3MJ8B

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
211
Chain Sequence
b'QVQLKESGPGLLQPSQTLSLTCTVSGISLSDYGVHWVRQAPGKGLEWMGIIGHAGGTDYNSNLKSRVSISRDTSKSQVFLKLNSLQQEDTAMYFCARHFYTYFDVWGQGIQVTVSSATTTAPSVYPLAPACNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
molecule tags Immune system
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
total genus 35
structure length 211
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B01
3V52H 1KJ2H 1JZ2A 1KTDA 3MV8E 5T3XD 1YY8A 3QHZH 4M7ZB 1WIPA 3QEQE 2XRAL 3RUGF 3VFUB 3BIKA 3QB7C 1LEKA 3HMXA 4YPGA 5MEPB 4NO5B 2FYYB 3LQAC 2UYLA 1KTRL 2R0WH 5ID1B 1KEGL 4BH7A 4AQOA 4QT5A 4JRYD 1W72H 4XVUD 2VH5H 4FFZH 5FF6B 4FQXD 5IHZA 3DO3A 3N85H 1G9EA 1UA6H 2DI9A 4WI4A 5F9WC 1WWAX 4G5ZL 4XBPB 2UYLB 1GH7A 1F3DJ 2VH5L 1S5IL 1LNUB 2EEAA 3TVMD 1IGTA 1ONQB 5GRJL 2X4QA 1OD7A 1GHFL 4TVPH 3QWQB 1MFBH 5FDWA 3PIQA 1JGUH 3QUXA 1QHOA 2BVQB 1FLRL 4NIKB 4MSWA 4ENEC 5FHAH 1KBGL 5F6HI 4QO1A 2AXFA 2H6PB 1U8LB 3LKNB 1EEYB 3HZYA 1I4FA 1RZJC 4JM2A 3DMMC 4WENB 3O3AB 4ELMF 2C3WA 4Y5YA 3ZE0E 4HIIA 4LHUA 1X5LA 3RY6C 1QO3B 3OSKA 4WWKB 3VXUE 2XN9B 1CCZA 4KROC 2RFXA 3LN4B 3QPXH 1U8PA 3GZKA 2AI0H 5CLWA 2V2TB 3SQOH 3WL9A 3NN8B 4Y4HA 4Q97A 1LE9B 1CG9A 2Y6SC 3OG6B 1MWAL 5K9KB 2GFBA 2JTDA 3PP3H 4HCRA 3P9LB 1J1PH 3EYOB 1TZIA 2F54E 4L1HA 3VFWB 1FAKT 4GKNB 3PG2A 3IAGC 2IQAA 6CGTA 5ITBL 4PBVC 2ZZUT 1MJUL 2VL4A 2UZXB 4A6YA 5F1IB 3RVWD 2BSTA 1HXYA 1HHJA 1FL5B 1Z0NA 1KTKE 4WTZA 1ZLVH 5HGDB 4Y4KD 3FT3A 1HYRC 1M6OB 1BAFH 3GMPA 3JUZA 1HSBB 3KPOB 4GT7A 1R24B 2Z8WC 3QG7H 3KS0J 4MNGA 4P46A 2O5ZH 4YDKL 3WJLC 3O6FD 4OCXL 1MI5B 2ZPKH 3RTQB 1ZANL 3GK8L 4E41D 5IMOB 1OAKH 4O9HL 3UROR 1T3FB 2PTUA 3VE0A 4PRPB 1I9EA 3NBNA 4Y2DA 5SWZD 3R8BB 5FECA 5I1HL 2WNGA 3HC3H 2V17L 2HT4D 3OR7A 4OCLC 4APQB 2ADGB 4JO4L 3FQWB 5FHBH 5C0IA 4FFVD 3BKJH 3DRTB 3ZE2F 4XBEH 1UACL 2X2YA 2AJ3A 2GUOA 1J11A 5SX4I 2OZ4A 3C8KA 5HVFB 1LO0H 3KXFD 4KTEL 2AAVA 2X05A 2R0LL 1IVLA 3GSNL 2HKHL 4OIIL 5EOCL 3P4NB 2R8SH 1D5XB 3QFJA 4LHQB 3S5LG 3DETC 1DEDA 3JV6B 1OF2A 4PJHF 4I13B 1NMBH 3K2UL 1JI2A 5J3HC 3S35H 4JCLA 4AG4H 2Q76A 1E4WL 2IH1B 3TA3C 3VRLF 3WXVH 3GK8H 1KULA 3JV0A 3KJ6H 1OF2B 3U0WL 4WI7A 2XZQL 3IF1A 3WHE0 2QKIA 3MBED 4PRPE 1LQSR 1LEKB 3O4LE 4UILH 1PD6A 4YLQT 4PP1C 1ES0B 2NY2D 4GH7B 4R7DB 1OL0A 5D2NE 4W68A 3T1FB 3QUZB 4HIEA 3N1GC 4N0YH 5D1QA 3BPNB 3CMOL 5ENWB 4UQ3A 1KT2A 2WM0A 4Q9QH 5FCSH 1NSNL 2LU4A 5DEZA 4K7PX 5C0CD 2ADIB 1NGPH 5C0CB 3UJJH 2BNQE 4UQ3B 4Q9QL 3Q0HA 4C4KT 3SCMB 5I1LA 3V6ZB 4FQJL 4I48B 4OTXL 2OTWB 1PDKA 4JY5L 4J4PC 4HCRL 3AREB 1SJHB 4P0DA 3RWFA 2P7TB 4KDTA 1A6AA 5EOQH 1ZGLB 4MMXC 1F45A 1A3RL 4XPAH 5KSUB 5C09D 2IAMD 4P23C 1IEBA 5KSVA 3IKKA 25C8L 1G9MH 5TQ0L 1FV1A 3P9WB 1FIGH 4HD9A 1G6RL 1TCRB 4ZFZA 1U2CA 3RKDD 3CCHB 4H20L 1KCRH 4QHMB 3CDCA 4TNVK 4QNPF 4WEMB 2R8SL 2F58H 2WBJB 2VERN 4AEIH 1YY8B 2R9HD 4RFEA 3QCVL 1X5KA 2AJYL 3SBWA 3JWDL 3SJVE 1OAQH 3JV5A 5D7JC 4JJ5A 3VFWA 3QXDB 2HVKA 3ULUC 4X5WB 5HGGS 3MRPB 3MJ9A 1T7YA 5ADPH 4NM4H 2NZ9D 5HYSG 5I30L 5B8CA 3NCYP 3AMLA 2EE6A 2C3VB 1DE4B 1OTUC 3L3OB 2CMRL 1B4JL 1CLOH 1I7UA 3U30C 4U1NA 1UCBH 3SE3A 1RIVL 4QRPA 2IG2H 4G9FA 1CDIA 2VR5A 5AAWA 4QRTA 4XT1C 2OSLB 5C0GB 3GMOB 3QEGL 2IQ9H 1VACA 3ULVE 4OZ4A 1AIFB 2VABB 3RAJH 5KSBF 4LHUD 5D7LB 2A6DB 2A0LD 4X9GA 3HZVB 3CFBA 3T2NH 2FIKA 1UENA 4O02H 5CZXC 1T4KA 3MUY1 1BP3B 1R3LB 4P3DB 2JCCE 4X4MA 5DDHB 5HYJE 4AIOA 4OZ4B 4HF5H 1LE5A 5FKAA 1CL7L 4XPTL 1G7MB 1BQHG 3H9SE 1DQJA 4HK0B 2BHUA 3BUYA 1LO2L 3CFEA 4JREC 3DV6A 5DDHA 1RZKL 3OKLB 1IJ9A 4CVWA 3T77B 4NC0B 4CL7A 2X10A 1IM9B 2IJ0C 1CXIA 3NFNA 3LD8C 3IRPX 1FO0A 4IS6A 1MPAH 2EDRA 4MJIE 3P4OA 2I5YL 2YWYA 3QNYA 5C2BH 3OKLA 3MQIA 1BD2D 4KI5D 3T77A 5HHXH 1R6VA 3SO5A 1GGIH 3CVHH 5TDOA 4K23L 4S0TD 2BNRB 3MRMA 3V5DA 3HPLA 4I0CC 5DMKB 2OJZL 4XBEL 3KYKL 2IAND 1JCKA 4MDIA 1J12A 4LLYA 4PRIB 3QA3A 3WN5A 4CNIA 3EHBD 3UTOA 3ZKMC 4D0DA 5IVXF 4E5XA 2XXMB 1IKNC 3GGWB 2D3VA 3TP4A 4HGMA 3ZSSA 2APWA 3NIFE 1OP5H 5F89A 5IMLB 1J1XL 3T3MF 2B1AL 4KK6D 5D7IF 5M94B 1O0VA 2DLIA 3BN9D 2AV7B 4XP9H 4HIJA 2UZYB 5D2LA 3LS5H 2VUYA 5JR1L 1VFAB 3QAZC 4Z7NF 4I5BB 2VXQH 3BDYL 1OQOA 3L5HA 3AROA 3PWJA 1D5MB 3QUMB 2B7DT 2X9XA 2XV6B 3K8KA 4M5YL 2AV7A 1LO4L 1FDLL 1BEYL 1S78C 1LO3L 4LF3A 2UWEE 1RULL 3RUGA 4Z77B 5HYSA 3CSYB 5TJWK 1O7SA 4Z5RA 5E0QA 3CZFA 4LVEA 4ZSOB 3F7RA 4JZOA 1ND0B 4WTXA 4TVPE 4OFIA 3T4YA 4LK4A 4LAQH 1S7UB 1ZXQA 2XY2A 3M17B 1PQZA 4UIMA 1T0MA 3RGVD 4ETYA 3LQAL 3L3IA 3UZEA 3QEQA 1KJ2L 3UO1H 3LEVH 2APXA 4UDUB 2DICA 3F58H 1IC7L 2YEZB 4QOKE 5DJDB 2A6IA 5DRWB 3TT1H 5B38A 2DI7A 2VLRA 1CE1H 4P2OC 4X6CB 2BHYA 2Z91A 2APFA 4O2FB 2IANA 3B3IA 4Y8AA 4YH6A 2C1PB 4Y16D 1YA5A 3SE8H 4PG9B 1FCGA 3EYFB 1NBVL 1XIWC 3PQYA 2RBLA 5DUML 4MNQA 1R3KB 3HAEG 3IFOA 5J56B 2AABL 4RGOH 3OF6A 4C4KO 5TDNA 3H42L 4G6KL 2HFEA 2WWMC 3MRNB 3HI5H 1BZ7B 1KIUA 5KVGL 1WICA 1WWBX 1QNZH 4LQFL 3DX6B 3IGAB 1JF1A 1HE7A 2D4FA 4OLUH 1OSZB 3HI5L 4M4PA 3KHQA 5DJ0B 3G9VA 5T1KD 3O6LL 2XZCH 1MQKH 1SM3L 4ZNEE 1PLGH 5IVXE 5H37G 1FFNB 3U9PL 3NZ8A 4JN2A 1YPZA 3KR3H 3PGDB 1YEEL 3UJIH 1HHIB 2FGZA 3CU7A 1DANT 