3MJ8B

Crystal structure of hl4e10 fab, a hamster ab stimulatory for gammadelta t cells
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
218
structure length
211
Chain Sequence
QVQLKESGPGLLQPSQTLSLTCTVSGISLSDYGVHWVRQAPGKGLEWMGIIGHAGGTDYNSNLKSRVSISRDTSKSQVFLKLNSLQQEDTAMYFCARHFYTYFDVWGQGIQVTVSSATTTAPSVYPLAPACNTVTLGCLVKGYFPEPVTVSWNSGALTSGVHTFPSVLHSGLYSLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIMULATORY HAMSTER ANTIBODY HL4E10 FAB LIGHT CHAIN
publication title cDNA sequence and Fab crystal structure of HL4E10, a hamster IgG lambda light chain antibody stimulatory for gammadelta T cells.
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 211
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj8B01
3KPMB 1FNEB 4FXKA 3ME0A 2EH7H 4Y89A 4JFFB 1AC0A 4WEBH 3QPXH 3I6LD 4JFDD 4RIRB 4EN3D 5DO2C 4OV5B 3G6JB 1BBJB 4CVZA 3MGOA 3V5DB 1A7NH 2GW5A 3S37X 4L9LC 2DQDH 4OLZL 2VDLH 1RQ5A 3W2DH 4Y2OA 4QRRE 4WU5B 3DVNA 2D4FA 5IVXA 3U30B 1FORL 1WBZB 3PGCA 4OKVB 3GO1L 1PKQB 2WBJA 3VFVA 4M02A 1MCHA 2FHFA 4OCSH 2VLJE 1DQJA 3WBDA 4KJQD 4QLRA 5I1IH 3B9KD 2B39A 3BESR 1HCFX 4MD0B 3QUYA 4QCIB 3W0WE 3THMH 2R69L 4UTBL 4XPFL 3W11D 2F74B 2OXGA 3U82B 1OP5H 3LKNB 2P43B 1SQ2N 1FNAA 4QTIH 4F7CB 4R0LA 2RJMA 4MAYA 1Y0LB 5CJXC 4I18A 4DFIA 2BVOA 2LVCA 2EYRB 3SGEI 1IGFL 3MLXH 3RNQB 5I1AA 3TIDB 1RURH 1MCOH 4RMWA 3IJSA 3SEPA 4RFEB 5D1QA 4GKZB 3ALXA 3DURB 4G9FB 4YK4B 5IEKB 3E6FA 5EWIL 2IFFH 4LLQA 4PLNC 1CF8H 1LK2A 1XCQA 2BP3A 4QRSB 3U1SL 5KSVB 2VAAA 5GIRA 1WGOA 3AS2A 2E27L 4P3DA 5ADOH 1CDHA 1N26A 3NTCH 1M7DA 5SV4A 1BJ1J 3ILPA 2NY2D 4HEPG 5CZXD 3HLAB 1FP5A 1A3QA 4UT9L 1A3LL 1KLUA 3WN5B 4V2BA 2YXMA 4L4TD 1BAFH 4F33A 3L5XH 2QEJA 2I9TA 3CXDL 2QKIA 5DMGC 1ACYH 3NAAH 2AABL 3A0OA 5DMKA 2GJZA 4MNQD 4RNRA 3TN0A 1HYRC 1NEZA 5HJ3A 5BO1H 4CVZB 5DJCA 4LHUA 1FAKT 2HKFL 1KJ3H 4L8CA 3HMXL 1MCCA 4I3SL 4L8DA 1DDHB 4GRWF 4MQXD 4NQCB 1LEKA 5FCSH 3U9PH 2BRRL 3N50A 4JFZH 4UDTA 5IVXB 4OCXH 2R0ZL 3PGCB 5B39B 3VFVB 4ZQKA 1MF2L 1KJMA 4Y5XA 4ZFZA 1G7HB 4PB9H 3LEYL 1YEHL 2HH0L 2FX8L 2A1WH 4B5EA 2NLJA 3NIGE 5BRZA 3BUYA 3UTSA 3LKRB 4OGAC 3BH8B 3BW9A 2AK1H 3QJHA 3L7FB 3GEWB 1AXTL 3QIBC 4OIIL 3ARGD 4XP9L 3WHXA 1QSVA 2BCKA 2OK0L 4WU7B 4D9QD 3BQUD 3BZFA 5TQ2L 1SYVA 3QIUA 3JVGC 3FQRA 4P0DA 1RZKH 4HKXB 1AR1D 2V5MA 4I18B 3ULUE 5IOPA 2CLVA 4M9OA 3C2AL 1FG2A 3X12A 4ZTPL 5F89B 1KBGL 4KPHL 3TV3H 5D1QB 1R3LB 5D1ZD 4HHAA 1NBVL 1NMAH 1T4KA 4OQTA 4K3EL 1IEBA 1OCWL 5EZOH 1XCQB 1FVEB 2ZCKH 4P5TC 4MVBC 3FONB 1J9CT 2VAAB 3WFZA 1KIRA 2R0KL 4ELME 3TWCL 2BVPA 4ZFOL 3TYFA 4NJ9H 1EUTA 3QCVH 1A9BA 3LEVH 3MNVA 1MLCA 1JFQH 4GRMA 1UH2A 1M7DB 1P69B 3U7AA 3QXWA 5E4EC 2E7MA 3SKOA 5HI3D 3PWPA 4P5KA 3FB6A 2O5YL 5GRZA 4OB5H 1WZ1L 4PJDE 5KOMC 5IMKB 4JFFD 1N64L 1QO3A 4MCYB 5IB4A 1FLRH 4M4PA 5C0AE 3C6LA 1YQ2A 3NGBC 5DMKB 2WUCL 5I1CL 2GJZB 5FUOH 1BQUA 1F2QA 2HT2D 3GJFB 2JF1A 5C0FB 5DHVA 1KB9K 4L8DB 1G9ML 1JZ7A 1MFBL 2C4FU 1NBZB 1F2XK 1DEEB 1MH5A 1ZHLA 5HVFB 2YPVL 1MFAL 1OGAE 1U93B 5ICXA 4FQIH 4X4XA 1JZ4A 3H9SE 3EYQD 4Y5XB 1MPAH 1V7MH 4XCCH 4MDJA 1S7QA 4LPTA 4QRPA 4D0BB 3CXHK 2MHAB 1PG7W 2NLJB 3H9YA 1MREH 3OR6B 5BRZB 2W0LA 4U6TA 3UTSB 5AAWA 4LSVH 3TNMB 1RUMH 2EDQA 3BW9B 1CE1H 3T0XA 3QJHB 4ZO8A 5GRWA 2CD0A 2OZ4H 3ARFA 1G7JA 5I1EL 3FQRB 2XZQH 2VR5A 1MWAL 1XGPA 4X83A 4YEEA 4XHJD 2BMKB 4JO4L 4JREC 2OL3B 5IOPB 2FH6A 5DEZA 2HYMA 3QR2A 2NY0B 1FG2B 3X12B 3MRCA 1C7SA 1KCSH 2NXZC 3HRZB 4U1GB 4B53A 1MRCH 4ZG1A 1N5AA 2A6DA 3REVA 5ICZA 1RZJL 1R0AH 3VXNA 4HHAB 1T04B 4G9FD 4AIOA 2DL9A 3PUCA 3WKNA 1IEBB 2HKHL 4JRXE 4FQQA 3QPQC 3BP7A 1JNJA 2EDDA 5EU7E 1XF1A 1KIRB 3H3PH 2QHLA 4HW6A 4YH6A 4DGYH 2FBOJ 4FQ1L 2NYYC 3TYFB 1F3RB 1RZGB 3VFWA 3MNVB 1MLCB 1RUAL 4WDIA 1YEKL 1BVZA 2DQHL 5JW4R 1YJDC 4P5KB 2ADFH 2H9GA 1CXFA 1NGWB 3VWJB 5GZOD 1B88A 1WFTA 1HSAA 1YNKL 3PABB 1QO3B 2JCCF 5IB4B 1P2CA 5INCA 3UEZA 2FIKA 3QUZA 4W6WB 3C6LB 1U8OA 1LO3L 1IC7H 2HRPH 2V17H 3MOBH 1OAXH 5HHVH 1KCRH 3U2SB 2NY7H 3VXRE 4LEOA 3RVVD 1IKFH 2XA8L 3QNXB 5DJZA 4NQCD 2JLLA 5I8KL 4RGMC 4AEIL 1MH5B 1ZHLB 2IANE 3H9ZA 3TFKC 1IL1A 5BV7C 4YWGL 1KULA 5HGBA 3GSNB 1EGJH 3MRKA 3MRJB 4ODXB 2WBJC 3OL2A 4YHLL 1KJ2A 3CFEB 4QRPB 1ULVA 4KTEH 4ACPA 1GYAA 4XP4H 4YHNB 2JKXA 3MV11 4L4VB 2FEDC 3ZLQC 2Z31A 1KB9J 3WLWD 1YJDH 4JG0L 5I66B 2OJZL 3I6LE 2WLZA 4K3GA 4JFDE 1P9MA 4NWUL 4R3SA 4YFLF 1YN7B 4U33A 5DA0B 3KHOA 4X6FA 3ARFB 1X5LA 4POZC 3TO4B 3PNWA 5FYJL 4R0LC 3T8XA 1A7OL 4IRJC 1XGPB 4MAYC 3CXHJ 4WW2A 5EU5B 4AL8H 1DN0A 1LO4H 3SDCA 4JFYB 5TFSL 1AKJA 3CDGA 3MRCB 5FUCC 4OCMC 1KIPA 1LEGB 1SYSA 3PHSA 5D1QD 1P84K 3LDBC 5BV7H 2AVGA 4N1EA 3RDTC 1GIGL 5AYUL 5IK3B 5KSBF 2AQ2A 1TZHA 1FZKB 3O8XA 5CD5D 4G5ZL 3HKFA 3Q3GA 4DGIH 4XXDA 1D5IL 3TVMC 3LEXB 3ZE1F 2YD4A 1BJ8A 2BNQA 2A83B 1Y6NR 2XFXA 4JY5H 4RWYH 4OFDA 4WEMB 4M93B 4NN6B 2VDMH 4LBEA 3RQ3A 4YHZH 2KDGA 3V95A 2J8UB 1U3HB 3EW3B 2WZPD 1ZVSB 3ARXA 5HTSA 3MRQA 2FEEI 1GGIH 3TH4T 4YHIA 1ADQL 2R4RH 1PZUB 3I6KB 4DWHA 4HQQL 3IAGC 2MCPH 3UXFA 1P2CB 2DLIA 3DRQB 4UT6H 3QUZB 1DQQB 1U8OB 3ARPA 3O9WA 5AZ2H 1JTPA 3P77B 1XF5A 3TN0C 4C4KO 4LEOB 3DGGA 1FGNL 1SBBA 2ZCLH 4ODBD 4K71C 3VFPA 5DJZB 5EUOA 4YDLC 