA 4AEFA 4CVZA 5J0BA 1OAQH 2FIKA 5D2LE 3Q1SH 3DMMC 3IXAA 3AS0A 4ZTOL 5T1KD 4NUJB 2QQLH 5I1GL 1OT2A 2VDPL 4G6JH 4YIQA 1Z0MA 3IXTB 5LGHL 1AGDA 4PJBA 4X9GA 2X4QB 4L3CA 4P3DB 3RFZC 3RGVD 3FT3B 4KK6D 1Y18A 1GHFH 2QQQA 3C60A 5JXAL 4PJ8B 1E27B 3OPZL 1CD1B 2R0KL 1AR1D 4LOUD 4ZOBA 4LVHC 3S3PA 2CO7B 3PV6A 1JPTH 1HDMA 1VACA 2WBKA 4UIKL 3GSNL 3RVUD 1P1ZB 3V0VA 4QRPE 1C5CL 1NUFA 3B4NA 3EYOA 4NFCA 4J6RL 2Q86B 5E7BA 4ZYKB 5I71C 4NN6C 4MVBD 4TULH 1IBGL 4FQJL 3HC0A 3EO9L 1JTTA 4OUOA 3DI2B 4YHZH 4QRSB 5HDQH 2E8YA 5JIIA 4M1GH 4IRJC 4K7PL 3WO4C 4TQEL 1LEKB 3VFGH 4S1DC 3S5LG 5J6HB 5ETUB 4NQXA 4YAQB 3ULVE 4OLWL 5GJSL 4LHJB 3NH7L 1KENL 3BJ91 4YEEA 3NFSH 2GUOA 4JFHD 4F7CB 5C9JA 2FJGB 4XP1H 1W8NA 4LCCA 3DXAE 5H37G 1WT5A 1TVBB 3O8XA 4F58H 1SY6L 5HGBB 5DRNB 5DF0A 3QHFH 5TDPA 3WFEH 4HBCL 5GHWH 1Z5LA 4PREA 5E95B 4JN2B 4RNRB 5C6PB 2P48B 2XFXB 1G9NH 3C09B 4DUXA 1M1SA 2VQTA 4O5LH 3JWDH 3QH3A 2E7BA 4NQCB 4XMLH 1AQKH 3V5KB 3JV6A 2VSDA 4PP1C 3C2AH 3JXAA 1XCTB 3AROA 3S8WA 4GG8B 4YWGL 4XWGL 2VAAA 4I3SH 3IDYB 1OGTB 2DI8A 3EDDA 5FYKD 5F96H 3PNWA 4KUCD 3HMWH 4MVBC 3HI1B 3KPRD 3OHXB 5E8NA 4XCEB 2UUDK 3HLAA 1DE4B 1N7ML 3CIQA 4LDEB 2NLJA 2OZ4L 4M7KH 4NZJA 3TO4B 3W5MA 1T21A 2VUOA 4NCDA 3RI5F 3ZTJH 5EU4B 4I77H 4U1IA 1IGMH 2JLLA 4ZO8A 4FQ2H 2APBA 3MJ9H 5GGVL 1A6ZB 1GZPA 4GAFB 1KACB 2EIBA 4P5MB 1LEIA 3D2UA 5LQBL 5EIQA 2AJVL 2ZG2A 1EDQA 2OK0L 2VXTL 3P4OB 3WNNA 3QJFA 1CXEA 4FFVC 3LHPH 4M6OH 3WIIL 3UTSD 5GGSY 1BQHB 4HKBA 3NN8B 3V6ZB 4QTIH 3P0GB 1NGXA 5DURB 4HLZH 4MA3B 3HMXA 4PRPA 4JY4A 4MA8L 2KUTA 3Q1SL 4GXUM 5EO1B 3W2DH 2YOCA 3MRHA 2ZG1A 1F4XL 1IGML 5CZXD 5C0RL 2CXGA 1NKRA 1YECH 1ZTXH 1FLTX 5CJXC 5IVXA 1N6VA 3ARED 2LU3A 3MRLA 1FIGH 4F7CA 4ZD3H 5B39G 4NYLB 5T3XH 5GSVA 4FQXC 4Y5XC 2W07A 2EO9A 5EB9A 3IKCB 4Y4FC 5E2TH 1NFKA 2I26N 2BY1A 1E4XH 1IZKA 2QJDA 1Y0LA 2H6PB 4LARH 5CJBA 5I8CA 4URTB 3ULSA 5I2IA 3EO1B 2FR4A 3QBTB 3SOBH 