4Y1AE 3HE6B 4WWID 5CAYB 4Z78A 4ETQA 4PP2B 1LK2B 3PP3K 1A1MB 3NCJH 1SVCP 3T0VA 5C6TL 2FHBA 4XAKD 3OGCB 1HHIA 1L7IH 5EG6C 4L4VA 1Q9WB 4UAOC 2IAMB 4NWUH 4P23B 4HEME 1O7VA 4Z7VF 3ARSA 4MNQE 3WSQL 1N64H 4NFDA 2OL3L 4XHJD 1RK0A 1TVBA 4NZDA 5ERWB 1QSFB 3MRQA 3WNOA 4JFDD 5HYIA 4P46C 4XVUC 5KSAA 1VADA 4HBQA 3FTGA 3MRLB 4RGND 1JHKL 2IMNA 2V9QA 3JWOL 2CMRH 2ED7A 4O2EA 2A0LC 3UTQA 3BZDA 3FB6B 2EE2A 1DBKH 2GCYB 1U41A 4P2RA 5L9DH 4GMSH 4QCIB 1MCSA 4WWKC 4X6DA 4BZ2H 4LSVH 4P49A 2NY1B 3GJFH 1YMMB 2LAGB 3WN5B 1R3HA 4CNIB 2BSED 1ZHNB 4YEFA 4CDGC 5I71C 4QRPB 2GJ6A 2YUVA 8FABB 2OTUA 4ZFGH 4LVHC 4EI6B 3BEWB 1II4E 3RZCC 2DIBA 2P43B 4JPKH 4P46B 1HHHB 5GZOC 1HKFA 3DBXB 5ETUA 4XP1L 4NO3A 5I73C 4MB3A 5F7DB 1JPSL 2MQ0A 1DQTA 1PX4A 5CSBA 3NIGF 5C0AD 5C0JA 4JY6B 1KJ2B 1IKNA 4WI8A 1G9ML 5TQ0H 5TQ2L 4OM1H 4PGCB 4PRAA 4DKDC 5CIPA 4WHTB 5FGBC 1YNTB 4FTVA 2FECL 4J3XA 5F3HB 5JIIA 2EDYA 5CBAB 3B2UC 2CUHA 1CLYH 4IDLA 4MQXC 3P73A 3PWPB 5IV2B 3WO4C 2C7UB 4MD0B 2XTJC 4KUZH 4ZUWA 1BD2B 4GW1A 1VA9A 4GS7C 3HR6A 1FGVL 4L9LA 4LU5H 5IVOA 3MO1B 1MNUH 4LSRH 4PGEA 4DUVA 3IDGA 1EGJL 5BS0A 5SWZB 1JK8B 2HJKA 3ESUF 4S1DC 3VRLE 1F42A 1S7SA 3D3VB 4WVRA 3VRIA 1DE4A 1IGCL 4NQDB 1OGTA 5I15L 5GGUB 4QOKA 1J7VR 3LPGA 4DUWA 1WAAA 4QRSB 3LIZH 5A2IH 5GSRA 5I17A 3ARYA 3GBLA 3BN9C 2OSLA 2Y5TB 4XI5C 5C0GA 3GMMA 2H1PL 1J0IA 1CFSB 2FECI 3DHMA 4KJQD 3T1FA 3H3PH 2MSPA 3UCRA 2GK2A 3MLSL 5B4MD 3UPRA 5GGVL 3DARA 1I7RB 5HHOE 3NA9H 3L3JB 5F9DC 4OZFB 2NY3D 4D8PB 3ARDB 3DI2B 2ZCKH 2DWEA 2Z9TA 1UXSB 5EOQL 4L3AA 4LLUA 1NFKA 3RUGB 5HYSB 4PJFF 1NPUA 2QR0B 3VG9C 4IRJB 5KS9A 1C8PA 3A6BL 5E95B 2LTQC 2O5XH 1JHKH 3ARVA 3WIFA 4JM2C 4FP8L 4N0CD 3GMLA 1EFXD 1KGCE 5E94B 3VWJD 4GRLA 5D7JA 2PTTA 2Y25A 3L3IB 1YEFL 2PXYB 3UTPE 3ULSA 4DZ8A 5EZJB 1HSAA 1OW0C 1SJVA 2WQRA 5AZ2L 4Y4HC 2Y4SA 4TUJB 1A9EB 5HYJA 4E42A 3OB0K 4ZOEA 5I1AB 1NC4B 1Q72L 3LKPA 4PJIA 5GGTA 1JV5B 5A2JH 5KSBA 1NBZA 2MCPH 1NDGB 1J0YA 1H15A 3MV9E 3VXTB 4QGTA 1AY1H 3UBXI 4R7NA 4R90H 2V2WA 3H42H 1OB1B 2V5TA 4GAFB 3RJDA 1P7QD 4PJ9A 1H5BB 1SBBA 4G9FE 4XX1G 3M45A 3LKSA 2R0ZH 1EFXA 3I6KB 3VWJA 3VXQA 1A3QA 4EBQH 2FX7H 5CINH 2MPAH 4YR6A 5T1MB 5ICZB 3ROLA 5I1KL 5CZVL 4Y16A 4QKXB 2D2OA 3VD4A 3WMSA 1YY9C 5JW4R 3QUYD 2VXUL 4GSDL 2R2EA 2FWOB 5ITBH 3CFJB 1FFOB 5J1AB 1AGEB 2E7LA 4WJ5B 5IVZB 3PXJA 4HGWA 3WHE1 1EJOL 2NZ9C 5I18H 5FYLH 3SEPA 3D0VA 2JCCA 4HS3B 1EH9A 5EU5B 1T66C 3GBMH 4HJGA 1FFNA 2X9WA 2P5WD 1KENH 4FFYH 3HI6L 3VFRB 1H5BC 2ESVD 5E08L 4HGWB 5JW5B 4IIQB 5EIQA 3ZTNL 4ESKA 3MLRL 1I1CA 1DBAH 3VXRD 1OCWL 5EC1A 5IEHB 3DGCR 4ETQB 3W82A 4H88L 1IL1B 5EUKB 3LHPH 1TXKA 4DTGL 3LIZL 3H9SB 4V1DD 1KOAA 4JGJA 1KCUL 4X4XB 1T66D 3P30H 4PRPA 1IC7H 2C9AA 3CPLA 3SY0B 4WO4B 2IFFL 5EUKA 3A67H 3O3UN 5FAAA 4K3EH 2Y06H 3HTLX 1YNLH 4B5EA 2R2CA 5JW3H 1BM3L 3K80A 3CK0H 4R3SA 3TZVA 2MNUA 2EO9A 4OIBA 2Z93B 5ACMA 5IFJB 1AHWB 1WBXA 2YMXH 5D1ZB 4HKZA 5DD6B 1A7QL 2O5XL 3TO2B 1CD1B 5IT2L 3J7HA 3QUKB 5LCVH 4AM0B 4K7PY 3OJVC 2DS4A 4EQ3A 3ULVF 2H8PB 5DD6A 3NIDE 3BZEB 5JDJA 4QRSA 1KCRL 4P3CH 4IRZL 1NANH 4JGMA 3LKRA 3L6FB 2KBGA 1UC6A 4YDVB 4MJ5A 4OLEA 2YPLD 3RL2A 3WUWG 4EXPX 5F93C 4LSTL 3HG1D 2E8ZA 1FHGA 5CJ8A 3EIFA 3K7UA 3HNVH 5KTEH 5GRVK 2YD5A 3H9HB 1DVFD 2G5BB 3QIUB 5DJ8B 5D5MB 1PYWA 1KACB 4R26L 4J4PA 5FGCB 1IEAA 5DA4A 5IJVB 1LEGB 1YQVL 3WBDA 3VMPA 1V3JA 3QUYB 5C0RL 3FFCE 1I4FB 3L1OL 4UUJB 2ICWB 3QISA 4PRIE 3PWPA 3KNBB 5J11B 3KYMA 1BQHA 1IC4L 1KTLB 3NABH 4G8IA 4LEXH 1TVBB 2ZG2A 3GEWB 3VGAB 4JRXE 5HGBB 3B4NA 5JW4N 3ULSB 2XKNA 5E4EB 3SDAD 1RMFH 1ZA3A 4K07A 3B9AA 3ZMRA 5FXCH 3MV9A 3MRRA 4BH8A 5DSCB 4PJBA 5DTFA 4ZS7L 1OWRM 3P3YA 3RWJB 4EI5A 1RZFL 3MRBA 3MXVL 3AY4A 2DQGL 2CLZA 5FCUH 3MLZL 5DURB 4RQQB 2C5DC 1X4YA 3GSVB 5J11C 4PJ8C 1RJYB 4O9HH 2ENSA 4NKOA 2FYYA 3MLZH 5BQ7B 5DUPL 5D71L 1YJDC 2BFVH 1EFXB 3I6KA 3VWJB 2X89D 1GZPB 5KOMC 5FO9A 3ISWA 3GUTA 1W8OA 4WI6A 4J3WA 4XVSL 3KR3L 3S36L 4Z7VA 1YY9D 4LSQH 1XF5A 3ARGD 1AGFA 4KHXH 2IC2A 2ZOKA 5I8KL 5CEXB 3M1BB 3FFCD 3BP6A 4ZUSA 1DUZB 3MRHB 3QEUA 4M3JA 3CK0L 4PJ8B 1OTUD 5CILH 4Y2DB 4HFWB 4PRBA 4Z95H 3LQZB 4X8XA 3BD3A 4TOYL 1JIBA 5EWIH 4P48A 4ZUWB 4WU5B 3VG9B 4NJ9L 1TDQA 5HY9B 4AEIL 2YPLE 1V05A 5GRYA 3MLWH 2JKXA 4WY7H 2QHRL 2VLKE 1U92A 5I74B 2HTLD 4RAUA 4NNXB 5AUMB 4KKNA 5IB3A 4E42B 5F9OH 4NN7C 5ICYB 1UM6L 4WUKL 1OWWA 1J05A 4YE4H 3SKOA 1TFHA 1OGAE 3RKDC 5T1DH 4FQPA 3LPWA 1NCWH 4XP1H 3BZFB 2AEQH 4PJHA 5DC9B 3MXVH 5IB4A 5ISZE 3NFPA 1I3RB 4BQ9A 4YHOL 3SKOB 1Q72H 4QF1B 2QQQA 2E9BA 1A64A 3CFIC 2CR3A 1R3JA 4RGNC 1FO0B 4W4OC 4ZFGL 4U1SA 4XCFL 4PJXA 4X6DE 4ONGH 4DN4H 3RL1A 4G9DA 2E5EA 2GT9A 1CL7I 4XH2B 4NM4L 3MLVH 1YEJL 1K3ZA 1H3XA 3GSNH 1EPFA 5E2WH 1QLFB 1YC7A 4LCUB 4YBLC 1CF8H 5T3XH 2HLAA 2VTFA 3DX7A 3TPUA 1QYGH 1NEZG 2XA3A 2F5BH 5H8DA 3D39D 5BJTA 4PLJD 1QNZL 4KKCD 5E6ZA 5GGQH 4BK5A 2YRZA 5IGXL 5ETUB 3KPTA 1A7BA 4JHBA 2VDNH 5IMLA 5IEHA 2JE8A 4HT1H 3HC3L 5E6IA 4LP5A 4YXKH 3ZO0A 4OCWH 4PRDB 5JHDE 4ZTOH 5EZJA 3MCKB 1AP2A 3VXSA 2AJYH 2GSIA 3UBXA 1JGVH 3KYOA 1U8JB 3SCMD 1CD0A 4FQXB 3BXNA 1U8MB 4OSUH 1JN6A 1A2YA 2Y07L 3KPSD 1H15B 2Z31B 3RZCB 4WUUB 3OJ2C 4NWTL 2M1KA 