1U3YA 4LKXA 4K94H 2EC8A 2FSEA 4NZRH 3CLEL 4XVUD 4GW5A 3G5ZA 2VL5A 5MERB 2E7LA 1R5WB 1ZANL 5DVKA 4OLVH 5D7SH 3GFUA 4OZFG 5C0BA 1KTLA 4L4TE 5BRZD 3CDYA 1OOAA 3UTSD 2X7LA 1B0RA 3UC0H 4AG4L 1DQMH 4ODUA 5EBLA 1UB6A 3I3DA 4K2UH 4ONFL 4ORGA 5SWQA 3GI8H 4MNQE 3PL6A 4OM1H 3GMNA 2GSGA 1GGYA 1T7ZA 1RUKL 3CUPB 4F3FA 3QIUC 3PNWB 2E7CA 4FZEL 4U6VL 4K3JL 4NNXA 1RIUL 4JFOB 5FDWA 4HWUA 3SDCB 1WT5C 1AKJB 2DQGH 2NY0D 4HXBH 4NUGH 5HHPA 5EO1A 4M61B 1SYSB 2OJEB 1I8LC 2O5XL 4OLXH 5IMMA 1QFWL 2IPUG 4X99A 1PSKH 5IM7B 1MQKL 5C2BH 5GGQH 4XXDB 2UZIL 3GSXA 4L5FH 4I5BB 4WRLA 2XFXB 3GNMH 2ZCHH 3MRHA 4KH2A 4C54A 1INEH 4D9QE 1LGVA 2DQEL 1WBXA 5FFLA 3EZ8A 3S35X 1UYWL 2BZDA 1SEQH 2XWJB 4QHMA 3MRQB 3RKPA 4Z0BL 3VWJD 1MIMH 4I48B 4GT7A 5L7XL 5KVEH 1AFVL 3LN5B 3C6LD 5LAXB 4QHLB 4M62H 4HX1A 4XWOD 3LD8B 2E7HA 3SCMA 1IVLA 1XEDA 3F7PC 4B7LA 1SMAA 3B6SB 1NEUA 4FQLL 3VFPB 4TRPH 1Q0XL 4KK8C 4M1CD 1IAKA 1FVDB 1IARB 3N06B 1EERB 2R1WB 4N0CD 5L6YH 2NY6B 4OQTH 3WSQH 2FSEB 4ISVA 3QUKA 4GMSH 4HS6A 3TPUA 4YR6A 4GW5B 1DQLL 1JV5A 2EDEA 1XF4A 4POUB 3ZKSD 4BFGA 4GW4B 2VL5B 2W9EH 1V3JA 3KJ4C 4QRPD 2DAVA 4MJ2A 4JO1L 1RFDL 4MA8L 5C0BB 3F7RA 4GQ9H 3T0EB 2H8PB 4HBCH 1A5FL 4L4VD 1CD9B 3KPRA 3S36L 1HEZB 2X7LB 4JFFE 3O6ML 1X7QA 4ODUB 1UB6B 4JM2A 2Q6WB 1A6AB 3DUSA 4RRPA 3PGDA 3VU2A 4ORGB 5SWQB 1JJUA 1BZ7B 1U36A 3G6JE 2QQNH 3GMNB 3ARFD 2GSGB 1FBIH 3TO4D 5F96H 4F3FB 5ACMA 2FBJL 1HHHB 1FFRA 1J1PL 3F7YA 4OZGF 1CZ8L 3FQXA 2P49B 2HJFB 1IAIM 2W38A 5DHVH 1PKQE 3ZDXF 2GY5A 3HUJF 5EO1B 5HHPB 3RWGA 5T1LA 35C8H 4U6YA 5KVGH 3WIIL 3O2VL 4R26H 5HY9A 1IM3B 2COQA 4KZEL 1MHHA 1TTUA 3I02A 4FQJH 1RIHH 4X99B 3S37L 3ZE0E 2VLRA 1E28A 3U7YH 3QXTA 1H8OA 5IHZB 4I3RH 2MMXA 3E6HA 4QHKJ 2DQUH 5FDYA 4K07A 1KIUA 1OGTB 1WK0A 2BY2A 4NRZA 4X6EA 3V7AE 3DLQR 3OSKA 1FVCA 3MRHB 4JHBA 3FRUA 2NPLX 2D3VA 5F7LB 4OAWA 2VJXA 4OUUA 4HKJA 3A6CH 4P2OB 4LQ1A 5JOPD 1U3HD 3UZQA 2J6EL 4I0KA 3VGEA 1V3KA 4DKFH 4PJIA 4F7MA 3MYJA 3GSQA 4LP4A 5KSUA 4KI5D 4HUXB 4K7FA 3KYNB 5DQDL 3MLSL 3OMZA 4G8GA 3AU1A 3PWUB 1NMBL 2VB5A 4G9FE 4HX1B 1K8DB 4S1SL 2X44D 3SCMB 5A1AA 1T80A 4YUEL 5E8PA 1C08A 4PJEF 1A6TA 1IAKB 1J10A 2VDNL 4G6KL 4RAHA 1HNFA 2ICEA 3S3SA 4X4ZA 1G7LA 3TPUB 4HS6B 3GMQB 4WO4B 3P30H 4M6ML 2XACC 2OS7A 2QQKL 1OD7A 2EXYC 2VH5L 5E99L 4R96B 3WXWH 1NCCL 1VEPA 5IHUL 4PJGA 1AIFA 3KPNB 4YHMH 3DMMA 3ZSTA 2Z31C 3QG7H 3QI9A 1Q72L 1MSPA 3G6AA 4JM2B 5E5RB 5F7HA 1LP9B 5B3JE 3BJ91 2C5DC 3OB8A 1A02N 3VG9B 3TYGL 2VXSH 3GGWA 3TGXA 3B8SA 4NQCE 1FHGA 4PGBA 3QJFA 3I50L 4LSRH 3EJYD 4WW2C 3VRLF 4M7KL 3SDCD 1AKJD 1YYML 3F5WA 2GSIA 4JN2A 4MMZC 5E1AA 3RWGB 4JANA 1EEZA 1E6OL 5DK0A 4TQEH 2PETA 3HR5A 2F8OA 1X5HA 1MHHB 4BH8A 3I02B 3OPZH 4MJIA 2VLRB 3O8XC 1E28B 2FB4L 1PX4A 1ODAA 4X6EB 3LVEA 4DGVL 4OF8A 4OAWB 1D5MA 1D5BB 2J7LA 3D9AL 2C1PA 2DQJL 5FA3A 2R39A 4QRQA 1FNGB 4PJIB 3OG6B 4QXGH 4F7MB 5TPWL 1DLFH 3GSQB 4G80A 4PB0L 5KSUB 3FB5A 4K7FB 5KJRH 3RY5A 4ODWA 3B9DA 4QY8A 1JPST 4G8GB 1HHIA 5K9JL 1S9VA 2Z4QA 2VDQL 3PP4H 2H2SD 4NO2A 4WWKC 3L7EA 2DLHA 4WI5A 3PDGA 5E8PB 2XQBH 1OAZL 2NY6D 3E1F1 3OG4B 3U4EA 1I7ZA 3U0WL 1G7LB 2FR4B 3L5HA 4AYFA 3NZ8A 2OSLA 4TUKH 3TC9A 1B2WL 1I1RA 4IIQC 5AWNL 1BMGA 1OTSD 5MI0C 2WWKO 2AS5M 2MKLC 4MXQD 2Y07H 5C0BD 3T0ED 3WUWA 2EC9U 1KCUL 4XMLL 5BOPA 1IGML 1NFDF 3DMMB 1X3DA 3G6AB 2YPLB 4AQ1B 1UWEL 3IRZA 1F13A 1IAOB 4DZBB 5J9PA 3PL6C 5I1GL 1NCDH 1AQDB 1EJOH 4FQXA 1YPZF 3UJJH 4P4RA 3GGWB 4D8PB 1AGCA 3QJFB 1QTYT 3MR9A 4WI4A 3Q5YA 4DK3A 3GMMA 3F5WB 3O3DB 1M71A 4JANB 1EEZB 4RISL 1YEFL 5DK0B 3HR5B 2HT3C 5E2VH 4LGRB 5BRZE 4BH8B 5GS0C 1ITBB 3VD7A 4NZDA 5TE4H 5IP4A 4NYLB 3BX7C 5T3ZD 1N6UA 3U0TA 3LZFL 4NKQB 4PRIA 3VI3F 1KCKA 1GL4B 2Y5EA 2Z92A 4ONOA 3FT3A 2NR6D 4P2OD 3N1PC 1OF2B 2C1PB 2I07A 1U92A 4Y4FA 1RJLA 1RV6X 3BE1H 5CS7A 4YIQB 3IU4L 3MA7A 2R2BA 1NSNL 2WBKA 4MX7A 4KKNA 4ODWB 3OGOE 4IBLT 4QY8B 2FRGP 1RHFA 3DETD 1UM6H 1S9VB 4MD5A 3LAFA 3MJ9A 2ICWA 2CMRH 3IFLL 4NO2B 2AJZB 2V2XB 5E2TH 5JXEA 3MLTA 1Z5LA 2FO4A 2I60H 1I3RA 4GRLA 1BFOA 3U4EB 3CLFL 5C0ND 2Q8BL 5GS0H 5SWSA 5B39G 4WO4D 3LMJL 4PJHB 5T5NG 5FOJA 1KCVL 4X7FC 1H3PL 5J12C 3V0WH 5T3ZH 3HS0A 4MMXC 1VGEH 2IWGA 3TJEL 4NZTL 4F57L 3MV7A 1RJZA 3EO0B 4GG6B 1PQZB 4F37K 2J8HA 4JM2D 4QF1A 3P4NA 1CU4L 4CVXA 3NPZB 2BK8A 1JRHI 1ZLWH 4I2XA 4WI9A 3RPKA 5IG7B 4FQXB 1C5CL 4P4RB 5DVNA 4NGHL 4BZ1L 2MQCA 1AGCB 4O9HL 2PCPB 1DQTA 3UJTH 4LMQE 1RI8A 3MR9B 4CRPA 4KK9C 4OFKA 2JE8A 2B4CC 3H0TB 4E41A 2HG5B 5IWLA 1F45A 4FFYL 3OXRA 2HWZL 3MOAH 2YUVA 2AXGA 2FGWH 3MX0A 2AJUL 3D6GA 1QNZL 4R4NC 4KTDL 1MRDL 3C5SA 3OKMA 2VLRD 3QRGL 2D9CA 4L4VE 1N5YL 5DJDA 1E4XL 4F7EA 1MELA 1L7IL 2V9QA 4MDIA 3LN4B 5L9DL 3HHRB 2OP4H 2VNCA 3KXFD 3MUY1 4KDVA 1CXKA 4OD1H 4EIZC 3U0TB 1NLBH 1IM9A 4PRIB 4Z7QE 4O00A 2Z92B 1JWMA 4KK6C 1ZTXL 1U8IA 2DWDB 3ULSB 5FXCH 1FZOA 3VXQA 3SKMB 2YKLL 4JJHA 1KNOB 3MA7B 2R2BB 3E2HB 4GOSA 4HS3A 2GTWA 2JK5B 4L8SA 4XBEH 5L8JB 1DQDH 4XNUH 1FLTX 4K7PL 4G8GD 2OYPA 3V5KA 5I30H 5JLZA 2ICWB 4XCEA 1MHPL 1I1AA 1DFBH 5J89A 3SE3A 5D7LE 3KVQA 3S7GA 1QBML 3DYPA 1EHLH 2FO4B 4YXLL 1I3RB 4GAJH 1UXWA 4GRLB 1BFOB 4X9GA 2N4IA 2XTJC 2ZSVB 5SWSB 1YN6B 3QUMA 5D96C 5ILTH 4O2FA 2W65A 5DRZA 