5MP6L 4ZOEA 3HZKA 3H42L 4XT1C 3K4AA 5JHDE 2FX7H 3F58H 4ZUTA 5KAQG 1QUNA 5FA3A 1T1XB 1MCEA 3V0VB 1UH3A 4LU5L 4ELMA 1IEHA 1RZKC 4OBRA 3EOYG 2QLVB 2FX9L 1FV1B 2H2SC 3O6LL 4XPHH 1F8TH 3QIUD 1F5WA 4PJ8A 2QKIB 3VD5A 1S7VB 1WFNA 2FH8A 3KR3L 4MJIA 1I7RA 1D6VL 3ARTA 2NXYB 4KMTL 1H3GA 1S9WA 4X5XB 4HCRA 1I8MA 3PP3K 4Y4HC 3WEXA 4HKJB 5K9JH 4GSDL 3V6ZA 3U0TB 1JZ3A 1BQHA 3C08H 1IGIH 5BZWB 1QFUH 4BA8A 5T3ZD 5HHXH 3GMNA 3B5GA 2P5EB 5TGBA 3GKWL 4PB0L 3OKLA 2CIKB 4XXDA 4LCIH 4EUPH 5DI8A 4WUUE 3UTSE 3S6CA 1NMBH 4CN4A 1KTDB 2HN7A 4AT6A 3MGOB 3WJLA 4JG1H 4N1EA 4GXVL 3QYCA 2AQ3A 2HA1A 3O3BA 3DX8A 3SDDB 3IGAA 1WWCA 4H1LH 3MUGA 3GB7B 1T80A 1UADC 4HFUH 1NAKH 4JZJC 1K8IA 1DN0B 1YY8B 1M6OB 3S96A 1NCWH 1FH5L 5CJQL 3OGCB 5IFAL 4P23B 1J86A 1JHKL 4Z7WB 1X5HA 3H9ZA 3J8F7 2XWBB 4G6AD 4Y5YB 4ONFL 4RMSA 4K3HA 1D5IH 5CCKL 5J4MA 1KULA 3IS1X 2P45B 1R3JB 2EDEA 1KJ2A 2DYPB 4NN7C 4PFEA 2YSSA 1CVSC 4Y5VC 4EEEA 3BDYL 3MOBH 3P0VH 1NCDL 1DLHA 5C0RH 1XEDA 1X9QA 1YEHL 1WAAE 1FVEA 4OZFB 4FTVD 5FKAB 3NCFB 2R56L 2DM2A 3WSQH 4L4VE 1JMXA 1C16A 2E7LC 1VPOH 1QZ1A 3L3DA 4U1GC 3VXQA 1PVHA 1MCOL 3LQAC 4XGZB 4LSQL 1MIML 2A1WL 4PRPB 3V6FA 4A2MA 5CGMA 5D2NA 1JK8B 4LAQL 4QXUL 1IC7L 4PJ7F 4LKXB 4OI9A 4PG9A 4L9LA 1Q9WB 5T1KA 4NKMB 1CBVL 4NT6A 2H9GA 5LAXA 2WZPD 1NC4A 1DQML 1HDMB 5HYJB 2BMKA 5B4MC 1P4IH 1UACL 1KN4H 3ARGC 5BS0D 3KPOA 5DZNA 2EIEA 4S1QL 1M71B 2JK5B 5FUZL 4PJIE 3AC0A 3U9UB 1VGKB 3MRKB 5GZOD 3JBG7 1QSEB 2JCCB 4JKMA 1YDPA 2RJMA 4Q6YA 2HP4A 2VZTA 3BKCL 1E4WH 5AG9A 1L9MA 3D39E 3EZJB 4Z5RA 5EPMA 1S7RA 2DN7A 3P30L 4JRYE 5I18H 2W0FB 3M1BA 4HHAA 4PJIB 1TJHL 2BY3A 3UPRA 1HHJA 1MFBL 2BFVH 4PTTA 3SE4C 4C56D 5DJ8A 3TT3L 2YSSB 2WM0A 3O2DA 1BQUA 5GS0L 2DYPA 1X5GA 3QIWD 4TUJA 4QXTB 5B3NA 4WV1C 3HI5L 3PWJB 3K8KA 5A3ID 1Q38A 2CDEA 2ICEB 3ULVH 1D5XB 4RAHA 5IHBA 5JW5A 4JFPB 4GRWE 3JWOC 3GUTB 1Z5LB 3AS3A 1OSPL 3K7UA 4Q58C 1S5HB 1WBZB 4LLDB 