1AO7E 3GHBL 2QADC 5GJTL 4NPYB 1H9VA 1PY9A 1NFDA 1P1ZB 4P2OA 4D2NA 2E8YA 1A22B 1JN6B 1I85A 4X6BB 4XNXH 3T08A 4HX1A 1X4XA 3S36X 1G7QA 2VLRE 4XZUB 4JKPL 1QFOA 5C2BL 3QIWD 2VZ1A 4NO2A 4UAOB 3VD7A 3IJSB 2HJLA 3RQ3A 1BREA 2YWZA 4Z7WA 4A6YB 1B3JA 3TLRA 5DJZB 2FWOA 4MA1B 5TDPA 5KANI 4PS4H 4PRHE 2DM7A 1J10A 1XR9A 4QRUA 4U1JA 4JE4B 2VNCA 5DMIH 1WSST 5DJ2A 4P2OD 4M6AA 2J12B 1QQDB 4PJ8D 3SKUD 3QQ4B 4PY8J 4XI5D 5I75C 2EH8H 4N0UA 3LCYA 2QBWA 4QWWD 4XNYL 4TSAL 3MV7A 3E8UH 3GRWH 4L8CA 4ZUTB 1OW0A 4YK4B 2AEWA 4HBCL 1ZLUK 3AY4C 1MLBB 4GBXC 3C8HA 7FABH 5CGTA 4HMEA 3M1BA 2BHZA 1CIDA 2EIZB 5DUBB 4PJ8A 4P9HH 4OLUL 1XF4B 4BK4A 4G8GB 3IGAA 3NACL 4M61B 3AXLA 1IGIH 1JRHI 1YYMH 1DQLL 2EH7H 3CFKA 5SWSB 1D7FA 4QYOB 1BOGB 4X6EA 1FVDB 4XC3L 1M1SA 5ELIA 4KAQH 3G04B 1Q8MA 2PTTB 4JY4A 4NKQB 5FHBL 5HHOD 1ZLWH 3RU8H 4C83B 1ACYL 4NQCA 4I3RH 5I66A 2HTKD 1Y18A 4D94A 1KLGB 2VZVA 3QCTH 4I2XB 3EDFA 3LRGA 3MMEA 3U83A 2A9NH 4L3CA 5F7EL 5FYJH 2EKJA 3R0NA 1TQCC 3MLSH 4QHMA 4XTRD 3QNYB 3V6OC 1FP5A 2Q86B 4N8VG 1FGNL 2R29H 4G6AC 1A1MA 4I77H 2X6MA 3KVQA 2D7QA 1EHAA 2JK5A 4O51A 5MERB 2EDDA 1B2WL 3I9GH 4MZ2A 2G2RB 3MLWL 2KH2B 1IE5A 1B0GB 4XPTH 2H8PA 3FN9A 3PWUB 2G9HB 1H5BA 1NL0H 4NWUL 3C5SB 4JB9H 3MFFB 1AGCA 1U8PB 2AJSH 3E6HB 1MCNA 4U3HA 4UT6L 2YN3A 4DGVL 5DUMH 5LAXA 3RVTC 3U79A 3VFSB 1DN0A 5K9OA 1GSMA 5BO1L 3FONB 4PGZA 1KTDB 4OF8A 1DANU 3ZYJA 1OGAB 3B9KA 1NMCB 1M71B 5L2KB 3OKNB 3B9EA 1LMKA 1Y0LB 3G9AB 3MCLL 1Y6KR 4PJ7F 1FZMB 2O5ZL 4G9DB 3FRPG 5D5MF 1F4XH 2J5LC 3UJIL 5DI8B 1I9IH 4XCCH 4P3WA 4XPBL 3FFDA 3ECBB 4QRRE 2QSQA 1EHLL 1MAJA 1IEAB 1MSPA 3OKNA 1DBJL 3ZE1E 3G5ZA 5E8DL 3C60A 4O58H 1INQA 1ZS8B 5EBGA 4MXQD 4U0RC 2NY4B 1WISA 2AK4B 4Y19E 5E5MA 4KJWC 1NEZB 4HHAA 1A7PL 4HG4J 1HSBA 4O5LH 3UP1A 1ND0A 3UTZA 1WTLA 5FO7B 5FYKH 2LV4A 3OZ9L 3X11A 4DN3L 3TCLA 3BPCA 1JWMA 2ZJSL 2MJWA 3JXAA 5E9DB 3T1WA 1NCWL 5DK3A 1K2DA 5IB2B 3VA6A 2EXYD 1T22A 3QPQC 3WDHA 4YHYB 3HCVB 1U9KA 1CF8L 5T3XL 3RUGE 1MRCL 5FCUL 2OS7A 5JZ7C 4HLZG 3TZVB 5DMJB 4X6BA 4PJBE 3GNMH 4MAYD 3MZGB 2KKQA 1E4KC 3K8MA 4K55A 4MD4B 5EB9A 1MWAA 5L88H 4KMLB 5F8RC 4V2BA 2OI9B 4LVOC 5HHXL 3IDGB 5SWZA 4LCUA 4WO4C 2NNAB 2V7HB 5J0BA 4LSVL 1XGTA 4ENED 4B0MM 4Q58C 4XAKE 3S4SG 1I1AD 2EDLA 2A6JA 5I6XB 1NAML 3D3VE 2VAAB 2JB6B 1XCTB 4IOFC 1U8HB 3HUJB 2BC4A 4KFZC 3DRQB 4G6MH 2X40A 1S7VA 2IBZX 1KEGH 5J6GB 3C5ZD 2DLEA 5D93B 4Y4KA 4FZ8L 3LEXB 1YPZB 4RA3A 5D1QB 5D70H 4G8EA 1DLHB 4PLNC 1RJZB 1HQ4B 1P4BL 3Q5TA 4PJBF 4ZDHA 5SX4H 4BJLA 1F6FB 4N68A 2I07A 1NUFA 5KW9H 3CX5K 4KKAC 1GL4B 5CWSB 2X4RA 3D0LB 4XNUH 1D6VL 5I30H 1BGXH 3S35X 3OTTA 2VZSA 4CJ0A 4KMTH 4OCRH 2WWKO 1RI8A 3VU2A 3V79C 1I7TB 1QRND 3DVNA 1HK6A 4LCWB 4POUB 1UCBL 3RWFB 1EHLH 3NACH 4G8GE 5D2NB 4P5KA 1XGQA 3VH8A 1ZGLA 1XH3B 1U8OA 2XIDA 5CHNA 1EAPA 3QRFM 1CS6A 3C8KB 3MBEC 5FOBB 2F8VA 2GT9B 3MJ9H 3MNVA 4O2CB 5ADPL 5AD0A 2RAMA 2R2BB 3IAQA 3K4ZA 4O2EB 3C9NB 3UTQB 5F7LB 3BH8B 5JHLL 3V2AR 5DLMH 4KQ3H 4YFLI 1JNNL 2EDNA 5IBTH 3VG0H 5EBLA 5H35B 5ANMB 1R5IA 4ZSOE 3MGOA 3ABZA 4QRQB 5HI4D 2B5IC 5K9OB 4DWHA 4WFFE 3WXVL 3INUL 1RQ5A 5DMIL 3HE7D 4ZUTA 2APVA 1BAFL 4TVPD 2PNDA 1AGBB 4HFUL 4YHKL 4KZDH 4ZQKB 1QA9A 1E6OH 3WJLA 4AIZA 4FFVC 4MNHA 3T0AA 5E2UL 4U7SA 3MRHA 1DDHA 3CH1A 1G7HB 5EC2B 1OAZL 3WLBA 4NRZB 4WY7L 3TF7C 1D6EB 3F8UB 3OBAA 2CRMA 4WGVB 2DKSA 5E2UH 1ZVHA 2VLJA 1X6NA 1INQB 1ZS8A 4QHUA 4LPYA 4X0KA 4LARH 5DZLA 5L88L 1T0MB 5GGVY 2DMBA 1FO0L 1Y18B 4MVBC 3QEQB 1J8HE 2XQBL 3BP4B 3QULB 3RDTB 3X3FL 4GRMB 1CICA 1U3HC 3OWEA 4KXZI 4YBQC 1F4WL 1WCQA 2V7NB 4HJJH 4JJHA 1IQDA 1Q1JH 4JZJB 4YIQA 4CU6A 3RPIB 3STBA 3DURB 4PJ5E 1MFCH 1A7NH 3PL6A 1Q9LA 5DT1H 3RWGA 4O5LL 1JPSH 3I6LD 3MA7B 1OTTD 5E00B 4MJIB 3VXMD 1ZKAA 4KRLB 4PJDA 4U2YA 2DLGA 2X1QA 4IEFB 4P9MH 4ZS7H 1UKSA 1FZOA 4JRXD 4FTVE 1CZ8L 3B5TA 3BW9B 4M7KL 1CLZH 3GSXB 1J0HA 3TA3A 4BKLA 5E8NB 1I9IL 1WUNT 4XCCL 1JGUL 4PRID 3WEXA 5EZLB 5DQDH 5IBUB 3H6JA 5J12B 1T03L 3CLFL 4QNPE 1EEZA 3AAZB 2NXYC 4GUPB 4HS6B 3O4OC 2YBRB 1N2RA 3HI1A 4B50A 3VXUB 3F62A 1NAMB 3IXAA 4U1LB 1ZEAH 4ZOBA 1KPRB 4U05A 1UJ3A 4F15C 3I75B 3S98A 1F4XL 4KI1A 2M26A 4X6EB 1CDGA 4XMKH 2WUBL 1Q0XL 1X5JA 3P0GB 3G04A 3V9FA 1M7IB 4UV4L 3MODL 2AKRB 1EIBA 3GSQB 3L1OH 4OZHB 3E2HC 1CLCA 3IDIB 4MHHG 4P5TD 3QDGD 4QTHA 3P4LA 1NCDH 1TETL 3D85B 5F1SA 2V2TA 3T0BA 3DWTA 2QSCL 3IJYB 4NQVB 3UYRH 4Y5YB 3H7BA 1FGVH 5FYJD 3HUJF 4ORGB 5MENB 5IT2H 1NUGA 3UYPA 5TE6H 4ZFOA 2B39A 4LCYA 2X44D 1RD6A 5CJOL 4EIZC 3IXTA 1VADB 1G9NL 4Z7VE 1AFVL 1CI5A 1CGUA 1EVUA 3MXWL 2YD2A 4FQHA 4WHYG 5DJAB 4OQTA 3LKOB 4CVXB 1RZJH 2ARJQ 2BSTB 2H41A 1P2CB 1Q38A 4XP5L 5EU7E 2YPKA 5L7XL 4LSPH 4EN3D 1BEYH 2E3VA 3GMRA 4PJFB 1MIEH 1J8HB 4MXVF 3IJHA 1LO2H 3WD5H 3RWHA 2QADB 4ZG1A 3KPOA 2A83B 2J4WH 2W59A 5E8PB 4S10A 1CDUA 3VI3F 3X13A 4RWHA 5F1OB 4JLRB 4PGBB 4JHWH 3ARFB 3SE4C 1MFDL 1CFVL 2AK4A 4N1CA 3QDAA 1NEZA 4HHAB 4Z76A 3RWHB 1NFIA 4PLKC 2P5WE 2Z4QB 3QIBC 3WIHA 3FRUA 5JUEH 1S9XB 2H1PH 3CXDL 1AGDB 1YUHA 1A3RH 4XPAL 3GBNH 3RAJL 2FGWH 3V6OA 4JKPH 1Z3GH 2CLVA 2HKHH 5KN5B 1XZ0B 3ZYOA 4OGXL 2BNQD 3RGVB 4U1IA 2GYSA 2IG2L 5SWSA 3FAXA 3U4BL 5FYKD 3NFSL 