3AS3A 5D71H 1DVFB 5D7IA 5EU7C 1LNUB 1NFIB 1OW0A 2H6PA 2J8UE 1UCBH 5JOPE 2BNRA 1JHKL 4NKIH 2WWMD 1F6LL 4EVNA 5F3BA 4KI5E 5I18H 3DMMD 3NIGF 3QI9C 4X6BA 2LV4A 2YPLD 3BJLA 4CVXB 2D03H 4LCIL 4P3CH 1YYLL 1T3FA 4I2XB 5EFIA 4M7LL 3WJJA 2NY5L 5DSCB 1JMXA 4P4KB 2UZYB 3IJYA 1UC6A 4XTRC 4F37F 4U2ZA 2XI9A 1MRFL 2FJGB 3P0VL 1EFXB 4NJAH 2RIKA 3MNWA 1H8SA 3OXRB 5IW1A 1M6OA 5FYLL 3ULUF 2XZZA 1A1OA 1IAIH 4N0UB 4HK3N 3NCYS 3KLHD 3EOYG 3P2TA 2C1OA 3C5SB 4LVHB 3VWKB 2ARJQ 4HGWA 4Q6YA 4MDIB 1EX0A 4PD4K 5BZWB 3U46A 5GGRA 3OKEA 3GMLA 4E42A 2PKDA 1V3LA 1IM9B 1G7MA 1CE6B 4NHUB 3TBWA 4IRZH 3LKOA 4X6DB 4GMTH 4H0GA 1JWMB 4U6HB 4XC3L 2EKJA 4ELMF 2VLKA 4MNGA 4ZPTA 1BZQK 5ANMB 4WI7A 1MCIA 1VACA 1U8IB 5B8CA 4IDJL 5DMYA 2BY3A 1FZOB 5JQHC 5LWYH 1S5HA 3QIWB 4X6CB 4QT5B 4C4KT 2GTWB 2IPUK 4PJDF 5JLZB 1E6JL 4XCEB 2AW2A 3AMLA 4YBLB 3ARVA 5FKAA 2HLAA 3VGBA 1ZEAH 1AE6L 3FTGA 5EORL 3VDCA 4S2SB 1UXWB 3BXNA 2ZNXA 1E4KA 2G60H 5HHXL 3WIFB 4C59B 2CLRB 3CX5J 2NY4B 3MROA 5EC1A 2ZUXA 3EOTL 2ZUQB 2W65B 5DRZB 5SWZB 3RVUD 1KLGA 3AREB 1LHZA 1OP5K 3KR3L 1PD6A 4ONGH 4JZOA 4JFEA 3Q5OA 3W11C 5ISZA 3C87A 3WFCL 4ZS7H 3DROB 5FB8A 5F3BB 1FDLL 3QXAA 4W68A 4HUUB 4ODTH 1PX3A 5CMAA 5KZCB 4X6BB 2BXZA 4HC1L 2QADB 4PREA 4PRPB 4R2GC 4UINH 2YZ1A 4WNQB 5KVDH 1KFAH 5AZEL 3QEHA 4FQXD 2LU7A 4HIXH 4EXKA 1GRWA 5GJTH 1A9EB 3BT2H 2ZKHH 2XV6B 3GUTB 4WW1A 3VFSA 4HKBA 4FFZH 3S35L 1F4XH 3VA6A 1J88A 3C5ZB 4Y1AB 4GG8B 3MNWB 5I73B 5HDQL 4CNIA 1QR1A 2C3GA 4K8RC 1TJIL 1ZT1B 1YEEH 4MQSB 1NC2A 3FQNB 3V6OE 4HXAH 3T0EE 2DIJA 4BJLA 1IGTA 2C1OB 2Z93B 1F02I 1GZQA 3PWLA 3U46B 1VA9A 3GMLB 3BZDA 5HHNA 1D5ZB 4PRID 4BFEA 4Q9CA 2NY1C 1NMCC 4ETQA 1N7ML 1G6RL 2D0GA 3FQTA 4ZPTB 4IM8A 1CFTB 3QWOA 2EDKA 3QG6B 3UPCA 4WHYH 5FUZL 2XKNB 1DANT 1VACB 5B8CB 3BRFA 3X13B 3I9GL 5CBEB 2HTKD 4Y4FC 2EICA 1S5HB 1IGCH 5J4MA 2LFGA 4XNYH 5EU6B 5FHAH 5FK9B 1YEIL 2YWZA 5HXMA 3QUXA 1MVFA 4WY7L 2O93L 4NRXA 3MUJA 5E8EA 2DQCL 5FKAB 2HLAB 5GGSB 2A73A 5JXEC 5C0DB 1CGYA 2NTSP 5EOTA 3HZYA 3IFNL 3PWVB 2X1OA 3RUGA 4GRLD 1BECA 2EZ0C 2APTA 5T3ZE 5SWSD 5I75C 5CFHA 3A6BH 4AMKL 3FT2A 1X5IA 3V4VL 4O5LL 1JE6A 5GQBA 1DVFD 1TETL 3CC5B 2DM3A 3OX8A 3MV01 4JZOB 4KZDH 4JFEB 4RMQA 4XVSH 1JP5A 5F7NC 4Z7VA 1CFVH 4ODVH 5ESQA 2UYLB 1BQHA 5IGXH 1YZZA 4WV1B 1IQWL 1OTTD 5EN2A 3TP4A 5DJAB 5ALCH 2PTVA 3QEHB 1MVUA 3L3DA 4P4KD 3OGCA 1BF2A 3MJ9H 3ULVC 4HIHA 2WMPA 5CEYA 1EFXD 3T77A 2CJUL 2R0LH 1FNSL 2WQ8A 4LP5A 1ROWA 1FJ1A 1DBAL 4RMTA 4GW1A 1INDL 2Y6SC 2F5AL 2VDRH 3VWKD 1DLHB 1Q9LB 1UXSA 4AJ0A 4OCYH 1GZQB 3O3UN 5J1SC 3PWLB 4YDKH 3CFKB 2BDNL 5EIIA 5DR5L 1LP9E 1I8KA 3Q1SH 4PG2A 1IM9D 1I3VA 4YGAB 3QXDA 4GAYA 43C9B 4PJBB 1CLYL 3SGJA 1VFBB 3LQZB 3L3IA 2ITCA 5F7WC 2Q3ZA 4ETQB 5DDHB 4JEGB 4PG9A 5I15H 3WNKA 4H5SA 4JLRB 3BMWA 2QQLH 1XF2A 3WEXA 4KRPB 2JJSA 3O0RH 1DUYB 3VXPB 2HT2C 4P2YA 3OB0K 2DMKA 3P3YA 3ULUL 4P2RB 4ZFFA 3QIWD 5BJTA 3F7VB 3VD9A 2DIAA 3DX7A 3ULVH 3GMRB 4FQPA 2ERJB 3LQAH 4NUJA 2GQHA 4UOW0 3QUXB 1I1AC 2P5ED 5E8EB 5LQBH 2R56H 4N1CA 2A73B 3O45A 1JZ5A 3SE3C 5KW9L 1WZLA 3RTQA 5EOTB 3OKLA 2VLRE 3HZYB 3EYQC 5BS0A 2VRAA 1JPGA 5DUMH 3QO0B 2WUBH 3KXFE 4N68A 2AQ1A 4OCWL 1JPSH 5HVGB 2NY4D 2IQ9H 4KQ4H 2XY1A 4WEUD 5DZOA 1TXKA 1BIHA 4NCDA 3AMKA 1F3JA 1EK3A 1U6AL 4OZIA 2VDKL 5SWZD 3RA7H 5FHBH 4LLWA 5EZIH 5HDBE 3ARED 3OX8B 4P9ML 5CEXA 3UPRA 5FA4B 2P48B 4N5UA 4IS6A 1MOEA 3QT2A 4O2EA 4Z7VB 9CGTA 4JAMA 1OPGH 5FO9B 1YMME 1BQHB 3L3HA 4PJXB 5EZJA 1SJVA 4G8GE 1GAFL 1URLA 5KZCD 4ZUSB 2O61A 5JDJA 2QADD 2IALB 3HAEA 4PRPD 3BP6B 1S7TA 4LDLB 2C7UA 3MOQA 4O2CA 5EN2B 2BY0A 2B4CL 3WJJC 1KB5A 4XMKL 4MA7L 1N2RA 5CEYB 4M43H 5CGYD 3C5ZD 3S3PA 3L3OA 4Y1AD 5E2WL 3H9HA 3RPIA 1KYOK 5DJ8B 4FTVB 2QHRH 5CBAB 1FJ1B 4OLWL 4GW1B 3MACL 3QUMH 4HJGA 3MRDA 4XZUA 1U0QA 1QP1A 3QO1A 1IAMA 4FN0A 2LAAA 5IEHA 5HHQA 4PV8A 2D7QA 1LD9A 3C8KB 4R8WL 2R9HD 4M5YH 3FMGH 2GJ6A 2YPLE 5EIIB 4PGJA 1I8KB 2VXTH 4GAYB 3QSKB 4EI6B 1MFCL 5CJ5A 1ZLUH 2ITCB 3UTTA 4PG9B 2VWEC 3EO9H 1XF2B 1U8NB 3WEXB 2R8SH 1K85A 4BQ6A 1WC7B 1T7XA 4Q9QH 5GHWH 3KS0H 3WFDH 3QCUH 3RVVC 4ZFFB 5BJTB 2R4SH 2I25N 4D9LH 2PN5A 5EU6D 4Z78A 3HR6A 2BRQA 3BEWB 5JQ6H 5GGVL 25C8L 4NUJB 4BK5A 4UIMA 3VH8G 4JCMA 4CN4A 3BPCA 3S97C 3UJIH 1C1EH 3HFML 3ARDC 1GHFL 4ZOAA 1JPGB 2AAVA 4KMLB 3FAXA 1OAKH 4NP4H 1GOHA 1YECL 3NA4A 4PP2A 2X4OA 4Q9BA 2WWKT 4KY1L 2P4AB 4XP5H 4OZIB 4CAGA 1CK0H 4QYOA 1LEIA 3HZMA 3O4OB 3QPXL 3UPRB 5ETUB 4JFED 2F19H 4DOHB 3RX5A 4LSQH 4IS6B 5JPMA 1RD6A 5A2LH 4O2EB 2V9RA 3T09A 1JIBA 4JAMB 2ZNWA 1G7PA 4EXPX 2O61B 3MLRL 3QDJA 3W2DL 4D9RD 4QHUA 1JZ8A 4O2CB 1FQ9C 3BWUC 2ZPKH 4JG1H 1IC1A 1QSFA 4NNPL 3G6JF 3SO3B 2X4PA 5DJ6A 2KKQA 1N2RB 2ZJSH 4HUVA 4MSWB 2MSPA 3SQBA 2Q8AL 3L3OB 4PJHE 3WIHL 1JZ3A 3RPIB 1J1XH 3RWIA 3LRSA 3LSOA 3MRRA 2Y9RT 3EYSH 4RGNB 3QO1B 4UU9A 1LMKA 3GBML 5DK2A 4YJZL 1RU9H 4EIGB 1A64A 4ODSH 4GG6E 1NDMB 4Y5YC 4LSSL 4OTXH 1NANI 3BMVA 2VC2L 5JW5B 1JNHB 1PDKA 3EFFA 5EO0A 3ZE0F 3KDMA 1S3KH 1UA6H 5IT2H 3UTTB 3MLXL 1GJIA 5F70A 1KYOJ 3UAJC 4Y5VB 4LSPH 5GGUA 1SHMA 1WBYA 4KRPD 1KPUB 4N1HB 1X5YA 4P2RD 4U05A 5HDOA 1A14L 12E8H 4YZFE 1QBLL 1CF8L 4HFUH 1J7VR 4Z7OE 4NM8H 3HRPA 4KWUA 5TQ0L 4OLUL 4UIMB 3QUXD 