1AHWB 4F80A 2EDLA 3ARRA 3BESR 2ADIB 3MNVB 4PJHA 1UGNA 1IAOB 3BP7A 4N5ED 2NY6B 2A74A 4HWBA 4OLWH 1I8KB 5GJSH 2GJ6A 1IVLA 2CD0A 2DF3A 4AENB 4M7KL 4HJGB 4JKKA 5EU7E 3HRZB 5MERA 5TFSL 3I50H 1J05A 5K9OA 4WNQB 1EJ6A 3QDJD 5F9AC 2XI9A 3FN9A 3VRJB 3KDMA 5IB1B 4RQQB 1UXWB 3UTTA 3V7AG 3DNKA 3CGTA 5E99H 5I19H 3ES6A 1QFOA 2I5YL 3H3KA 3O9WA 4LPVA 4XPGH 3EHBC 3FONB 4H26A 2LTQB 3ARWA 4V2BA 4P9HL 4HGWA 1G9NL 1I1YA 3DUSA 2QSTA 3BH9B 3PL6D 1GC1L 5A16B 1NAMH 4G8FB 3GGWB 3AGVA 5IKCB 3WS3A 2FEEI 2VLLA 5C0IA 1FZOA 1WT5C 4HC1A 5FDWB 2BC4B 3OF6D 4PJ7A 4ZXBA 4UTAH 2DOCA 3P9WB 3OJVC 2F54A 3VH8A 2NY7L 3D25B 4JREC 3HNSH 2FIRT 4MA7H 4X6DE 3VGHA 5JHLH 2BOBA 5HHQB 3QXVA 1FYTE 1U3HB 2WP3O 3KPNB 4U33A 2UZIL 5E24E 1T1XA 3TT1H 1OPGH 3D39A 1OP5K 1KCRL 4UI2A 5FK9A 3GSRA 4BSVA 3MYJA 4X6FA 1QVOB 2GI7A 5IF0A 4K8RH 4TVPL 2WWMD 3HRPA 3NCCB 1PX3A 1S9XA 5IMKB 4ODWA 2JJTA 2CRIA 1IGCL 4G9DB 5GGVY 5CUSL 3U30B 1D9KB 1KEMH 2YD1A 5F7LB 2IAMB 5FGBC 1S3KL 3U2SA 5KG9A 3IAGC 5HI3D 1N2RB 3HC3H 4YHML 3ALPA 5IUSA 3HNVL 1XF5B 5DR5H 3MLWL 5GS0D 4ODHL 4MMXC 4XNZB 4KJWD 4J3TA 2AV7B 2R4RL 5D2NB 1BFVL 3QG7H 3V52L 1FORL 1KJ3H 1FFNB 2NYYD 4NQSA 3IU3A 4L9DA 1V7MH 3QI9A 4MA7L 4GKNB 3GKZA 3S4SG 1OAQL 5E5RB 2PYED 4MHHG 5SWSB 2YD6A 4JFYB 5HHNB 2BXYA 3QDME 4HUVB 4C56A 2VRAA 2FH6A 1YPZE 3CVHA 2OS7A 4YK4B 4N8CH 4YHLL 4BZ1L 2E7HA 4XCYB 3EGSA 4I18B 5I1CH 3CFEB 3IDJB 3QO0B 5HYSA 4NC2B 2XRAH 5L8JB 4WIQA 4QRTA 1INQB 5F9WB 1G9ML 2PYEB 3D3VA 2WQRA 3PABB 4OD3H 1ZXQA 3O11A 3DV6A 3BHBA 3ULVC 1TETL 2C4FT 3LY6A 5IW1A 2XQBH 3IU4H 1JI1A 2FATH 2AI0L 4G9FB 1KIPB 1NCNA 2ZSWA 3QPQD 4GRLA 3BDXA 5FO9B 4YBQD 2UY7A 4OBSA 3QDJA 1B90A 5HPMA 5KANI 5DMGC 1A6UH 3WFZA 1PQZA 3DX6B 4DVBB 3SGEI 3S4SA 1ED3B 3A67L 5DT1H 1F90L 4XZUB 2NY7H 4GH7B 1Q0YL 2EDKA 2FEEL 4BFGA 1W72H 4OGYL 4HWUA 3GZKA 3EHBD 2VN4A 4CDHA 1QHOA 3NA9L 1DBML 3KLHD 1CR9H 1NJ9A 3F7YA 4UV4L 2XY1A 1OAKH 4ERSL 