3NGBB 5DJ0A 3BO8B 4UINH 4D9LL 1JPFA 4KK8D 4MWFA 4P59L 5I71B 3BP5B 3PGFH 2IFGA 1OAZH 3QQNA 4OT1H 5CP3A 2FR4B 2GJ6D 4FQIL 2FEDD 4HK3N 5DA0B 1KN4H 5F7YC 1XH3A 3MRIB 1ZT1A 3W0WB 1I1RA 3HC4H 3ULUF 4PRPD 2HAZA 4DGVH 3DTXB 5FO8B 4OF5A 1ITCA 3PL6B 4NCC1 1YDPB 2FNBA 3RWGB 4PRHB 1JL8A 1JWSB 1Z5LB 1KLUA 1RUKL 3FO1B 4TUOA 5A1AA 1WF5A 4FQCH 1S9KC 5FM8A 3L3GB 2GSGB 3O2DL 2IWGA 3T2PA 4JFDA 1FCCA 2R4SH 1CFTB 1E6JH 3DGGB 4AQ1B 1A7NL 2J1KA 2NY1C 4IJ3C 3WN5C 3U9PH 5EBWA 2DQHL 4F9PA 4P5MB 3VXOB 4KJYB 3KXFE 2QKIB 5E2WL 5M7QA 5C8JB 1UYWH 3C08H 2XT1B 2DQEL 1C5CH 1JFQL 2VL5A 3S37X 5CGYC 1AGEA 2O26U 1WFUA 4WUUE 1ZA6B 3OKEA 3FO0L 4P4KD 4PJXB 3UDWA 2B5IB 1YPZE 5FF6A 3GM8A 2GY5A 3WLBB 2AJVL 3W5MA 2WANA 4X99B 5A16A 1Y6MR 3FO0H 1D9KB 3FOMA 1B9ZA 1FYTB 3G5XA 5GRJH 5SWZE 2AV1A 1H8NA 4JFZH 2EXWC 4WO4D 3S3PA 4DGIL 4J6RL 1Z9LA 1JZ4A 4CRPA 4NGHH 2WP3T 5TF0A 3R06A 5I1LB 2F74B 2AABH 2E7CA 4KKLD 2YD6A 5IIEB 1D9KA 4D9LH 1UM4H 3NCBB 1T83C 1HHGB 1NCAL 1D5BB 3IDIA 5DK0A 5GGTL 1QSEA 1K9TA 2V7NA 4HPOL 5EN2A 3RJQB 2QHRH 1P9MC 2P47B 5HYQB 4HDIB 1MFEL 3OKYA 3IDNA 4JFPA 4O2CA 3MYZA 5MHSD 1A6UH 1EMTL 2DQHH 5I16B 3ULVL 1S9WA 3H7BB 4YHPA 4MB4A 4HKXA 2BERA 3L5WA 1T0NA 2XN9A 5F3BA 5DYOB 4KKAD 4YBHA 2JF1A 5D70L 4Z8FH 4LAQL 3IDYC 1XAUA 2DIAA 3ROOB 4I77L 2LABA 2F54D 5IBLC 2Z35B 2OQJB 4XMKL 4FMKA 3WNNA 3GKZA 4NPYA 1NEUA 4MYWB 1I3UA 5DD1H 2C1OA 1W72B 1N7MH 4CMMB 2H45A 3QDGB 2DRUA 4X4ME 4ZTPH 4UIKH 4FRWA 1QA9B 1YEGL 3MC0A 5C0AE 3FN0H 5J7CC 5JLZB 4PJFA 3MGTA 1YECL 3EYSH 3VXUD 5ID0A 2RGSA 3EO9H 3LV3B 3MBXH 4LLMB 3KPLB 2X4TB 4PJ7B 4UBDC 4GOSA 2JB6A 4F37K 4ODBD 3CFBB 3HUJA 5JOEA 3BKMH 3D5OF 2FIKB 1A14L 3PWVA 3VXNB 3S3JA 4R2GC 4EOWH 4Z0XB 2R2HB 1DL7L 2C3HA 1FE8L 1RIHH 2AEQL 5D7LA 1N59A 4TPRH 1D9KD 4I9WE 2CLVB 4K3DL 1UM4L 1NGQL 3ZLQC 3O9WB 2NXZC 4EN3B 4NQVA 3G5YB 4XXCA 2A9ML 3WE6B 4I0PB 4HJJL 1AKJD 4I0PD 2IBGA 2VOTA 4N5EC 5KS9B 1A21A 4JFYB 3VGFA 2J8OA 1TJHH 5F3HA 1K4DA 4XC3H 5I1EH 2XNAA 5I18L 3QIBA 5IB1B 2NTFB 4KVNL 2ZSWA 1RFDL 4PLKD 1QTYT 5KANG 1B6DA 4NQSA 1I3RA 1LP9A 3QEQD 4DW2H 3VW3L 4NQCE 4HKBB 2YKLL 4OAWB 1P2CA 5TDOB 5TH2A 2NTFA 4UT7L 5CKAA 3TGXA 3JZ7A 3O8XA 3P4MB 5D8JL 2IALA 1F58H 2GSGA 4XCYA 3QI9B 1IMHC 4OGXH 3WS6A 3OB0H 5FB8A 4TPRL 3TM6A 1M7DB 4FQ1L 1SQ2N 3O6FB 2EDTA 4ZPVB 1R5VB 2XZAL 2OMNA 4JN1H 3VXPB 3LKSB 4PGDA 4NO5A 4Y4FD 5E2VH 5BO1H 3HE6C 1S7RB 3P9MB 5BS0D 1D5ZA 4JPVH 2DQCL 4D0CB 3QRGL 3HPJA 3BISA 1X5HA 2B2XL 1OT1A 3QCUH 4FQQB 4KV5E 4F57L 1FORL 1DUZA 4XP4H 3GIZL 4JCMA 5ILTL 1F8TH 1NCUA 3TBYB 4PRDA 4L4TA 5I2IA 3UEZA 2VWEC 4M1DL 1GYAA 5IG7A 3BO8A 2VISA 1MHCB 4TQEH 2IF7A 4H8WH 5FUCC 3EKCA 3L7FB 2W9EH 3IDUA 1DTUA 1IGFL 1CFNA 1FBIH 3D18A 4U4BA 1KN2L 3GKWL 4GRMA 4WI3A 3D6GA 2BXYA 4LOUC 4F58L 2DYPD 4XC1H 4XP6H 5D7IE 2PW1A 1G7LB 4JGUA 4ZPTA 3N06B 4QTIH 1VFUA 1AXTH 3O2WL 2D0FA 4LNRA 3UTSE 4F9LC 5KVEL 4YGVA 5FFLA 1JRHH 5D96C 3U4AA 2OR9L 1X5YA 3HNTL 4UT9L 4HUXB 4JREB 3FB5B 4TSBH 5K9JL 3B8SA 1GGCL 4LNRB 4X8JA 5F3BB 3OKOA 3PJSA 4H8WC 2UWEF 3KJ6L 3SY0A 1BZ9A 4RMVA 2W38A 4P5MA 3SGKC 4YXLL 3WO3B 3F6IA 4YQXH 2W60A 3A0OA 1MAKA 2D7MA 5EO0A 3UPCA 3ZTJG 3O2DH 3MJ6A 4GKNA 5DS8A 3BQUD 4WU7A 5D6DC 2J8UA 5GS3A 5CEXA 3ROLB 3IDMA 3TT1L 4Q9RH 3QEHA 4Q9BA 4PJGA 5DJYB 4F37F 3KPQB 1SY6H 2A77H 4KPHL 1LK3L 4KUCD 4BSVB 4M5YH 4U1NB 4UTBL 4Y88A 4K9EC 4HS3A 1QRNA 2I26N 2AJZB 3T2OA 4DGYH 3KPQA 5LWYL 1V7ML 4L4VD 1A4KA 3V8CA 1HIML 2F54B 1R24A 3LDBB 4EBQL 4ALAL 3HB3D 1A4JA 4ONHA 3RIAF 1MLCA 2E27H 4OZIE 1T04B 1A4KB 2YZ1A 4HT1L 2I9LA 5C1MB 1A2YB 5C9KA 1A6ZB 4JQIL 4YHIB 3S96B 4W6YB 1DL7H 4Q0XL 1BMGA 2ZUUA 4ZDHB 1Q9WA 3VFOA 5GIRA 4APQD 4KWUA 4OGAD 5DD3L 3B6SA 2NY5H 2VQ1B 2E6QA 1XGYL 4NM8H 4AK1A 4MJID 5C70A 5LXGH 4NUGL 2NY3B 1FRGH 3P4OB 2ZCLH 4JHAH 5E4IA 1X7QA 1FV1B 1QFPA 3ALWA 3KXFB 3FN0L 5ESAB 3FN3A 4R4FH 5GGRY 2R0LH 3UTSD 4R2GB 1BBDH 3QH3A 4RISH 1ZHNA 2FSEB 3MV9B 1HHKA 2BY0A 4GMTL 3VWJC 5I74C 5DSCA 4BH8B 4YX2L 1JGLL 5MP6H 3CIQA 4QCIA 2F8OA 4JFED 1EEUA 1DQDH 1CD1A 3CGTA 5CS7A 3QIWB 1U3JA 1H8SA 1NCDL 1TETH 2QQKH 3K3QA 4P99A 4LHJB 3FFDB 2IPTL 5L2KE 1FZKB 1N64L 4ZPVA 2A73A 2PN5A 2GJZB 5F89B 5GS0H 2MWCA 3QQ3A 1C5BL 4E5XB 1MFAL 2BVQA 4IOFD 3T3PE 1T89A 5EU6A 1I8LC 5C0JB 2N4IA 4FQCL 2IPKB 4NQXA 1I9JL 5LWYH 2NY1D 3ME0A 5IW6B 3C8DA 3O45A 4NO3B 1YEDB 4JFOB 1M05A 2VMFA 1L6ZA 1NCAH 3STZB 2BX5A 5F7HA 3D9AH 5AEAA 5CJQH 3GSWA 2VDRH 1IM9D 3X11B 4AMKL 4PGJA 3CVIL 5IKCB 1H3GA 1ZVYA 2C7UA 5E9DA 3L3KB 4JFYA 4NRZA 5JXEA 3T0EC 2Z92A 1FVCA 2CRYA 3D3VD 5EU3B 1OAYL 1NFDB 4G6JL 4WWKD 3VFMA 3STZA 1BBJA 2CQVA 3LB6C 4AYFA 5IFAH 4NQUA 3JUYA 2HLFC 2A9MH 1A6AB 2EIEA 3I2CH 1J88A 4FG6D 2HJKB 3QXAA 3QO0A 4GKZA 1YEHH 1B4RA 4NQCD 5IK3B 2Z31C 4RZCB 1ZLSH 3EDEA 4FFZL 5FKAB 2LVEA 5F88B 1U3HD 4XPFL 3KPRD 4QGYA 3L3GA 3GBNL 2WAHA 3HN3A 43CAA 5C08A 3RPIA 3VFNB 4H20H 5HVHC 5CIPH 4M02A 2Y06L 4NKDA 3VXMB 2AXJA 4JR9H 1WAAF 3PE9A 5DFVC 3VD3A 4PD4K 3D48R 1Y0LA 4XRCA 1FG2B 3SKNA 4DK6A 3DECA 4R7DA 1FVEA 1OPGL 4WW1B 5J06A 1ADQL 2DL2A 3PQYB 4C54A 2Q3ZA 1MI5A 4XWGL 4O4YL 2VDLH 1R3KA 5BXFB 5D5ME 2OXGA 3JWOH 4HPYH 2DM2A 1LDPL 4HUNB 4X7FC 4E41B 4Z7VB 1C08A 1KB5H 