3AM8A 3CCHA 4XVUC 5A43C 1EMTL 1SM3H 1MCJA 5ADOL 3MRPB 3O81A 4K3DH 2APWA 3KYMA 3GI9H 3KS0J 2V5TA 5H94A 5J13B 3PQYA 4QXUH 2YD8A 2NQCA 5HPMB 4PP2B 2X4OB 4PRIE 1MUJA 5ITFB 3MODL 3UO1H 5I0ZA 3H7LA 3BWAA 3X3GH 4QYOB 1LEIB 2F5BL 2GIYA 2QSVA 3JWNC 1H8NA 4U1KA 4EI5C 4YFLI 1FIGL 4YNYB 3GJFK 4PJAA 3S88H 1G7PB 5DMJB 3QDJB 3UYRL 2CKNA 4J3SA 4RX4D 2Q7YB 5MENA 2V2TA 3GHEL 1HH6B 4GQPH 2NY0C 1CGSH 5D1XA 1FNHA 2J8OA 1KENL 4NO0A 5D6DC 1JK8A 5B3JF 5CZKA 4FFWD 3AUVA 5CHNA 4YDIH 4L9DA 4HUVB 5SWSE 1TVHA 2A1WL 2DBLH 4IJ3B 3SDYL 4FTVD 4EQ2A 1NAKL 5CINH 3LSOB 3MRRB 1EBAA 1J18A 4IMKA 5I71B 3KLSA 3MSPA 3R06A 4KKCC 4UU9B 3CVHA 3X14B 1S9YB 1UT9A 3CPLA 1BEYH 3ARQA 1L0YA 4PJ8B 4U1MB 1EA9C 3D18B 4HT1H 3IT8D 1RZKL 4NQDA 5EO0B 4KKAD 1FH5L 4HH9A 5CKAA 4H20H 5ADPH 2BJMH 2PR4L 1MHEB 3SGJC 1I85A 5GGUB 2H2PD 4UB0L 2H41A 5DD5L 4I1NB 5HI5C 4ZFGH 5FEBA 3TV3L 3WO4B 4G6FB 3TZVC 1HINH 4Y19A 4CN1A 4DN3H 4FS0A 4A6YB 2QR0A 5LBSL 5I1DA 3IFPA 3QQ9C 3VXSA 2H1PH 2ORBH 4N0CC 3OKNA 4N0UE 3CCHB 1HSBA 3VFGH 3FO2A 4KQ3L 1PG7H 1RK1A 2PF6A 3MLWH 3NCBB 3LEVL 3RTQC 1G1YA 1R3KB 5H94B 3BD5A 3PQYB 4APQA 2Y1VA 3VXTB 4G6AC 5BW7A 1I3UA 3NPSC 4XCFH 5I17A 1MUJB 2X4UB 4X6DE 1S7XA 4PY7A 2F54A 3BWAB 4UDUA 3CZJA 1JTTA 5A2KH 5ANME 4NC1E 1PLGL 5C0GA 4U1KB 5C09A 1HIMH 4TTGA 4X6CE 4TSAH 4U2YA 3GKWL 3TO4C 3D3VA 3LS5L 3WJLA 2WIMA 3EFDL 4Z7WE 4JVUA 3ARBA 5EA0L 5CD3A 3LPWA 2CR3A 1FSKC 2YPKA 5MENB 1YDPA 1ZMYA 2P5EE 1BM3L 4Q6IC 4X9HA 3ZDYE 1QSEA 5D1XB 3BPLC 3C8DA 1JK8B 3X17A 4NC0B 1RJYA 4R7DB 2IAMC 2FJFB 5IFAL 4G9DB 4KVNL 2ATPA 3VXUB 4GXUM 1TVHB 4JB9H 3DXAA 1BD2B 3DVIA 4HCRL 1HILB 4CJ1A 4PP1D 5SWZE 5CILL 1E27A 3VW3L 3IDJA 1V7NL 2CGRH 3QULB 1TQCC 2AXHA 4RGND 3R06B 1MFNA 4WENB 5MP6L 2I26N 4XRCA 1QSZA 3CVHB 3IXAB 1N4XH 4G3YH 3BGAA 4BQCA 3QWRD 3IKCA 4ZPVB 4YBQC 2X9XA 1U3HC 1FE8L 4NQDB 4NT6A 2UVFA 2HN7A 1TJHH 4PRPE 3L5IA 4HH9B 5C8JB 5GISH 1OAYH 3O3BA 3UTTD 3T3ME 2D7MA 4ERSH 3GIZH 2F58L 5AUMA 1U91A 5JIIA 1K3IA 3HAEH 3UTZB 1VFUA 4RZCA 2FIRT 4S1QH 1KLFA 7FABL 1I8MA 4Y1AE 4EQ3A 3NFPB 4UOJA 4OCLC 1F8TH 1T1ZB 4E5XB 4P46A 3QP3A 1YC7A 5FF6B 3MRNA 4P59L 3OKNB 5I6XC 4LLUB 2PXYA 1EO8L 5DVLA 1WEJH 1MHCA 1JNLL 1T0NA 4XB7A 1S7WB 4M6AA 1R3JA 3CMOH 4LAQH 3TT3H 4APQB 2ADFL 5I17B 2F8XC 3F12B 3C5JA 1S7XB 4NKDB 1YNLL 1FG9C 3ZYIA 2F54B 3QAZC 2XWTA 2ZUSA 4S1RL 1J12A 1JN6A 3ECBA 2LQRA 2FECI 3INUH 4UV7H 2WP3O 5D9SB 1GOGA 4JFPB 1K8IA 4ZUWA 1NGZA 4K7PY 3UP1A 5EU6E 3WNLA 1MJUH 4KJWC 1AI1L 4XWGH 3QDJD 5CD3B 4JRYA 1FL3B 2C4XA 2YPKB 5BVPH 5GS2D 2MKWA 4NNYA 2GHWB 2V5SA 3TPKA 1RJYB 4EBQL 3MCLL 3D1MC 3MV8A 3S5LB 4PGCA 2R2EA 3DXAB 4YE4H 4L1HA 4KTEL 1TJGH 5IB5B 5DHYA 2R0WL 3QZWA 2JJWA 1N0XH 2BSRB 3VRJA 3BVNA 3MV9A 1XR9A 4I3GA 4JFEE 3G08A 4C56A 4PUBH 4JR9L 4XRCB 5I9QB 2HRLA 1UM4L 4XC1L 4PJ8D 3IKCB 2HT4D 4GJTB 4DQOL 4D9RE 3JWDC 3L1OH 4EOWL 3K2UH 4MB4A 4RDQG 4I4WB 2J4WH 3Q6GL 5CP3A 3L9RA 3VXOA 1BZ9A 1U91B 4K23H 3DVGB 3OF6A 4Z7QF 3P0GB 1XR8B 4LPXA 3BH9B 4JHWH 4PR5B 1E4WL 4G6FD 5DI8A 2RAMA 1SBSH 2H3NB 4XP6L 3IB4A 2YD7A 3KLDA 4XPBH 2B2XL 1YNTB 2DQIH 1WLHA 4ZD3H 3MNZB 3AM8C 3R0NA 1H5BC 4CMHC 2DS4A 2YBRA 1D5XA 2CKBL 5CJQH 2PO6A 4NZUL 4H1LG 1T0NB 3U4BH 1G9NL 1UJ3A 3PQYD 3JUYA 1R3JB 4HKZA 5LCVL 3V6OC 4ENEC 1CG9A 3T0EC 4PJBE 4FZ8H 4ZSOA 5T5FL 1MCPH 3KLAA 5H35B 2R23B 4PJFA 3FJTA 4H8WL 1F4YH 2XWTB 2VDPL 2R4RL 2HFEA 3QYCA 5I1JH 4JQXC 2R29H 2MCPL 5DJ0A 4BKLA 1S8DA 4U3XA 4KHXH 3VFTA 4P2RE 4RSVA 2CPCA 3HMWH 2J8UF 4LFHD 3RY4A 1ITCA 1T20B 1TCRA 3CFJA 3O6KH 2YMXH 5IUSA 2AJ3B 1A4JB 1NCBH 5J57B 5DJ2B 3FO1B 4JRYB 4EDXA 5MEND 4KI5F 5J1AA 3WV0A 4NNYB 1RZFH 3VFRA 5D1XD 1NL0H 1A6WH 5I8OH 5DFTA 1FO0A 1PGRB 4JPKL 3VXUD 3MLYH 4P2QB 4PGCB 3LKSA 1BD2D 5JHLH 3VE0A 2ZSWA 4CW1A 5DHYB 2CDGA 3QZWB 4NQSA 1C16A 3TA3A 4Z95H 2EIZA 3HC0A 4RA3A 3VRJB 3D87B 2VZUA 3NFSL 3PWNA 3SHSA 4OGZA 4Y16B 3G08B 4NM4H 4Z7VE 3RY6A 4PJXE 3GSVA 4OGXH 4PJCA 2FWOA 3N85H 2E6QA 1Z9SA 3TBYB 1MY5A 4U1IB 1NAMA 4HXBL 1MLBB 3F6LA 3S98A 1LO5B 5DI8B 4YX2L 2JELH 2A6KB 1N8ZB 1N6VA 5EPMA 3OAZH 3H7BB 4DFHA 3P4MB 1YUHB 4FTVE 2R1XA 4R4FH 3Q6FA 4KKLD 3MLZL 4UQ2B 3NA9H 3SDXA 1BF8A 5F7KC 3W9EA 5EOCH 1D5XB 4L5FL 5EUKA 3QNZB 2B1AH 5I74B 5IHLB 4I13B 3RZCC 4HKZB 4APQD 3JTSA 4X0KA 1Q9OB 3JV4A 4RQQA 5BW7C 5DJYB 3CVHH 1CG9B 2XZAL 4TSCH 1FFOB 1KGCD 3KLAB 4PJFB 2F54D 3ARTA 2IPTL 4LVNB 4XPHH 5H2BA 4PY8J 1ZA3A 4D3CL 2XNAA 1ZLWK 3BSZH 4YXHL 4BKLB 2OL3L 4UOW1 4G8IB 4E9LA 3DGCR 1WWWX 4N90D 2W9DL 2D31B 3WJLC 4MB3A 1HKLL 1U95A 4EDXB 5F72S 1ZLSL 1K4DA 2PTUA 4B41A 1IT9L 4XNXL 1GGCH 2VIRA 3ET9F 1T03H 4I0PB 3SPVA 2CUMA 1HHKB 4FABH 4XPTH 3LKSB 2IH3B 5IQ7H 4JFXA 5DJXB 3ZKND 1B9ZA 3EYFA 4OCRL 2P8LA 4CW1B 4NQSB 4TUOA 4OZIE 5FM4A 3TA3B 3HC0B 3HE6A 2V7NA 3ZTNH 3HI5L 4ONHA 4DOHE 1LE9A 1T83C 1Q38A 4R90H 2WW8A 1Z0MA 4TVPH 4U7KA 1S7UB 5I1KH 1T89C 1M4KA 1ONQA 1KTKE 5F96L 3WHE0 3GSVB 4PS4H 4ZTOH 5HVHB 4PJCB 2FWOB 1OHQA 5GZND 2BNUA 1MIEL 3VGDA 1KTRL 2X89A 4O58H 2DQTH 2QSCL 1NAMB 3KPLB 5DMIH 5D8JL 3SDDB 35C8L 3AAZB 1DBJH 2VXUL 2GY7B 2I9LB 3D85A 4K3HA 3GSNL 2BVEA 3TJHC 2ATKB 4LQFH 1AJ7H 1RIHL 2R1XB 4R4BA 4P46C 4U1HA 4I3RL 1JPFB 1JPTL 2LTQC 1UACL 5DEFA 5ENWB 3SDXB 5FKPA 3M8OH 3W9EB 