2P5EA 5TGBB 4ZNEA 1U8JB 2H2PD 3BP6A 3T4AB 4PJHF 3RKDC 1PYWA 4EJ1C 1CFBA 5GS0H 2BRRL 4ODBD 2WLZA 4M8QA 4CRPA 4AEIL 4W81A 1X5YA 3HI6H 3CFKA 3AFLA 4Y16C 4NP4H 4PJDA 5ADOL 5ESVB 3UTQA 4L4TA 1I8MB 1RD6A 2BVPA 3KXFA 4ZOAA 1AGCB 1U8NA 1AJ7L 4XRCB 3DARA 1FL3A 1JN6A 1RZIA 2OTUB 2P5EE 2R23A 5EU5B 2CDFA 4P57B 2AJSH 3MNVA 1MNUH 2ESVA 2KQNA 3F7VA 4NQTA 4OT1H 4JO4L 5DRXB 4U2ZA 1MF2L 4YX2H 4ELMB 3PABA 3VI3F 1AO7D 1P4IL 4LFHG 2ZCHH 4N9OB 1T83C 2ZPKL 4PJDE 1ZT7A 2JB6A 1PLGL 1H5BB 5DJCB 4K94L 3HPLB 3BKYL 4FP8H 4ZFGH 5IBUB 2XTJC 4BFIB 2IQ9H 3PWJA 2R1XB 1M7IB 3BQUC 5D70L 1MPAH 3BQUA 5DQDH 5EZLA 4LSPL 4OSUL 1UB5A 2CRYA 3QULA 2J7LA 3EYQC 2HVJB 1RJLA 4X7FC 2RB8A 3MRLB 5E00B 4RFNC 3WUWG 3T0EA 1P69B 1A1OA 4MXVF 5BMFH 1LQSR 4KK8D 5EUKA 4AQOA 4LHQB 3MUZ1 3GK8L 3DYPA 4R26H 2J8OA 3FTGA 4M02A 2R0ZH 3DROB 3O8XD 2IALA 1AR2A 2FLRT 4Z7NF 3NAAH 1I1AA 2V5MA 2NW2A 1I9JH 1TZIB 4JVWA 3VFOA 4S1QH 5CINL 1XH3B 4GAYB 3X11A 4K94H 5L0QB 3SCMC 1QRKA 3DUUA 4HMDA 1MUJA 3FONA 1FH5H 5CJQH 1A6ZA 3BRGC 4K9EH 1AQDA 3QUMA 5GGTL 4S2SB 2VDLL 3FQXB 4XGZA 4O2EA 5E1HB 4WGWB 5ADOH 1G7IA 4JAMB 4U2YA 4OLEA 2FBJH 4C83A 1DEDA 1EMTL 1C08A 1F4AA 3FFCA 2DI7A 3QEQA 1OT1A 3STZA 2MCPL 3V5HA 1EZVX 4LQ1A 2YK1H 4Q74A 2DQFB 1V3JA 5C7XL 1N3NA 1T1ZB 1II4E 4LLAA 3HI6L 2P1YA 2UY6A 5H35B 1RULL 1WTGT 5FO7B 5CEYB 1KCLA 2NY0D 2HT3C 3KLAA 5KS9F 2FX8H 2NY4D 5E1AA 4WHTB 3EYSH 2V5SA 5J13B 3OXRB 4E0RA 4IHOA 1FSKB 5EZJB 4YBHA 4NNYB 3Q5YA 2ESVE 3BH9A 5HHXL 2EE6A 3SGJA 3ROOB 4V1DE 5SWSA 2IH3A 4JPVL 3RUGF 2FGWH 2BJMH 5K9JL 5EO0B 4KU1A 1WCBB 5EH1A 1A7RH 3D0VA 1K8IB 3AREB 4LEOA 2X7LB 1FFOB 4JQVC 3PWPB 4J3SA 3QUKA 2V2TA 4U6TA 4LCCB 5EWIH 3UYRL 2GUOB 4ZS7H 4F15B 3GSOA 4HWZA 4XH2A 4LSUH 5DMYA 2LFGA 1GJIA 2CKBB 3LH2H 1UB6A 1KFAH 4TTDD 1J0ZA 2DLIA 1U8JA 1RIUL 4MJ5A 1QSEA 4O2CA 4JG1L 3V95A 4IOSD 4KROB 4HC1L 5TE6H 1YEGH 4EXKA 3NAAL 3PG2A 2YRZA 3QCTH 4KI5C 1DL7H 1QEWA 