2DQGH 1F4WH 4LFHG 3UC0L 1CFBA 1I1AB 2QEJA 1DBML 4Q74A 4H1LB 3FCTA 1SYSA 5DD5H 5B3JE 5D7JB 1VFBB 4XP4L 4M4RA 2PXYA 3RIAK 1NAMA 5C0RH 1KLGA 4YUEH 4JY5H 4CU8A 2BVPA 1DVFC 5ACLA 4HIIB 4LHUB 3W0WE 4ZYKA 1ZT7B 4LEOA 2ZSWB 5ANME 5KJRL 1NJ9A 2X42A 3X14A 1MLCB 4QRRD 1LK2A 1QPPA 1MRCH 1KC5L 1PFCA 5CD5C 1QP1A 4LLVA 3TT3L 3QFJB 5HYJB 4Z77A 4POZC 3N9GH 4M8QA 1BFTA 3O9WD 4OD3H 5GS0L 5DT1L 3MRFA 3QJHB 4N8PA 4M6OL 1VEPA 1ORQB 1S5HA 4UT7H 2LU7A 3HLAA 4OZIB 2K9UA 1DN0B 4GXVL 1T7WA 2XPGB 4TNVF 1DVFB 4HIXL 1CGTA 1P7KA 1MWAB 3QJHA 5EBLB 2VDPL 4FXLA 2CO6B 4WHDA 1H0DB 5HDBE 4LARL 4WU7B 1ZV5A 3DMMB 2JJTA 1PSKL 5ENWA 5F9AC 2CUMA 1CU4L 1S7TB 4OLYH 1HEZA 1UM5H 4QXWA 4J7RA 4GRWF 2NY2C 2EE3A 3ZKQD 5ICXA 3VRJB 1PSKH 3OKKB 4E0RA 1BPVA 1WIUA 2FX9L 1RVFL 1CR9L 4LCCC 4PJ5B 1LEIA 2JELL 5CCKL 3ILPB 2QV2A 1NUNB 3DIFA 2BDNH 2J5LB 3G6JF 1GC1C 1OLZA 5BRZA 4EJ1C 2CGRH 2Z8VC 2ICWI 4ORZC 1HDMA 4RAHA 2NY6D 3FT3B 4ZPTB 1QSZA 1LO5B 3I3BA 5SV3A 3E6FB 1D5MA 3CPLB 5I76B 4F33A 4HH8A 2VN7A 4FQIH 4D9QD 1P5UA 3TBSA 4R4BA 5TE7H 2DKUA 4MXQC 2FCBA 5IMMA 2Z8RA 1OSPL 3WFCH 1XR8A 4TOYH 4X7TA 2P24B 3BH9A 2HVJA 1LWRA 3FQUB 4WIQA 5CIPB 5I1IL 3O0RL 5FOBA 1OSPH 4QXTB 3HE7B 3S37H 5CBAA 3GNML 1HH6B 2EDFA 5E5RB 3NN8A 4Y4HB 1MFNA 2P4AB 2HWZL 3SDYL 2FX7L 5CINL 1N5AB 5D7KD 1JE6A 2C3VA 2HT2C 4W6XB 4WV1C 4G42B 4LSQL 1QLRA 2BVYA 2ZCHL 1HH6A 2PYED 2A6KB 3CU1A 3LKRB 1OY3B 3O6FA 3EO1A 3V8OA 3DPBA 2EDEA 1HOCA 3BZEA 1RK0B 1UXWA 5ERWA 1NLDL 2H2PC 5FYKE 1NKRA 4S1SL 1DSFH 3K8LA 4PB9L 3QO1B 4AENA 3L7EB 3UZVB 1I1FA 4F7PB 1IZKA 2H3NB 4M6NL 3TFKC 4OD3L 1QFWL 1MQ8A 4F9LA 3VXOA 3UPRB 1RJZA 1UKQA 5IW6A 1BFOB 2APBA 3MLRH 1S7XA 4L5FH 4DQOL 3GMMB 2OL3B 1I1FB 3QHTC 3NPSB 3H7LA 4M7LH 1OSZA 2X4SB 4QY8B 2HMIC 2FJHA 3D2UB 4KJPC 1NGWB 4F3FB 4EDXA 4K3JL 2EC9T 1CIUA 2UWEA 4K9EH 3VWKD 5FGSA 5HHPA 3R06B 4PTUA 4GRLB 1EZVX 4GKZB 3V6ZA 4NQCB 1DBKL 2OTWA 4JDTL 2VC2L 1XGYH 4NM8L 3ULUL 2YUZA 3AC0A 1KPVB 4YQXL 4JPVL 4MJIA 4X83A 2ZUQC 4M7JL 5IF0B 3W11D 4TUJA 2VDLL 4MQXD 2H6PA 4R26H 3LKNA 43CAB 1NC4A 2PO6B 2Q86A 4FZ8H 5HJ3A 5LKNA 2EIBA 1I9RL 4NQED 5KOVC 1T22B 1JWUA 3MACL 1PGRB 5FYJE 1VCAA 2OX5A 1DVFA 4FXGB 5ISZD 5TDNB 1YYLL 3MACH 2EYTB 3MJ7B 4V2CB 1FFPA 5INCA 3ZKXB 5C6PB 1JZ8A 3AAZA 4JLRA 4PGBA 4DGYL 1RUAL 1KYOK 3P9LA 3UC0H 2F53D 5EC2A 5A2FA 1N3NB 4MQTB 2DBLL 1VKXB 4H0GA 2N56A 4OZFG 4NKIH 3VXQB 1FNSL 2PYFB 4EZMA 4YR6B 4M48L 3A6BH 2HG5A 4FFWC 1QRNB 5B3NA 3ARPA 5HYEA 1RUPH 1BGXL 1I7UB 4ONOA 3T8XB 3L95A 4H5SA 5F9WB 4JZOB 4K2UH 4PRBB 1R0AL 5DUPH 2GK0B 2AK1L 1KJMB 3WIIL 3VDBA 3MRCA 1AH1A 4XXCC 2BC4B 4IMLA 5ICYA 1ZK9A 2NY5L 2PR4H 4YXLH 5C0BB 5L0QB 1PKOA 1PG7X 3G6AB 5C0EA 25C8H 3ZE1F 3NZHH 4GQ9L 1LP9E 4ORGA 5C0ND 5B38B 1U8QA 3P11H 4RWYH 3TO4B 3OZ9H 3D69A 5GIRB 4L4JA 3Q48A 1IFHL 3FQRA 4U3XA 5JA9A 1S5HB 3HMWL 3HS0A 4P5TB 4OM0L 3CNKA 2JB5H 3FO9B 4BSWA 2R4RL 4JRWA 4NRXB 5D1XC 2WBWB 2CDGB 4U6HA 2H32B 4L29A 4Y1AA 2AXGB 1CU4H 1OP5K 4D0DB 2XWTB 1IM9A 3NFNB 4J3SA 2VAJA 4BH7B 4U1MB 1Q9KA 1J1OL 5LGHH 4CADB 3U9UB 2ESVA 3JV6A 4Y7MA 5IHUL 4LLQA 3BN3B 1EVTC 5L8LB 3P77B 2BJMH 4Z7QF 1KEML 3WJJC 3GSRB 3TO2A 2VDPH 4LPWA 3UZQA 5J57B 3WXWH 2Y23A 3ORJA 3WDIA 4DEPC 2M8XA 1AHWA 1WBXB 3MRMB 2W0FA 4XNUL 2ESVB 4NN5B 1HNGA 1UXWB 4TSBL 3PNWA 3QQ3B 4JZNB 1WK0A 4FQLH 3AS3A 4YO0A 3JWDH 5ECJE 2O61A 2VDOH 3CMOH 3VXSE 4ZUVB 3VDAA 4PJXE 4X98A 4RFNB 4M62L 1JTOA 5DD0H 4H0IA 3RBSA 5IIEA 1TENA 2KZ1B 2O5YL 2R69H 3BXNB 1KCKA 5EO1B 4X6DF 3MCKA 1I7ZA 5D5MA 5FA4A 4EDWL 5B22A 5J12C 3RX7A 2YD9A 2NXYB 4TVPL 4GXUN 5GRUH 3V7MA 2ICWA 1GGUA 5CWSA 1VGEL 3LMJL 3U4EA 2ADFL 4HQQH 1T6WA 3QQ9D 1ZSDB 4JEGB 1ORSB 4DCQB 3CFEB 3BJLA 1HINL 1T5XB 4M6ML 5J6HA 4UB0H 1UH4A 1ETZA 4OUUB 1LO4H 1HQRA 2X7LA 3EFFA 4NO2B 5JPNB 4JN1L 3W2DH 5BV7B 1QSEE 5I1GL 15C8H 5JQ6L 1CVRA 1OARH 4HBCH 3TJEL 2ITCB 5FDYA 4ZXBA 5T3ZD 3WFHB 3EO1B 2GJJA 4Q7DA 4KTYA 4K3DH 5EA0H 1KCVL 2VSCA 1JZ5A 1LEIB 4EI5B 4YPGB 3HRZA 4EI6A 5MEND 2P5EA 4WW1A 4JANA 4FQ2L 3ZT7A 4U1HA 1TITA 3IETA 3MUGA 4LRNH 3TBVA 3F7YB 4G7YL 1NAMH 4MMZC 4PY7B 3W39B 2BRRL 4IIQC 3CFJA 4X5WA 3ULUH 2VXUH 2WMPA 4WFHD 3S34H 3QEGH 4GJTB 3EJZC 4Z9KB 1X5XA 5C9JB 5IMMB 5LVEA 1EGJA 3PWJB 4MSWB 1GIGL 2GK0A 1AJ7H 2D03L 3GMLB 3W9EA 3L3DB 4CN1A 3D9AL 1GC1H 3FZUC 1G84A 4AIXA 3BESR 4OCRL 4GW1B 2ERJB 3ARFD 1VGEH 2KL6A 1G9NC 4NOBA 5BV7L 4MDJB 3NCMA 4J8RB 4AL8L 3TBWB 4PR5A 1FQ9C 5DZNA 2ED8A 4K3HA 5I1AA 5BW7C 3S36H 4JZJA 4HPYL 4JKKA 3NA4A 4OJFL 4P3CL 4YNYB 1KJ3L 2Z8SA 2ARJA 4LRIA 4POZD 5EBWB 5I1GH 4R90L 4PJEB 1PVHA 4FXGA 3IF1B 2NXYD 4X6DB 1LO0L 4G6FB 2Y5TA 3RBGA 4CW1A 1CFSA 1DBBH 3N85L 4UI2A 3OX8A 3MROB 4NKIL 3ECBA 5E1HB 4BKLB 5C07A 4N90E 4WCYH 1N3NA 2QADD 5ISZB 2V6HA 3TESA 4JFFB 5D96B 5HPOA 4CUCA 2FO4A 4JM4H 4YFEA 1BIIB 5DQJB 2GAZA 4FQQA 5F8QC 2YPKB 3SGEH 4HWUA 2AJVH 5I1IH 5CJXC 4Y4FA 1D5IH 3SDDB 3EYQD 2F74A 1U8IA 1RPQA 5MENE 4YEEA 1E27B 3MLUL 4HULB 2LVCA 2DBLH 2Q3AA 1EUUA 5DQJA 2YPLA 4Q0XH 3WIFB 4HIJB 4X98B 3NGBC 4OCXH 3TCLB 1U8NA 2GJZA 4FQ1H 3QWRD 1DCLA 5C0BA 5HHVL 1OVZA 4FTVB 4LLWB 3HMXH 1X6LA 3BWAA 5JXEC 2YD1A 3DUHA 4RA0C 3F7VB 4JFHE 1PEZA 1OAUL 5T5NG 4K7FA 4JDTH 1HH9A 4JQXA 