2OXHA 2FX9H 1QKZL 3DSFH 4RGNE 2PXYC 5EUKB 4KC3B 4J3UA 3B2UD 5TF1L 1J05B 3A6CL 4X0KB 3SDAB 2EYSB 3JV4B 2YUZA 5DLML 5I76A 3HCVA 1G7QA 4WTWA 5JUEL 5H2BB 4HD9A 2XNAB 2EIDA 4LEXL 3HMXA 1ZSDA 4ZS6D 5F9WC 2CDFA 2XWBB 2XPGB 5IVZA 3ELAT 4YHPA 4OCNC 4JRYD 3IDIA 4GS7B 1AQKL 4HJJL 1PY9A 5HPOA 4ALAH 4YDJA 2EIBA 2IADA 1I3GL 3VA2C 5I8CB 5F9OH 1T0MA 3O6FA 2NX5B 3BP5A 2DMCA 4P2QD 1ZGLP 2GTZA 3HE7A 2APFA 2YC1A 4I8DA 4JFXB 3EYFB 5D6CB 2HFFB 2ESVB 4TUOB 4M6OL 5E1HB 3HE6B 2V7NB 2VERN 4ONHB 4J6RL 4UBDD 3NMEA 2QSQA 4X98B 3GMPA 4Y16D 3ARUA 2YSSA 5GRUH 5C0RH 1X4YA 2D7OA 5JNYB 4IRSA 2B0SL 3DIFA 4MYWB 1ONQB 1RZ7H 1XGYH 2VXSL 4LCWB 3QDJE 5F1IB 5GSVA 2Y06H 2BNUB 5T3XD 2FX7H 2F8VA 4LSRL 4JM2F 4HLZG 4N8PA 1LP9F 1IBGL 3C09B 3P9MB 5J11B 3MRIA 3VGAC 3QHFH 4X5WA 1J0IA 1IC5H 2GJJA 2CXGA 2VZVA 3MRMA 3QDGA 4ZFOA 5K9KA 3FCTA 5MEOB 1ZT7A 1LK3L 2GCYA 5JR1L 3E3QE 5FKPB 4DEPB 4HIEB 2LABA 4QO1A 2D7TL 2PO6C 4U1NB 1QBAA 5AD0B 4O02L 5TDPA 5HGAA 3RVUC 3V6FB 1UJ3C 2RFXA 5HI4C 1CBVL 3N9GL 3UCRA 5IB1B 1IGJA 2JJTC 4NQXA 4KXZI 2CK0H 1W2KT 2YEZA 3CSPA 3SQOL 3MPCA 4YHYC 1WAAE 4OGYL 4RA0C 1JF1B 4PJ9B 5T3XH 3R8BB 4XVJH 3MLUL 5CP3H 2ZP0T 2DB8A 3SOBL 5IVZB 3L3GB 5DD6A 1DANU 4WTZG 1H9VA 4YHPB 4LVOC 3LB6D 1J1OL 4RGOH 5EIQA 4LLVA 4RFOH 5B38A 3HPJB 1LO2L 2FEEL 2IG2H 4LRNH 3O2DL 3DRTA 3FT4A 3QEGH 1RHHA 4I0PD 1RMFL 3HZVA 3QFJA 2MJWA 4GKNA 1T0MB 3O6FB 5CEZD 3PQYE 1RUQH 2WV3A 4PLKD 4R9HA 1R5IB 3HE7B 5KS9B 2YC1B 4XI5C 2F53A 3IXTA 1W72L 4FQCL 2AEQH 3RZWA 4HUMB 3FFCD 4KDTA 1F90H 3L3JA 1JHTA 5I1LB 1G84A 3TA3D 1CXEA 1S9WA 3MBXL 3WL9A 3X11A 2GK2A 2R1YA 2EEAA 3KJ6L 3JV0A 1T5WA 3GMPB 2MCG1 3JWDL 2X1QA 1CGXA 1I9IH 1MWAA 2YSSB 5F9JA 5KN5A 2EYTA 1NCDL 4R97C 3OKDA 5HYSG 2HAZA 3RY6C 4XAWH 2EXWC 3S34H 2GAZB 3VCLA 3HC4L 1I1CA 4PTTA 4JKKA 4WCYH 1MFEH 5ESAA 4Y4HA 1H3XA 2HTKC 3G5VA 2AV1B 5T1KA 3HZKA 4F58H 1RY7B 1BFVL 3CSBA 3SDDD 3VXUE 1SJEA 1AO7A 4GSDH 2FD6H 3RWEA 4GAGL 3VMOA 4XB8A 4GUPA 1BD2E 5K9KB 3FCTB 5EBGA 5CEZH 1EDQA 2GCYB 3D0VA 4O4YH 2V5YA 1J0ZA 1VGKA 1HXYB 2O5ZH 4NKOA 3VFNA 5F21B 4P9HC 3OKOB 2P8PB 3QQNA 3V4UL 4F15B 5C0CA 1Q0YH 5HGAB 1ORQA 2KUTA 2HJKB 4PGDA 5HBBA 3SDAD 5IFHH 2FLRT 1IGJB 4NQXB 3TESA 4LNRB 4U6XA 2CRIA 2YEZB 2DDQH 3BE1L 5HGDA 1T7WA 3QEUA 1OM3H 3BGFC 4HF5L 5C2UB 5FO8A 2IC2A 1CLZH 1TENA 3RWDA 1T2XA 3WNOA 1NAMH 4Y4KC 3DO3A 5E2TL 2BERA 5E8DL 3ZZ1A 1MI5B 4QOKA 4KRMB 4LLVB 3QDMA 5CJOL 4UAOC 5CAYB 3DRTB 3S4SA 5JXAH 1CD1A 5F7MC 5CJBA 5SX4I 2OBGA 1BVKA 1JRHH 4M8QA 2NX5D 3V0WL 2W1NA 5E08H 4FQHA 4TNWK 2MPAL 4DCQB 1CDGA 2UUDH 4HPYL 1KGCE 4O51A 1QLRB 1KT2B 3L3JB 2ESVD 3EAKA 1BOGA 3MUGB 1S9WB 3HE6D 1NCWH 3WL9B 3X11B 3BN9C 1SY6L 4PJHF 2B5IB 3E8UL 1T5WB 5K9QG 4NPYA 1O5DT 5K93A 1L7TH 1MWAB 2EYTB 4HUWA 1Q94B 4N5ED 4NKMA 4N90E 4TN9A 1BGXL 43CAA 4OLZH 1X5KA 4LCWD 4PV9B 1F3DH 4GG6F 1OAQL 3OKKA 1QUNA 5KTEL 3EBAA 4Y4HB 3RVTD 3UJTL 5T1KB 3NFNA 1XGTB 1FORH 3GO1H 4G43B 3P0YH 1PBYA 2BOBA 2PW1A 4RBPH 1SJEB 4TUJA 4NQEB 1XIWA 4GUPB 1CLOL 2XN9B 3P73B 2DI8A 2B8OT 3FOLA 4YZFF 2R69H 4NKOB 1INQA 4XPFH 3FQUA 4Z7OF 4X4MA 4PRAA 1UWGL 2PYEE 1J5OH 1ORQB 4R7NA 1CL7L 1ADQA 1U9KA 3AREC 4PGDB 1HK6A 5CLWA 1PJ9A 3W5NA 4I77L 4U0RB 2WP3T 1IGFH 2PW2A 2AV7A 3LH2L 2EKSA 3GIVA 1KIQA 4PJ9D 1IRAY 5FO8B 1QFWM 3M1BB 4ZUTA 3RWDB 5CP7A 4MQ7A 5EWIH 4LFHG 1OARL 3V6ZA 2CDEB 3U1SH 1IGYB 3P9LA 1F4WL 3QDMB 3I3EA 1ED3B 1CD1B 3LRHA 2E27H 5CGYC 1FFQA 4XPGL 1EAJA 3REWA 1MCQA 3OJDA 3B9AA 1TPXC 3O6FD 5D71L 4FQHB 1ZLVK 1C5BL 1UCBL 3HE7D 4UT9H 1A3LH 2OTPA 4EUPA 4HJ0D 5C92A 5CJXA 5C0EB 3BIAX 1BOGB 4NN5B 4YGVA 1ZLUK 3CXDH 3MMEA 3UBXB 5DZNA 3CSYB 1X5AA 4NPYB 2AABH 1Q1JH 2V5RA 4P3CL 4HUWB 1Y18A 4TNWF 3N1QC 4CUCA 4NKMB 2HKFH 4IRSC 3HMXH 4I3SH 43CAB 2J2ZA 1RVFL 3IETB 5LXGH 4JRYE 4LGPB 2ADIA 3LKQA 1XF3A 1B0GA 3OKKB 2BRRH 4X5XA 5E8NA 4K9EC 3OAUL 1JI2A 3NFNB 3U48A 1JGVL 2R0ZH 4BQ8A 2UVEA 5BOZG 5J06A 1MF2H 1RIVL 4KK5D 3BGMA 4P2QE 1L0QA 1YEHH 2EC9T 3CU1A 2X41A 5I1HH 1KUMA 1UGNA 3IFOA 1INQB 4IOIA 1QFOA 2BHYA 3FQUB 4OIIH 3NCJH 2OK0H 5L0QC 5TQ2H 4R7NB 3GRWL 3K2MC 4L9LB 1EHAA 3CFCL 2HVJB 3SE9L 1QBBA 3SJVB 5T3XE 2EKSB 3OJ2C 3C2AH 3PWJB 3GIVB 1P7HL 1S9XA 5CIPB 4L3EB 3UROR 4ZTPH 3NVQA 1K2DB 4PJ7B 1KBGH 4KPHH 4X6DF 4HWZA 4RDQF 1GC1H 1F58L 4NQTA 3ZT7A 1NBVH 4ZUTB 1F11B 5IMOA 5C07A 4L3CB 4MQ7B 4HS8L 8CGTA 3BEVA 3U83A 1OCWH 5FV1L 1A7PL 1I9JL 1MI5D 4XNMA 1ZEAL 2BSTA 3MBEA 3B3IA 3P9LB 4HZAA 2R0KH 5HYQA 3W5MA 4X6CF 3TWCH 2FATL 4CMMA 4Z7WF 2JCCA 4LRIC 3T2NL 3WFBL 5GGTL 6CGTA 3QIBA 3OJDB 3S5LG 2FLBT 1YMHA 3ZDYF 2ZOLA 1KEGL 2ZOKB 1Y6MR 5EO9A 1N59A 5EBMA 2J88L 2O5YH 5BCAA 3LV3A 5LKNA 4PJFE 1P7KA 1WZ1H 3TT1L 4LARL 4XT1C 2Z8VC 4HH8A 4YGVB 1N64H 4GO6B 3MMEB 1IKNC 5DRXB 4CN6A 4NFCA 5JW4M 5I1CH 2WUCH 1I7RB 1OSZA 1Y18B 1EEQA 1AP2B 3N0PB 5L2JB 1G9MH 4P5TA 1MFBH 3QNYB 2IH1A 3LKQB 4G6ML 5E8NB 4Y4HD 4JVPA 4FFZL 1F4XL 1RZJC 2AJVL 1MFAH 5T1KD 3EOBA 1ZK9A 1N6QH 1L6ZA 1W0WA 2J5LC 3BGMB 4KGLA 3ARSA 1W0VA 3O4LA 5CEZE 2OI9C 3T3MF 4NQED 3V4PL 1YEEL 1OB1A 3NCFB 3FFCE 2AJXL 2XN9D 4X7TB 5HGGS 5DA4A 2K9UA 3ILQC 3IFOB 4XH2A 4CDGC 2J6EA 5E94B 2EIEA 2N7BA 4JHAH 1II4E 5I1EH 3DV6B 1VDGA 4C83A 4PJCE 5LGHL 1HH9A 1MWAH 5KSBA 1CQKA 4JO4H 