5CWSA 3AU1A 5DGRA 4F7TA 4LSDA 4OUUB 1IAKA 1PQZB 3QXDB 5DJDB 2XZAH 3CFDB 1MRFL 2AJXH 4YXHH 1IC4L 3V4VH 1NLDL 3SKJH 2JJUA 5SWSE 5LGJA 5D7JB 4JB9H 2RAMA 4X6DF 1ZLWH 4MJID 4OQTA 5KSAB 1X5XA 1CE1H 1BZ7A 5C0NC 4DW2L 5D2NE 2EC9U 4QT5B 4ZXBC 4OFIA 3VFRA 2ID5A 4FQQB 4KV5E 1A9BB 5IB4B 3BD5A 2Q3ZA 2AK4E 1INQA 2OZ4A 5A16A 2NTSP 3QQ3B 1ZA6A 4XBGB 2FJFA 3ARBC 3LHPL 4WUUA 5J89A 5EORH 1FL6A 1YEEL 2XT1B 3V0WL 2EDOA 1ZHLA 5DEFB 4IRJB 4YK4C 1F4WL 2PXYC 3VRLE 2O5YH 3UJTL 3NACL 1UXSA 4NRXA 4ZPVB 5DVNA 5HYSG 3UAJD 1ZSDB 1MCLA 1ZA3B 1B9ZA 4HKZA 3H3PL 4KHTH 3QZWB 4GKSA 3HA0A 1EH9A 3AREC 3QUYA 3HS0A 1Q8MA 4PJ9B 2CLRA 4PGZA 3NIDF 4PJDF 1VGEH 2C4FU 3T0BA 4GG6A 2H8PB 2HJFB 1WBYA 3QO1B 1HHHB 3H9HA 1IGFH 1OGAB 1RSFA 1UZ8A 3PQYB 4FN0A 4XNZC 5E0QA 1BAFH 2VH5H 5F1IB 1MCIA 2XRAL 4JRYD 4MA3A 4XI5C 5HI4C 3P4MA 4Y8AA 3OAUH 2FSEA 2P7TA 4EZMA 5ISZE 5DC0A 5KVMC 2NY5L 1KGCE 1MI5E 1RZ7H 4YUEH 1T6WA 1XGRB 3K74B 3BSZL 3ZHKA 1BVLA 5I8OH 3EGSB 2UYLB 3CUPA 4TUJB 1RUQH 3PJSA 1CQYA 4P2QB 1VDGA 2V7HB 5EBGA 2EKJA 1KT2A 4D0BB 4JPWH 3PQYD 3FMGL 4NO3B 1U8HA 5JOFB 4JRYB 4QGTA 1A6UL 1UA6H 1GAFH 3V0AC 1FYTD 3VFSA 5C70A 3GO1L 4HHAB 1MI5B 4YPJA 1FORH 1KJ3L 4PJHE 4DZ8A 4HULB 1PW3A 1N5AA 2AEWA 4E5XB 2B4CH 3UBXI 4UQ3B 2X1QA 5EU5A 2E6JA 1SJEA 3DMMA 4HWEL 4ONGL 2NYYC 2XG4A 3V8OA 1L0QA 3RWFA 1C12B 4PJ5D 4H1LG 1VESA 3MUGB 4PJDB 4JQXA 4XVJL 3KNBB 2ZUSA 4GAYA 1WLHA 3V5DB 5DJDA 3X11B 3B6SA 2LAAA 3LAFA 3IJHA 1CZ8H 1YNLH 3DWTA 3PP4L 2PW2B 2BSSB 4FNLL 3IJYA 2IQAA 4RIRB 3LZFH 3PWUB 3HPLA 1SYVB 3RZCC 3S36H 4WI5A 1T4KA 1FNSH 1MCPH 3T4YB 5DK0A 2C1PB 3UZQA 1XF3A 4ODXA 1MCSA 5C0FB 3C60D 3CCHB 2ZUQB 4G3YH 2HT4D 4OLZH 5D1XA 4Y19D 4HK3N 1WIOA 3RNKA 4H26B 3RZWA 3FN0H 3DPBA 2YPLA 1IAII 2C3XA 2ZNWA 3RVUC 4PJ7E 1MFDH 1ZT4A 3VRJA 3HNSL 2VTFA 4MNQA 4N68A 1ZSDA 3IRPX 3CC5B 2W0PA 2X1OA 4U3CA 5HHVH 5FO9A 4Z7OE 4M5YL 2P5WB 1P53A 4G6JL 4HAFA 5B22A 2AVGA 1H3VA 