4QRRB 4FQ2H 4R8WH 5C0BD 3D1MC 2I9TB 2IBBA 5FUCE 1XMWA 3FQNA 5JORA 1E4XL 4HCRH 5MP6L 3TZVD 3UBXG 2F5BL 2Z92B 3LY6A 1NCNA 5GISL 3GDBA 1ZGLP 1BWMA 1K4CA 4NQDA 3VCLB 4F7MA 3RZCA 3IFNH 1FRGL 1LP9F 5HD8D 1UYWL 1ZT1B 4F58H 4JFXA 1MCIA 5DTFB 4NRYB 1A7OH 2X4UA 4ZTPL 3REVB 5F1IA 5C86A 1HWGB 5J89A 3BD4A 1P7QA 4WNQA 4M6MH 1OLLA 4LPUA 5IVZA 3DJ9A 4OFYD 4KK5C 5TE4L 5KG9B 2IANB 2CXGA 1IZJA 3VXNA 3VD9A 5HD8C 3QDJA 1VACB 5ILTH 2W65B 2WIMA 1G7IA 3KLAB 3KHOA 2HFEB 1KJMA 1KT2B 2F15A 3BUTA 5KG9A 1UJ3C 4U6VH 1FN4A 1UM6H 4WUKH 1SMAA 3EOAB 4PD4J 1JHTB 4Y5XB 2AK1H 5CKGA 2XQYK 5DJ8A 3MODH 3GO1L 4DKEH 2R23A 2RHEA 5FYLE 1MCCA 1LHZA 3N50A 3ARED 5KAQF 1MEXL 3BHBA 1A9BA 3TIDA 4EDXB 4KJPD 1MRFH 2DB8A 2PKDA 3DI3B 1YEEH 3NH7H 4G8GA 4GMTH 1K4DB 3LOWA 1ZT4A 4AZ8A 1W72L 3TH4T 2GY7B 4PRHD 1A9BB 3TIDB 2YXMA 2XXCB 1MVFA 3PGFL 4HUWB 3VI3E 2J2ZA 1XF2A 2FR4A 5T1KA 3QNZB 3BQUB 1GCFA 2VJXA 2IEPA 1S7WB 4HKZB 2J6EA 4GSDH 1UZ8A 3FL7A 4X7CC 1PZ5B 4GKSB 1NAKH 2HH0H 7FABL 1FFQA 4R96A 4WDIA 4JO2L 3C9NA 4KRMB 1H3TA 3AMKA 3FT4A 5DZOA 3A6CH 1YN7A 2W60B 4B41A 1YMHB 1S7SB 4PV8A 3D3VA 5DF0A 2BSRA 5CGMA 3QFDA 5E9DD 4XNYH 1MUJA 4MNQD 4U1HB 2J7LA 5CMAB 2A1WH 3FQXB 1C7SA 3HZKA 4GG8B 5KZCB 3LQMA 3BGFB 1FNFA 5B8CB 2G9HA 3QEHB 3FB6A 4NZUL 2DTSA 3X3FH 4XPGH 4ONGL 2P46B 1BVZA 1XF5B 2F53E 3FTGB 5I2IB 3DMMA 4UV7H 2QQLL 1ZA6A 2DAVA 3OKEB 5DFWH 4RISL 2WINA 2DL9A 1MH5A 3TYFB 1HYSC 5CEYB 1MJJB 4P57A 1JI1A 4JKMA 1N5YH 3FQTB 3Q3GB 2VKXA 4QHUB 3T4YB 2B1HH 1NBYA 5F44A 3TNNB 2VDKH 4K94C 3J8F7 2GTZA 3REWB 3NPSC 2I9LB 4WW2A 3MRGB 2KUTA 2AGJH 4NFBA 4Z0BH 5EZOL 1RZGA 5HHNB 5FO7A 5JOPD 2XZAH 3UTSA 5E5MB 4GG6B 3SO3B 4X6CA 4XNZB 4PRAB 2NX5D 4L3EA 1NC2B 3BOVA 1FZOB 4MQSB 1ZHBB 2VQUA 4UT9H 2B2XH 3W5NA 4IHOA 4U1KB 3IFPB 4TUKH 5D8JH 5I8OL 1EMTH 2DF3A 1F3JA 2HWZH 1AR1D 4EUPG 5HI5D 1KPUB 4MA3B 2RCSH 4O58L 3SDXF 2WUBH 2F8XC 2P24A 3OX8B 3BH9B 4XNXL 1C5DA 1LDSA 1WTGT 2J8UB 2PO6C 1FBIL 3O6FC 1L0YA 3NH7L 4TRPL 4F9PC 2EDQA 4MCZA 4GAJL 4P9HL 5HDQL 3BD5A 3F65A 5DJZA 1P7QB 4WNQB 5KSBE 1YEJH 2VLJD 3MJGX 4OLYL 5FOJA 1JK8A 4I1NB 4YC2B 1OOAA 2DLFL 3SKJH 1AGCB 3E6HA 3MFFA 2JJVA 2GIYA 3O81A 1AD0B 3DNKA 4R97B 2R0ZL 4N5UA 5IFHH 1PG7W 5GGVH 2EDKA 5IWLC 3HMWH 1U0QA 4OZHA 2X1PA 5C92A 1E4XH 4LAJH 1KNOB 5HGDA 2CK0H 1QR1B 3T0ED 3WO4B 1M6OA 4DVBB 2DQUL 5E4EC 2DQDL 3QUMA 3QUXB 5HY9A 4OZFA 4HUKB 35C8H 3JTTA 4KU1A 1LD9A 4BUGA 4LSDA 1PZUB 3LPFA 1BFOA 4L1DA 3BUYB 4ZAKA 5IR1B 3RVTD 3SDAC 1NCBL 1NC4D 1G6RB 2HFTA 3DV4B 1KIPB 1FC1A 3LEXA 5I73B 4GAGL 4NNPL 1IC4H 3U4EB 4CN6A 1KB5B 4BZYA 3TNMA 3KDMB 4X5XA 4HV8B 3RPKA 4NJAH 3MUJA 3MRDA 4JDVA 4K9EL 1CXFA 3DVFA 5DK2A 1RMFL 4MCYA 2XTJD 5EPMA 2YD7A 4ONFH 2PF6A 5GZNC 4X9BA 4IM8A 2XPGA 3V0VA 3ZYZA 3V5DB 2UY6A 5GQBA 4NRYA 3LKOA 4CVXA 1EAPB 2F53A 2X4PA 3DVNB 5IVXA 4F7TB 3LD8B 2DOCA 2CO7B 3EYFA 5F96L 2NW3B 3F12B 5IM7B 1KUMA 3ARFA 3OJMB 2XKUA 4JAMA 1P4IL 2IALB 1NC2D 3FJTA 1FYTE 3FMGH 3R1GL 4RRPG 5BJTB 2IPTH 2R2BA 2DDQH 2HP4A 2VLLA 4WI9A 1GGTA 3BPOB 4LSSH 3WFEH 1G0YR 3GI9L 4DN3H 5BV7C 3QIWC 5IQ9B 3H3KA 2EXYC 3FRUB 5J1AA 5DHVA 4WJ5A 5E24E 1BQSA 1I1AA 5F6IB 5BMFL 3RL2B 4XCNA 1KELH 2BCKA 4JZJC 4YHZL 4UBDD 4P2QE 3CLFH 3VFVA 4HUUB 3Q6GH 3JBG7 4OZGA 4EI5C 4LRIC 1NANI 4OV5B 1F90L 3PDOB 4YDLB 5E2JA 3QAZB 1JGLH 4WUUA 3VWKA 4G9FB 4UV7L 5DD3H 3W0WA 2VZUA 2DWDA 1V3LA 2AJZA 4QEGA 5C0FB 3OAUL 4MGXA 5I1KH 1A0QL 4EN3C 2WP3O 2CIKA 1R3IL 1JP5A 4DN4L 3G6JE 3MA9H 1KTLA 1LGVA 2NQCA 3KLHD 2R4RH 2GTWB 5ADOH 1LVEA 1FORH 1KV3A 1IQDB 3MSPA 5B8CC 4HFUH 3VFNA 1NBVH 1JYVA 4PRHA 4QRPE 4QOKB 4K8RC 1CICB 2YOCA 1BF8A 4Y4FC 5F6HJ 3DVIA 5DHYA 1FAIH 3C2SA 4RGNB 3HCVA 1MI5E 1F3JB 2BVOB 2NY4D 4TYUA 1RZ7H 1AC0A 4KGJA 4V1DE 3U46A 4QHLB 3VGDA 4AH2B 2B1HL 4N90D 4QXGL 1AXTL 2H32A 4JFFA 2VSDA 1R0AH 3HNSH 3U6RA 4ZODA 2IMMA 3NCEB 3NOIA 4G6AD 4LVNB 1RUQH 4NN6C 5D72L 4LLUB 5D7LD 3C60D 3ILPA 3DO7A 1A1OB 1NMAL 5HTSA 3GMQB 1VEMA 1IAKB 1IGIL 1SBSH 1K6QH 1TQBB 4YHNB 4L9DA 5IMKB 2I60H 2I24N 3IXAB 3ZTJH 5CILL 3QUZD 1L6XA 3G5VA 1P7HL 1AP2B 3VXSB 1AR1C 2YZ8A 1N8ZA 3HNVL 5KTEL 4R8WL 5J8OA 1G0DA 4JY4B 1W2KT 3DX8A 1WVZA 3ES6A 4RRPA 5EIIB 4ZUVA 5HGAB 4JR9L 3SDXA 4FQXC 3RI5K 4J1UB 1AI1H 5IFHL 3MCG1 3ARBD 3RX5A 5IVNA 2N7AA 4OD1L 5IJVA 3KJ4B 2R69L 4LCIH 5KBNC 3O3BB 2JLLA 4G9FD 3MV7D 2DQUH 4L8BB 4U1KA 3ZE2E 3OKDB 1OB1A 4JPKL 5ACZB 1KBGH 3BMVA 3HNTH 1BD2A 4G8IB 3LS4H 2C1OB 5EBMA 4L8DB 5AYUL 3IXTB 3KLHC 3O2WH 4OT1L 1XR9B 4ELKB 2HTLC 2OQJA 4MA1C 3GJFK 4BZ2L 5EU4B 1RUPL 3QUXD 3T09A 1M71A 5L2KA 2PXYD 4G43B 5AYUH 1JPTL 5DC0A 3UTPD 2LE9A 4R4ND 4UDUA 3S88L 1HXYB 4M8VA 2WWKT 2GKIA 5CZKA 1OM3L 3HPLB 4MXVE 1RUMH 4LBEA 1ZWIA 5H35A 4NKOB 3ZHKA 2A83A 1PKQA 3AB0B 2BRRH 4OD1H 5MEQB 2J8UF 4JDZA 1SJEB 1QKZH 3BKYL 5GRWA 2QQNL 3O9WA 4JFEE 3L95B 4H5SB 2CRIA 4AEHL 5FECB 3G5YA 3CDGA 3WE6A 1IGML 1KFAH 1KCSL 1VFAA 2XI9A 4L8CB 1T4KB 4P3DA 1MHEA 2XICA 1X9QA 4Z0BL 4UB0L 4KHTH 1YYML 2UWEB 4S1QL 4XP5H 3DRTA 4NN5C 2ZOKB 5IBLD 3TNMB 4MXWL 4MWFB 4X5XB 1OARL 3BZ4B 5F7FA 3W81A 4P5TC 5F7WC 1RU9L 2ZG3A 3BP4A 3QULA 3RDTA 5T1KB 2FRGP 5TH2B 4PGEB 2CKBB 1U8OB 3CH8A 1GAFH 4KGLA 1YJDH 1A6VH 4GAYB 3ZDZF 