2BSSA 4HMCA 3PV7A 2E8YA 5JW3L 3HNVL 1S9XB 2DYPA 1ZWIA 4HWZB 1RZJH 5IMOB 1ORSB 4HLJA 1IQDB 2HKHH 1S78C 5HHOA 2VZSA 2AK4B 2BSTB 3ROLA 3H8NA 5HYQB 4J3OC 4FQ1H 2AEPH 3A6BL 2EE2A 3MZTA 3DTXA 5IMLA 1CXIA 1RUAH 4YHKL 3QISA 1YEKH 2DQHH 3FQWA 1YMHB 2ZOLB 1RZ8A 1N59B 5EBMB 5IBTH 1HXMA 2A0LC 4LLMA 4XVSL 3KPQA 3LV3B 1A22B 1P7KB 5KSAC 1F6AB 5D2LB 1SJHA 1HZHL 1NBYA 3O2WH 1LO3H 2FHCA 3U36A 5J6GA 3PE9A 1NPUA 4PGEB 1X4XA 1DUZA 2XRAH 4FNLL 4U4BA 3TBTB 2W91A 2XA8H 2Z8SA 1BJ1H 3BDYL 1K9TA 5F1SA 4AIZA 2EDXA 3WLBB 2YN5A 4AEIH 4OJFL 5DD0L 4WFED 3STZB 2VQ1B 2Y5TA 4YWGH 5DFVC 2ZUTA 5CUSL 4N9OB 2QSTA 2VISA 3SO5A 2NX5E 4YHLH 1T21B 5IW3A 4D94A 5E4EB 3LRGA 3GB7A 1MCRA 1XIWC 2IMMA 3OR7B 1JHLL 4NO5A 4J8RA 2ESVE 3MRLB 3V7MA 2X4QA 2Z35B 2NXYC 4JG0H 4DAGH 1D9KA 2DBJA 1UCTA 1X6NA 2Q76A 3WHE1 1NJ9A 4NWUH 3NGBB 5ABDE 5DO2D 4G8EB 1NCTA 3PDOA 5DRWB 1W8NA 2A77L 1OAUL 3SKNA 2Y7QA 4JO3L 3DOSA 3WUZA 2AI0L 1DE4A 4LCWE 3SJVD 3MO1B 4WJ5B 2GT9A 5E2UL 2BSSB 4BFBD 4UNVA 4L3ED 1T1WA 2SEBB 1JWUA 2DYPB 4PJBF 1ZWIB 4DW2H 1Q9KA 4P5MA 3B8YA 1GIGH 5AYUH 5SV3A 5KG9A 3KG5A 1MEXH 5ESVA 4QRUA 2GUOA 4G5ZH 1D6VL 3ROLB 3WDJA 2XICA 4DZ8A 4BZYA 1D5IH 5FV2A 2YD6A 2IQ9L 3BPNC 4KQ4L 4LF3A 4LCYA 4PRNA 5IMLB 1RULL 1RK0B 4N8VG 2DICA 4UILH 4JZJA 4PRBA 1ZHBA 1AGDB 1HXMB 3KYOA 3I6GA 4IRJA 4LLMB 3VI4E 3O3AB 1IILE 3BFOA 4JREB 3QXVA 1U8PA 1ADQH 1WIUA 4ELKB 1OPGL 4GKSA 4HQQH 3HTLX 1CTOA 2G5BA 1NBYB 2NXZB 2DLGA 5J6GB 5GRVK 3RDTA 5J56B 3MJ6A 1A1MA 1FGNH 5CIPH 1PYWA 4LLDB 1KEML 4EDWL 1EFQA 5DK3A 5ICYA 4XGZA 3QFDA 1HQRA 3SKJL 4Z7VF 1BWWA 3DX8A 3TVMA 3CLEH 4PJXF 1UENA 5CSGA 3B43A 2XKSA 5C08A 1A6ZA 1A1NA 2QHRL 1I1FA 2CLZA 3WFEL 5FGRA 1PZ5A 2ADGA 3GB7B 4HAFA 5KS9E 4OFIA 1MCWW 3UZEA 5TDOA 3PHQA 4OZGA 1T1XA 4FXKB 5D7KD 4AG4H 3ES6A 3A67L 1XZ0A 5A3IC 4ONFH 3T0WA 5DMGD 1C8PA 1X5FA 2J12B 3HUJA 5B3NA 3KPSA 1BVLA 3WD5L 1UVQA 5J1TC 4PBXA 3MGOB 1RUKH 5EU3A 3EO9L 4FZEH 3C9NA 4U6VH 4K3JH 1FPTL 2GT9B 1RIUH 4RGMB 3DVNB 5F1OB 4F7TA 1YEGL 2NZ9C 5BV7B 4JM4L 4KFZC 1F5WA 3ZMRA 1FN4A 2WBJB 1MNUL 4ZXBC 1Q9KB 4P5MB 3OXSA 1KCLA 1DQJB 2O5XH 2VXQL 5KG9B 1FL6A 3RI5K 1A2YA 1QFWH 4QRUB 3H42L 3LN9A 2AK4D 3UTQA 1MQKH 3MBEC 4P23C 4OGAD 3QUYB 2EO9A 1NKOA 2UZIH 5IIEA 1GXEA 4DVRL 1VPOL 5HYJA 1LDPL 3PXHA 2W0PA 3MA9L 1L0XA 4W4NA 4MJ6A 4Y2DA 5HGHA 2DQEH 5FECA 5TDNA 1CK0L 5E8OA 4PRBB 5J3HC 3VG0H 4R0LB 1UYWH 3KYOB 4IRJB 4YQXL 2ADJA 4MAYB 3WKML 4Z0BH 5TE6L 3QBTB 2BVOB 1U8PB 1WT5A 5I1AB 4A2LA 4BFIA 5L7XH 1AFVH 3BYYA 3IJSB 3V79C 5CLTA 4OZIF 4K9EL 3LDBB 3RWCA 3RDTB 2ENYA 1B6UA 3U7WL 1I8LA 3E6FB 4FQLH 4HMDA 1PYWB 1MI5E 1Q0XH 5DFWH 2Y25A 1YEDA 2AGJL 2ZPKL 3PIQA 1LK2B 4LLQB 1GCFA 3BPOC 4MVBD 3WO3B 4XGZB 1FIEA 5GIRB 3TVMB 3FRPG 4OFPA 4P3DB 1DQLH 4BELD 5C08B 1A6ZB 3CVIL 3WXVL 4F80A 1BJMA 4MA3A 1PZ5B 2ADGB 3ILPB 4JO1H 1FGVH 2VITA 5E6YA 3OHXA 3EYSL 1KLUB 4YAQA 1T1XB 3S36H 4F33B 3O6MH 1VESA 2I9TB 2QKIB 4GKOA 2H45A 1BVLB 4RNRB 3TN0B 1NEZB 1Z2KA 5HJ3B 5DJCB 4LHUB 4K71B 4L8CB 2FBJH 4LCUA 4ZNEA 4JDTL 1CZ8H 4YDLB 1LEKB 1FZJA 1FAIH 3GBNL 4XNQA 4UDTB 12E8L 3STLA 2DYPD 2Z91A 1B0WA 1FN4B 1QFUL 4NM8L 4ZQKB 1EPFA 1KJMB 4IOFD 3WDHA 1A47A 4ZFZB 4NDMA 3WIIH 4NQEE 3OXSB 3O2VH 4LSTL 4LIQH 4H88H 4KZEH 1FL6B 4V1DA 5E00A 3G5XA 2XN9E 3BUYB 1I75A 3T0AA 5IIEB 5HYJB 1GZPA 4FOMA 3EKCA 3U79A 1CIUA 3S96A 4CVUA 4MJ6B 5HGHB 3WHXB 1QFPA 2BCKB 5TDNB 3RI5F 4LMQI 5E8OB 3BZFB 1SYVB 1U8JA 3QIUB 5JHDA 2J6EH 3RAJL 3DO7A 3CMGA 2ADJB 4AZ8A 4MS8C 2Y36L 2MNUA 3RVXD 2CLVB 5DQDH 1WWCA 2NXZD 1NMBH 1I1YA 1KN2L 3SE8L 4S1SH 4TSBL 3RWCB 3V8OA 1D6EA 4MB5A 1T4KB 1JZ2A 4OBSA 3DJ9A 4YUEH 3QPQD 3TCLA 3PIQB 2JB5L 2KH2B 3OAZK 3RBGA 4G6KH 5ITBH 1JGEA 4FHBD 1NFDA 4S11A 2E8ZA 2R2CA 2BVPB 3MLVL 4M6MH 1A9BB 1NUNB 5JPNA 1NLDL 4GRMB 2OR7A 5IJVA 5GRJH 5CINL 3SKOB 1NCCH 3VJ6A 1JI1A 2AJYL 3OHXB 3PWPB 5IHUH 3FB6B 5GS1A 3V5HA 4ZO9A 1AGFA 1DBML 4YAQB 2XTLA 1BEYL 3SE4C 1ES0A 1Q72H 4HT1L 1D9KC 3QQ3A 3TO2A 3RVWC 3ZT6A 3ZTJH 1CTNA 4HGMA 4HDIA 3TYGH 1JWSA 2EEBA 1M7IA 4FG6C 5DHVB 3P11L 4LCUB 3I50H 3GSUA 1FZJB 1JYVA 1K3ZA 4WFEE 3S3JA 4XNQB 1MFDL 4M7KH 4TOYL 3I2CL 3TFKD 1IMHC 4DN3L 1YYMH 4JDVA 5FGBA 5ICXB 4X4XB 2WBJD 1R3IH 2H1PL 1E6OH 2ORBL 4OFYA 4NDMB 1PW3A 4MDJB 3KJ4B 1WAAF 4WUUA 1S7QB 2OMNA 3CK0H 4ZUVA 2UWEA 1T0PB 4V1DB 3FO9A 5E00B 3G5XB 4X80L 1T2JA 4U31A 2FB4H 5E5UB 4DKAA 2FEDD 3QUYD 4M48L 1XGRA 1CWVA 3OBAA 2YD1A 5ID0A 1O0VA 2XIDA 4DGVH 3FN0L 3S96B 1FNLA 3V0VA 3SKUD 3D2UA 3ZKMC 1TVBA 2HTLC 1OLZA 2EE9A 2KZWA 4M6NL 4POZD 3D9AH 4JZJC 4N0YL 1G7JB 5JZ7C 3CD4A 4RFNC 2DQJH 3SJVE 3DO7B 4KMTL 4IRJD 1ZOXA 2FCBA 4ODHH 5DUPL 4MAYD 3CZFA 4HC1A 1A0QL 2WLYA 4LPYA 4PB0H 1KF9B 4L3EE 4PJ7E 4XX1E 2YRZA 5GZNC 5K9JH 3OQ3B 4QRRA 2VDQH 1JGDA 1N5AB 2A6DB 3REVB 5ICZB 2X1WL 1JUFA 4M7ZC 3VXNB 4M5ZL 4PBWD 2AXFA 4FQQB 3BP7B 5D7JA 1VSCA 1OAZH 1OP3H 3U0WH 1AGBA 1CN4A 5IB3A 2AERT 3BAEH 5C08D 5JIHA 3VFWB 1B2WH 5AWNH 3ZYZA 2FO1A 4WDIB 3W0WA 3V52L 1P7QA 3W81A 4XMPL 1TTFA 1TZGL 3V5HB 2H9GB 3PHOA 1AGFB 1KCUH 3D39A 1IGMH 4G3YL 4F9PC 1ES0B 1G6RA 3NIFE 1HSAB 1XGQA 4PY8I 5INCB 3EOAA 1UWEH 2FIKB 1TJHL 5L8KB 5I1GH 1OAYL 4WWKA 4HDIB 3TN0D 5E7BA 1M1SA 4HPOL 3GIZL 4LHUD 4AH2A 5DEGA 4LK4A 2DIBA 