3QIWB 3ZE2F 3FCTA 1CDHA 2Z31B 5DMJB 5C07E 2XKUA 1PJ9A 4ODTH 3WIHH 3TIDB 4Y1AB 2ZUYA 3PWLB 1CGUA 2B2XH 4DQOH 4Z8FL 5D7KD 1Z0NA 3QEGL 3GSXA 1I1YB 3MRIA 3JSSA 3BT2H 4M1CD 2GTZB 1F58L 2X4TB 2NY6D 4P23A 1P1ZA 2CRMA 1KIQA 1N4XH 3G9AB 1QNZL 4OFVA 4L4VB 5E08H 2NTFB 1KJ2L 3CNKA 1AP2B 1K8DB 4NKDA 4OZFG 5E4EC 1KPRA 4XNYL 1YQVH 1GGCH 3K2MC 1GGIL 1P5UA 4FQIL 3HLAB 4JM2D 2Z4QB 1RFDH 4X0KA 4ZUSB 3BAEL 1DTUA 1RIVH 1XF2A 4N0UB 3MOQA 3SKOB 2Z8RA 1AXSA 3MR9A 3MRNA 5D7SH 4NZRL 4O9HL 1GC1H 4ETQB 3TZVC 1U6AH 2FL5B 5C2BH 1CXHA 1UYWH 2FHFA 5FV1L 1YC8A 5L8LB 5BO1H 3OWEA 3R06B 5CZKA 3ESUF 4PRNB 2Q6WA 5JZ7C 3QXTA 5L2KD 5GGTH 4B50A 3D39B 2J5LC 3OF6A 4NCC1 2A2QT 4X8XA 5J3HC 2PXYB 1CD0A 3U1SH 1EO5A 4F7PB 4ZNEE 1KIPA 4KUZL 4C55A 5FYJH 3DVGA 3L3DB 1WVZA 4E9LA 5A43C 1U91A 3U6RB 4HMCA 3VMOA 5FUZH 1GRWA 4ZFOL 4LSRH 4R4ND 3BUYA 2Z92A 4KJPC 5C0GA 3FN0L 4YBQC 3CUPB 2X42A 2DWEA 4AG4H 5L7XL 1TTUA 4E41B 3DO7A 5FO7A 5CEYA 4N90E 2X4RA 1X5FA 4G8EA 1ZMYA 2DQFA 3QNXA 2OMBA 4YNYB 2X89D 3GM8A 2XWTB 1IC7H 1LP9F 1LK2A 4PRPE 3DUSB 2WWKT 4RRPA 2H3NB 3I6KA 4IOIB 4LDLB 4M7LL 2DQTH 1TPXB 1UZ8B 3P77A 4FQHA 5JPNB 3TVMC 3WHXB 4KAQL 4PLJD 5JA9A 1LGVA 4MXWH 4WO4D 1G7MA 2O5ZH 3QXAB 3LRHA 5T33H 5E6ID 2D3VA 4UT6L 1E27A 4E42B 4GRWF 2D7NA 3D25A 5I6XC 4Q6IA 5K9OB 4PGCB 5I1KH 2XNAA 1JGUH 3O6FC 3DGCR 1I1AC 3GMLA 1B4JH 4I48A 3R8QA 3O3DB 5LKNA 4APQA 3U30C 3D85A 5IEKB 1K2DA 4DZBB 3BSZH 8FABB 4XXDB 3VXMB 3X14B 4QRSA 5FEBA 4JQVA 5D7LA 1OHQA 4FQQA 3KPLB 3MLPA 4HMEA 4LIQE 1KB5H 3JWDL 1M05B 2FX7L 4HUNB 4DGYL 2VDNL 5C0EB 1YY9D 4K7FB 5LCVH 1TMCB 1L7TH 4OZ4B 4HUUA 5CJOL 3U0TA 3RGHA 2BY2A 1LWRA 2ADJB 3PWUA 3ARFD 3SO5A 5FOJA 1HI6A 2J8UA 2OP4H 4D94A 2BOBB 5JIKA 1NGYA 2PO6D 1KV3A 1RZJC 1SBSL 4ZFFB 1U92A 2WSKA 4EUPB 1HHIA 1FLRL 3KPRE 4DN3L 3T0AA 1FFRA 4PJBB 3ARXA 1FV1A 5D72H 1CR9L 4UV4H 1TVHB 4PG2A 4LCIL 1IGYA 1ZVYA 3QUZC 1VFUA 4ZODA 4J7RA 2DQTL 3QUYD 