2VLKA 4IDJL 2WW8A 1XGRA 2IH1A 1AQKH 3JWDC 3T4AB 4YHZH 4C57C 1G9MC 1NGYB 5EDXA 3VG0L 5GS1C 1AI1L 2EYTA 3MJ7A 4R0LC 3EDJA 1Z9SA 1F97A 4GG8A 3EO9L 4PJHB 4PJEA 2K3TA 4LGSB 1VHPA 5DEFB 3QUMH 5L8KB 1RK1A 5C08D 1K3IA 1ED3A 4MJ6B 1FGNH 2DJ4A 3ZDXF 3KPRA 3MLUH 4N0UB 4OZGF 2Q7YA 5C0CA 1JZ6A 3JSSA 4LLDB 1SVZA 4Z18A 1DDHB 1T89C 1I8LA 5A2KH 4M43L 3PP4H 3TBYA 4I8DA 1CXEA 1XEDA 3E2HB 2FD6L 2H2PD 4J6RH 1SJHA 1EUTA 2Z31D 2GJ6B 2BY1A 1HWHB 4Y4FB 1K8DB 3RI5F 3TPUB 5BMFH 4EQ2A 2B0SH 3UMTA 4PJGE 2AXHA 5EPMB 3JVGA 1I3GL 4J1UA 4Y2DC 3RVXC 4NJAL 2OTPA 4OIAA 1JNJA 1NGPL 2XA8H 3HKFA 3DURA 5DD0L 4A2LA 4U1IB 3F6LA 4OI9A 4X9FA 1AQDB 4BSWB 1IT9H 2Z31A 1BF2A 4HZLB 1G1YA 5E1AA 1ITBB 4RFEB 5DVNA 1HH9B 3UYOD 3TT3H 4YAQB 3ZTNH 5CBEB 3OKOB 3PJSB 4JPIA 2QQKL 3MV8D 2ZUXA 5IHBA 1K2DB 1RZKC 3ZZ1A 1MNUL 3KPNA 2CR6A 4OIIH 4QRQA 1G7QB 4O51B 5JXAL 1S9WB 5B21A 1KSRA 2XTLA 1D3CA 2FZ3B 2X4NB 3KG5A 2G75A 3L5IA 3ZKNC 1B4JH 1RHHA 2FEEL 2NY6C 3FO1A 5D7IA 1RUAH 1WAAE 3FONA 2OJEA 1YECH 3MRNA 1E0OB 4UDTB 3SDAA 2IPUG 1P5VA 3B9KB 2W0KA 1RZIA 4OZFH 3REVA 3RY4A 5BZWA 5EO9B 1YNLL 5FGBA 4M3KB 4Q2ZA 1CVSC 2ILLA 3CVIH 3GHBH 1XGUB 2ARWA 1ZTXH 3RVUD 2X5PA 3C5ZB 3QQ4A 4XHJC 4LGPB 3PWVB 3GSQA 5EIIA 2DQFA 2X4RB 2DQIL 5EUOF 2WSKA 3QDMD 4N0RA 5HDBF 1FLRH 1NGXA 4NYLA 5HHMB 3C6LC 5HHOA 4QXUL 1MY5A 3HG1A 1ZLWK 4KDWA 3MOAL 3WFEL 3ARFC 4WFGE 3RWEB 1FNHA 4FNLL 1QVOB 1TIUA 2V9TA 4KDTC 1EZVY 4OZGE 2BDNL 3PV7A 5EWIL 4NSKA 4L8DA 1V7NL 4I18A 1F11A 4KQ4L 3P73B 1R3JB 5I75B 3RZCD 3AS0A 3T3PF 1QPXA 3RWJA 1KN4L 5MI0C 4L8SA 2J3SA 1OPGH 2YPVL 3IFNL 2O93L 1XF2B 4G8FB 4YHPB 1MCWM 1DQML 1PJ9A 3QHZL 1LDPH 4NQSB 1NGQH 1U91A 2PETA 4PB0H 2JJTC 1JV5A 5HJ3B 2OP4H 3SBWC 5CFHA 2ORBL 1PZ5A 4GKSA 5TF1H 1DZBA 2HA1A 4YHOH 5J1TC 2J4WL 5C6WH 3HB3C 2APTA 2A73B 5CD3B 5TFSH 4AEHH 4EOWL 2DQJH 5DEFA 4IMKA 3PABA 3TJHD 4GRWE 3TWCH 4ERSL 1S9XA 1MUJB 5EO1A 2G5BA 1U95A 3P9MA 4D0CA 1I7ZB 4WTZG 5DVOA 1FJ1A 4QTHB 3UBXB 1RJCA 1W0VB 4HWBA 4X9IA 1SEQL 2NY0D 1UH3A 3VFMB 2A74B 1FNAA 5GS1A 4XNQA 4NQEA 1S7QA 5CJOH 4OF0A 2CKBH 3MOQA 3I3EA 3CFCL 2P8MB 2ITDB 1ETZB 3G6JA 1A5FL 3QIBD 4P4RB 1FNLA 4GMSL 1ACZA 1VPOL 4KHXL 5EU4A 4CJ1A 1S78D 1BD2E 4HDIA 2IFFH 3UTZB 5LJYH 4XPBH 2ATPB 3HMXL 3P0YL 3QYCA 2P5EE 2E7LC 4TUOB 1FNGB 3WFZA 2RJMA 5J3HD 2CLRA 3BRDA 3HS0B 4JPIB 2F19L 3RTQD 2CJUL 1FVEB 3T0XA 1UVQB 4OFVA 4GS7B 3UXFA 4HWBH 2AEPL 2NZIA 3JVGC 1A7QH 4XRCB 4PJDB 1TJIH 4HS6A 1SEBA 3QP3A 1WBZA 4NFCA 2CGRL 1IC5H 1ZVSB 1IKFH 1C5DB 1TZGH 2FD6H 2YK1L 4FA8A 1CICC 2MMXA 3IFLH 5IWLA 5GZOD 4XX1E 4UIKL 3QHFH 5HDQH 5IQ7H 4XMLL 3PV6B 5IP4A 4QLRA 5KN5A 1GOGA 4X6FB 3I50H 3LV3A 1KF9B 4H8WL 2BVPB 1CZ8H 1YEIL 3O4LB 5FV2A 4L3EE 3VXPA 1CFQA 2VXQL 3BDYH 3EUUA 4PJAB 3W11C 1MCKA 4MD5B 3FHQA 3F7VA 3NIDF 4LPTA 4YDVA 2FJFB 4YHKH 4NNXA 4PR5B 4LLVB 2VAAA 5GRXG 2B4CH 1F02I 4JQVC 3N1MC 4PREA 6FABH 3DUSB 4IRJD 5K93A 2F19H 3HAEH 3W0WD 2XN9D 2AS5M 3PWLB 5IESH 4WGWB 2VLKB 3EZ8A 5JO5B 2MKLC 5JORB 4Z7UE 4QHNB 1GGCH 4PTTB 3BWUC 4NKMA 5H2BB 4N0UE 3BZFA 1DQJB 4HK0A 5GGQL 1OAUH 3HE7C 5IB4B 3CLEH 2COQA 5BVPL 1J9CT 1E6JL 4L9LC 5KSBB 4JM2F 1B90A 3KYMB 2PW2A 5CEZH 4X7SL 1BQHB 3QCTL 4ELKA 3MA7A 1XIWB 4WV1B 2VXVL 3DROA 3P0VH 2QSTA 1CE1L 2J8UE 1N5YL 3QI9D 4FFWD 5KJRH 5E5UB 5CEZL 2FO1A 1HCVA 4ELME 3MNVB 4MJ6A 2PW2B 1N7ML 1ZA3B 3GJFA 3DXAD 1CBVH 1V7NH 4FS0A 4G8FA 3KPSB 3RHWK 2HLAB 2P8LA 4DUXA 3Q6FB 3OQ3B 5FEBA 2R0WL 1CD9B 5ITFB 5E8OA 3PGCB 3HNSL 2DD8H 3HAEA 1I1AC 5C0CE 5T1LD 2MHAB 3TIEB 4ZTOL 5LGJB 3KPRE 4OLXH 3GHEL 3SE9L 1HCFX 2N1KA 5F9OL 1UB5B 4LFHD 4JY6A 1T7ZA 4LGRB 3U30B 1KJ2A 3GUTB 1IQWL 1QBAA 2DQDH 1NBYB 3F7YA 1N6QH 1DFBH 4KRPB 3KYOB 4F8TA 1ZTXL 4BQCA 4EUPB 1I3GH 3O4LD 1AQDA 5FGRA 5FHAL 2B4CL 2NTSP 3S88H 5KS9F 3GSNA 3O3DB 1P4LB 2CRZA 3QT2A 4L4TD 1UB6A 4G7VL 5EORL 1F90H 1W0WA 4P2QA 4PJCB 3ESVF 4K2UL 5C0IB 1IC5L 2YR3A 3B9VA 4D9RE 4UUJA 1YDPA 4NZJA 4J4PD 4HAGA 4M7ZC 1BVKA 1QSVA 1CXLA 3KWWA 1ZE3C 3TCXA 5BS0B 1YYLH 1YMMD 4L3ED 3QXAB 4TTDD 5F7UA 5ESQA 3K74B 3O2VL 1KB9K 2EC8A 5FM5M 1RZJL 2Z93A 3D25A 4OI7A 3MZTA 2BY2A 5E00A 4JKWA 3SDCB 4DQOH 1QFUL 4HWEL 2A1WL 5DJ2B 4XCYB 3RZWA 2Q76B 4M6OH 4P4KC 5L2KD 5F70A 3EBAA 2VDRL 3LRSB 1XIWD 4GW5B 3RVVD 4UQ2A 1DBAL 1QBMH 1QRKA 4Y16C 3GM0A 1OGAA 1I7RA 4EVNA 4OCNC 1FL3A 5I8CB 3BSZL 5L6YH 3T65A 4JANB 4MAYB 4E41E 2R29L 1DLHA 5E99L 1KEMH 4U6TA 3X13B 5L7XH 3TEUA 2B4CC 5D6CA 3GSUB 5TPWH 2VZ3A 4LCCB 2VXVH 1QLEH 3OAZK 4N1EA 5F1NA 3MNWA 5BXFA 2YRLA 5LXGL 3TNNA 1TZHA 1CDJA 3O2VH 3BFOA 3IRZA 1MCWW 1QFWM 5IMKA 3CSBA 5ALCH 3LZFH 1KPRA 3SPVB 3THMH 3E3QC 5JMRA 4HFWA 4ZFOL 1BBDL 3RWIB 4NQXB 3L3HA 4OGZA 4HKXB 4LRNL 3IU4H 2QSCH 2D7OA 3UYRL 4PJ5D 5DK2B 3BWAB 2X70A 4OQTH 4L5FL 1JHLL 2QQNH 1U92B 5HI4C 1KJVA 1D5BA 5DK0B 1I3VA 3BIBX 2OR9H 1NH6A 3OKMB 3AGVA 3O8XB 1EO7A 2HFFA 5MENA 1J8HD 1KPUA 2F53B 2X4PB 3D85A 1ORQA 3IJYA 3TJEH 1H3PL 5LAXB 4YDJB 3S5LB 1QO3A 1IC1A 3QJFA 1KJ3H 1U36A 5GGTH 2HFFB 1R5VA 1T7XA 1OM3H 1BQLH 3KYKH 5JOFA 3SDXE 1IGCH 2R2EB 4XB7A 1F4HA 4RIRB 4JFQA 2J6EL 3WFBL 1X4ZA 4MNHB 3WIHL 3U7WH 4PRNA 2W07A 3I02A 2FHCA 5EUOA 3U0PB 2CIIA 3L9RA 1J8HA 4FFYL 5C8JA 1JGDA 4WCYL 