5F6IC 5I2IA 1UEYA 1JL8A 3GSUB 4GBXC 2HLFC 5JIPA 2EDNA 4GLRI 1IL1B 4JDVB 2Q86A 3QHZL 1OT2A 5HGBB 3MRKB 4IIQA 3QDHA 4RISH 1T22A 1FFPA 1YEFH 1KJ2B 1G7IA 4WUUB 3GSWA 4X4YA 4ZUVB 2UWEB 5E6IA 2X40A 3FO9B 1U8QA 1KN4L 1WEJL 2YD5A 2ENSA 3GJEA 1EV2E 3VFOA 5JTWA 5D7KE 3HG1A 1XGRB 2Z31B 1DP0A 3FKUS 5HYJD 5FYJU 1A7BA 3LZFH 4N8CL 3RP1A 4KJYA 3ESUF 2I24N 4LSUH 4AY0A 3V0VB 4R3SB 1UKTA 4Y2DC 4X6FB 1X5ZA 2H26A 3QIUD 2ARWA 4F8TA 2P7TA 3T8XB 1KJVA 4WW2B 3IU4H 1DN0B 1NSNH 1EZVY 2VZOA 3L3KA 3UBXG 1MJUL 4WUKL 3CDGB 3NZHL 1JGDB 1KIPB 3IFLH 1JUFB 4PYHA 3LS4L 4U1LA 5DTFA 4UT7L 5JA9A 4XVTL 4YHOL 1O7VA 2AK4E 1TZHB 3BIBX 1IEAA 3O8XB 4OF6A 2D4DA 3Q3GB 3CLFH 5DHXB 2Q8BH 1AGBB 1OP9A 3LMJH 2A6JA 3EYOA 3R1GL 2BNQB 1H3PH 1FCGA 4LBEB 1X4ZA 1P7QB 3PWPD 3TJEH 1P84J 4NZTH 4F57H 2H32A 3M17A 3D39B 5D2LE 1DTUA 4YHIB 2BOCA 1XGQB 3MFGB 2FZ3A 2W0FA 1CU4H 2OM5A 1NGYA 3GMOA 3O9WB 3K2UL 4WWKB 5FM8A 1XF5B 3HNTL 1C5CH 4UI2A 3DGGB 1BQLL 5FOBA 1FV1A 4KK8D 2EDWA 4BZ1H 1BREA 2CK2A 4O9HH 1CICC 5EUOB 1BPVA 4LKXB 1H0DA 2FL5A 4LIQE 4NRYA 3LB6C 1U8LA 5DWUL 1U8KA 1OWRM 4FFYH 4XX1G 4DUXA 1V05A 3G5ZB 4XPBL 4RMVA 2HWZH 1T22B 2DQIL 5MI0B 3IU3A 2AJUH 3GSOA 4JPVH 5CJQL 4I0PC 4V1DD 4KTDH 3RIAK 1MRDH 1KTLB 1N5YH 3QRGH 1U2HA 1E4XH 3HG1B 2RHEA 1L7IH 1B0RB 1WICA 3BHBA 5L9DH 5EBLB 4KJYB 3G04A 1MCPL 3UYPA 1L9NA 3PL6B 4PJDA 1ZTXH 2R29L 4H26A 5C0AA 3ZHKA 4BQ9A 4NNXB 2K3TA 5TGBA 4U0QB 3B5TA 2YKLH 5FDWB 3L3KB 5F7EL 5DYOA 2NY5C 1Q8MA 4K7PH 1U58A 3C08L 2L7JA 1JBJA 4MXWL 3VMPA 1KG0A 1MHPH 1VFOA 1EJ6A 1EO5A 1P4IH 4U1LB 5HDLA 4A6YL 1OGAA 1CL7I 4L8BA 2QJDA 1EBPA 5IMMB 4PLJD 1IEAB 4HZLA 4NN7C 5EBWA 1JNNH 3GSXB 2A6JB 3EYOB 3RWHA 3PGFH 4HEME 5T33L 2B20A 2GKIA 1WBXB 3OAYK 4W6YB 4KHTL 1JHKH 3V6BR 4U1SA 2XG4A 4P57A 5GS1C 1JGUL 2H32B 2Q1EA 3FFDA 4QHMB 1OTUC 4LCCC 4DN4L 2FZ3B 3QUZD 1F42A 4Z77A 1YYLH 4KROC 4QHNA 4LLYA 2NY5H 2X6MA 2G9HA 3BIKA 4XBGA 1FV1B 2FNBA 4CU6A 3SY0A 2GITA 1MRFH 1H0DB 3P0VH 3CJJA 2FL5B 4OZFA 4ISVB 3QUKB 4NRYB 4YR6B 3BN3B 5FGBC 1JV5B 1XF4B 1CQYA 4NIKB 4MNHA 1QPXA 4TTDC 5J12B 4OFYD 5FYLH 5DVOA 1IGIL 2EXYD 3IU3B 6FABH 4WUUD 2VE6A 1SJXA 3GSOB 4OI8A 4FFVD 4UZGA 1NC4A 2V7HA 3DX6A 3EDKA 5FM5O 3KPRB 2YXFA 3BHBB 2Z31D 4LKCA 1X7QB 5D2NC 1CDUA 5E5MA 3DUSB 1NGQL 3PGDB 3KYKH 4ZDHA 3FL7A 4TPRL 3G04B 3DHMA 1IC4L 4XC3H 4HWEL 5F3HA 3RIAF 5JIKA 1IAII 1ZT4A 3EZJB 4BM7A 1MQ8A 4IDJH 3T0DA 3DECA 3F7YB 3NCYP 1HYSD 3FQXB 3IAQA 5TGBB 3IKKA 4KJPC 2CIIA 2IFGA 4N5EC 4DKEL 5AG8A 5IVXE 3NABH 4CADA 4OZHA 5E4IA 1J86A 1E6JH 3GZKA 3JTTA 5T1LB 4U6YB 3RVTC 2IANA 4BSWA 3BO8A 1GGCL 3H2WA 5HY9B 2BVQA 2IQAA 1AE6H 4HUKB 1TQBC 2MTPA 1XT5A 5D7JC 3WIHA 3F62A 5EORH 2ID5A 3O8XD 2GFBA 1OQOA 1KJ2H 3NACH 2HMIC 4XPTL 4LASL 3BZEA 3E6HB 5HHXH 4AENA 1IFHL 4UTAL 3NN8A 1LO0L 4NRZB 2BNQD 1CR9L 3EYVA 3R4DA 1FVCB 3RWHB 4KMQA 1IJ9A 3FRUB 3ZTNL 3KR3H 4OUUB 4HKJB 3VGFA 2VTFA 4JFDA 3BI9X 5IJKA 3BKYH 5CZVH 3WFCH 5F9DC 1CT8A 3D39D 3GHBL 5DGQA 2DD8L 3MYJB 5GSRA 1OSPL 1Q9WA 4RMSA 5FUCE 1QRNA 4NO3A 2N1KA 4ZTOL 3L95A 3AU1B 4Z77B 3O9WD 4WWKD 4QHNB 1RAMA 1DSFH 3MC0A 3MXVL 5AZEH 2G9HB 3BIKB 2YUXA 1CCZA 1C08B 1KPRA 3EJZC 4UV4L 3FOMA 4W70A 3V2AR 1A6TB 3S35H 2ICEB 4UUJA 3IF1A 1NGPH 2A6IA 2QBWA 2XTJB 4MGXA 4PJCF 1QLEL 1UZ6E 5D96B 3FB8A 1AJ7L 5HDQH 3L6FA 4MNHB 1MCBA 5E9DA 1TJIH 1A7RH 1OWWA 1ND0A 4OD3L 1NC4B 5E6IC 2NY3B 3CFDA 2DLFL 3DX6B 1QZ1A 3FZUC 1IE5A 3HG1D 4M1DL 4PJGB 1YY9C 1AIFB 4LKCB 2VO5A 3QI9B 1FRGH 4LU5L 3V7AG 4OIBA 2EH8L 4HJ0C 4KKBD 3PL6D 1N7MH 1G6RH 3ZHDA 3VDAA 2X5PA 1BWMA 1ZT4B 3GSRA 5FUZH 1A6PA 1SVCP 2R15A 3I9GH 4J4PC 4PGBB 2CIIB 4YXKL 5GRXG 1PEZA 4JN2B 1T7VA 2GSIB 4YC2C 5E1AB 1XGUA 3ROOA 1YEIH 4OZHB 3TM6A 3K1DA 1A3RH 4WY7H 2DQCH 2FECL 3BO8B 5GJSL 5GS0D 3SBWA 3T4YA 3IFNH 4MJIB 1NUGA 2P44B 4ZMAT 3UTSE 4ZUUA 5CCKL 5HYJE 4AMKH 3K8MA 2VXVL 1DBBH 5CJ8A 2PNDA 4L4TA 5F88A 3V4VH 4O5LH 4NWTL 4X8JA 2A38A 1M05A 1D5MB 3MJ7A 3OZ9H 5FA3B 4QRQB 1CT8B 1A6UH 1MJJA 3D0LA 4JKPL 5GSRB 4G80B 4H25A 3FB5B 1Q9WB 2ED9A 2GK0A 2EO1A 1QRNB 4NO3B 5IQ9A 1HHIB 1IQWH 4J23A 2YWYA 2Z4QB 1TNNA 3SCMD 1T2QL 3L7EB 3ULUC 3HI1A 5C9JA 2BVTA 4PPTA 5LG1A 1IZKA 1QYGL 1TCMA 1IC5L 3G5YA 1W0YT 2CJUH 1I7ZB 4X9IA 5FYKL 1FNSH 3FB8B 3WS6A 3NZ8B 4Z6AT 2OSLB 3JWOL 1DBAH 5E70A 5E9DB 3MRFA 4JY6A 3WE6A 2ARJA 4BA8A 1INDH 2F5AH 3NIDE 2Q3AA 3PWPE 5I19H 2A9ML 1ND0B 4KDWA 2ZUUA 3FO0L 3RNKA 2XOTA 3WUWB 2ICWI 2HP4A 2NTFA 3KPRD 4LGSB 4EEEA 2CO7B 5DR5H 1QLFA 2H32H 3VD5A 5LGJA 1DL7L 1CLYH 1QEWA 1UQSA 4R2GB 3GK8L 2Z8WC 1AGEA 5J9PB 3RGVC 3QB7C 1HHJA 1P4LA 1FZMA 3LKPA 4JJ5A 1WZMA 1UM5L 4CVWA 4JPWL 4ZNEE 2RB8A 2P46B 3MFFA 1QA9A 3GMMB 3VI4F 3NBNA 1XGUB 1M71B 3RL2A 2IG2L 1XH3A 5T1LD 1GOFA 2YD2A 2FDBP 4QRPE 1Z6JT 1NDGA 4AT6A 3FN9A 4HGKC 3QEGL 4KUZL 2BC4A 4V1DE 5KW9H 1G1CA 4R4ND 2FYYA 4P49A 4HCRA 1PAMA 1ZHKA 5JOFA 1NUDA 4ZUUB 3VDBA 4OCWH 2VL4A 4WVRA 4P99A 5F88B 2NY1B 1NMCB 3KPMA 1F90L 4LSDA 2VDKH 5HD8C 4KK6D 4JFFA 4OT1L 1XFPA 4WI8A 4P9MH 1M05B 3FT3B 3MJ7B 4RAUA 1I9IL 4KAQL 2I07B 1U92B 1MJJB 1BBJA 4TULL 4Y4FB 1RJLB 5KS9F 4XAWL 4H25B 4MX7B 2GK0B 1GAFH 1YA5A 3IDYC 4MD5B 5FYKU 1NEZG 5C7XL 2B4CH 2VYRE 1GGBH 4LHUG 1WBZA 1WTLA 2Y23A 1WTGT 4ZAKC 1PKQA 1U8MA 3MLTB 