3UROR 4CKVX 5IV2A 1LMKA 4H1LB 4M03A 4ISVB 2OX5A 3QXUA 4OIBA 5HHMB 2VWEC 4C4KO 2P8MA 4XCYA 2XQYK 4PJGB 2YPKA 3GNMH 3CSBA 3GMQB 1NDMB 35C8H 1ERNA 2R15A 4JB9L 2XKNB 3K81A 1BM3L 1CG9B 5IMMA 3V4UL 5E9DA 1IC5H 1FFNA 2OQJB 4P5TB 1DANU 2X89A 3A6OA 4HW6A 3BW9B 4HLJA 3BP4B 3JVGC 3FQRA 4WVRA 4JDTH 3QCTL 1ZAGA 3FO9A 4OD3L 1IFHH 4NQEA 5CFHA 2KZWA 3NCJL 5EOQL 3D18A 1ED3A 4YXKH 4U1SB 5IFJB 3MRGA 2VLKB 2EE3A 3EO1A 4YWGH 3O0RH 4LBEA 2ATKA 4JGJA 4OIIL 3RNQA 5E6IA 1OOAA 5TH2B 2C4XA 3D2UB 1AQKL 1P7QB 4F33B 5J7CC 1NMCC 1SY6H 4NSKB 1QLEL 4WW1A 4OZGE 1BD2B 1IQDA 3IDIB 4PB9H 2CLZA 3CFJA 1BFVH 3QG7L 3V52H 1K3IA 2F5AL 4U1IB 2Q8AH 4D3CH 2DQUL 3LKQB 5C1MB 1HKFA 1DQJB 3LD8C 5D93C 4WO4A 3QUMB 3MZTA 4PJXB 2NR6D 1D6VH 3F62A 4TPRH 5DDHA 5T3ZL 3VFWA 3O6FB 3MA7B 2IANA 1RURH 2Y5TA 4HSQA 3PWNA 3PWPE 3LKNA 1KPVB 3ARBA 5TJWK 3NABL 3G6DH 4ELMF 1M71A 3S35X 2VQ1B 1CLOH 1YEHH 5I1IH 5DD6A 5F7WC 1JI2A 3MJ8A 4YHMH 4K71B 4OFDA 1WEJH 2I60L 1DDHB 2W38A 1N0XL 5HHOB 4JO2L 1OGAD 4OGAC 3S7GA 1EFXA 4GRWH 3E8UL 3FQTB 3SDXA 1GL4B 4CADB 3OBAA 3V8CA 2J2ZA 4EI5C 2R0WL 1YC7A 3EW3B 3IU3B 1XGPA 5EUOA 4EBQL 1AIFB 4D9RE 2GCYB 1UXWA 1CD9B 4MHHI 4KI5E 1F3RB 5D5MB 3FQUA 1RURL 1MHPH 2F19H 4P46A 1R5IA 3IKKA 4R0LC 1EK3A 1W0WB 2XV6B 4NFDA 4PJEE 1JZ4A 4DKDC 2R2CA 4KKBC 3F5WB 1GHFL 1FYTB 3GMQA 1NAML 2VDQH 1ZKAA 1G6RH 5JNYA 1P84J 4FXKB 1HHGA 5LGHH 35C8L 3WO4B 4R8WL 2W65A 4WWKB 1S7UB 1E28A 5C0EA 3MCLH 32C2B 3BIKA 3GNML 4NN6B 2APXA 4Z0BL 1Q1JL 3I75B 3SDAD 3QDGE 3CX5J 5EIVA 5IOPB 3ILQC 3ZDXF 1NBZA 3QFJB 2P42B 2GJ6E 4Y89A 4Y4FD 2X05A 3O4LB 4ZTPH 4LVHB 4XWOD 3DX9B 1A21A 2A77H 5BMFL 4KZEL 3H7BB 4IOFC 1AFVH 5MEOB 1HSAB 3OAYK 5GGRY 3VXNA 3JV5A 3WE6A 4WU7A 1IC5L 4JVUA 4TQEH 4OJFH 3BD4A 4KMTH 4PJXA 5KZCB 4Z18A 4DCQB 5JZ7D 4XPAH 4ZO7A 4CVUA 5HPOA 3TV3L 2VIRA 1AXIB 1VFAB 1G7MB 3OJ2C 1XGPB 1MJUH 1RVFH 5MEQA 2CMRH 3PGFL 4HXAL 3MODH 3QA3B 4NZTH 1UVQB 2B4CL 