2FB4L 2VZTA 3VFRA 3M07A 3JTSB 1SY6L 2A77L 4KPHH 2ZNWA 3N1FC 5HI5C 2VLJE 3SJVA 3STLA 2FHFA 4EUPH 4HUMB 3HR5B 3RIFF 3INUH 4FMFA 1IM3B 5LGJA 4U0QB 2XOTA 3G6AA 2Y6SD 3BGMA 4DZBA 2LTQB 4FNLH 3HZVA 5TQ2H 2D31B 4L8SC 4X7SH 4JVWA 2W9DH 2NY7L 1U8NB 3DIFB 5AWNL 4JFFD 4N8VB 4YGVB 5EOTB 2GEEA 3HG1B 4P5TA 1MLBA 2W9DL 2EH8L 4NKMB 5H2BA 3EYVB 4YJZL 3IVKA 4G8GD 5IMOA 1WIOA 3D69B 1ZHLA 1NAKL 2HH0L 1QRNE 2CLRB 4K94H 5EOTA 4MCYB 6FABL 3MLYH 4BZ1L 1BVLB 5ABDE 1MHHA 5CP7B 3BAEH 1GC1L 2VXSH 1BOGA 3LEVL 5EA0L 2JELH 4X7TB 4IMKC 3SO3C 5JOPE 3D39B 5T3ZH 4KMQA 1QZ1A 2DLTA 2Q6WB 1CD8A 1CE6A 4PJDE 4QF1A 5IVXB 2DN7A 4I2XA 1VEOA 3EJZD 1MCEA 2EDBA 4R0LA 5E8DH 5SV4A 1WZMA 2DJUA 3DVGB 4PJ9C 3MNZA 3U4BH 4JKLA 4PGDB 3AU1B 1MRFL 4IRSB 4EDWH 2Q8AH 2KPNA 1WQVT 3IFLL 3S9DB 3WUWA 3T4AA 1BECA 2ZUSA 1BFSA 32C2B 3PNWB 1FAIL 1M7XA 1KELL 1QLRB 4PJAA 1WBYA 2Y9RT 5T5FL 5I8OH 2E7MA 1NLBL 5BRZD 5HYFA 1SJXA 4KJYA 3DOSA 4P23D 3ARQA 5CUSL 3EYSL 4C56E 1KENL 3SDCD 2NYYD 3X12B 5I6XC 4MLSA 1CICD 1U8KA 1S7QB 1C16A 2CDEB 1MCOH 5DQ9A 2BK8A 4ZFOB 4U6XB 3RY5A 3BKCL 4LCYB 3KYAA 4WEBH 1WITA 3CVHL 1W0YT 2X4SA 3B5HA 2YK1H 2CIKB 5IFAL 3VH8B 3L3HB 1MRDH 4PTUB 1FH5L 5SX5K 5EH1A 3GIZH 4G7VH 3CSPA 1IGYB 3EFDL 5GGSY 5GRZA 4N1HB 3O6ML 4NT6B 4RAVA 3UTSB 3GSVA 2DQIH 3LSOB 1UWEL 3P11L 4RWYL 3EOBA 3O11B 2C3XA 1A6TA 4MX7A 3T0WA 3QFJE 1XR8B 4EIGB 2ZKHH 4WEUD 1QEWB 4QHLA 3TN0D 1T5WA 5C08E 3MV8B 5CBEA 4YFLF 1DQMH 5AZEH 3V6BR 4DKFL 1FL3B 3KLDA 5I8CA 1OTSC 2Z4QA 4KK9C 3H9ZA 3MJ8A 1TMCB 1KIRA 3VMOA 1J0ZA 4Y16B 2K1MA 5CJ5A 5F9JB 1URLA 4UOJA 1DBJH 3TN0C 5BCAA 1LK3H 3EDDA 3RIFK 2B20A 2ZUTA 3LH2H 5FV1L 1KB9J 3VGGA 1K5NB 1QSFE 1RUQL 5D72H 4M1GL 3MGTB 5HHQB 5EO9A 3RNKB 5FA3B 4I3GA 3HZMA 1CL7H 1F6LL 3C60B 1FVDA 4Y0GA 4APQC 5GISH 3ELAT 1N59B 5DGRA 3BPOC 4YE4L 1LO5A 3H3BC 1EEYA 3SE8L 4YIQB 1IARB 2E9WA 3U1SH 4U7KA 3RWCB 1G0XA 4ISVB 3VJ6B 1NFDF 4QY8A 3H2WA 3MRCB 5HGHA 4AT6A 2JIXD 3IVKB 3MREA 1DQDL 4QXUH 3TBSB 3QBTB 1ADQA 3SE9H 4CU7A 1G6RA 4OLVH 2YN5A 3FFCB 3O6MH 4P23A 4DEPB 5DWUH 4UNVA 3CUPB 3MOBH 2AJUL 2ARJB 1NCCH 3DX9A 1JHLH 5L2JA 2EDJA 2VR9A 1FZJA 4JFHD 1RJLB 2YKLH 1OT2A 2NX5A 1KYOJ 3O41A 4NHUB 1H0DA 4NSKB 1PG7H 2W9LA 3IU3B 3S37L 4WUUD 4QT5B 4TN9A 4YX2H 3WFDL 1FZJB 2V5MA 1MCOL 1U58A 5EZIL 1QYGL 2QSVA 5A3IC 2D9QB 4W70A 3QZWB 3DVGA 4Q9RL 1J0JA 4OAWA 2L7JA 2EZ0D 1YNKL 2VITA 2GAZB 4WI2A 3G5XB 3X3GL 1HHKB 2NY5C 1G9NH 5IEKA 1T1XB 1GPOH 3IDMB 3S97C 2LFGA 1YC8A 4OM0H 3V5KA 5BVPH 1N0LA 4XVSH 4DZBB 1HHHA 4GBXA 4BZ1H 1L7IL 1TCMA 4ODXA 4BFBD 5J1SC 1RY7B 1GZQA 4IRJC 2P48B 4ZYKB 5B4MC 2O5YH 1HN1A 3AVEA 5DGQA 3SOBL 4N9GA 1T3FA 4PBWD 1WGOA 1S7RA 4CKVX 1MIEL 1D5ZB 1U95B 2GJ6E 5I19L 3MV7E 3V4VL 2R1YA 1JJUA 1PYWB 5DRZB 5FYJU 2PYEB 1F4YH 3PHQA 2WQ8A 5HVHB 12E8L 1NGWA 4F3FA 3SKJL 1VPOH 2CUIA 2YUXA 4U6XA 4OV5A 1YEFH 4JO2H 4PJ9D 1IAIM 2M2DA 4X5LA 4ZMAT 2D7PA 1AO7D 4Z7NE 3KPPA 3D0LA 3KNBA 1KB5A 4LQ1A 5IKCA 4PP1D 3RNQA 3CSYA 3QDJD 4PJXF 4WHCA 5KSUA 1K6QL 1CDYA 3S3SA 4P2RE 2DMCA 3CLEL 5LGHL 5HSFA 2JIXB 1BZQK 3WCYA 1DP0A 1HQRB 1PQZB 4NZUH 4ZS6C 4OF7A 1BM3H 3CZJA 1FG2A 1S7TA 3TH2T 3U0PA 1KB5L 2PO6A 2BOCA 4KK5D 1EERB 4MX7B 5MEOB 3U82B 2WLZA 4XNMB 1CFVH 3WUWB 4WFHE 2EO1A 3E8UL 3F12A 3WFHA 4YHLL 1IT9L 3K2UH 2IH3B 5GHWH 1T21A 2HT3D 5HHMD 1P6AB 4YBLB 5C71A 2P8PB 3T0EA 4K71B 2AQ2A 4XC1L 4M62H 4ACPA 4XWOC 4CDHA 3IFOB 2FBJL 5DJYA 3FOMB 4Z95L 1A7OL 2HT2D 5FKPA 2DLFH 5F1NB 1AGFB 3IT8D 4A6YL 2FJHB 4OCYH 4OGYH 4XCNB 5IGXH 2VIRA 5GRUL 1NJ9B 3X14B 1EHXA 4YO0B 4JFOA 4K3JH 4Z7UF 4RGMB 3T8XA 1QSED 4HWZA 4YDIL 3RWIA 4S0SD 3TO4C 3VGBA 1HINH 4BM7A 5DRXA 1WEJL 4XWGH 2X4QB 4ODWB 3UPAA 1LP9B 1MQKL 3ARTA 3QDGE 1FSKC 4W6WB 2XWJB 4JO4H 5C0DB 4LCWA 1T04A 1XF3A 5HDOA 1BQUA 1MJ8H 1MJ7L 1BBJB 1PBYA 1F11B 3TN0A 2JK5B 5MERA 5GHWL 1A4JB 1BLNB 2CD0A 1JYXA 4XP9L 1QKZL 2WBKA 4LSUL 1B0RB 4Y4HD 4K3EL 4ZFFA 3EOBB 4YC2C 4UT6H 4PP2A 2AK4E 2E7HA 4Y19B 3EOTH 1XF3B 4MDJA 5GSVB 3ROOA 1KCSH 2IPUK 1E4KA 2Z0BA 1NLDH 1U2HA 1OD9A 1JMZA 1HEZB 4U1GC 1P4IH 3MBEB 3MGOB 2D03H 2NR6D 5ALCL 3QH3B 5J9PA 3EHBC 5CD3A 1XIWA 4F2MB 3DROB 4Z7OE 5E8NA 2G5RA 3KPMA 4PPTA 3E1F1 3QIWA 3SJVB 5H94B 4R9HA 3OG4B 5DC4B 3STLB 1QLFA 1UA6L 5EU5A 1T2XA 3Q6FA 2NR6C 3WFCL 1MEXH 4ELMB 1IEHA 2P5EB 2EICA 4XBPA 3I6LE 1U93B 4HKJB 2X4OB 5C07E 5CSGA 4MS8C 4OM1L 5DVKA 2R39A 3JV4B 3SQOL 3V5HB 3ARDC 1IEBB 4WW2B 4PY7A 5C07D 5IHLB 3ES6B 1RZGB 4HWBL 1N6VA 4BFIB 3TC9A 1RIUL 3DYOA 3LKQB 1L0QA 2E7BA 1CQKA 3BPLC 1RZ8A 1ZT7A 4LEOB 2ED9A 4RMTA 4DVRL 3L5WB 3PHQB 4HXBH 5JQHC 3B83A 3MV11 3IU4L 5HVWA 1RUML 3U1SL 1A14H 1BZ9B 2I60L 5SWSE 3EO0B 4AJ0A 3ARDD 4NUJB 2V2XB 3HHRB 1ZSDA 1XT5A 2A9NL 4OI8A 3OAYK 1S9YB 5CSZA 5M95B 2Q6WA 1FVCB 1I8IB 2ADGA 4H1LH 3Q5OA 1VENA 1PLGL 3BQUC 2A6KA 3F5WA 4PJAE 4BFGA 1REIA 2VDMH 5F88A 3VH8G 3W9DA 5JPNA 1XGTB 3MV01 2F9BT 4B7LA 2CDFA 3U0TA 5ESQB 1EK3A 3QUKA 1A8JH 5BZWB 1EBAA 1HKLL 5CJQL 3WDJA 1AKJA 1AC6A 4M00A 5KSAC 1NCTA 4I0KA 3HG1E 3TVMB 4P46D 5JZ7D 2HG5B 4EKXA 3D85D 1T21B 2DQEH 4OQ1A 5C08B 3PV6A 1IAIL 4AY0A 4HF5L 4OKDA 3MGAA 1AIFA 4RDQF 1FL5A 3MROA 2D7TH 3T2QA 1OAXL 2BMKA 4N8CH 2B1AH 4PJ5A 1S3KL 4NOFA 4XVTH