1Z5LB 4MA7H 1AY1H 3G5YB 3WFHA 2XTJD 5I75B 5E2WH 4QEGA 4MD0A 4OLWH 3B2VL 5CEZL 1T66C 4QCIA 3C60C 3MRFB 3CX2A 3MACH 4O4YL 3WE6B 2O5ZL 3HS0B 1ZA6A 4UQ3A 3T0BA 1NC4D 3P40A 3RNKB 1JYWA 3RX8A 2NY3D 2NTFB 3MV7B 1RJZB 4X7CC 3QI9D 2VKWA 4QF1B 3P4NB 5LGJB 1MFCH 1WFUA 4JO2L 1QEWB 2EYRA 1HHJB 3RNQA 1P4LB 1FZMB 2DDQL 3LKPB 3TIDA 5I0DA 1OM3L 4OM0L 2DN7A 1HE7A 5SX5H 4XTRD 4JE4B 3PP3K 4GKZA 5IEKA 3DURA 4G9FA 1I9RL 3ABZA 4QWWC 2CRMA 2ED7A 1QA9B 2LE9A 4KVCL 1MCWM 4E41B 2YA2A 4QRSA 1HQ4A 5KSVA 25C8H 3RL2B 1JZ6A 4OZFH 2AXGB 4WUUE 2DTML 4AT6B 1NDGB 2E6JA 2UWEE 1FC2D 5IESL 2APBA 3HFMH 1V3MA 1UWXH 4MJID 1ZHKB 3OKMB 1NH6A 5DS8A 4UIKL 4KU1A 5DJDB 4F7EB 5FCUL 4EKXA 5F8RC 1B90A 4KY1H 4U3CA 3WN5A 5L2KA 4LVEA 5M7QA 5ECJE 4MAUL 1NCWL 5AAMA 2M8XA 4RAUB 2AEWA 1AHWC 4EN3C 1L7TL 5IJKC 3VXQB 2CXKA 2E9WA 3B5HA 4HS3B 3MLRH 4L8SB 1QRND 5DD1H 5DRNA 1DDHA 4NQCA 4QXTA 2B1HL 3V5KB 1I1AB 2Q20A 2A9NL 1TIUA 4NQVA 5B39A 1U8MB 3P0YL 4NNPH 3ARDA 4XNZC 1G7HA 4G7YL 3WFHB 2Q8AH 4KJQC 3WIHH 2BNQE 3U0PA 4NBYB 2CKBA 3QUMB 4XXCA 4F7PA 3B9KC 4O2FB 4DTGH 3LKRA 5E9DD 4HWBL 1BHGA 5IF0A 5D7IB 3BH8A 5C6TL 4JGUA 3L7FA 2H6PB 1ZA6B 4UQ3B 2Q87A 3GBMH 2BNRB 1G0XA 3TBVA 3D39E 1HCVA 4LSSH 4WU7A 4EVNB 1J5OL 4Z8FL 1KPVA 2BFVL 4WGVB 2VC2H 3ARRA 1S7SA 1SEBA 4HKXA 2XZCL 4CDHA 1Z9MA 1AD0A 1X9QA 4R2GD 2P42B 3TEUA 1JGLL 1T3FB 5EFIB 2LAGB 3GBLA 5F89A 1P6AB 3IJYB 3K74B 5EUOE 3DPBA 5L88L 1R3LA 3KGRA 3K46A 4CGTA 1KELL 5DF0A 3T2PA 4QXWA 4CU8A 1A14H 5TE7L 5JW4Q 1QBLH 3HNSL 5KVFH 3DI3B 3F65A 3HI6L 1FVEA 4OZ4A 1HQ4B 1XCTA 3FONA 5TQ0H 4OLUH 5IW1B 1M6OB 4K8RD 1A1OB 2YK1L 3HA0A 1EMTH 3L5WA 2X4SA 3ARWA 1I8IA 5C0BE 4LHJB 4PRHA 4JKWA 2D7PA 3HG1E 4Y5YA 3SBWC 5DS8B 5C3TA 4HGWB 5CZXC 2NY2C 5GGRB 1QPPA 3AS0A 3OKEB 4E42B 4Z7UA 5L2KB 1T7YA 3MODH 5F71A 2NY1D 1G7MB 2W92A 3TBWB 4X7SL 3LKOB 5IMKA 3AVEA 3P4LA 2F5BH 2VLKB 4MNGB 3O6LH 5IHBA 4MCYA 4JRWA 4WI6A 1Q1JL 1RZKC 4Y4FD 1FIGH 3C2SA 3GJFA 5C0FA 2YA0A 2BXYA 2YRLA 4JFHD 5DRNB 1E0OB 3UYRH 5LXGL 4QXTB 1NBZA 4MQXC 4PD4J 1DEEA 3GHEH 4BSJA 1U93A 2CO6B 3EHBD 5JXED 1KENH 4NQVB 2IBZY 3ARDB 2IF7A 3T04D 3FTGB 4K8RH 4OF3A 4D0BA 3BXNB 2MHAA 3KWWA 2EZ0D 3X3FL 3VFMA 2BHUA 3W9DA 3SDYH 3EIFA 2CKBB 3MROB 3OR6A 5EC1B 3U0PB 5JORA 4F7PB 3WS6C 1NAKH 2HA1A 5I1HL 5IF0B 5L8LB 3TNMA 1CIDA 1KLGB 1WQVT 4N0FA 2ZG3A 3TBVB 3AFLA 3NCJL 5ISZB 3ARGC 4L3AA 1A6VL 4EI5A 5FB8B 3MV7D 4BZ2L 1VERA 3BQUC 1MAMH 5EDXA 1KPVB 3QXAB 3LPFA 1A8JH 1S7SB 5CMAB 1SEBB 5EOQH 1FH5H 1AD0B 3H3KA 2BMKA 1AR1C 2PR4H 4PREB 2OL3A 3AB0B 3LHPL 1GGTA 4UB0H 5DD5H 5D6DA 3BKML 3HRZA 3ULVD 2KZ1B 1GC1L 5D1ZC 3WS3A 4WW1B 1T04A 3CFIC 3OKYA 3VFSB 4HKBB 3IS0X 5LBSH 1KC5L 4E41D 4OZ4B 1XCTB 1KXQE 1H3WM 4CNIB 1QR1B 1TITA 2NZIA 4KQ3H 4PJ7F 2Y6SD 4M1GL 1NC2B 2OR9L 1RZGA 3L5WB 2DMBA 5ALBL 2X4SB 1I8IB 2K7PA 2MWCA 4PRHB 4J3WA 1IGTB 4HBQA 4Y5YB 3KPRE 5HI3C 4L4JA 4G7VL 1A4KA 4Z7UB 1GSMA 1T6VN 5HHNB 4CJ0A 1NGWA 3VWJA 3PABA 3FQTB 3QWOB 5DT1H 4UMGA 4Z7NE 3AXLA 1PLGH 1UADC 1ZAGA 1N0LA 3DYMA 4QKXB 3TZVA 3U2SA 1V8HA 1U3ZA 32C2A 3GKWH 3LS5H 3DWTA 3EFDH 3QNXA 3DVFA 3OB0H 4MD4A 5EA0H 1JF5A 4GXVL 1BM3H 1AR2A 1I1AD 4BQBA 3NIFF 4NRXB 1BBDL 3U30C 4RWHA 1N6QL 2IEPA 3GSNA 4ODXA 3MRJA 2XXMB 5IFAH 4IOFC 4KVNH 4OF5A 3RUGB 3CFEA 3KWWB 3VFMB 3W9DB 2CIKA 4YHNA 3FT2B 4HCRH 5JORB 2PTTA 4L4VA 5EU4A 5CILH 3VW3H 1QVOA 1V7NH 5I66A 2VSCA 4LDOB 5MP6H 4N0FB 2BNRD 5B4MD 1YN7A 4PJIE 4EI5B 4JHAL 3TO4A 3IGAA 5ESQB 1FCCA 1G0YR 1FE8H 3IDMA 5ACZA 2O26U 3DNKA 4XHJC 5EU5A 3IDXL 4FP8L 5F1NA 3RVXC 4Q6IA 1VB9A 2WIIA 4JFYA 2F58H 1MVUB 3L3DB 2IAMA 3OGCB 1LEGA 4NCC1 5KANI 4HIHB 3QCTL 1YQVL 3WS3B 3MLPA 7FABH 1JVKA 3NH7L 4YK4C 2XTJE 3BDBA 5D7LA 5IK3A 3T77B 3D48R 1FZKA 3DHJA 2CR6A 5D72H 5ACLA 4P59H 4LPUA 4MZ2A 4OLYL 3LEXA 1A7QL 1EO8H 2A83A 2AEPL 1JNLH 1OQXA 3UDWA 1UXSB 3EYUL 4PJGE 1A4KB 2J8UA 5D93B 1U3HA 1Z3GL 5F6HJ 5IBTL 3BKJL 4JQIL 4YFDB 5L2KD 1ZVSA 3WN5C 1YNLH 3QXDB 2RCSL 4M00A 5IW6A 2UZXB 3L3IB 2YRPA 5GZOC 4S1RH 4M8VA 2VLKD 3I6KA 4H5SB 3LY6A 3DRQA 3AXLB 1DQQA 1ERNA 3O2WL 3VFUA 4Q9RL 2IGFH 3P77A 3TZVB 4G42A 2XRAL 2BVUA 32C2B 1ZKAA 2IPKA 4HIJA 1HHGA 1AI1H 4W4OA 3DX7B 3SGDI 4P2CG 4OZHE 2E9BA 4MD4B 5D2LF 4U49A 4M7JL 5DD3L 4NSKA 3RL1A 3O45B 4ORZC 5IKCA 4EBQH 4MJIE 3ARDD 3RTQB 1R5WA 3MCLH 5MERA 3OKLB 1CDBA 4LPCA 5BS0B 3KYAA 2CIKB 3NPSB 3OJMB 4XXCC 2R0WH 3G9VA 2PTTB 5EU4B 1F3JB 3QUYC 1QVOB 2EH7L 4DAGL 1K4CA 4K7PX 3WLWC 4LLWB 3I3BA 1G9NC 4WEBL 5CEXB 4JR9H 4Q0XH 1VFMA 1UM4H 4XC1H 5ISZD 5FM5M 4H8WC 3IGAB 3CUPA 1A7NL 3L3HB 1QRNE 4RRPG 5EZJB 2DQDL 1QR4A 4DQOH 2VDLL 3IDMB 5ACZB 4EOWH 4JFOA 5E6ZA 1FSKB 3HAEB 3Q6GH 4I18C 5F1NB 1S7TB 1ZXQA 1TTGA 2C7UB 4Q6IB 2WIIB 1OD9A 5T1MA 3BPLB 1KB5B 4M61A 2IAMB 1F97A 1E4WH 4DW2L 4OCSL 5D1QC 2OJEA 3DI2B 3O2DA 4K94C 4ETYA 1OP3K 5D7LB 1ZVHA 4XP6H 4KRLB 1MEXL 3H9HB 3Q5TA 5I1IL 5IM7A 5CD5C 2B2XH 5E9DE 3SGEH 5FIEA 5CSZA 2CKBH 1TQCB 4HJGB 3THML 1NC2D 3MRDB 4I5BA 4XZUB 5H37H 1XMWA 5IEHB 1W72A 4G6JH 4NZUH 4PRHD 5HHQB 4PV8B 4LPWA 1EVTC 2MFNA 1G9NH 4UILL 2R2HA 5LCVH 1LD9B 4LHQB 4QTIL 2GJ6B 2X05A 4YPJA 5T5FH 4PJ5A 1R3HA 2XWJA 5IW6B 4H8WH 5DQ9A 4JVWA 2VDPH 3UAJD 1NCUA 3H3BC 4I48A 3PG2A 1RURL 1MCOL 3LN5A 3ZKXB