2ADGB 2A83A 5D71L 5EA0L 1NEUA 1MHHB 3SDCD 3MLXL 3LPWA 5IEKA 4MWFA 1WF5A 2XWJA 3GM0A 4S11A 1E4XL 3WEXB 1EO8H 1YPZB 3SQOH 3AVEA 4QHUA 4LSRL 2GAZA 5HTSA 1G6RL 4PGCA 1DBAL 3SDAC 5F9OL 2ZOKA 4RGMB 4MJIB 3QDAA 1D9KC 5C07D 1A6VL 1A4JA 4N8VG 3T8XB 1A1NB 2HKFL 1NC4D 1FVEB 4UT6H 3HMXH 1BBDL 1MQKL 1FNEB 4JRXB 1OGTA 1MRDL 4LPWA 3MMEB 5BOZG 1OP5H 3T0DA 4JKWA 5ESAA 4WY7L 4GW1A 5GIRA 5AEAA 5DS8A 2VXSL 5ISZA 1ODAA 5GGQL 3CVHB 5C0DA 3O9WC 3QNXB 3VRLF 5GHWL 1A02N 3PWVA 1C5CH 1U8MB 3A67H 1LEIB 1YEIL 1GZPB 3TBWB 3HFMH 3ULVF 3E3QC 1KNOB 2VXTH 2XQYG 5GSVB 3VGAC 1NC2B 2F54E 3STLA 4JHWL 4OF6A 4WW2A 3PHQB 5IB5A 4PJ9D 4K07A 4LVOC 1T04A 1JGUL 1BF8A 4HS3B 4GUPA 3MRBB 4L8SC 5D1QA 2DQGL 1YDPB 4N0YH 3CPLB 1JTOA 3HZYA 2ITDA 4Q9CA 1NGYB 5C09B 5GXBB 2BMKB 3NZHH 3ZT6A 5HI3C 2NNAA 4J2XA 3KYMB 4MZ2A 1FBIH 1OW0A 4G43B 4R7NA 4KZEH 1EEZB 3TBYA 3QEGH 4O51A 2D9QB 3VA6A 3T4AA 4HCRH 2I9LB 2AEPH 1BBJA 3STBA 4XBGA 3OV6A 5DEZA 1Q0XH 5DVOA 1RK0A 3WLWD 1MAJA 4QRUB 4FA8A 4S1RL 4Y88A 3SJVE 1T1YA 2NY6C 2MHAB 1A7QH 2HRPH 4APQC 4X6EB 1U3HD 5FKAA 2OJZL 6CGTA 3MV7D 3FCTB 4WEBL 5GS2D 5I1GH 2YKLH 4PUBH 1HHIB 4DGIH 1WV7T 2VLME 4GRLC 3TP4A 3Q5OA 1GGIH 5LGJB 1S8DB 5L88H 2EKSA 3G6JF 3DX9A 1RU9L 2IPUG 1TQCC 3S5LB 1T1WB 4WO4B 5ESQA 3CU7A 1VEOA 4PLKC 4HCRL 3MUJA 4U1LB 2LABA 3WKMH 1I9RH 4POZD 1QFUL 3P9LB 2EE9A 4NSKA 4NQEB 4JCLA 2X40A 1KB9J 3M8OH 4IEFB 4P4KC 5ICZA 5I9QC 5I0DA 2ESVD 2J6EA 4WHDA 3MRGB 1KBGL 3LN4A 3FZUC 3FL7A 1FGVH 2VITB 4DN4L 4TPRL 1RJYA 2P5WD 3L7FB 4ZXBD 1WZ1H 2O5XH 3LS4H 2IPKA 4YZFE 3GEWB 4YIQB 5IESH 1T0NB 1U91B 3U6RA 2F5AH 4P5TA 4GKNA 4UTAL 2WW8A 1O5DT 1EJOH 2R2BA 4ZTOH 4Y1AD 5D7JC 5F1KC 5L6YH 2AKRB 4WFEE 1V3KA 5GGQH 5BVJB 2P46B 4QGYA 3PF2A 5DJAB 2EDBA 5K59F 3BIAX 3MGAA 5CS7A 2VDRL 1K85A 2D9CA 1CGVA 2IAND 3DXAA 1NDGB 2UYLA 1NH6A 4QRPA 5I1KL 4ODWB 4JM4H 4PJ8C 4N5UA 1I85A 5A2KH 4G9FD 4KKBD 4R0LB 4Z7NE 3DETD 1IAIL 1MCWW